2PD4A

Crystal structure of the helicobacter pylori enoyl-acyl carrier protein reductase in complex with hydroxydiphenyl ether compounds, triclosan and diclosan
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
274
structure length
274
Chain Sequence
GFLKGKKGLIVGVANNKSIAYGIAQSCFNQGATLAFTYLNESLEKRVRPIAQELNSPYVYELDVSKEEHFKSLYNSVKKDLGSLDFIVHSVAFAPKEALEGSLLETSKSAFNTAMEISVYSLIELTNTLKPLLNNGASVLTLSYLGSTKYMAHYNVMGLAKAALESAVRYLAVDLGKHHIRVNALSAGPIRTLASSGIADFRMILKWNEINAPLRKNVSLEEVGNAGMYLLSSLSSGVSGEVHFVDAGYHVMGMGAVEEKDNKATLLWDLHKEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
publication title Crystal structure of the Helicobacter pylori enoyl-acyl carrier protein reductase in complex with hydroxydiphenyl ether compounds, triclosan and diclosan
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Oxidoreductase
total genus 91
structure length 274
sequence length 274
chains with identical sequence B, C, D
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2007-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2pd4A00
3WQSB 3ANLA 1UZMA 3O8QB 1YBVA 4FFOA 3U5TA 3IMFA 4RVSA 3AOEA 2Y0CA 4GMGA 1I30A 1GU7A 5IN4A 3RJ9A 4CMIB 1CDOA 4YJFA 1JU9A 1E3LA 1QYCA 3FR8A 3FN4A 3I6IA 3RROA 5KNLA 2Q45A 5CDUA 3IJRA 4YYZA 2Y1GA 4TSKA 4IQGA 3ON5A 1EE9A 1P33A 2C2YA 1DIBA 5THKA 5JY6A 2EIHA 3I9OA 4XYLA 2X0IA 5B4UA 1PZEA 2BI8A 3MEQA 4A0SA 4JNKA 3KYBA 2JAHA 3ROQA 3AOEC 4KQWA 3C1TA 4XZ3A 3ROMA 5KTKA 3ONFA 1E7WA 3OEWA 3QV1A 1UAYA 3I9MA 1BVUA 2WYUA 1WMAA 3WMXA 4E5KA 1V35A 2B4TO 3DWFA 3WYEA 1QYVA 2NACA 1JN0A 5BR7A 2XAAA 3ZGYA 5H82A 3RU9A 3I4FA 4D0SA 4HUJA 4CODB 3ICCA 3L07A 4YRDA 4CQLA 3SXPA 3JQ8B 1SBYA 3AM4A 5TX7A 1GZ3A 1R15A 2H5LA 1F8FA 4L4XA 4YB8A 5T67A 4NFHA 2ZQZA 1LDYA 5EIOA 3GVCA 3DZHA 3ZNPA 3F3SA 3OJLA 2BI7A 1M6WA 2AEJA 3CKYA 4LK3A 4FOSA 4IDBA 3JQBC 4J7XA 3UFXA 1AUPA 1SEVA 2PH5A 2VHYA 5L53A 4CL3A 1KETA 2IEDA 3H2SA 3QWHA 1AGNA 1ZK1A 4FD3A 4JJGA 1ISHA 1GV1A 3VZRA 1GYRA 2I65A 2VWQA 3DOCA 3W4KA 4LRTB 2NTVA 5IZ4A 2FSSA 2WE8A 2QZ9A 1P3DA 1ZMOA 1HT0A 3H3FA 4DIFA 4L76A 3JYOA 4NI5A 4PRKA 1U5AA 2Y1DA 2JKVA 4BQRA 5CDYA 3BTSA 1UJMA 4IIVA 4O59O 4CV1A 3P19A 3VH2A 1LX6A 2VCYA 3GN2A 2VHWA 1DIRA 3WIDA 4BMVA 3A14A 1XQ6A 2J3IA 3W6ZA 5C5IA 1NAIA 4N7RA 2FZEA 3GAFA 3DO5A 4R5MA 2HSDA 4QXMA 2CVZA 3ZV5A 3BHMA 1CEQA 4Q3CA 5BNIA 3CEAA 2AG8A 2PFGA 2UUPA 4CM4A 2QYSA 3NEPX 4DUPA 2YQ4A 2FWMX 1I2BA 4PGFA 1GDHA 5KJCA 4E21A 2O3JA 4EJ6A 2OXIA 4PZDA 2BFOA 1XDWA 2B5VA 1C1XA 