2PD3A

Crystal structure of the helicobacter pylori enoyl-acyl carrier protein reductase in complex with hydroxydiphenyl ether compounds, triclosan and diclosan
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
274
structure length
274
Chain Sequence
GFLKGKKGLIVGVANNKSIAYGIAQSCFNQGATLAFTYLNESLEKRVRPIAQELNSPYVYELDVSKEEHFKSLYNSVKKDLGSLDFIVHSVAFAPKEALEGSLLETSKSAFNTAMEISVYSLIELTNTLKPLLNNGASVLTLSYLGSTKYMAHYNVMGLAKAALESAVRYLAVDLGKHHIRVNALSAGPIRTLASSGIADFRMILKWNEINAPLRKNVSLEEVGNAGMYLLSSLSSGVSGEVHFVDAGYHVMGMGAVEEKDNKATLLWDLHKEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Helicobacter pylori enoyl-acyl carrier protein reductase in complex with hydroxydiphenyl ether compounds, triclosan and diclosan
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Oxidoreductase
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
total genus 86
structure length 274
sequence length 274
chains with identical sequence B, C, D
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2007-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2pd3A00
2OP0A 1WVGA 2Y0DA 3RBXA 2Q50A 1MXFA 3RQSA 4FJ2A 3L9XA 3D4NA 3V2GA 1WDKA 4WLUA 5JAQA 4W7IA 4BMSA 1BVRA 2OZPA 3QJ5A 4YCAA 5A9TA 5I7VA 1NFFA 1QYXA 2RHCA 1H6DA 3UKOA 4D44A 5THQA 5DCYA 2JCVA 1B7GO 5BNTA 5TF4A 1LNQA 4KP7A 2A9FA 3FR7A 2DAPA 2X7HA 1HTBA 3GC6A 1AUPA 1V0JA 2DVMA 4NZ9A 5DULA 1WMAA 3U4IA 2PGLA 5TNXA 1DIGA 3CSDA 1JVBA 3TOXA 1JWBB 1T2AA 3D5QA 3INGA 2ZTMA 1RJWA 4CLOB 3VZRA 2VYNA 1ENOA 1N7HA 3U09A 2I3AA 4OMUA 4YDRA 1TEHA 2CFCA 4IQ0A 3ZHXA 4GWKA 4J90A 1YQXA 1DC4A 4IDGA 1SOWA 4I08A 4BIIA 2O3JA 1GUYA 1N9GB 2OO5A 3WWYA 3VC7A 3Q6IA 1NP3A 2DBRA 2XPCA 3IQDB 3E8XA 4AJNA 2BD0A 3OICA 1E3WB 4JP3A 5LC1A 2YV2A 3KYBA 4OAQA 3UF0A 4RJTA 3TF5A 1PGOA 2FPPA 2HMVA 4K28A 2VCYA 3E48A 3FR8A 3PHGA 4N5NA 2NTVA 1KVTA 2WM3A 2O7SA 2FY8A 4UULA 1QLHA 4W7HA 5TSDA 1PS9A 4II3A 4BO8A 3GOHA 4FD3A 2HDHA 4RV9A 3AUTA 5EMHA 3JQAB 2XF8A 4WCDA 1NVGA 1I8TA 3WBFA 1YBAA 5T67A 3GHHA 4FPXA 2P4HX 1FDVA 1R12A 2LDXA 2Z1MA 4TRNA 3AU8A 5T6BA 1UAYA 4N54A 1ID1A 3FNFA 4CLXA 2GZ1A 1T2FA 1R0LA 2AEJA 3WMXA 4XA8A 1SB8A 3OM9A 1I33A 4Z0HO 4NG5A 2ILTA 3GUCA 4JIGA 3OEYA 3NTRA 2O7QA 2ZYAA 2Y1EA 3A1NA 4UVDA 5L95A 3OP4A 3PWZA 3PJFA 4RPJA 1H2BA 3VH3A 1GDHA 1T4BA 2YQ4A 4LMRA 3WOHA 1BSVA 3GDGA 4AJPA 5G0UA 4UAGA 5JNLA 2QYSA 4L76A 4AJIA 5KOIA 4UVGA 3C1AA 1NPTO 1C14A 3R3SA 2DUWA 4XGNA 3QVXA 4Z9YA 3UCEA 3F5QA 2PKRA 4RDHA 2CVZA 5L40A 1UXHA 1WWKA 4AJHA 1E3WA 4YJHB 2GR9A 5KNLA 2WJPA 2BGMA 3HB5X 5JBIA 2EWMA 3KV3O 3JQ8B 4AJLA 3RJ5A 3W6ZA 4CMIA 2X5JO 3C3XA 1SCUA 1H9AA 2JD0A 3QY9A 1SAYA 4HWKA 5HTOA 1ADCA 4MVJM 1CQIA 4OKIA 1DAPA 1X15A 1I0ZA 2BELA 4CM8B 3ZU2A 1ZBQA 2TMGA 1XQ1A 2ZK7A 3LT0A 2QRLA 3B1KA 1D7OA 4ID9A 2VWQA 1WMBA 3JD2A 4DLBA 4OXNA 3RCBA 3DBLB 2YHUA 4KOAA 4JBIA 3UCFA 3EUWA 2ZQYA 3PPIA 1O0SA 1IB6A 2W2LA 3JSAA 2HRZA 5B12A 4IGEA 1CQJA 3ABIA 3KXDA 1GCOA 2FPGA 2V6GA 2WDZA 3P7MA 5TC4A 1ULSA 1DIAA 3JQAD 5F5LA 3SJ7A 2PWZA 5CDYA 3BTSA 2GUGA 2WYWA 1YDWA 3TFQA 4RLHA 2WD7B 3P19A 1JW9B 3BA1A 4E31A 4I9HA 3OHSX 3G17A 3HE3A 3WGQA 4N5MA 5K0ZA 2JL1A 2NVBA 3LLVA 2EXXA 3E03A 4KMSA 2VZ0A 4XJTA 3QE3A 4K1LA 3WFIA 4DQUA 1BXGA 1D1TA 3RUFA 2EJWA 5AOVA 4BO4A 2NLOA 3OJ0A 4D43A 1P0CA 1SOVA 4D7AA 5JC8A 4RVSA 5DF1A 4P4LA 5LCXA 3VTZA 3F46A 4DTIA 3WYBA 1Y8RA 4L75A 1NBOA 4CV3A 4OSOA 1RWBA 2VRCA 4JROA 4AVYA 3ZWCA 1LBEA 2C82A 3RUDA 2VWPA 4WNCA 4JCOA 3ZWNA 5JO0A 4E5KA 2DBVO 1NVTA 1JA9A 1E6WA 1W6UA 2PD6A 5C37A 1EMDA 3OIFA 1MLDA 3HWRA 3MTJA 1N1GA 4BO9A 2EG9A 1MXHA 2G82A 3D5TA 4HX5A 5JAZA 5F5NA 5G2OA 1R4MA 3BHIA 3PJEA 2FRDA 3RUAA 5B4TA 4BB5A 3LC1O 3KYDB 4TZTA 3HUDA 1IOLA 1PR9A 3CEAA 2JHFA 3K6JA 3QWFA 2NTJA 4DGSA 1FMCA 2J3JA 3OEWA 4EI2A 1HE3A 1D1SA 1ISMA 2J3KA 2RH4A 3K2EA 3DQPA 1WLYA 3D3EA 1GPDG 3EVNA 3BMOA 2G0TA 3C7CB 3FNHA 3FTNA 3ZDFA 4WLFA 1K89A 1ZJZA 4CQMB 2X22A 1BDMA 2NM0A 1XU7A 2EIHA 3UUWA 3PIIA 4OSPA 2EJVA 4I1IA 1E3JA 1SMKA 4GBJA 4M8SA 4PVCA 3IOYA 5DBIA 3TZCA 5CEFA 2X0NA 5JMWA 5CDSA 2O2SA 1E7RA 3DBRA 4EW6A 1JVSA 2ZKLA 1IZ9A 4I9NA 2FSVA 1ZK4A 1E5LA 4NFSA 4XR9A 5G4LA 1EDOA 1YOVB 4XJSA 5H82A 3H9GA 4YJDA 2PH5A 3EHEA 3JQ7A 3LC2O 5L9AA 4ZU3A 4PG5A 3RKRA 2EKQA 4DC1A 1N2SA 1E3SA 5A9SA 3PJDA 2PNFA 5IDWA 4KWIA 3HADA 3QSGA 4LGVA 4GX0A 1L1FA 1EK6A 1GTMA 1C1XA 1FXSA 1HWYA 5DDIP 3RC7A 3OECA 4HP8A 3MWDB 1UJMA 5EQDA 3OA2A 4N18A 4RQTA 2QZZA 4DBVO 4ZGWA 5JYEA 4QEDA 1KVSA 1MA0A 4WLNA 4IDBA 1LLUA 4NNJA 4J2OA 4ZVVA 2BFAA 3VPSA 1B15A 1E0DA 1QV7A 4RVHA 5AXCA 1DIHA 3V8BA 2OOSA 1UZNA 1ZXLA 5GMOA 1IL0A 3AY3A 2Y05A 2VZ8A 5J23A 1E6EA 2YW9A 2HO5A 1C1DA 1HE5A 4E32A 1NQ5A 4YJFA 1JKJA 3GZNB 5B4VA 2E49A 4Z3KA 4D0SA 1UZLA 2ZQZA 1HLDA 1KETA 5A04A 1QORA 3GEDA 4CMHA 4NU5A 1LDBA 1PWZA 1S6YA 1JKFA 3CZMA 2ZJ0A 1GU7A 1LLDA 5CDUA 1RM5A 1UDCA 5GZ1A 1HT0A 3U0BA 1I2BA 1VC2A 4NHEA 4JN6B 1LDYA 4E2YA 4UVEA 3JYLA 3DHEA 4WUVA 1UDBA 2CD9A 5ES3A 4EBFA 3BMQB 2FP4A 1PX0A 3TL3A 2XXJA 1V9LA 2QG4A 3JQGB 4Q3BA 4WEQA 1XGKA 2OMEA 4WCFB 4KTTE 4BNWA 1E7QA 2B4RO 4J16A 4OKNA 1ISFA 1YH3A 3EZLA 4E4YA 3L6EA 1YS4A 1P9LA 4BVAA 3RKUA 5C3MA 4YA6A 5EERA 3WDSA 1OAAA 3AUSA 3ZWOA 1RKXA 2I6TA 3GFBA 3FF4A 3KETA 4IBOA 4KTVE 2AE1A 2WD7A 4IS3A 