4YWJA 3ORFA 3UCXA 2B4QA 3N74A 5U4QA 4A2CA 4NJMB 3FNEA 3VH4A 1MLDA 4OHUA 1GQQA 5TT0A 1K6XA 4KUEA 2BRUA 1KVRA 2DAPA 2VNSA 2ZYGA 4Q3BA 4AJOA 1W0CA 3WIEA 4BMSA 1K2WA 3E5RA 4WOJA 2VNAA 5A5EA 5JSFA 5IDWA 4NR0A 1MG0A 3LVFO 3ZNOA 3PWKA 5ILOA 1P77A 1GCOA 4R3NA 3VTFA 4JJIA 4A03A 2V6MA 4I9NA 3TZHA 4B7XA 4IPTA 4P22A 5CEEA 4CM5A 5BSFA 5GZ6A 3GMDA 4M86A 1YO6A 5A05A 1ORRA 2Q4EA 1IUKA 4HFMA 4I5FA 2PGLA 4BKQA 3RUEA 5LC1A 3VOSA 4IM7A 1EDZA 3RUFA 1OFGA 1R4MB 3R3JA 2QRKA 1BMDA 2FY8A 1FDTA 2WMDA 4ZU3A 1QMGA 2E49A 4ZQHA 4BGVA 1GUZA 1T4BA 4MKZA 3U3XA 3QE3A 4NFSA 3PRJA 3GDGA 3KV3O 1ZZEA 4RCVA 2B69A 4BNYA 1F12A 2I5PO 4Z9YA 2OORA 2DTXA 2J3KA 3K6JA 3WLEA 1HZJA 4LRSB 5U9CA 2WWRA 3OA2A 1PJQA 4ONEA 4CMBA 1Q0HA 3E5MA 1ISJA 4FOOA 4II3A 3HFGA 1ULSA 3T4XA 4BKPA 1F8GA 3PHHA 2SCUA 3PIIA 5EINA 5CEFA 3AI1A 3AI3A 2PKQO 3DXFA 4PIVA 4DA9A 1E77A 3NKLA 5AOVA 5JAMA 5DT9A 3NX4A 4ZQFA 3GAZA 4DQXA 4JBIA 2YY7A 1ZVMA 4XGKA 5KJ6A 3IIEA 1H94A 2EG9A 1I10A 1Q0QA 2ZTLA 1UH5A 3NUGA 4UEOA 1R4NA 4EUEA 2AE2A 4YQZA 2AQHA 3CPSA 5A04A 2IE0A 2GN6A 3PVZA 4GLOA 1R0LA 3I5MA 2HMTA 3FTPA 3PK0A 3PJGA 3DBRA 2DU8A 3OQ6A 3FPCA 3H5AA 2VYND 4PN3A 1DAOA 3I3OA 1O5IA 3D5QA 2C7VA 3QVTA 1X13A 5T64A 4CM8B 4R1NA 4DLBA 3JQFA 4OH1A 3GN1A 3PQFA 3Q2KA 2J5QA 1E3JA 1HRDA 1KS9A 5HTOA 2IEBA 2X1HA 4WKGA 1H2HA 4M89A 1HEUA 3A9WA 4GBJA 4QO8A 1PX0A 4IQ0A 1ZCJA 1ONNA 2WSBA 2JFHA 2PD6A 1NHGA 4CV2A 5CFZA 1HE3A 1TVEA 3BMQA 4YR9A 3L77A 4GKVA 4I08A 1EQUA 5EQDA 5COBA 1FMCA 4XRRA 3E48A 3KYCA 5JDIC 4BNLA 2AHRA 1HE5A 3ADOA 1ZK3A 4XIJA 3JQAA 4BMNA 1PS8A 5KVVA 3P2YA 2PR2A 5F1OA 1DHRA 3RU7A 4JP3A 1AHHA 4CMHA 3K30A 3K5PA 4PZEA 1C3VA 1LJ8A 2ZCUA 3G1TA 1GR0A 4R4JA 5A3JA 4RV9A 2OUIA 3I9KA 1PL6A 2Y1EA 3NGLA 3KO8A 4BO4A 3NTQA 1N92A 1DFGA 4E32A 4GSKA 1PR9A 1R16A 3WS7A 4FCCA 4XEHA 2GRAA 2I99A 2YZ7A 2A94A 1TEHA 4R3WA 4D46A 1MGOA 1KOLA 1QLHA 1YB1A 5F5LA 1D7OA 1M6HA 3GG9A 5JW6A 4J9UE 3Q11A 1FDWA 4U6QA 2IRWA 5ILGA 4JJFA 3F4BA 1HZZA 4LMRA 4TRNA 3V2HA 3UHAA 4K26A 4W9NA 2Y99A 1Y5MA 4R5HA 3ZNQA 5I7VA 1GPDG 2VUSA 3VDQA 1NASA 1BVRA 1T2EA 2WYWA 4PLZA 4DXHA 1NQ5A 2X7HA 2ZTUA 4HWKA 1PSDA 1OC4A 2CFCA 2NLOA 3JQGA 3KEQA 4OYRA 1EBUA 3DHYA 4GGOA 3TL3A 4BKRA 3H5RA 4GWKA 3QA9A 5B12A 3KVOA 4FC7A 2GZ1A 4J2HA 1WPQA 3AM5A 4E6PA 1DC3A 4Y6SA 4NBRA 1BXGA 1NQOA 1Y8QA 5A3VA 1V3UA 1NWHA 1MUUA 1DEHA 4JCOA 1K0UA 2DBVO 3GQVA 4UULA 4BO0A 1PZFA 3L0DA 3QQPA 3FR7A 4FQ8A 4RF5A 4E31A 2GF2A 4BV8A 1LDMA 3RWBA 2A4KA 2CVOA 3ZH2A 3M2TA 4KUHA 2HU2A 4AJPA 3GVHA 3OSUA 3UUWA 1I8TA 5JCJD 5EESA 3ZWOA 3KRTA 4HFNA 1O89A 4PLWA 3FNGA 4LGVA 4EGFA 5G4KB 1E1MA 1JA9A 4PLYA 1QSGA 2YYYA 3EC7A 3L9WA 4RPHA 4HXYA 4U8GA 2D5AA 4WGGA 1DRVA 3W6UA 2B83A 2QHXA 4I9UA 3U9LA 3AOGA 3K2BA 4ZRNA 5A4DA 2YJZA 2HO5A 3WGYA 1GD1O 3NDIA 4F45A 2VWGA 1I24A 1NVMB 3BTOA 3OECA 4OAQA 5J23A 4A26A 4ALLA 1I32A 1TT7A 1B2LA 4BNMA 4WLVA 1A5ZA 4BNKA 3EVNA 2Y66A 3OQ1A 4O6VA 1M75A 1YOVB 4D44A 2DPGA 3DEYX 4FDAA 4RLHA 2UV8A 4E0BA 1PQPA 1YL5A 2JCVA 4BKUA 2I67A 4DIOA 2J5KA 2Q3EA 5IZCA 3FWNA 3KLPX 1U2GA 2QYTA 3KSDO 4ND3A 4RL6A 4MVJA 4CLHA 1EFLA 4YAGA 3IKTA 4R1UA 1HKUA 1H6AA 1LNQA 1C14A 3EK2A 5KWEA 2P5YA 4XQCA 2P91A 1PGQA 4CR8A 4ZGWA 5FI3A 5BSEA 3V8BA 3ICPA 3LK7A 1FK8A 2GN9A 2HDHA 4I8XA 2Y67A 4CR6A 1GL3A 1NFQA 4TVBA 3KLMX 4XB2A 3ZNNA 4I5GA 4O5OA 4HV4A 1E3EA 2ZYAA 3PJEA 3FWZA 4PVDA 1LQUA 4A7PA 4IJKA 2CDCA 3INGA 3PLRA 2NVBA 4RVFA 2GZ2A 4WLUA 3UCFA 3E9NA 3W1VA 1IB6A 1ONPA 4NFYA 1AE1A 4XB1A 2X9GA 4D0RA 1VSUA 3GVXA 4LISA 3GG2A 3PZRA 5F5NA 2IZ0A 1G0NA 4AJKA 3AUAA 5B1YA 3GFGA 1TA4A 4BL5A 6ADHA 5DF1A 4IS2A 3D4PA 5F3RA 1X7DA 4BB5A 3QLJA 4YEDA 1EMDA 1EUCA 3G49A 4K6CA 1GPJA 5L40A 1NQTA 5K9ZA 4CLOA 4J1NA 3QWFA 4KQXA 4E5YA 3RC2A 3ZW8A 5FWNA 2B36A 3OP4A 1R66A 4X54A 3ZV4A 1PGJA 4JXKA 3VKUA 5A06A 4WNCA 1DFHA 2V7PA 2EW8A 3ROPA 3GNQA 4HBGA 2B5WA 3TFOA 2X9NA 2CVQA 2HUNA 1YQDA 3K2EA 3UXYA 4B3JA 3TJRA 2DT5A 3DAFA 3TRIA 1K89A 1L1FA 1GAEO 1ZEMA 3EUWA 4FFLA 3NJ4A 4YT8A 3H9JA 4NU5A 4YT4A 5GY7A 2AG5A 5JCJA 4ZVVA 4ID9A 1K5HA 1J49A 5TS3A 4EEZA 1YONA 3L4SO 4TVOA 3FNHA 1E6EA 4WASA 2JHFA 3GNSA 1UDAA 3RUAA 2GYYA 3Q6IA 4UEJA 1LBEA 2RHRA 3ABIA 3IP1A 3QWBA 2P4HX 1E3SA 2BFPA 5JXWA 1PL7A 2EGGA 4TZKA 5ENDA 5JAZA 1H6DA 2NU8A 1PU2A 2Y1OA 1YS4A 4J0FA 1SOVA 1JQBA 1LLDA 2OMEA 2VUUA 3I1JA 4MVJM 1YKFA 1OC2A 1SCUA 4P8RA 1I3NA 2VZ0A 5C3MA 1G6KA 1ISIA 1RYEA 3DOJA 1Z45A 5TSDA 4LCEA 3PHJA 1EZ4A 3F1KA 4R9SA 3DDNA 3RC9A 4ZD6A 2V6BA 3C7DB 1L7DA 2GD1O 1IPEA 1Y81A 4IZIA 1ENZA 1TXGA 1EFKA 4WLNA 1JWAB 4E2ZA 4NPCA 3ZWAA 1ZMTA 1IY8A 1EVIA 1SOWA 1KY5A 2I66A 2NSDA 3D7LA 3U4HA 3VH3A 4B8ZA 3DZFA 4QTZA 1PR3A 1I2CA 2J3JA 5COQA 4CLRB 1SPXA 1ZXLA 4IJWA 3RUCA 3GGOA 4CMIA 4WK6A 2VTDA 1C1DB 2O7SA 2PKQP 4ND1A 4NNJA 1HDXA 5FYDA 1A9YA 3H9EO 3L6EA 3LF2A 3IS3A 4J1TA 5F1PA 3GFBA 2PZJA 2X23A 4Y6PA 2D2IA 2OP1A 4XQGA 4Z3KA 4F3YA 4BNJA 3F5QA 3F46A 1LSOA 4AJ1A 4FB5A 1A7AA 1I2ZA 1SO8A 1T2FA 4W6ZA 4ZA2A 1B3RA 1O0SA 1MXFA 1O6ZA 1XA0A 3ZWCA 4U0JA 4ZRMA 4ZICA 3N7UA 3AU9A 2E82A 1YJQA 2DBZA 4OKNA 5EMHA 4ND5A 1FJHA 3F6YA 