1K6IA 4GSKA 1EEHA 3H4VA 4AL4A 3QVOA 4G65A 4D41A 5T5QA 4O1MA 5C7IO 4MP3A 1F8GA 1DHRA 2I66A 4URFA 2B83A 4BNGA 4EUFA 3CKYA 2PH3A 2SCUA 1O5IA 2GN9A 3VPXA 2GPTA 3D7LA 5HWSA 5TIIA 3E9MA 1QV6A 2AE2A 4MJLA 3VH2A 3I9OA 1K2WA 4YQYA 2JD1A 3JQEA 3AM3A 3ZWVA 4YAGA 2VYVA 1LDEA 4CV2A 2QRKA 2NTNA 3BMNB 5FYDA 2I5PO 3FBTA 4ROSA 4LRSB 5COQA 1YQGA 5BR7A 3ZU5A 1H94A 1MC5A 2B5VA 4Y98A 2GO1A 1E5QA 2HJRA 4CQMA 3DBVO 3OQ1A 2QIOA 4RCVA 4PLHA 3CPSA 3QVTA 3HZZA 3GRPA 3PXXA 3G0OA 3COSA 1DJQA 1FDTA 1VSVA 4PG7A 4Z3DA 1NM5A 5MGBA 5IXSA 3FNGA 2EW8A 3GVHA 1Q0QA 1Y9AA 3JYOA 5JC1A 3U9LA 1HRDA 1A9YA 1Y9EA 2EKPA 3ZW8A 4ALMA 3S2IA 3IAHA 1DC3A 1YXMA 3AFNA 4CLDA 1MUUA 3GEMA 3ZHYA 2GSDA 2VOEA 2ZB8A 3OFSA 1ISGA 5CAEA 5I9MA 1M6WA 1AXGA 2P2SA 1I24A 3B70A 3MJVA 3Q9NA 4FOOA 3RI3A 3UGKA 4AJJA 5THKA 3F3SA 2FN7A 4D0RA 4WLOA 1X0VA 2W2LD 5CDTA 1LSUA 4EDFA 5TRTA 1D3AA 3IP3A 4D79A 1ZMOA 2BGLA 1X14A 2DU8A 2NADA 3I9MA 3E9NA 4XGKA 3S2FA 7ADHA 1NQAO 2EGGA 2CDBA 1PEDA 3E5MA 3LVFO 4QUKA 4CLRA 1Z74A 3Q2IA 5G0WA 2NACA 1AGNA 3NDJA 3S55A 3U49A 1C1DB 3KEOA 4XKJA 4B8WA 1IZ0A 4J49A 4CM3A 3H5RA 2PLAA 4J91A 5A06A 1ARZA 4LRTB 2EEZA 1TB4A 2VHZA 5T57A 1P1HA 1Y5RA 1X1EA 3U3XA 3WWZA 1W4ZA 3QRWA 4TRMA 3WG9A 4UEOA 2DPGA 1BW9B 1F06A 2PGDA 3LF2A 1E1NA 3MCVA 3KOUA 1ZVMA 4NH4A 3L07A 5TQVA 3HJAA 2Y68A 4CMKA 4WE3A 1PQUA 1XLTA 3CUKA 4E2WA 3CIFA 3PGJA 4BNZA 4NMHA 2B4QA 2Q45A 4JGBA 1WZEA 2GNAA 1GUZA 1LQUA 4XYBA 4A26A 2UVDA 3GLQA 4RLSA 2DKNA 1NHGA 4QQRA 1BXGB 1U3VA 1BW9A 4RO0A 3PLNA 1A4UA 5I8ZA 1ZNQO 5BT9A 1PL7A 5CDGA 3EK2A 3PP8A 1KEPA 1ZK1A 4QO7A 3ZV4A 3RD5A 2YJZA 2QQ5A 4KUGA 2FHSA 1DLIA 4BNUA 2YY7A 3ZCXA 2G17A 3O8QB 4S1VA 5JDCA 4FN4A 3A14A 5DZSA 1ENPA 2FWMX 1PJTA 4XDZA 1GV1A 1PQPA 1Y1PA 1P1RA 1K6JA 3L0DA 1E77A 4FFRA 3WBBA 1HDYA 1LXCA 4MDHA 3FTPA 5JCXA 3H3JA 2EHDA 2IXBA 4OM8A 3G79A 2WMDA 4J9UE 1SNYA 3ZV3A 3RC9A 3RC1A 2P91A 1NR7A 2EKLA 3V1YA 1VM6A 1YBMA 1YRLA 3CZRA 4FIZA 3WGTA 1T1RA 1VJ1A 4BHTA 5KJFA 1Q0LA 5ENVA 2A4KA 4R3NA 1TVEA 4MKXA 3GVXA 3EMKA 2V6BA 4NFHA 4R4JA 4O6VA 2JAHA 5HS6A 4B4WA 1GY8A 7MDHA 3I23A 4CV1A 3CTMA 4YAEA 2IODA 4BQPA 4CMJA 1HLPA 1KEVA 1PJBA 4IJWA 4TVOA 1QP8A 1YL5A 2VN8A 4BNXA 1UP4A 4GX2A 4P4NA 2WE7A 4ZICA 3OQ6A 4XB1A 3HHPA 2DPHA 4CMBA 4D42A 3PEFA 1WDLA 5DP2A 8ADHA 1Q0HA 5ICMA 4EEXA 4GL4A 3WSWA 3OJFA 1MC4A 3TZKA 3VH1A 5EESA 4Q39A 2W2KA 1IPEA 1I3MA 4RVUA 3U4DA 1E7SA 4EUEA 1U9JA 4K26A 1BXKA 1RPNA 2PY6A 2VUTA 2Q1SA 3KRTA 3DHYA 4J1QA 4CPDA 3KSUA 3TNLA 3DBLA 3NX4A 4BO3A 2VHVA 2Y93A 4NPCA 4IDCA 4Z9FA 4E33A 4YRBA 4B7XA 1F0YA 1O95A 3U4HA 1N1EA 4A10A 3RVDA 3DWFA 4XQCA 4E5YA 2X9GA 4H3VA 1ADFA 3PHIA 1CIVA 1IY8A 4GKVA 2C0CA 4YEDA 1Z45A 1PZFA 4NJMA 4HNGA 3WX0A 1HSZA 2VHXA 4B8ZA 1P44A 1P77A 3UXYA 4YVFA 1LX6A 1LLQA 3BTVA 3PQDA 3T7CA 1B3RA 3PHJA 3EAGA 1I2CA 4NBRA 3WMWA 4H15A 1EBUA 4JLWA 4R01A 4XWYA 1KC1A 1D8AA 3DAFA 3RSHA 4BO2A 1WDMA 2A92A 2YV1A 1W8DA 3IC5A 3WQRA 4AJEA 1E1MA 1M76A 4B7UA 1AHHA 4I5EA 3ROQA 3R1IA 2Q2VA 1CWUA 2E4AA 5AQ1A 3I83A 1E1KA 5IDQA 5IZCA 4Z0PA 2D0IA 4MVJD 5GZ3A 1SB9A 2O50A 4J4HA 3PFWO 2PA3A 4RZHA 4Z0TA 2IDZA 4ZD6A 3H3FA 3S2EA 2NVUB 3ASVA 2NSDA 1ZK3A 3K8ZA 4MVJI 3QP9A 4M86A 4ZA2A 2E48A 1Z75A 4XQEA 1ZSNA 5CEEA 5KJCA 3STHA 1P0FA 2DFVA 2YDXA 1DC6A 3O8QA 2CF5A 5L3ZA 4CL3A 2GN6A 5MDHA 2B36A 2VWHA 1V6AA 1DFIA 2BI8A 2BKAA 4OJNA 4U0KA 3I9JA 4MOWA 2PTGA 3TPCA 4TKMA 4L4RA 4Q3AA 1R4NB 3GAZA 4NU6A 3H6KA 4BNKA 4BUCA 4BGEA 2G1UA 1XIVA 3A28A 2C5EA 3RBVA 5K9ZA 3O38A 3UN1A 3JQGA 3UICA 1UXKA 4N7RA 3KYDA 1XHLA 5U1PA 3PVZA 4B3HA 1X13A 1RM4A 4NIMA 3IJRA 5JO9A 2C54A 2W4QA 3EY4A 4B4OA 1NNUA 4YWJA 1BWSA 3MOIA 4HV4A 4Z9XA 4LW8A 4YAJA 4DIOA 3M2TA 3W8EA 1IHYA 3GUYA 3VZQA 2V6MA 2GZ3A 3QW2A 4ONEA 1T2DA 5EJ2A 2A94A 4BO7A 2AQHA 4LMPA 2YDYA 3JQCA 4YPOA 3CINA 5A5FA 2NU9A 2DTDA 3PYMA 2CDCA 4D45A 2J8ZA 4A5OA 4WPGA 2RCYA 4MVJH 2B69A 3WGIA 1NQOA 1PS8A 3DZHA 3LYLA 5JPIA 4GLOA 4J6FA 4JJFA 4PLGA 4F45A 1GR0A 3MZ0A 5GZ6A 1EVJA 5L4SA 2ZB7A 4AICA 4OH1A 3TSCA 2VT2A 3BAZA 3HG7A 2UV8A 2D59A 1GAEO 4TRJA 1U5AA 4BQRA 2WD8A 2JFFA 2HK8A 1HDGO 4HFJA 4YAKA 5CPFA 4HUJA 3E6AA 3JTMA 3DZJA 4BB6A 3I9LA 4J43A 3OIGA 1KEWA 2R00C 4CM5A 5LDHA 3PQEA 2BFMA 4L74A 1FDSA 4UEKA 2XAAA 2D5CA 4I9UA 3W4IA 2PZLA 3WGYA 3BMCA 1YBVA 1ML3A 5ADHA 1NQTA 4S3MA 2R00A 4FB5A 5I9LA 5HRUA 4KUEA 3OA0A 3GK3A 2P5UA 5G0SA 4AJ2A 4BKQA 1SC6A 4ZN6A 3TZQA 4D46A 3DOOA 3BHMA 5JY6A 3VVBA 1X0XA 2EV9A 4B3IA 5JCJD 4PLZA 3DTTA 1OOEA 1PGJA 4P22A 3DR3A 4HKTA 1L7DA 5A05A 1DOHA 3IJPA 3QLJA 3H8VA 3BMOB 5F1PA 3A9WA 1EE2A 1TI7A 2PFGA 2BHLA 3PIDA 2IZ1A 4ZRNA 3VAZA 3L4BA 2UUOA 3WGGA 3ST7A 3FSRA 2FZEA 3ZU4A 1U28A 3BMCB 3VDRA 1UAGA 3ORFA 1DPGA 2B35A 2YHIA 5HBRA 4GKBA 2W8ZA 2E82A 1ZMTA 1M6HA 1WZIA 5C7OO 4F46A 3DZKA 2IXAA 3FPCA 4K6FA 3WJ7A 3VH4A 4BKUA 8LDHA 2OXIA 5L7WA 3MJEA 2WWRA 1ZEJA 4IDDA 1N92A 5ENDA 1C3VA 2JCYA 4CM4B 4TKLA 2O3RA 1A5ZA 2QYTA 2C7VA 3GR6A 5JW6A 3ASUA 1YB1A 2Q1WA 3GZ4A 1GZ6A 4HBGA 5K6AA 1M75A 3JQ9C 3WICA 4BGIA 3RU9A 5BSGA 3UAGA 5JLAA 4R69A 3ZV5A 2VOJA 4OOEA 4BNTA 1VKOA 3KTDA 3ANNA 1BHSA 3K96A 2I65A 3E5RA 3DMTC 3Q11A 4XDYA 1JU9A 1GQQA 3NT4A 1DJNA 2Q2WA 2VYND 3CMCO 4BGUA 2ZATA 4C7JA 4XR4A 3QWAA 3AW9A 2CSUA 2ZTVA 2HJSA 1H6AA 1ZK0A 1A4IA 3CH6A 1J0XO 1ISHA 3NRCA 5KJ1A 4X54A 1JAYA 3WGOA 2V7PA 1LC0A 3QA9A 3DBHA 4CQMD 3L6DA 5FF9A 4MIYA 1QG6A 1LRKA 1Q1NA 2ZCUA 3U5TA 2IEBA 3ZU3A 2OL4A 3GRKA 4YJGB 1UP6A 3I4FA 3S1LA 1ISIA 3WSVA 1EFLA 2PZMA 1B14A 1VL6A 4TWRA 5A03A 2PKQP 5A1TA 4PLFA 3P2YA 2C59A 4GQAA 2GF2A 3HDJA 4BO0A 1QXSA 2CZCA 2AQ8A 2DT5A 3FD8A 3NT5A 3PWKA 5G0TA 1R15A 2W2KB 1YONA 4CLOA 2EERA 3MTGA 4O5OA 4QX6A 4RL6A 3IUPA 1H5QA 4GGOA 1NAHA 2AQIA 3NGXA 1OBFO 3PJGA 3IP1A 4EJ6A 1N9GA 3KB6A 2AQKA 4OHUA 2O23A 2V6FA 5EPOA 4G2NA 3AOEA 3U4CA 5F21A 3DEYX 4EEZA 4E13A 3S8MA 4ND2A 4XYLA 4DPLA 4J0FA 3FHLA 4MVJG 2NU6A 3TN7A 4H16A 3LDHA 4EJMA 1Y81A 2C29D 1PR3A 5L4LA 4HADA 1CDOA 1NASA 5EIOA 2RBEA 4L0QA 1Y5MA 2CVQA 3DFZA 4Z6KA 4C7KA 5CG1A 5I7SA 1C0LA 3AFMA 3T4XA 1DSSG 3BIOA 4P8RA 4BKRA 3E18A 4UEJA 5JYDA 4UUPA 3RUHA 3LF1A 4YACA 4FSHA 3C7DB 4WASA 1FDUA 3E1KA 3Q3CA 1R0SA 3HDQA 4GX5A 3W6UA 4R1NA 4BOYA 4QFCA 1DIRA 2JAPA 3JV7A 4XEHA 2BH9A 4B4VA 4E12A 3ZH2A 4UUNA 2B37A 4U7WA 2YHIB 3HDYA 3T4EA 2DBQA 2Y1OA 4AJOA 1H6BA 3TDKA 3KEQA 1EVZA 2O4UX 4Q3DA 4OYRA 2Q46A 4BNIA 4XB2A 1E3IA 4NBUA 3NDIA 2ZIZA 1KVRA 1LSSA 1U7TA 3GAFA 2B0JA 2X5KO 1PZEA 5BNFA 5IDXA 1KBZA 1JDJA 3ZI0A 4JXKA 1GL3A 4FDAA 4WKGA 1LDGA 1YB4A 1PSDA 4L4XA 1SEPA 1U8XX 4BV8A 4Y6SA 3V1TC 4WGGA 1N8KA 4H7PA 5H81A 1QYVA 4MVJE 1ZJYA 2GN8A 4E6PA 1UXJA 2X5OA 3GPDG 2Z5LA 1MB4A 4M89A 3H9UA 4CQLA 1H0KA 4YT5A 4JP2A 3WTCA 3GDOA 1T24A 2AW5A 1GEGA 3A4VA 4RPLA 3L6OO 5IAAA 1YL6A 3GG9A 3M1LA 3DZFA 4E0BA 1KC3A 4JJIA 5TT0A 3DDNA 1KS9A 3GGPA 1Y8QB 3JQ6A 3Q2KA 5LDGA 1UUFA 3OBBA 3PRJA 1KOLA 4CLEA 1DO8A 3ZWPA 3G1UA 4LVCA 1ZSVA 2OUIA 1EK5A 4CLRB 1PJ4A 1N7GA 2P9GA 5C7LO 1VE9A 4JBHA 3TWOA 3RUCA 3ADOA 1DFHA 2IZ0A 2OP1A 3BHJA 3GFGA 4R5HA 3RWBA 3DHNA 2Y1FA 5COBA 3UCXA 1KVUA 4QT0A 3F6YA 3SX2A 2OBNA 3ADPA 3ZV6A 1HZZA 4U6SA 4PLTA 3HDHA 1MG5A 2BGKA 1QR6A 3QIVA 1H2HA 1VJ0A 2WEKA 1V3VA 4PLVA 5IFLA 3SXPA 1DBVO 1I01A 3R0IA 3AUUA 1BVUA 2IYPA 1HDZA 3GN2A 1MG0A 3N7UA 3RJ9A 2HMWA 4PZDA 5JSFA 2CNBA 2R2GA 4R54A 1QSGA 2HMTA 2VHWA 3GT0A 3MJSA 3PI7A 5A9SB 3IMFA 4NFYA 1AN9A 3ICCA 3ONDA 1O94A 3DOCA 4FCCA 3F1KA 4W6ZA 3RUEA 4IZHA 1NPYA 5CP8A 3SLGA 4Y67A 3ZW9A 5BSHA 1YE3A 3GQVA 4E5MA 3DL2A 1GQ2A 2GLXA 3EYWA 4KQXA 1DEHA 1KVQA 1RYDA 4CUZA 1YL7A 4BNMA 3GMDA 1PL6A 3JQ8A 1TT5A 2HRBA 4RPKA 1W73A 2OHXA 1KYQA 4XRRA 4G81A 4J3FA 3X2FA 2RIRA 3MJ4A 4GVXA 2ZTLA 5JCJA 3TZHA 3AWDA 4DMMA 4IJUA 5AXDA 1TXGA 3WQSB 1ZEMA 5K6AC 2HU2A 1CF2O 5DBGA 3LT1A 4YT4A 1ZSYA 4NDNE 4DVJA 1I3KA 3X2EA 4R68A 4CR6A 4HFNA 3K5PA 1N5DA 3MEQA 4TMFA 3H9JA 4E5NA 4U0JA 2JHGA 2QW8A 4RF5A 2AEMA 1GFSA 3WB9A 4WK6A 3K92A 4PIVA 1R66A 1LDMA 2YV3A 1J6UA 4ALNA 1HETA 4ND1A 3PLRA 4KZPA 1R16A 5KTKA 1XELA 3LC7O 4B7CA 1EVIA 1TLTA 3M1AA 3FNEA 4ALJA 3AUAA 4XQ9A 4OXKA 2I9PA 1GZ3A 2X6TA 3KSZO 2WYVA 4R51A 3PHHA 2HUNA 3W8DA 4BV9A 2X58A 3WR5A 1QMGA 1LQTA 4OXYA 1UR5A 2DC1A 2F00A 2QRJA 3DMYA 2HCTA 5JE8A 5JDIC 5FEUA 2X9VA 4NBWA 5KIAA 3E9QA 2C2YA 4MO2A 2B4TO 3V5NA 4ZQFA 1NAIA 5I8WA 2CF6A 3KZVA 1F12A 9LDBA 3U62A 4J7CA 4L4SA 3JD0A 2IZZA 3IKVA 3WLEA 4JK3A 1FK8A 4IPTA 3FPLA 1Q7GA 3VPFA 3ZWAA 1LDNA 1R4MB 4OQYA 4MIOA 1PGQA 4CMGA 1PGPA 2GERA 1VPDA 3Q9UA 1V3UA 4GGPA 4CUKA 1NFRA 1EE9A 2Q49A 3IDSA 1P1FA 4Q3NA 4WLVA 2VRBA 4F6CA 5L4NA 1WW8A 3INRA 1A9ZA 3NEPX 4JQCA 5JDCC 3GHYA 3EW7A 4PLCA 3WNQA 3NTOA 1V8BA 5CHEA 4B4UA 2JCXA 4BNNA 3ENNA 1O89A 4OO3A 1KEUA 3EZYA 3JQ9A 1ZZEA 2HK7A 4YB8A 5ITWA 2GCGA 2OORA 4W9NC 3KYCA 1DC5A 2Z95A 5KKCA 3FRJA 4EYEA 3AJRA 1UP7A 4W82A 2D2IA 4O0LA 1XU9A 2HAEA 1WAMA 3H65A 3IS3A 1VJTA 3B6ZA 2X0RA 1U7HA 1PIWA 2DFDA 3PK0A 3NJ4A 2F1KA 1I32A 3LK7A 3O03A 3PFFA 1Q2XA 2Y0EA 3HSKA 4J1NA 4ZHSA 1XSEA 4DLAA 3AY7A 5T8KA 5COAA 2EP7A 3JD3A 4MVJA 1CYDA 3JCZA 3RASA 2ZYGA 2P5YA 4PRKA 1QYWA 3NAQA 2DTXA 1NHWA 2AHRA 3UFXA 5L7TA 5AXBA 4DLLA 5L51A 2O2YA 4KDEA 4FOSA 4XYEA 4D3DA 4F3YA 3TFOA 2D3TA 3HNPA 1TA4A 3WTBA 4XGIA 4KUHA 2BRUA 1U2GA 4FJ0A 1NWCA 3LSYA 3PGXA 1T25A 1RM0A 2EP5A 3OF2A 1KIFA 4FFMA 1D4FA 4J1SA 2GRAA 2HK9A 2OFPA 4PLPA 4PG8A 3GNQA 1I2ZA 5TGDA 2C5AA 3BTUA 1SPXA 3GA0A 4MIEA 3OMLA 1UZMA 4IJVA 3E82A 2VYVD 2ZB4A 5BSFA 3ZZNA 1EUCA 2O3QA 2IRWA 4P38A 4BKPA 2HMUA 1EUDA 3I1JA 4E3ZA 2NWQA 2Z1NA 2PZKA 4TQGA 3MJCA 3HFGA 4CL8A 3ZWWA 4DXHA 5G4KA 2H63A 1K5HA 2ET6A 3AOGA 3CE6A 2HMSA 5GY7A 3VKVA 1B26A 1PL8A 1QRRA 5BNIA 2YZ7A 1EUZA 1NVMB 3PWSA 3JQBA 4WCFA 4D3FA 2P9EA 4XQGA 1PZHA 3IIEA 4YJFB 4E2ZA 2YQ5A 2R6JA 2NV6A 3DB2A 1Y8RB 3W8FA 1DXYA 3GN1A 1P1KA 4M55A 3WGZA 1ONOA 2NQTA 5KVSA 3P2OA 3MJTA 3UOGA 1QKIA 2PD3A 2VTEA 4BO1A 1OFGA 2J3IA 3H2ZA 4IMPA 4FFNA 3KHUA 4YJGA 3SEFA 1E3LA 2G5CA 1DAOA 5ICSA 5F1KA 1E7MA 3GDFA 5TX7A 4PVDA 4GX1A 5L7YA 2JFGA 1YWGO 2PV7A 2X4GA 3I9NA 4DWVA 1C0KA 5DNAA 1E7WA 3PYLA 1LSOA 3ZGYA 1H6CA 1UDAA 5EQFA 3KM0A 5CEJA 3EC7A 1LLCA 3RC2A 1ULUA 4O59O 2V65A 3L4SO 1ZO8A 4CMAA 3PHLA 2EGHA 1PQWA 4PN3A 4Q3CA 2HSDA 1ENZA 1NTOA 3L77A 2PGJA 5IXYA 1I3LA 2A35A 1PJLA 2VWGA 2GASA 1NFQA 1DRWA 1FJHA 1VRWA 3WGHA 3C1TA 1GEEA 4IINA 1ONNA 4AJ1A 1GV0A 3QV1A 1ADGA 4NQZA 4BS9A 3H9EO 4TSKA 1EBFA 4ALLA 1GADO 3AI3A 3O9ZA 4ZQGA 4CM8A 3ITKA 3C24A 3DZGA 4Q9NA 3QQPA 4RF2A 3DBHB 3I4CA 4YT2A 3ZNPA 1C0PA 1LA2A 3F9IA 3D1LA 1XDWA 3WYCA 5AVOA 2ZCVA 4NJOA 1Z73A 2P4QA 2Y0CA 