4E33A 1KC1A 2BFMA 2W2LD 4E2WA 3HDYA 1BGVA 2Q1WA 3MTJA 2Y1CA 4UUPA 2EKLA 3JQ8A 4KTVE 4NBVA 4NJOA 4XGIA 5JC8A 3Q2IA 5IXYA 3CMMA 3E03A 2HK7A 3WGTA 5KVSA 2W2KB 2W8ZA 3DZKA 2OGUA 3LF1A 3D3WB 4BNGA 4UAGA 2AQ8A 2HMVA 3WYCA 1B14A 3TOZA 4IGFA 3VC7A 1M66A 3AY3A 3H4VA 3MCVA 4XQEA 3TNLA 3DZGA 1QRRA 3ITKA 4DBVO 5HWSA 1RM3A 3RAJA 4JN6B 3Q3CA 3U4IA 1AXGA 4ZN6A 2HK8A 4YJDA 5KOIA 3BA1A 4PLCA 3HDJA 3EZLA 2D3TA 2FPIA 2O7QA 1QR6A 3JD3A 4N5NA 2NVUB 5KCZA 3BZUA 3C7CB 2Q1SA 2VRBA 2GR9A 2YFHA 1IZ0A 2CMDA 3C7AA 3PXXA 5ER6A 1WMBA 2GLXA 3MOIA 3MJTA 4DLLA 1LA2A 4BGIA 1UP6A 2V6GA 2J6IA 3MJCA 4S3MA 4JQCA 4L73A 3W8EA 2DTDA 2ZTMA 2EP7A 3BTUA 4KUGA 4UVHA 4OSOA 1WDMA 4NBWA 3U49A 2BGLA 1QLJA 4PG4A 1RPNA 5L4LA 3OIDA 1ENOA 2J5RA 1A7KA 3GK3A 4GGPA 2O3QA 1R12A 1PJLA 3T7CA 4BO7A 4BNUA 2JD1A 3NT2A 2DM6A 2RH4A 3V2GA 2FR0A 4CM9D 4MIOA 3RFVA 4A5OA 4AJLA 1X1EA 3RUIA 2J8ZA 5CDTA 2D8AA 1MXHA 4YT5A 2X0NA 2VQ3A 4CUZA 2YV2A 1ONOA 3W8FA 3OM9A 4I5EA 3OF2A 4WNIA 3HZZA 3OICA 3IP3A 4BB6A 4BIIA 5L7TA 1UXHA 1X14A 4UVEA 4NJMA 4MPDA 2FRDA 1DIAA 5I8ZA 2JCYA 5JYDA 2DUUA 4R54A 3KTDA 2C59A 3JQCA 2UYYA 4GH5A 1E7SA 1PZGA 3OJ0A 2POQX 2Q1TA 1ULUA 4QFCA 1CQIA 2FMUA 4BQPA 2YHUA 3B6ZA 1W8DA 1C0PA 1Y1PA 4RVGA 3JQBA 3VPHA 3NRCA 1NNUA 1H6BA 1H93A 3HUDA 1B3BA 4B7CA 1GYPA 3B20A 4BKOA 1VKNA 1MV8A 2RH8A 3C24A 4PLGA 4OQYA 4DC1A 3BIOA 3ADPA 1C0LA 2W2LA 3VAZA 2NV6A 2QIOA 1R4MA 3EW7A 5K6AC 1IZ9A 1B15A 3ETDA 4NK4A 3ZV6A 2F1KA 2C2XA 2CY0A 3WWZA 2A9FA 4Q9NA 4RVDA 5KJFA 1CRWG 2F00A 4MO2A 1FDVA 5EN4A 3WQQA 5EL0A 1IYZA 3E9QA 3RBZA 2FHSA 3DB2A 1E3IA 2X0RA 3NTOA 2UAGA 1U3UA 2PH3A 3COSA 1XEAA 4GAEA 2YDYA 4MJLA 1NPTO 1MA0A 1P1HA 5JMWA 3KBOA 4GX2A 4L0QA 3CIFA 2YV3A 3QW2A 2BD0A 3JYQA 4R01A 4CR7A 3I6QA 4J1SA 4QFDA 5F1KA 4AJEA 3WGQA 4ESOA 3S2FA 5BT9A 3GLQA 3M2PA 4N5MA 5KKCA 3MJ4A 2X5JO 3LZ6A 5IFLA 4K9DA 5HM8A 1KEWA 1YQGA 1YB4A 1LEHA 2OO5A 4BVAA 2NU6A 3IUPA 4EBFA 5IDXA 3L9XA 4MOWA 1EBFA 1WP4A 1YBMA 1NFRA 1ML3A 3GY0A 3D64A 3L4BC 4CM8A 4P4GA 3LU1A 2CSUA 1PS0A 3I9JA 4D43A 3TWOA 5C37A 1NXQA 4DYDA 1OMOA 5T5QA 3GZNB 4CMJA 3GRPA 2NUAA 3WG9A 3ZU2A 3ZHXA 3ZCXA 5DP2A 3N58A 4IDDA 2WM3A 3KUXA 3SC4A 5EQFA 1HXHA 2B35A 1KVQA 3D0OA 3C85A 1YL7A 3UKOA 4MKXA 2VWPA 4CM9A 1N2SA 3S1LA 1W73A 4NQZA 1MC4A 2OFPA 3E18A 3GUYA 1S7CA 3MJVA 3C1AA 3DTTA 3MJSA 1KYQA 3DC2A 4H7PA 2WDZA 3V1UA 1BW9B 4YA6A 2O2YA 4B8WA 3NYWA 4XA8A 4D3FA 5I9LA 4Z3DA 1XLTA 4PRLA 1XSEA 1ZW1A 4PLFA 3UW3A 1YQXA 3Q9NA 5LCXA 2YV1A 4QEDA 1WW8A 3KB6A 3GEDA 5DOZA 4OXYA 3O4RA 