1HDCA 3V2UA 2JJYA 1Y7TA 3F47A 3RROA 3W4KA 4OGWA 1T4DA 3S2GA 2Q4EA 1JN0A 1U2DA 2D4AA 2ZJ1A 3OETA 5FI5A 3GVPA 1NXQA 4CQLB 1YO6A 4RGBA 2VNAA 1XYGA 5IZ4A 1ORRA 1F8FA 1HKUA 2DUUA 3FI9A 1JQBA 1HDRA 1U5CA 3UH1A 3LZ6A 5FI3A 2C2XA 3ZNQA 2H9IA 1A27A 4CMEC 3IUSA 3GNSA 2GZ2A 3ITDA 2I3GA 4FFLA 4EGFA 3GVIA 3C7AA 3WXBA 4CM7A 4FBGA 4XYMA 4CJXA 1XKQA 1U3UA 4PZCA 2RH8A 3UW3A 4TRRA 3Q1LA 2UYYA 4IIVA 1IUKA 1UXIA 3H2SA 5I9NA 3F1LA 4EJ0A 3QHAA 1S7CA 3GF4A 4JJGA 3MOGA 2VHYA 3K30A 3L9WA 2I67A 1CEQA 1A7KA 1PJQA 4DA9A 4RVDA 2O48X 4DUPA 4JNKA 4OQZA 1OMOA 3OH8A 3DAPA 2X0IA 1DB3A 4MVJF 5HM8A 3TL2A 1LSJA 3PYXA 2ZTUA 3D3WA 3ROPA 5B4UA 1QLJA 1AE1A 4J7UA 1Z82A 3RFXA 1TT5B 4A2CA 4R1UA 3L4BC 2FZWA 3PZRA 4I5FA 1ZW1A 1MV8A 3I6QA 3NV9A 4CM9D 2DTEA 1JKIA 4HNHA 5EINA 4YRAA 2GD1O 2X9NA 4Y6RA 1ZCJA 2X86A 3I6IA 1LEHA 1KY5A 5KJ6A 3NGLA 1B3BA 1QYDA 1LUAA 4HFRA 1K3TA 3WQQA 4J7XA 2FMUA 4CMCA 4CLHA 4AJKA 3ETGA 4IM7A 1LRJA 3SC6A 5BQFA 4IDEA 1VLLA 1VKNA 1LI4A 1Y8QA 1ZUD1 3AK4A 1U3WA 3LT2A 1CJCA 5HS4A 4Q3EA 5H83A 3KLMX 1IYZA 1NX6A 3NJ8A 1C1XB 1PTJA 5ILOA 3G3EA 4LK3A 5KKAA 3FWNA 1PJ3A 3CXRA 3PQFA 2IEDA 4IS2A 2BI7A 2VNSA 1VL0A 4FFPA 1GYQA 3IL2A 2Y66A 3OIDA 4BO5A 4GMGA 3RUIA 3DC2A 1HDXA 4DPKA 1B8VA 2AG5A 4K6CA 2AEFA 3BXXA 2FSSA 3Q0EA 4M54A 3JQ7B 2RAFA 4CM6A 3ICPA 3HB4X 3B20A 1T2CA 4RQUA 5IN5A 1LU9A 1U4OA 2J5RA 4FC6A 2Q1UA 4RDIA 2AXQA 4TZKA 2VUUA 4UVIA 3VOSA 4CODB 3I5MA 2J3HA 2VQ3A 3ZWYA 4A73A 1T26A 1XWFA 4QTZA 1Z7EA 1I5RA 2BMAA 4D3SA 3H7AA 1E7YA 4IDAA 1E6UA 1NPDA 1XG5A 4NK5A 3O4RA 9LDTA 3DZBA 4W4TA 2BLLA 4TROA 4E30A 4ND4A 1G6KA 1F14A 1GCUA 1MP0A 1HF3A 4PG4A 1GYRA 2CMDA 3DTYA 5JY1A 2NNLD 2Y67A 1L7EA 4I5DA 1IE3A 4IUYA 1H9BA 2QX7A 4KQWA 3WIDA 4IXTA 4INAA 3TRIA 1X7DA 4XZ3A 3FBGA 4UREA 4XIYA 1HZJA 2C07A 2WE8A 4DQVA 3GY0A 1SZJG 1XEAA 3ZWXA 3ENKA 1XCBA 1A71A 4U6QA 5F1OA 5JFOA 1BG6A 4XRGA 2HLPA 2H1SA 2QZ9A 4BNLA 4PCVA 5JAIA 2D5AA 3ETEA 5B37A 3SBOA 4PRLA 1WXDA 3D0OA 3AOEC 4FC7A 3ANMA 4B3JA 4CR7A 4WJZA 3GMSA 1EQ2A 4IQ8A 4XYGA 1GZ4A 4LN1A 4J4TA 4C4OA 4U5QA 4AG3A 2FR0A 1MFZA 3JD1A 3VHRA 4L8VA 1XA0A 4BMNA 1RYEA 4QXMA 2AMFA 4EUHA 2EW2A 2GGSA 2Q1TA 5KWEA 2FOIA 4YRDA 4R5MA 4OL9A 4F6LA 4P4GA 2AA3A 4UVHA 1YOVA 1KERA 5U9CA 2WTBA 4RF3A 1EDZA 3D4OA 1CETA 3OJEA 4ZQBA 4ZQHA 3HN7A 4ILKA 3VTFA 4Y6PA 4M87A 3ZHZA 1M66A 5KJEA 2H5LA 1O8CA 2PZJA 2OGUA 4B79A 1J49A 4YBZA 2CVOA 1PJSA 3PZBA 1MX3A 1LTHR 3BYZA 4AFNA 3H5AA 4PGFA 3PTZA 5AYVA 3HQ4O 3RFTA 3LT4A 5EL0A 3GGOA 4O63O 3ETDA 5KCZA 3JQAA 1Z7BA 1R4NA 1GUFA 1YB5A 3IKTA 4R3WA 3FN4A 3JQBC 4WCFC 2JKVA 3F4LA 4R16A 3ROMA 4BNHA 2AG8A 4FFOA 3DMTA 3OQBA 4WOJA 5DP1A 3BMQA 1GPJA 3ZHBA 2DM6A 1BMDA 1UH5A 2Y1CA 3AM5A 4ZQEA 5U4QA 1VI2A 3GZNA 3UHAA 3VKUA 1DLJA 3WJAA 1G1AA 3R6DA 4LSWA 4DYDA 5L53A 1P31A 4I5GA 3C85A 3W4JA 3ZNNA 2P9CA 5B1YA 2NVUA 4R1TA 5I7FA 3TOZA 3D64A 3QVWA 1A72A 1PGNA 2CY0A 2B5WA 4LCEA 1I10A 1IULA 1XR3A 3ONEA 4W99A 1ZKMA 4CUJA 2EF1A 1M67A 1QYCA 4A7PA 2UAGA 5DOZA 1WPQA 1G0NA 3HN2A 3KYCB 4GH5A 3VZSA 2YFHA 1DFGA 3EGOA 2P68A 5DOVA 3I3OA 5TJ9A 5DBFA 1DRUA 1KY4A 2BFPA 3JYQA 3RAJA 4YT8A 1P74A 3CMMA 4CMEA 3B1FA 3DO5A 1T2EA 1PU2A 1X1TA 3ZWBA 3M2PA 1UXGA 3ANLA 1PS0A 4TVBA 1ZFNA 2YUTA 5CFZA 1J4AA 1DDOA 3P5SA 1YJ8A 1YKFA 5EN4A 4NBTA 4Y9DA 3DBRB 2NQ8A 5ILGA 1P45A 4ESOA 4PFJA 3TQHA 4GWGA 2BFOA 1WNTA 2JFHA 4FW8A 2ZB3A 1I30A 1NWHA 3BZUA 1IPFA 1Q7CA 2O3SA 2VT3A 2WYUA 3DAGA 1ZK2A 4IGFA 3GNTA 3F5SA 1BTOA 4A27A 3GG2A 1Q7BA 1X7GA 3V2HA 4RF4A 1EZ4A 2WSBA 2ZYDA 5TJHA 3VPHA 3WYEA 1IHXA 1HYGA 4LCJA 1Y6JA 5DCWA 4K9DA 1PZGA 3ROKA 4DBZA 2NUAA 5A4DA 1R6DA 2PR2A 4IZIA 3RBZA 3PDUA 4JX8A 3WS7A 3H9QA 1DRVA 2YFQA 3M6IA 4FJ1A 5KVCA 3B1JA 3FWZA 5BSEA 5ITVA 4M49A 1A7AA 3ZN2A 4RPHA 1V3TA 1R0KA 2HQ1A 2JD2A 4R1SA 4DC0A 5A02A 1I3NA 4J9VA 1EFKA 1B8UA 1E1LA 4YQZA 5KVQA 1P1JA 1X7HA 1NR1A 1P33A 4ALKA 2YYYA 3AI2A 1DIBA 1PWXA 1ENYA 2IYOA 4R9SA 2UDPA 3ZNOA 4II2A 4FGSA 2OBYA 3I9KA 3WFJA 1AXEA 3PDJA 3FCOA 2G76A 4DIFA 4IY1A 4PZEA 4QO8A 3K73O 4BGVA 1GD1O 3SLKA 3DOJA 2J5KA 4PLWA 1G0OA 4LSMA 1GQYA 4DMLA 3AM4A 2GDZA 2CUKA 3G49A 5DCUA 3WIEA 3AU9A 2NU7A 4XCVA 4DRYA 1O6ZA 4MP6A 3T7EA 6ADHA 4U8GA 1ZH8A 3QWHA 4AJ4A 4DL9A 4YR9A 4QFDA 4BMVA 3OSUA 3JQFC 4LISA 3DXFA 3VPGA 4W9NA 5JAMA 4CR8A 5FFFA 5JMPA 1F17A 4FQ8A 3DONA 5L45A 3A06A 4RORA 4QECA 5T8KC 4NJMB 3NT2A 3GPIA 5KVVA 1CERA 4JBGA 1T1SA 1ZIDA 4GLLA 1EQUA 4GPD1 3VZPA 1HEUA 2GYYA 4FR5A 4BL5A 1HYEA 4ZJUA 2VUSA 1BRMA 2J6IA 1SBYA 3LQFA 4EZBA 1OC2A 5A3JA 2X23A 2Q2QA 1P3DA 2C7GA 4XIJA 2W90A 4L9RA 4NBVA 2FPIA 4WNIA 4FS3A 2VTDA 3KLPX 4J2HA 2C20A 1VL8A 3JQDA 1OZAA 2D1YA 2NU8A 3VDQA 2DBZA 1SEVA 4WOKA 5TLSA 4NK4A 3RFVA 4HFMA 4E21A 1U8FO 4IXWA 4MPDA 3TJRA 1MGOA 3BMNA 1HDOA 1V35A 4DREA 4J4BA 5T64A 1YJQA 3W1VA 2Q99A 4YAIA 5JDIA 5DT9A 1H93A 1U1IA 2H6EA 2VZ9A 4ZRMA 4RVFA 4WLEA 1HXHA 1YVEI 3ULKA 4IDFA 4YJHA 3RIHA 1OC4A 3I52A 4A0SA 1TT7A 1HE2A 1YGYA 4M1QA 1B8PA 3K9QO 3OJLA 3H5NA 4L73A 5IZCC 5A5EA 3ON5A 1YDEA 5JS6A 2Q4BA 1I36A 2NVWA 4E2XA 3NDRA 1JWAB 3K2BA 4ND5A 4CV0A 1BDBA 1K0UA 4IMRA 4J0EA 3NUGA 2X0JA 2CDAA 2PD4A 4ND3A 5C5IA 4DPMA 5FWNA 3EDMA 2X8LA 4PLYA 3LLSA 2FR8A 4OIMA 2Y1DA 3JQFA 1HL3A 4WECA 1B2LA 1C0IA 1E92A 3ZWMA 3JYPA 5A9RA 2IE0A 4BKOA 3DZIA 