5JCXA 3E6AA 4UVDA 1NYTA 1PEDA 4DWVA 2IYPA 4N5LA 2Y1FA 1XWFA 1V0JA 1LUAA 1ZJZA 4J0EA 1EK6A 2V6FA 3WGOA 2IXAA 5ADHA 1U3WA 3NDJA 4O63O 4WLEA 4WCFC 4KWIA 4GX5A 2PD4A 4FJ0A 2EF1A 4A27A 3ZWPA 1JKIA 4AFNA 2P4QA 1E1LA 1O94A 3QY9A 4PVCA 4HFJA 3ULKA 1PJ3A 1LU9A 1V8BA 4II2A 5TQVA 2DFVA 2VWHA 1NR7A 4EZBA 2FZWA 2VHZA 3JQ9C 4PLPA 3HNPA 2ZB7A 1NVGA 4B7UA 3M1LA 4OGWA 4FFRA 4RVHA 3IUSA 4XYGA 5AYVA 4CMEC 5ITWA 1T1RA 3Q9UA 5C7IO 4RF2A 3AY7A 3C1OA 5JO9A 4M55A 3QHAA 2X0JA 1X1TA 3NJ8A 3A28A 3DHNA 3H7AA 2IXBA 3WYBA 2C0CA 2JFGA 2JHGA 4TKLA 3ANNA 3ZN2A 4JBHA 4AG3A 1BSVA 1XELA 3HG7A 3QVWA 1Q7BA 1LDGA 4LSMA 1UP4A 3PGJA 3KOUA 2W90A 3HQ4O 3PGXA 4AJNA 1IE3A 3GHHA 1PJCA 3NTRA 3OBBA 3H2ZA 1U2DA 2BFAA 4GSLA 5JDIA 3PLNA 5HS6A 3PPIA 5CP8A 3AU8A 4INAA 3NGXA 1I01A 3AUSA 4PLVA 4RF4A 4XIYA 1T2AA 1VI2A 3ZWBA 1FXSA 1MFZA 1ZXBA 3QIVA 4XDYA 3EDMA 4FSHA 1LRLA 3GC6A 5CAEA 2PLAA 2O3TA 1R0KA 2DKNA 3CZMA 4LMPA 1A72A 3VPXA 3WGHA 2O50A 4FJ1A 3VPFA 1SEPA 1C0KA 1F17A 1A27A 1J4AA 3A1NA 3FI9A 3I52A 5GMOA 4FJ2A 5CEJA 1ZH8A 3LT4A 1DAPA 1K3TA 1HF3A 1UXJA 4WCFB 1DB3A 1C1XB 3O03A 3WDSA 4CL8A 3Q1LA 1CF2O 2DLDA 1YOVA 1YRLA 1KVTA 1PL8A 3WSVA 1FF9A 4ILKA 4BO3A 3PDJA 1UXIA 4G65A 4G2NA 2PD3A 5JMPA 1T26A 4JGBA 5TLSA 1B8UA 3OA0A 4EUFA 1PTJA 2AQIA 2WD7A 2OZPA 5I7SA 1I33A 5JY1A 3G3EA 2A35A 3GEMA 4CM1A 5I7EA 4D41A 1C0IA 1A71A 4FFNA 4WECA 1HDCA 3PEFA 3PIDA 4PCVA 2G82A 5IF3A 1SAYA 4YVFA 2GERA 3R0IA 2Y0EA 2YHIB 4UVIA 3UOGA 4RLSA 5JDCC 4UREA 3UICA 2Z95A 3ZHYA 4E3ZA 4KDEA 4E30A 5JAIA 3HDQA 3WJ7A 3TQHA 3V5NA 5DULA 3BMOB 3FPLA 4E5PA 5CG2A 5MDHA 3ZHZA 2D4AA 2Q2QA 1OZAA 1YB5A 1V3VA 2Z5LA 1Y8RB 2ILTA 4EDFA 1BXKA 2HMSA 2WJPA 3DBLB 5CHEA 2RBEA 3CE6A 4I1IA 2C82A 4RZHA 4R51A 5I9MA 4TMFA 4M8SA 4OM8A 4XX0A 1DC4A 4FR5A 5H81A 4FBGA 4URFA 3RBXA 1T2CA 1QV6A 4TWRA 2I6TA 4F6CA 4Z0PA 3JQDA 4K28A 4Z9XA 1OBFO 5KIAA 2ZJ1A 5L7YA 3D4OA 2HKIA 3H5NA 4IY1A 4DQVA 4GPD1 1LQTA 1MG5A 4XRGA 1UP7A 1NX6A 4E12A 4NZ9A 4FFMA 3INTA 2JL1A 5AQ1A 3H8VA 4RGBA 4EEXA 1D4FA 1R4NB 5TNXA 2VYNA 1PJ4A 1P1JA 1NBOA 3GT0A 3H9GA 5L4NA 3GZ4A 1PWXA 3X2FA 1B26A 3I9NA 3TZKA 2VHXA 3KYDB 3WGIA 5C7OO 2PY6A 2QRJA 3GHYA 2BH9A 3PP8A 4GMFA 4TROA 4JROA 4PG8A 3HJAA 4CUKA 2GASA 5DBGA 3HN2A 4UVGA 1RM4A 1B7GO 4AJ4A 4IJUA 3RSHA 1LSJA 1LLUA 1GY8A 2PK3A 1TLTA 1KERA 2FOIA 1G0OA 3WWYA 1E3WB 2WYVA 3JCZA 3H65A 2O23A 4W99A 3BMQB 3RASA 1HETA 3RBVA 3I9LA 4DVJA 3AY6A 4CMCA 1WDLA 3KYCB 4RPGA 2GDZA 2GNAA 4B4VA 4MVJF 2YDXA 4TRRA 1VJ1A 2O3SA 4BO2A 3JQAB 4J1QA 2C5EA 3SJ7A 2VZ8A 4YJHB 3GNTA 1QG6A 1E0DA 4NG5A 2XPCA 3IOYA 1KBZA 1KC3A 4OMUA 3WGGA 3IC5A 3IL2A 2EW2A 3UVEA 1HSOA 4CM6A 1E7YA 3BHIA 4W7HA 3DFUA 1Q2XA 1UR5A 2B4RO 3DMTC 4WJZA 1JTVA 4MVJE 3U0BA 2FR8A 4LCJA 4CM3A 4YXFA 2HJSA 1N9GB 3QVXA 4CLRA 5F21A 1T24A 2I3AA 4RDHA 3ASVA 4JLWA 3DBVO 4DLAA 1C1DA 5DP1A 2ZIZA 2QG4A 3H6KA 3V1TC 3WMWA 3DZIA 4GX1A 1CETA 3PHGA 3MWDB 2NVWA 2ZB4A 4BUCA 1JAYA 4Q39A 3OEYA 2D59A 2CF6A 2VOEA 3CUKA 3BMNB 4QX6A 5TC4A 1NAHA 3IQDB 3VTZA 4BNWA 5LDGA 5A03A 4DPLA 1E7MA 1GUFA 4D45A 1ZK0A 2NU9A 1R37A 2IDZA 1GZ4A 1BWSA 1UAGA 4TRJA 4ZHSA 1IHXA 1HYEA 4B3IA 4J4TA 5A5FA 5JYEA 4IDAA 3LC2O 4ND2A 3JSAA 5L45A 1P1IA 4IDEA 3K8ZA 1FDUA 1GFSA 3WTCA 4PLTA 4RDIA 1NP3A 1YH3A 1JWBB 4J49A 1QXSA 4BO6A 2W2KA 4BNIA 1YDEA 3UH1A 3HSKA 1XIVA 2C7GA 4QT0A 4HX5A 3HB4X 3EGOA 4L74A 3NAQA 5T8KC 3FCOA 2QW8A 1W4ZA 5A1TA 5DBFA 2I9PA 2BLLA 1CERA 2Q99A 3FD8A 5CDSA 1LRJA 3LT2A 2VRCD 3GR6A 4RZIA 7ADHA 3GUCA 3IDSA 1LSSA 4ZJUA 4DQUA 2PWZA 3I23A 1DJNA 4YAIA 4DREA 3HWRA 3IJPA 5CG1A 2NTJA 2ZYDA 4UUNA 2VT3A 2JCXA 5ES3A 1WLYA 1JAXA 4OXNA 2NVUA 1BXZA 5MGBA 1DC6A 3KZVA 1N1GA 3I83A 2BGKA 5DNAA 2GPTA 2EEZA 3ZWYA 4RQTA 4H16A 3ITDA 1EUZA 4WEQA 2TMGA 5BNFA 1YWGO 4XKJA 1YDWA 4YAEA 1ZJYA 1X0XA 5IDQA 5CPFA 4R68A 3SVTA 1QKIA 1BTOA 1EEHA 3KHUA 4Z0TA 3ZV3A 5DOVA 3S2GA 3AUTA 4NDNE 4AVYA 4QSMA 3QSGA 3KEOA 3CTMA 1VRWA 3OFSA 5JS6A 1LLCA 3RIHA 1YE3A 1QV7A 3RCBA 3O8QA 3OIGA 2HLPA 3ZWVA 3ZW9A 2Y68A 4TKMA 5A9SB 5B37A 3F1LA 3WBBA 3HHPA 1GQ2A 5EERA 1PGNA 4EITA 2GO1A 4WLFA 3DBHB 2HAEA 1ZO8A 4J6FA 2R6JA 1DFIA 4XCVA 3ONDA 4TZTA 3ETEA 4XR9A 3ZU3A 4MVJP 4RPKA 1P45A 1O8CA 4PFJA 1B0AA 2NWQA 4R9RA 1U8FO 1EVJA 5ER9A 1MB4A 1QYWA 3LC1O 4EUHA 1Z7BA 3AUUA 4IXTA 3TZ6A 1M67A 4E4YA 3PJFA 2O2SA 4CPDA 3JD0A 1PIWA 1TB4A 1DSSG 5A9TA 1P44A 5G0VA 5DN9A 3RQSA 3QWIA 1VLLA 1KIFA 2Q46A 3PFFA 1BDMA 1X7GA 1NTOA 4HFRA 4MKRA 4YT2A 1H6CA 4CQMB 3HN7A 2EWMA 4YTEA 1GZ6A 2IZZA 3LYLA 2AQKA 2CNBA 3PHIA 4BNXA 1D1TA 1EVZA 4CM7A 1VM6A 4CLOB 4N54A 2UVDA 4OOEA 1H9AA 1DLJA 1GUYA 2AW5A 2PKRA 2QX7A 3WNVA 2Q1UA 4FIZA 4OXKA 1F0YA 2DUWA 1PJBA 4FGWA 9LDTA 1SB9A 5L51A 3G79A 3LT0A 3RUHA 5B4TA 2V65A 2LDBA 1A9ZA 3M1AA 5G0UA 3VH1A 5TIIA 2LDXA 4YJGB 4RPJA 2E4AA 4MINA 4W82A 2VZ9A 5JE8A 1F14A 3MJEA 2CZCA 1K6JA 3GGPA 4IS3A 3OJEA 1I36A 1JDJA 3BMCB 4OSPA 5FFFA 4MDHA 1ENYA 1Z73A 1VE9A 3GMSA 4GVXA 2NADA 4IJVA 4YQYA 2Q2VA 4AICA 3K96A 1ZK4A 4NIMA 1U3VA 3EAGA 3AM3A 1GV0A 3R3SA 1IL0A 1GEGA 1Q0LA 5JC1A 4CJXA 1TT5B 1N7HA 2E48A 2ZK7A 2AMFA 4Y6RA 2GGSA 