4E5PA 3NTQA 3AY6A 1J5PA 1HYHA 4DQXA 1M2WA 1O9BA 3AI1A 2W98A 3JYNA 3QWBA 4ALIA 1PJCA 1JLLA 1FF9A 6LDHA 1R37A 4LVUA 5IN4A 1U4SA 4Y8VA 1WP4A 3K31A 3C1OA 1OI7A 4N5LA 4RPGA 5IG2A 3NYWA 2I99A 4OOFA 2POQX 4MKZA 4GMFA 3N74A 2X1HA 4KWHA 4GAEA 1VSUA 1YQDA 2HKIA 4BO6A 4IJKA 1PJ2A 4PG6A 2D8AA 2Q3EA 4IIUA 3EVTA 2DLDA 2PK3A 3KVOA 4RVGA 4NR0A 1E3EA 2E37A 3ONFA 3R3JA 4CM1A 2UUPA 4CM4A 1W0CA 1BXZA 3N58A 1SO8A 4UUMA 4BNFA 3HFSA 1ZXBA 4GSLA 1Z6ZA 4WEOA 5A3VA 2TMDA 4FGWA 2XOXA 2PKQO 5ER6A 3QVSA 4QSMA 2LDBA 3MWEB 2I76A 2O3TA 1B16A 5IDYA 4KDFA 2VRCD 1ISJA 1HSOA 1EVYA 3TZ6A 4GVLA 4CM9A 4I8XA 1P1IA 2O3UA 4YYZA 4YXFA 1XQ6A 2QHXA 1NYTA 3GGGA 1LC3A 2J5QA 1ONPA 1RM3A 4BNJA 5IF3A 1GYPA 2RHRA 4ITUA 1AHIA 4MP8A 5HA5A 3QWIA 4GI2A 5JXWA 4YTEA 4A03A 2O4CA 3GH3A 2Y99A 3V1UA 4UUOA 4G5HA 4RZIA 3SVTA 5TT1A 4XD2A 2E6UX 3OJOA 4XX0A 2DQ4A 5I7EA 3D4PA 3KSDO 4NI5A 3G1TA 4R41A 3F4BA 3GVCA 1CRWG 1JAXA 4DIBA 1FDWA 1JTVA 1BGVA 5G0VA 3WNVA 4R9RA 4EITA 3WLFA 3JD4A 3KUXA 2Y1GA 3O26A 3RU7A 4MVJP 3LU1A 4DYVA 3C8MA 3INTA 4IQGA 4J1TA 5CG2A 2XXBA 3NKLA 3SC4A 3UVEA 2BF7A 5IJZA 4HY3A 4MINA 1K6XA 3VVCA 1MFPA 1U3TA 4CMIB 1ADBA 1LJ8A 5TS3A 5G4KB 1B0AA 5AXAA 1HE4A 4BNVA 1LRLA 3BTOA 3D3WB 5F3RA 3SJUA 5DN9A 3DFUA 2FR1A 5ER9A 1DHTA 4MKRA 2GN4A 3KBOA 5CPBA 4HXYA 3KO8A 4BNYA 3GEGA
chains in the Genus database with same CATH superfamily
4CKYA 4TPKA 1WVGA 2Q50A 1MXFA 3D8TA 2F43A 3V2GA 5JAQA 1JRLA 4RKWA 3P32A 4PSDA 2OZPA 5KNDA 2DXIA 3CONA 1Q83A 3QE9Y 1QYXA 2PX4A 5THQA 2JCVA 4B0OA 2ZT7A 1LKZA 1L7OA 1EH5A 3LUAA 2AG6A 3L2OB 4IDPA 3ZKAA 4YO8A 4U5XA 4RJLA 4DUZB 1U1DA 2A9FA 2FU5C 2VJBA 3EFOB 1NVBA 2X7HA 4I8IA 3VJMA 5KSWB 1NVEA 4XTCS 1O58A 2DVMA 1V0JA 4C87A 4MRNA 1M8GA 4PZZA 4W5NA 4NZ9A 4ZMSA 1S8OA 3AHHA 3SYTA 1D9ZA 4P4SB 3CSDA 4Y9TA 1FRFS 4IV8A 4PN7A 5HCNA 1JWBB 1R18A 5EHGA 5CA1A 1UBFA 4Z2YA 3D5QA 3KVRA 4MAAA 2R66A 1GKUB 1CHNA 1Q16A 4CLOB 2VYNA 5HOQA 2YRXA 1N7HA 3A3NA 3G8BA 1WMDA 3MCUA 3T9CA 1CR2A 4YDRA 1TEHA 3SQLA 1CZKA 3LUPA 3PNSA 4J90A 1A9OA 1W36B 1YQXA 3KJHA 1DC4A 1M2OA 4IDGA 4LTNA 4I08A 1PT8A 2O3JA 4TT3A 3E2IA 2FQXA 2J67A 2OO5A 2BGUA 3Q6IA 4LHVA 1NP3A 2P69A 5DCLA 4LS3A 4JB0A 3L3BA 5LSAA 1RBYA 2JDIA 2YVUA 5JZBA 1QRTA 5KTTA 4FK8A 3FNQA 4KBFA 1SD5A 3PXBA 3MTQA 3RIGA 3UF0A 5HZHA 2NO0A 3ZU6A 3D3JA 4RJTA 1OROA 4ZWNA 4K28A 2CCGA 2FPPA 5E2IA 5EE1A 3B7WA 1RACA 3FR8A 4N5NA 4Y2HA 2DQSA 1UJ4A 1JFTA 1OSNA 1ACMA 3L49A 2G1PA 4L5IA 4W9MC 1PT7A 4Z49A 1P1BA 2FY8A 2NUBA 3OZRA 4UULA 1NLMA 6NULA 4W7HA 3K72B 2IS4A 1KZ6A 1BA2A 3GOHA 2HOQA 2QTZA 1Q6YA 3KJEA 2QOEA 5GIPE 1LLFA 3AUTA 3MJHA 3QVJA 4PTZA 1X7WB 1EFTA 5FV7A 2F3QA 4EKEA 2DULA 2H4JA 2OG2A 1FMLA 1FX0B 1NN5A 3D7MA 1VB3A 4ZYXA 2VF8A 2YRFA 3VVLA 1FDVA 3I0NA 1UDRA 3EBPA 3WZLA 4OI0A 1FUUA 1QGUB 1QPBA 5T6BA 4DLRA 5IM5A 5FNVF 1P29A 1UAYA 4FFBA 4UAVA 1Y6FA 1ID1A 1WD7A 1DBRA 5L8VA 3BWBA 4ZEVA 1M0WA 2AEJA 3WMXA 1B8OA 5LIPA 2ZS8A 1EHCA 4XA8A 4Z0HO 2F67A 4E2FA 2VPIA 4NG5A 5JZSA 4F93B 3RJTA 1Q1QA 3GUCA 4JIGA 3OEYA 1MV5A 1T35A 1W75A 1GGMA 2AMJA 2XHEA 4F85A 4ER5A 2VHJA 1XROA 5CT6A 1M5UA 1T9BA 1XAGA 4MS3B 1FLNA 1NQXA 4M21A 3UH0A 3PJFA 3OJXA 1FMJA 5FULA 2YQ4A 3OFJA 4LMRA 4AF7A 5AW6A 2CL7X 5G0UA 4UAGA 4M0PA 3LIPA 3L1HA 3FCEA 2WWXA 3C1AA 2J48A 3TJZA 3GGCA 1NPTO 1BD3A 1SXJE 4QTYA 2G77B 2XDQB 4XGNA 3V32A 3ASZA 1HQDA 1SKMA 3UCEA 2NG1A 5SY9A 4EZEA 3KQPA 3OFND 1SBIA 4DUGA 1WTAA 2CVZA 5JWOA 1UXHA 5L40A 4D9JA 1E3WA 2DUJA 4AYTA 1DS6A 4RC9A 1JDSA 3PG5A 3T7KA 4TLAA 1ZHHA 4P33A 2BGMA 4REQB 1E3TA 2D4HA 1RADA 1ZCBA 4AJLA 2RI0A 3H75A 2X5JO 1MZVA 1SCUA 4P93A 4RU1A 4TXNA 5ICFA 3PL5A 3HCAA 4Q4CA 3QY9A 2WPDA 4M1OA 1ZY2A 4RY2A 4EY4A 3ZJ4A 3DYBA 3PX7A 2L17A 5HFJA 1C9YA 4LY0A 2FF5A 2Q5OA 5BYKA 1Q1AA 2LCFA 3FPAA 5DEIA 4B6QA 2RK6A 4URWR 3ZU2A 4PZUA 1N1DA 2WV7A 2Z57A 1XQ1A 4X6YA 1QHSA 5DLDA 3FYDA 3B1KA 1A4RA 5BQPA 3UJCA 3W3ZB 5CD1A 1WETA 3PDIA 4AZ0A 3O4VA 4HDAA 2O2GA 1SQGA 4Q4DA 4BRUA 1P5HA 1MB3A 4JBIA 5LOVA 2IHVA 1RVDA 4LUCA 2AUMA 2IEZA 3BE6A 4KO1S 2NW6A 4MSUA 3BSYA 3TLXA 5LMZA 2HRZA 3MFQA 4OP2A 4A8HA 1T8PA 3ABIA 4MS1A 4LYGA 4OKSA 2BTEA 3HCWA 5AJWA 5AKZA 5CIWA 2WKWA 2QVZX 3P7MA 3QFTA 1UZAA 3OG9A 1IXZA 4MQ5A 1LF0A 1J7JA 4D0GA 2JK1A 1OA1A 2UYQA 1L4MA 2PPVA 2X15A 2PWZA 4GKAA 2X5XA 1FP2A 5EKXA 1NOJA 2O0LA 2W5UA 4K9SA 5D3MB 3KXLA 1MW9X 1NGSA 3PPWA 4G1VA 5A5DA 4Q1EA 2YZNA 2EJTA 2WD7B 3QUQA 3OE1A 1EP9A 4WNYA 2VSYA 1XTVA 4G0WA 2V54A 5CCDA 3RSOA 2PIAA 3AF3A 3P71T 4KITB 4KPFC 3NALA 4TWIA 4KNYA 4D3XA 1NOKA 3GU3A 4IEEA 2Z6UA 1JH8A 3HCDA 1GIAA 4KMSA 4XJTA 3EZNA 3P9CA 3QE3A 3WFIA 2YXDA 1JPJA 4GDMA 3JY6A 1YE5A 3UOWA 2N0SA 3QELA 2FUKA 3ZIDA 4D7AA 3L7KA 5DF1A 4DTIA 1CY7A 1HTWA 1T3GA 2HFJA 1NBOA 2ZUDA 4NLLA 3C3DA 4OSOA 3SIRA 1RWBA 4AVYA 2FPWA 2YASA 3NWBA 1OIXA 2FFRA 3RUDA 1JSCA 1Z5ZA 4HPJB 4KIWA 4WNCA 1E8DA 4AN1A 1FTWA 1XKLA 3B6IA 2HNKA 3H9CA 3WL5A 1UMDA 1E6WA 1W6UA 2Z5VA 2XCQA 4P3KA 1ZN8A 1EMDA 1PVOA 2BV3A 1MLDA 3TGPA 3VAAA 3MTJA 3E27A 3M5PA 4P82A 5LA6B 3WI7A 4CF4A 1MXHA 4YRGA 2A59A 1QHFA 4HX5A 1ETUA 2Y0PA 1Z5UA 2Q5EA 1R4MA 3RAEC 3QNUA 1JHZA 1QWSA 3TOCA 4RZUA 3RUAA 1MAWA 1JIQA 3PQ3A 2WU0A 4Y30A 4Q00A 4UXJA 3THRA 3GRYA 5LQDA 1DGQA 3KYDB 1M1YA 1ORTA 2Y2VA 4WY8A 2QL7A 4IVQA 3CEAA 3QWFA 1EYZA 2XZPA 4ES6A 2F55A 3UUEA 4LJ9A 4EI2A 1I6KA 1HE3A 2R60A 3AEUA 3BD9A 1CQXA 3GJ0A 2ECQA 2J3KA 4G4GA 2BVNA 2RH4A 3GRVA 4UUQA 3F9RA 2XJ9A 3C7CB 3MPUA 2AIRA 2JNWA 3T9FA 3Q3EA 1L9KA 1J8DA 4WLFA 3SZUA 4I9FA 5JXGA 3LAWA 3QTTA 5T4BA 4F3KA 1YNOA 3E0XA 5BRJA 5HZGA 3PKZA 2I6QA 1V9CA 1BDMA 2NZVG 5FO1A 1T9DA 4QUAA 3PIIA 3D31A 4JEIA 1AQLA 1E3JA 5DBIA 2Q8PA 4NZZA 3HFRA 3EXEB 2X0NA 3T5CA 1NQWA 5B1IA 5CDSA 2YWDA 3ZGOA 5C8XA 4EW6A 3UEOA 3P26A 5C4IA 3IIKA 2FSVA 4XR9A 3IR7A 4NFSA 5G4LA 5H82A 1EDOA 1Z4QA 2JJMA 1KMHB 3E4CA 4URXR 1ZN7A 2Y9MB 2C4MA 1AGXA 5K3FA 2IPOA 3LC2O 2J59A 5FX2A 4YAWA 4PG5A 2OMKA 2ZJ3A 2VUIB 4JUFA 1R2QA 1E3SA 2WJHA 3KZNA 3KT6A 2PGXA 5CNIA 4A8PA 3HADA 3K6KA 4MV8A 4GX0A 2OGWA 4C5AA 1O5TA 1X94A 1JQ5A 1GL6A 1NVUQ 4YIHA 4QYIA 2IOQA 2ZRLA 1FXSA 1HWYA 1D2GA 2PRZA 2J3EA 2Q6TA 5DDIP 4N47A 2BE7A 1JIVA 3F7TA 4UFPA 1UJMA 2K2QB 5EQDA 2C95A 4MV4A 1AJEA 4K9MA 2O2ZA 2OZLB 2MMCA 4QEDA 4DBVO 2VQDA 4YP0A 1FUYB 3PTAA 5A4KA 2H3EA 4WLNA 4YJ2B 3SYNA 2N3ZA 2D8MA 4RACA 4V0OA 4MR9A 4TLBA 2BFAA 4TZ0A 4CEIA 3K1AA 1YUBA 4HCJA 4EG6A 4TVSA 3K9FC 4CRWB 5AXCA 1DIOB 2ZDHA 3L5KA 4PZYA 4RVHA 5REQA 2YIVX 3V8BA 4YONB 1RLIA 1UZNA 1ZXLA 2BFCA 3AVQA 2XH8A 5EWMA 5LJLA 2VUHB 2MMGA 2Y05A 4ARAA 4NAVA 2H59A 2HO5A 1C1DA 1LBSA 1I2AA 1ZINA 3EXAA 4HQNA 1SK8A 2V8BA 2XE8A 3GZNB 1ZGCA 2E49A 4Z3KA 4G0YA 1L4LA 2ZQZA 1V1JA 3LOQA 4RSGA 2P65A 1SULA 3UK2A 3UO8B 5A04A 4L3VA 2Q0QA 1VRVA 4NU5A 4XB6B 5DM2A 5TPZD 1PWZA 3H13A 1JKFA 1KAGA 3HABA 3MM4A 5JSQA 5JSUA 2VDUE 2KS6A 5DXAA 5E6SA 1D1PA 1HH4A 3AR3A 1GU7A 1ADYA 1LLDA 2ZJ0A 2GPWA 3BWEA 3E9YA 3NFYA 4DCMA 5GZ1A 3UBTA 1RRCA 2ZXEA 5CDFE 3KQKA 1BE6A 3M1YA 3F5MA 3NBAA 3RSLA 5AIBA 3GBPA 2YY6A 2CLMB 1C30A 4X6LA 1PR1A 4CL0A 4WCVA 3BMQB 3PGMA 2YBDA 1C4KA 1RWMA 4K40A 1CE8A 2VSFA 3SKYA 5FPPA 1V9LA 2QG4A 3FAZA 3I58A 5BN4B 2W71A 5JSYA 4YUYA 1XGKA 2K2WA 3GD7A 1R9MA 1YS1X 1E7QA 1UPBA 3TUIC 5LUAA 1ISFA 3EZLA 3ORQA 2WICA 4E4YA 4KZKA 5I3CA 3L6EA 3DFFA 4OB6A 1E2BA 2Q0XA 3HKCB 2VP2A 2ZAMA 1GG2A 4HDNB 2IW1A 3NI2A 3NEYA 1KOGA 1OAAA 2WKRA 1BWRA 2I6TA 4KPUB 4ZDKA 3DE2X 4Y0VA 1VTKA 3FF4A 5AVTA 2XB4A 1C7RA 1I4EB 2J0UB 4G0QA 4IS3A 4KTVE 1B00A 1FNCA 2WWVD 3HH8A 1KP3A 1SIOA 1EEHA 3H4VA 5EIAA 1UKZA 2P4SA 4D41A 4W5RA 5T5QA 2IHZA 4O1MA 4DYHA 1KF0A 1WX1A 3KALA 4JXJA 3UJPA 3THWA 1XCGB 2BMFA 3B5EA 3OAAD 4KLZA 5FEMA 3VR6D 3FSEA 4RM3A 1N2CB 4D56A 4EUFA 4FWIB 3HB9A 4F7DA 3SR4A 1A5AB 2SCUA 3GPLA 2I1VB 2G28A 2M6SA 1WQ4A 3OPYI 4R6WA 1D2EA 1CXZA 2J08A 3K0KA 4K9NA 2REQA 4XXHA 4M0UA 4C78A 4B5KA 2JD1A 1Y1LA 3L8DA 4E1VA 4MWBA 2FNAA 3OCCA 3KU4A 4CGZA 1A9QA 3KR2A 3ESBA 1LDEA 2WLSA 1JSLA 3AIIA 3FYTA 3O31A 3G0IA 4KFSA 4O4LF 1MVLA 4LK2A 1XZEA 4KI7A 5C51B 2GCPA 3OC6A 2HCFA 1K6EA 1E64A 1L8XA 3NC0C 5BPHA 3A11A 1ZLXA 3IV9A 3VYVA 1H94A 2GO1A 2H9YA 3OQ1A 3CPSA 1AUQA 1SCIA 4PONA 2FZCA 1FDTA 1COWA 1NM5A 1W1IA 5IXSA 1AKUA 5KINB 4OHZA 3INYA 4LQLA 3RU3A 1UM9B 3LYAA 2NXWA 3DLCA 4B71A 1HRDA 3AX6A 3HM2A 3ZE1B 4AUMA 5KSOA 1TCBA 3P5BA 4ALMA 3S2IA 2GEJA 4YRRA 5GPBA 3GP5A 3HVRA 3CW8X 1OBVA 2BFNA 4UBMA 2WM2A 2HZBA 1U8YA 3KYIB 3VBEA 5FT9A 5KTRA 2GSDA 1BOFA 1S2MA 2VOEA 2Z83A 2ZB8A 3S8YA 1TCUA 3ED1A 3OFSA 5EUMA 1SBTA 1M6WA 1VJRA 1AXGA 2P2SA 1I24A 4U2EA 4FOOA 3HJFA 1VXRA 1JPNA 1YQTA 3UGKA 4F6RA 2H1VA 1M2KA 2W2PA 5THKA 1T4CB 1EQAA 1W96A 3WDKA 3BDVA 4N41A 4QRHA 5D2CA 3RWOA 4LF8B 1W59A 1DT3A 2N1MA 3QBDA 2HA0A 4EDFA 2R84A 2QR3A 4LJ7A 3IP3A 1YGPA 1FLVA 1QH9A 3INNA 3RLIA 2BH2A 3EPHA 5BW8A 1QVAA 4DSTA 1EFDN 1YZLA 1GJRA 3O3OB 5EWLA 3FGNA 2BGLA 1BMQA 3ILXA 3LRPA 3JZMA 4I50A 5FO0A 3I9MA 4MA4A 2QIPA 4NE2A 4TTVA 3E9NA 2COUA 3AG6A 2PBZA 3FYHA 4ETNA 2CDBA 5HVNA 5J2TB 3E5MA 3LVFO 1ULTA 4OHXA 2ONZA 3KR1A 1T8UA 4QUKA 3T35A 4CLRA 3AP2A 3Q2IA 3AP1A 4I1PA 2NACA 4CQNA 2EBFX 1YR2A 2AZMA 1YQ9A 5H59A 1ONSA 3KEOA 4BZQA 1AV6A 3O1JC 4YXWA 2ST1A 3RIYA 4B8WA 1CDDA 3H5RA 1ATZA 4J91A 4O4HA 1TPZA 1Z25A 4LRTB 4XUCA 2IOFK 1UPFA 4RDXA 3H0CA 5C8YA 1SVMA 2XCIA 5EKDA 1P61B 3AJDA 3F74A 3U3XA 3HA3A 2OECA 3EEIA 3D7KA 2CB0A 5FOQA 1ST3A 4AWBA 3HS3A 4UEOA 3K0HA 3HUUA 2PGDA 1F06A 5C31A 2WM9B 1E1NA 2ALJA 4OPMA 1QGOA 4NH4A 2YBEA 1EXMA 5I47A 5TQVA 3HJAA 3MAAC 3ELYA 1QGZA 3UPTA 3SMQA 1CZHA 3CUKA 1U1GA 2K5UA 2WP8J 4EFKA 4BNZA 1FLDA 4NMHA 1WOYA 1IJEA 1JE1A 2B4QA 3W7BA 5HKKA 2LWIA 3EA4A 4XYBA 1KTIA 2UVDA 1UKBA 5A71A 4RLSA 2DKNA 1T5OA 2WTMA 3FIJA 3GJQA 3L1UA 1NHGA 1GPWB 1FTSA 3TIGA 1WBBA 4DWWA 1OW3B 5BT9A 1ZNQO 2H18A 1I80A 3PP8A 3ZV4A 1H23A 1ZK1A 1ZN2A 3O4IA 4KLAA 1EIWA 4L4ZA 3N2LA 4EW2A 5JASA 3M4NA 4FGLA 4NCXA 4Z4EA 1S01A 2WSIA 4EGQA 5JD6A 3C0KA 1F2TB 3JWIA 1BYIA 1SXJD 3HMQA 4A36A 1VKRA 2JLQA 3BS4A 2G17A 3O8QB 3C14C 1GAQA 1L0BA 1URPA 1WXFA 2JJ2D 4EKYA 5T41A 3C1UA 1QX4A 1GPMA 4TLCA 1MZPA 1PJTA 2NZJA 3AKYA 4NTZA 4YAFA 1GV1A 1PQPA 3CLRD 4KX5A 4WINA 4Q7JB 4C22A 3UK1A 2VF5X 3Q7QA 1KIAA 3WBBA 3RU2A 2MHCA 4TL7A 3WWDA 3AC0A 3NAGA 2FRXA 2AUTA 5BV0A 2EHDA 3B6EA 3BDIA 3G79A 5DMXA 4OB7A 4YGYA 5HRCA 1OV4A 4GZLA 3O5AA 1GU0A 1ZAKA 2R6DA 3RIMA 4BN4A 2E85A 3ZLJA 1NNI1 3V1YA 1VM6A 1YRLA 5DRYA 1LCIA 4ZOEA 3EZGA 3BFKA 5KJFA 1P7ZA 1IHOA 2PS1A 4KL8S 4AZWA 4O4JB 2A4KA 2RGCA 1SHKA 1U8CB 3EMKA 4R4JA 5DNCA 3U6KA 4KVZA 2B4AA 2WOOA 1LJLA 4MQUA 3ESCA 