5I8WA 2PTGA 3GH3A 3JQ7B 1NWCA 4IMRA 5L4SA 2CDBA 1H2BA 3ZHBA 3FF4A 5T57A 1P0CA 1NPYA 4R16A 1E5LA 4YAKA 4BV9A 3PQEA 3AWDA 4BNTA 1ISMA 4R1SA 1JVBA 1KVSA 1T2DA 5HBRA 3TZQA 4RPLA 3JD4A 4C4OA 4FC6A 2ZB3A 3EY4A 3GZNA 3GF4A 4U0KA 3HB5X 3WNQA 5DDIP 1KEVA 1NQAO 2EGHA 4GKBA 4CMGA 1HE2A 1LDBA 3ZWNA 3FBGA 1YJ8A 1Y9EA 1LTHR 3CSDA 3NT5A 3WSWA 4HADA 2P5UA 4OQZA 2C20A 5A9RA 5GZ3A 2B0JA 2R00C 4IDCA 1DHTA 3X2EA 5K6AA 3UF0A 3JD2A 1BW9A 1PGPA 4DRYA 2QRLA 3PHLA 2Q50A 4E13A 4YPOA 4UUMA 4TQGA 5G4LA 2FN7A 3FNFA 1NM5A 2O4UX 2PGDA 4DBZA 1QYXA 4OL9A 2BKAA 2NTNA 1NPDA 4CLDA 4YBZA 3B70A 4C7JA 1XG5A 3L6OO 1XGKA 3TZCA 3F47A 3HFSA 2BELA 4EYEA 5CDGA 5I7FA 3VVCA 4JK3A 4P4NA 5KVQA 5FF9A 2HRZA 4K1LA 3WX0A 3VHRA 1VL0A 2D1YA 1AHIA 2ZCVA 1KVUA 4IQ8A 1CQJA 1Q7GA 4MVJH 4XGNA 1PQUA 1BG6A 3ZU5A 4XYMA 4PLHA 2NM0A 1HDOA 5DZSA 4IDFA 3GRKA 4J90A 2PNFA 3C8MA 1GADO 3LLSA 1HSZA 1Y7TA 4BGEA 2AE1A 2W98A 5BNTA 3LT1A 4E2XA 1J0XO 3OQBA 2H6EA 4ITUA 3W4JA 3FSRA 4FFPA 3VKVA 2Y0DA 1PJTA 1JKFA 1VJTA 1YL6A 3AI2A 1HL3A 3RI3A 1ZIDA 2DVMA 2E37A 4Z6KA 4ZQGA 3RC7A 1EVYA 4L8VA 3L4BA 1DC5A 5G2OA 1PJSA 1KEUA 1SC6A 1R6DA 4BS9A 3EMKA 1B16A 2AXQA 1XU9A 2PZKA 3GEGA 5L9AA 3WJAA 3WXBA 1CYDA 1SNYA 4JIGA 1E92A 4R41A 4TRMA 3T7EA 2OP0A 4CV3A 4HY3A 3S8MA 4D7AA 3P5SA 3QRWA 1E6UA 4CUJA 1EK5A 4L4SA 3FRJA 4FN4A 3UAGA 1VC2A 4DC0A 4W7IA 4JP2A 1DXYA 1T25A 5L3ZA 3ST7A 4JBGA 3PYMA 4A73A 3R6DA 3RFXA 5KKAA 2X86A 1E7RA 4G81A 1LSUA 2OBNA 4YCAA 2Z1MA 2PZLA 1V6AA 1E1KA 1Y5RA 3B1FA 3JV7A 4D3SA 1AN9A 3C3XA 4WE3A 3E82A 2YW9A 2JD0A 3AFMA 3G1UA 7MDHA 1XR3A 4RF3A 3HE3A 4ALJA 5ICMA 1XKQA 5TT1A 1DRUA 4J7UA 3SBOA 4DYVA 2CDAA 5AXAA 4B4OA 4YJFB 4D79A 5BSHA 2AEMA 1KEPA 2AA3A 1CJCA 1OI7A 3VPSA 3ZWXA 3INRA 1U1IA 3LLVA 1NFFA 3KXDA 4M49A 5IJZA 3ZZNA 1UDCA 4IXWA 1HTBA 4WEOA 2Q2WA 4WCFA 5GZ1A 1HDRA 1HDZA 3JQAD 1XYGA 1LDNA 1PJ2A 4IGEA 3QWAA 2RIRA 1GTMA 2Q49A 2NQTA 4XR4A 3WOHA 5IG2A 1K6IA 1E5QA 1D1SA 1P1KA 4NBTA 2ZTVA 3WFJA 2UDPA 3JQ9A 4RJTA 2HQ1A 2BMAA 2OHXA 1ZFNA 4M1QA 1M76A 1I5RA 2X8LA 4CMEA 2VYVD 1EE2A 4CQLB 2PA3A 3MOGA 2X5OA 4YACA 5KJEA 4E2YA 2G17A 3GA0A 4HNHA 4MP8A 5IDYA 2PZMA 1UZNA 4ALIA 2YHIA 4Y67A 2I3GA 1HYHA 3VPGA 2DBQA 4GVLA 2Y05A 1V3TA 1N7GA 1T1SA 1U9JA 3BMOA 4Y9DA 3TPCA 3KETA 2EKPA 1RJWA 4J2OA 3MWEB 5G0TA 4R1TA 4MIYA 1RYDA 1Y8RA 4P38A 3IKVA 3JYPA 4J9VA 1EQ2A 4XYEA 3CH6A 3EYWA 3UGKA 3DBLA 2ET6A 1EDOA 5THQA 2EV9A 4EW6A 1ZSNA 2X58A 4LSWA 4LVCA 4AJHA 5ICSA 3Q0EA 4L9RA 5KJ1A 1HYGA 3T4EA 1WVGA 3TDKA 2YUTA 1BRMA 4O0LA 