1GY8A 2O59A 5TQJA 2E5FA 1ECCA 1YMQA 2JK0A 3I23A 3RRXA 4BV3A 5FUXA 4BQPA 4IJWA 4DNPA 5LBUA 3AF4A 1N75A 1QP8A 1YL5A 2VN8A 2XEDA 3ADDA 1DEXA 3B7PA 4GX2A 3FGZA 4P4NA 5D3QA 1RE1A 3AFHA 4ZP1A 2LCIA 2NO7A 4TL9A 1IM8A 4DT1B 2R8EA 4R2LA 5DGIA 2OM6A 3HHPA 4OYHA 2YZMA 4HGRA 1QHHB 4X7BA 4BAGA 1CW2B 4F1WA 1Q0HA 2OHHA 4EEXA 2AG0A 5HJ2A 1FDIA 1DNPA 1VB5A 3ZK8A 2QSZA 1KY2A 3A9VA 2OWEA 1I3OA 1T0BA 3L01A 3OJFA 1Z0IA 3R6TA 5LN1A 1CUFA 1V45E 5BUCA 1T1JA 4OQFA 1L4GA 2QRQA 4KRXA 4RVUA 4PNHA 3U4DA 4EHNA 1QP7A 3R09A 1IN7A 2PY6A 3QTLA 2NU6B 1T1EA 1X86B 1VFPA 1G2QA 3UPUA 2PT9A 2GT1A 2E18A 5ALLA 1DWPA 1EFHA 4MV3A 1KFEB 5G1OA 3HDTA 3VNQA 3BC1A 3NX4A 4K05A 4R9VA 2O8EA 5AKEA 4IDCA 4B7XA 5CBKA 1O95A 4MGEA 5ENZA 4X84A 5BY2A 3F6EX 1M54A 4WZBA 3RVDA 2Z2XA 4A10A 4XQCA 1UM8A 5LQMA 1ADFA 3N3AC 1DBIA 1NC1A 1WV0A 2XMRA 3PHIA 4FU0A 3E9DA 4FTWA 3LQYA 1YBHA 1ZD1A 3G2HA 5BSKA 3WRYC 3WIBA 2XOEA 4I19A 6GPBA 3TQCA 1VGQA 2E4YA 3JZAA 1B41A 3BIFA 3DEZA 4YEDA 3UWDA 3ZD9A 5CB4B 3ZDDA 4LVNA 4TTSA 4FI3F 4B8ZA 1XFAA 1P77A 2O0KA 4X95A 4YVFA 2JI9A 3N0XA 3JAWA 2ONYA 2IOHA 2QTLA 1B3RA 2QP3A 2XNDA 4U2CA 4NBRA 4K03A 4YJKA 4EFNA 4UZFA 1D8AA 1N5KA 1J56A 3RSGA 1DG1G 2A92A 1WDMA 1E8MA 1O77A 4HXEB 4NNOA 2VDWB 3C8UA 2VAVA 1EFPA 5DBOA 1IWPB 5DTEA 2CJPA 2HLDD 5H16A 3RTDA 5BN4A 2JLCA 3WVNA 2BTQA 4B4DA 4PNPA 3PPYA 3EHDA 1GPNA 4QVKA 3U3JA 1YTLA 1DMSA 1N9ZA 4WFIA 1CDEA 2XWSA 2XGMA 2YYAA 4HTFA 1RD4A 4LWZA 1LPPA 1GTJ1 1UEXC 3I28A 5AQ1A 5C8DA 2CBZA 3I83A 4I50B 5AKIA 3TTYA 3NH9A 2GEDA 4G63A 1U7OA 3O2NA 1T6ZA 5GZ3A 3H9BA 4R0MA 4HNUA 5GOTA 3PFWO 5IBPA 2MSEB 3QEJA 4URYR 4X3CA 3HYCA 5DGXA 4Z0TA 1RZRA 4U7GA 2IDZA 3W9BA 3KL2A 4C6RA 4LTDA 4ZU1X 3LH5A 2UZ1B 1POXA 1P2GA 4DMCA 3NIWA 5HP4A 1RMTA 5DJ5A 5A0TA 2ATEA 1W87A 2E4UA 2GCOB 2VVTA 2ZBFA 3C4VA 3HXLA 4RD1A 5P21A 3HRKA 5TDHA 5DSXA 1MAAA 5C8YF 2EGUA 3TJMA 3A9UA 1FFBA 2CF5A 3L4EA 1RXWA 4NSNA 2YL2A 1M34B 1V8OA 2ERCA 1HT3A 2GN6A 2ISCA 2WSSA 5LYJF 5L3RA 1SVLA 4PAQA 3GNLA 3AY0A 3NASA 3W8RA 2PU7A 3IV6A 4OJNA 4UNPA 2XITA 4BFCA 4MOWA 3L0PA 1Y1SA 1V4BA 2GN2A 4QSHA 4ZI2A 3TPCA 1OWNA 3GAZA 2CWDA 4QKQA 1K5GA 5JQGF 3IT1A 4RK4A 4BNKA 4BGEA 1NMEA 1OGJA 1SBQA 3OOEA 3ADBA 1Y4AE 3O38A 3GBSA 4V03A 5DNWA 2HF8A 2D6FA 5U1PA 1PN3A 3IAM1 3PVZA 1X13A 4B3HA 1XRSB 4IXDA 5B3KA 1WOMA 4ZO4A 3Q3JB 3IJRA 3NNDA 3PNLA 4MX8A 4S2UA 1U65A 7REQA 1NNUA 4KSCA 3IE2A 2HBZA 3MOIA 5LIRA 3H8WA 3CSSA 3N6RA 5I48A 3GLFE 3D7SA 2XGJA 3Q2OA 3W8EA 3MCAA 1IWOA 1EWYA 1IHYA 1UC5B 2QT0A 3GUYA 5K3SA 1IPHA 1GN9A 1F0NA 2QMUA 3J7TA 5EJ2A 1O8BA 3SJCA 4BO7A 2AQHA 4BN0A 1ECLA 4QUIA 2G83A 1L5GB 2O8DB 4YPOA 2DT8A 5E1MA 1DOZA 2J6HA 2RC5A 2PT5A 4BEVA 4EHBA 4Z7JA 1DKOA 2HIGA 3BFJA 2CDCA 1ZD4A 2J8ZA 1X19A 4A5OA 4H6XA 4EDHA 1O2DA 3PDCA 4FZ5A 5F73A 2QZJA 3TE6A 4PLGA 4F45A 3EH2A 4RYLA 4CKEB 5GZ6A 1JP7A 4L7VA 4N3AA 1Y1KE 4DCVA 3TSCA 3EOAI 3VZDA 3NP9A 1M7HA 1Z2PX 2UV8A 3FVQA 2CFSA 3VO2A 3O92A 1H1DA 4HFJA 4YAKA 3OZWA 4FOLA 4DDKA 3QMWA 2I7TA 4MR7A 3VV2A 4BB6A 1ZCZA 5SYAA 4EYOA 2AN3A 2CLSA 4JZYA 3FOBA 4WZAB 1AURA 2XMZA 3PQEA 2QRMA 2DFLA 2VDRB 3GT3A 4N5IX 2Y4OA 3WNZA 3R8CA 4OQ4A 1SPBS 5A5GA 2CBGA 1PHPA 2HGZA 2BPOA 1MT3A 2JIMA 2AVDA 4ZOQI 3FVTA 2PZLA 3AERA 1Z8NA 3RAGA 3V4PB 1FP1D 3MINB 4OJQA 2HWXA 4BX8A 3G82C 3QU9A 4WACA 4DEVA 4F3NA 4B44A 1N0UA 2IYEA 2R00A 3N5CA 5I9LA 1O95C 4TGLA 3IE0A 2HU7A 1HOTA 4IYRA 3OA0A 3DP9A 3NORA 3UG7A 4EVQA 1NXSA 3KIPA 4RA9B 5IJ0A 2Z5GA 3DVAA 3L6BA 4MR8A 2O8EB 5AW0A 2CLKB 3T95A 4D46A 2G9QA 3DOOA 3ZYZA 2PJRA 2AFHA 4QGGA 2EX1A 3BHMA 4MVWA 2ERXA 5JY6A 5FI1B 1G4AE 2WFMA 5JCJD 1SGWA 2CLLB 4PLZA 4NCHA 4QWMA 4X62B 2WWYA 3TAHA 3HCFA 2D7DA 1V11B 2HSWA 1ID8A 4KR6A 1TJPB 2ZJ2A 1DOHA 3SQNA 1OXVA 3H8VA 1D07A 3EIUA 4ZRNA 5DM60 3L4BA 3STVA 2PRYA 4KG7A 1OIWA 4ZKDA 4U3JA 3FSRA 1M1ZA 3ECCA 1ZBDA 4ZOCA 1GGNA 3UXHA 3ZCTA 3DLTA 4E7PA 4R2WA 5KTMA 2H3HA 5AVSA 4X41A 2DQZA 2YHIA 5FUQA 3AR9A 4OI1A 3T5TA 1MH9A 1E89A 4YRMA 4CDGA 1ZMTA 1A69A 1M6HA 3PR2B 4BP3A 3DUFA 3M6WA 1VOTA 2IXAA 2NPOA 4ZQCB 1YUNA 2CMFA 4R2KA 5DTMA 2IWRA 3CFYA 4YV2A 1J2RA 3AB8A 3R9XA 2AN5A 3L0YA 2JIZA 1J2YA 4OHMA 1Y4SA 5KB3A 3PXUA 1N92A 2RH9B 5IVPA 3WLHA 1W47A 1BFUA 1GPUA 2JCYA 2BIFA 3UWMA 2ZSBA 3UZUA 1PT9A 1M0TA 4CM4B 3OKCA 1LFAA 1XZIA 3GR6A 2QG9A 3FB4A 3W5SA 2Q1WA 1AZWA 2WG0A 1SQFA 2JI8A 3DEHA 3IMCA 4RSRA 1USKA 1J9EA 2AXEA 2JFPA 2QTNA 2IBMA 5DTRA 1NSFA 3IILA 3MTIA 1E5TA 4O4HF 4P3OA 3RU9A 3CBQA 3U7QA 2XRYA 1DU4A 1T29A 4R69A 1SHUX 3ZV5A 5G02A 4BVFA 2P9FA 3EVGA 2AWOA 2OV8A 2RAVA 2JJ8A 2QMOA 5IAEA 1W76A 1VA4A 1PRYA 3D8BA 2FSIA 2I65A 3WHLA 1T3LA 1Z6GA 4ECEA 4KACA 4KHZA 2BR3A 4XDYA 4JT8A 1KZ9A 4A6DA 1WW2A 4C03A 3NT4A 1ODLA 4MRMB 1UPXA 1DJNA 5KDDA 3K0AA 4XR4A 1N34B 2O6LA 1F4PA 1E2GA 3KLBA 5GM1A 2HJSA 5BQ5A 3CH6A 3G2LA 2IF0A 1OVMA 3NJRA 2HHJA 1IK4A 1LGYA 1XMQB 4CKBB 1APBA 3IYLW 1JAYA 1MDFA 2JH3A 4X54A 2I54A 3LPCA 3T1QA 1LC0A 3HA7A 1R6BX 3OOYA 2ZUSA 4CCWA 2AR0A 3IODA 3ILHA 5IEBA 5GV7A 5M7EA 3FPKA 3R7BA 3ZU3A 1KJQA 2E2WA 3PENA 2AJDA 3M4JA 3TGWA 4YJGB 4PNEA 1M3SA 1UP6A 3I4FA 3PE4A 3A8TA 4XLTA 1ISIA 4YRPA 3CA8A 2NUAB 2PZMA 4TWRA 2ZU6A 1TYZA 3MHPA 1CUHA 3LA6A 3H5IA 3QPWA 5A1TA 4XPIB 4OBEA 2EFHB 4PLFA 3VUFA 2C59A 5BSRA 4BX2A 1C8KA 3N39C 2C2BA 1ZISA 3OX4A 2ZUUA 1MX5A 3H2YA 4MV0A 1QMPA 2WTNA 3EVEA 2DP4E 3K9BA 1WHSB 3LD9A 3EDCA 4ZYZA 1T36B 2W2KB 3O2JA 3OEHD 1AK9A 2J5BA 3GGJA 4U02A 4KH0A 1K68A 2ZRMA 3IUPA 5LBTA 1X8XA 2QZ4A 2VF4X 2PL1A 4O29A 1H5QA 4Q12A 4TYMA 2OO5C 1TF5A 3D8RA 3OKFA 3A9RA 4ZVPA 1DAKA 3D0RA 3IP1A 3LSTA 4LOAA 2AQKA 5FNZA 3R8XA 3K9CA 4JVNA 1IVNA 1CY1A 4OA5A 5E38A 2B6HA 3UJ3X 1JI0A 2QXYA 5K45A 2P0EA 2PMBA 4H7DA 4KWEA 1Q11A 1N7JA 4LYAA 4GDFA 4E13A 3EFOA 3S8MA 4M7PA 1CUWA 1CUBA 2OQVA 4DPLA 3QX7A 3FHLA 1YE8A 1C3OB 2B25A 1VE7A 4KE8A 4FX5A 4GYJA 2C29D 2ONCA 3VR2A 2Z08A 1H5UA 1PR3A 4YI3A 4BZZA 4HADA 3NWPA 3T4PA 5L4LA 3WMFA 2RBEA 1SU7A 3H5WA 4IIEA 4Q6WA 1TYDE 4TKVA 5I7SA 4CQJA 3BIOA 4TT3D 3STUA 1H2WA 1H69A 2GJ4A 5SV2A 1C9KA 2B20A 4UEJA 4N1AA 4UUPA 2VH2A 2VF7A 1UDWA 3C7DB 1DKLA 5FOTA 3Q3CA 4X1KB 2HDOA 2WI8A 1JLSA 3QKRB 1R0SA 1II9A 3HDQA 1W35A 4QQNA 1CUUA 3W6UA 2PUDA 1UCFA 2WSSD 1DIRA 1Z6PA 2JAPA 5JVDF 2BH9A 3IAAA 4JI7B 1L5YA 1XRLA 4JQYA 2JEZA 2LVBA 2HRRA 4JITA 3TR0A 4WZAA 5KAMA 1E59A 2Y1OA 2YQZA 3OCXA 4Q3DA 1IQPA 3RE1A 3HBFA 5HDBB 3EEBA 2Q46A 1JFFA 2WSLA 4XB2A 1YR8A 1JDBB 1U2EA 2F64A 2JIRA 3NDIA 2ZIZA 5TPWB 1KVRA 2PTHA 3TEMA 1LSSA 1U7TA 2ZAYA 4BLSA 2B0JA 5AVQA 4D8UA 2AD5A 4G5YA 3TM5A 3KJIA 3KPVA 1KBZA 5FBQB 5FTNA 3TTUA 4CT4B 4JXKA 2CNOA 5B5SA 2A3RA 2G3YA 2JHPA 4IV0A 1RCFA 4ZI3A 4L4XA 1RPAA 1N2OA 1MX1A 1VHQA 4NOMA 4WGFA 2BFWA 1U8XX 1NV9A 4WGGA 1N8KA 1QU3A 1PVVA 1IY0A 4N4AA 2PLWA 4N7MA 5DYIA 4HGYA 4B73A 4E6PA 3M4XA 1FSZA 5IFKA 3KKQA 5BQXA 4NDZA 4IIJA 1EAMA 5CXSA 2XVYA 2FEOA 1H0KA 4CQLA 4YT5A 4JP2A 1E2LA 4XLZA 2J32A 8ABPA 1ZRNA 3B52X 1T24A 3EZFA 3F73A 1OYVA 3RF7A 1BFKA 1KU0A 1R4AA 2PUTA 3ND9A 5IAAA 1JU4A 2QNRA 3L6OO 1YL6A 2O8DA 1KDRA 1L4YA 2C2KA 2ZOSA 2R48A 3M1LA 4UU7A 5EP1A 5F3WB 1JQJC 3R9WA 5HILA 4DJTA 1KS9A 4UKDA 3GGPA 2DHCA 1ULAA 2C0QA 3BGDA 4M0DA 2IXFA 1Y3BE 1CJVC 1KOLA 5K20A 2HDWA 3CLUC 3N1UA 3ZWPA 5HKBA 3G5TA 2CJFA 4Q7EA 1JEOA 5BQOA 2P9GA 1N7GA 4GMDA 3O91A 4CE6A 5C7LO 1SD2A 3CVVA 4JBHA 1CE8B 2ZBQA 3RUCA 3ADOA 5CA0A 5A2GA 4R5HA 1JEYA 1EE1A 4IW3B 4P4TA 1KS2A 2CK3A 2IIPA 5IVIA 2JFNA 2KBEA 1NI4B 1Z5NA 2W6MA 4IH9A 4QT0A 3KOZA 2B8WA 3MMNA 4K6KA 1N2GA 3O9MA 1Q15A 5JRDS 4U6SA 1AB6A 2OBBA 1MG5A 4ID3A 3QIVA 2AC2A 1J0AA 1H2HA 3PXDA 2ZRPA 2WEKA 3JVIA 1QH1B 1HGXA 3SXPA 5A2QA 2K6GA 3R0IA 4P83A 3TMAA 2WPDD 1YRWA 2IYPA 2IQIA 1UC9A 2EQBA 5DB4A 5CEJA 4MJXA 2WWWA 3LPNA 3N7UA 2VJDA 3PC7A 3RJ9A 3IE1A 2R2GA 3EB9A 4F2DA 3AIKA 4GKKB 2FEKA 1SCQA 3MJSA 8MHTA 3BGVA 3BE8A 1FFCA 3ZI7A 1NUAA 2QRUA 4NFYA 1NXWA 3ICCA 2IIQA 1VLVA 2Q6LA 2VATA 2XE7A 4GEGA 1DTEA 2G9NA 3OTHA 1AB5A 1TUGA 2EKBA 3IO5A 4IZHA 5CP8A 5B7PA 1AC5A 3H1FA 4FBLA 3SK0A 3Q8XB 1RPJA 4A0RA 1KVQA 3HLYA 4CUZA 3T0FA 2E4XA 1TEZA 1YL7A 5D1HA 4BNMA 3GMDA 4D5GA 2ZRJA 3O83A 3HB1A 1Z08A 1W73A 4B43A 4ZGGA 2QUZA 1KYQA 4XRRA 1GCAA 4KXVA 4MV9A 3I39X 3X2FA 3WLPA 4WBSA 4GVXA 4UBNA 5DI9A 4ZV4A 4Q5IA 1E1QD 1QFMA 1CR1A 1KAMA 2H57A 4KBGA 1X1RA 4D0LB 1TXGA 4H0FA 3A1EA 3WQSB 4F96A 3PPVA 1RHMA 1Y5IA 5K6AC 5KYNA 1U7ZA 2H4WA 1AS0A 3B13B 1G55A 1ZSYA 2OSBA 4NDNE 2P67A 1I3KA 3UGTA 5CA1B 2RHDA 2P9ZA 3IERA 4FFVA 4C89A 4CKBA 5CUQA 2ZZNA 1PT6A 2AFVA 5EIXA 3K1YA 4YREA 5JWRA 1GFSA 5IMSA 2R4UA 3AQ4A 3K92A 2O7NA 4MVXA 1Z0AA 3P9PA 4ZCMA 3DDWA 4OJTA 1YU9A 2GCEA 5ALXA 3E22B 4EUSA 2OXTA 4ND1A 3RO7A 4TXMA 1K7XB 4LIPD 4AECA 5KTKA 2BBTA 2BEUA 3SZRA 1U7XA 3R9IA 1EVIA 2W70A 3OX1A 3VXKA 2VNHA 4XQ9A 1G8AA 3KJXA 4KQKA 1GNPA 2BJWA 2X8BA 3E5NA 2X6TA 4G5QA 1ZN9A 3PHHA 3GJ7A 2WVJA 1C5KA 2FR8C 5K3CA 4D97A 5ABPA 2O7RA 1UR5A 3DW3X 1Q0TA 5JE8A 2XKAA 2CHFA 1CIPA 4BBJA 4OXRA 1KMCA 3Q9LA 4EWLA 1G3QA 2C2YA 4MO2A 1Q21A 1L5HA 3FLEA 5BR1A 5C1DA 5I8WA 2CF6A 2O5VA 2Z9CA 1Q50A 3H1BA 4Q3LA 1F12A 1I7LA 2W4MA 4WVFA 3ZPXA 3U62A 5EFOA 4J7CA 5FI0B 1ZICA 2FZKA 2OT3B 3JD0A 4MI3A 3IKVA 3WLEA 2Z98A 2C2WA 2E5WA 1FK8A 3NHYA 2JGJA 3KPYA 3O94A 2I34A 3OT1B 4LEIA 3ZWAA 4F2GA 5IHPA 1C3OA 1LDNA 1R4MB 2Z3WA 3P0FA 1RABA 1TW2A 3TLCA 3MIIA 4GPTA 3U3DA 3X2SA 3DVSX 1PGPA 1YSCA 1VPDA 3AKDA 3ZGVA 3CLTD 3U48A 1QF9A 1GRCA 2GF0A 4RIGA 2Q49A 3FFBA 3IDSA 4AXXA 5HQ3B 4RVNA 1USGA 3DGFC 2VRBA 4WOCA 2C7OA 4BY9E 3H97A 4KGZA 4GMHA 3REFA 3PC3A 2HF9A 4D6YA 4MUXA 4G5RA 1Q91A 4M60A 4WOBA 3EISA 3H6HA 5AHXA 2WTEA 5KTNA 4PLCA 3S7ZA 4Y6GB 3TTSA 1MW8X 4MYCA 3SBDA 2FYTA 1HUQA 4H4DA 2A78A 2R6HA 2ZBGA 2BEVB 3FZNA 4KO3S 4MKHA 3COVA 1VXOA 4AY3A 4B4UA 2VXYA 1RAIA 3ELDA 2NU7B 4A2WA 1FB5A 4FEEA 2VDOB 3U7IA 3R3ZA 2CHVA 4JVOA 4DIUA 1K7YA 5HBGA 4EYEA 1V43A 1FPMA 1R10A 3AJRA 3EULA 3FY4A 4IHJF 3NFRA 4W82A 1RP7A 5JFTA 4B34A 1YR6A 4AI6A 1KNQA 1KSJA 1JHMA 3ZZ1A 1Z06A 1A4XA 3B6ZA 4OGFA 2DFDA 3O3NB 1GRQA 1M8KA 1PR6A 2F1KA 1WTCA 3LK7A 3O03A 3P2EA 1RLUA 3SQMA 3NAZA 4W1SA 1SUPA 1V25A 3REGA 3RASA 2RG7A 1USWA 2P5YA 3ZCUA 4PRKA 1DZ3A 1QYWA 3M6LA 1QO9A 4Q66C 1I7PA 2DTXA 5FTKA 4AXBA 4XUEA 4W63A 3GUHA 3UFXA 1OY1A 3GEBA 1H2AS 5AXBA 3CUTA 4DLLA 5L51A 1Z7WA 2XCUA 3WYGA 3FMFA 2PBRA 3U7GA 2J7KA 1GGFA 3PS9A 4ER7A 2IKSA 2PGNA 3MELA 3BXGA 4KUHA 1WCYA 4HQFA 3I9V1 1D03A 3RYHB 4A8JA 1NWCA 3LSYA 4PICA 1T25A 1KXJA 4FFMA 2AF4C 1OLXB 3H84A 3MCZA 5K8VA 4LJLA 2YC2C 4PLPA 3C4QA 3VO8A 1I2ZA 2M1XA 1PX2A 1PO7A 4KN9S 3HV2A 3IBYA 3BTUA 3LUGA 2Q6I