5HS4A 3WLFA 3JQEA 2AEFA 1RM5A 4S1VA 2HMWA 1N5DA 4Y8VA 1Z75A 2VN8A 1UXGA 1ZSVA 4RORA 3ZWMA 3DAPA 1X0VA 2ZB8A 3H3JA 3RKRA 3S55A 4PG5A 1DRWA 1GYQA 3ONEA 3ZI0A 4NU6A 3QVSA 3WICA 3GVIA 2CF5A 4KWHA 5JLAA 2DC1A 1H9BA 5BSGA 1I3KA 4CLXA 3U4DA 2EKQA 3STHA 1DIGA 3JYNA 3KYDA 2CUKA 5G4KA 3CINA 3AJRA 3OHSX 4CM4B 2RCYA 4DTIA 5CPBA 3ANMA 1ZEJA 4DGSA 3LQFA 3QVOA 2X4GA 3V2UA 5ITVA 4I5DA 2EERA 3RKUA 4HNGA 4WPGA 1VSVA 5JPIA 2GCGA 1WZEA 4D3DA 2EJWA 3TF5A 1P0FA 1E3WA 4XWYA 4DPKA 1AXEA 4XD2A 2WTBA 4MIEA 1LRKA 3BHJA 4NK5A 5EPOA 4DL9A 4J7CA 1ADGA 4UEKA 4FW8A 1LLQA 2G76A 5JDCA 2XOXA 1VKOA 3DZJA 3H9UA 3JQFC 5EJ2A 5T6BA 3VZSA 4C7KA 2GUGA 2HK9A 1JW9B 1VL8A 1Q7CA 2VTEA 2HJRA 4P4LA 1Z7EA 1U7HA 3DONA 3EVTA 3SLKA 4ROSA 4GQAA 3K9QO 4YJHA 2EP5A 5H83A 2OBYA 1ZBQA 2FSVA 4MVJD 4E5MA 3QP9A 1J6UA 4L75A 5ENVA 2Q4BA 3G17A 4CLEA 3WGZA 1Z82A 3VDRA 3NV9A 4RVUA 4ALMA 3WB9A 1DLIA 2VYVA 5G0WA 4XJSA 3SLGA 1N9GA 1TI7A 1N1EA 4Z0HO 3AFNA 1R0SA 3SJUA 4PZCA 3RVDA 4J4HA 4AJIA 4E5NA 4RQUA 2GSDA 1OAAA 2IZ1A 1LXCA 1EUDA 1U4OA 3DL2A 4QECA 2EHDA 3JQ6A 1B8PA 1U28A 3O26A 1H0KA 4ZQEA 3UCEA 5B4VA 4QO7A 1UXKA 3A06A 3B1KA 4BNHA 5IXSA 3BMNA 1HDGO 3ZWWA 5G0SA 1S6YA 4O1MA 1XCBA 4OKIA 1IULA 3FTNA 2P9EA 4BGUA 1YGYA 1Z74A 2NNLD 1XQ1A 2EJVA 5I9NA 4CQMD 1SMKA 3EZYA 1HWYA 4KTTE 1VJ0A 3K31A 4ALNA 5JNLA 4IZHA 1U8XX 2BHLA 1J5PA 4XDZA 4AL4A 2VUTA 4MVJI 1JKJA 4W9NC 4EJ0A 4XQ9A 4YRAA 1QORA 3DBRB 1PZHA 4BOYA 3P7MA 4BNFA 3TSCA 4GWGA 3U09A 4LVUA 2VOJA 4OJNA 4EI2A 1NR1A 2DTEA 3LC7O 2P9CA 3JD1A 3RFTA 4OOFA 3GDOA 4NH4A 4Q3EA 2H1SA 4PG6A 4J3FA 1PWZA 1Y9AA 2DPHA 4U6SA 4W4TA 4HKTA 1LC3A 1WAMA 1WWKA 1I3MA 3PDUA 2C5AA 3WBFA 3OH8A 5A02A 2FP4A 1NVTA 2XXJA 4I9HA 3DR3A 3DMTA 4BNZA 4IDGA 5DCYA 2P2SA 3F4LA 4WCDA 3PYXA 3ENKA 4N18A 1PGOA 2P9GA 5DBIA 2WEKA 1NHWA 1LC0A 4BNNA 1Y6JA 5BQFA 1MC5A 1YVEI 3BTVA 4Z9FA 8LDHA 3WFIA 3G0OA 2NU7A 5KVCA 4U5QA 3ENNA 1G1AA 3DAGA 2O4CA 4M87A 3FHLA 3ETGA 4GI2A 4L4RA 3E9MA 4U7WA 3PTZA 4KOAA 5L95A 2WD7B 2R2GA 9LDBA 2RHCA 4NMHA 1MX3A 2GN4A 4IBOA 5A9SA 4B3HA 4H15A 4BNVA 2O48X 4AJJA 2OL4A 2E6UX 1SZJG 1VPDA 1WDKA 3DBHA 1DIHA 3FBTA 3M6IA 3KM0A 3F9IA 3ROKA 1P1RA 3NT4A 4EJMA 2YFQA 5IZCC 2GZ3A 3LSYA 4QQRA 3L6DA 4ZQBA 4B4UA 1GEEA 1U4SA 1FDSA 4Q3AA 1ZKMA 4G5HA 3PZBA 3PI7A 1PQWA 4RO0A 4CMAA 3P2OA 4DPMA 3VZPA 4BO9A 4Q3NA 1DOHA 3OJFA 3KSZO 1D8AA 3RJ5A 3D4NA 3I4CA 3JQGB 3QJ5A 2Z1NA 4FGSA 4DMLA 1P1FA 2GN8A 4GLLA 2JAPA 4DMMA 5T8KA 2ZKLA 1P31A 2ZATA 5AXCA 3E1KA 1SB8A 3OJOA 2A92A 1WZIA 4GL4A 1U3TA 3BYZA 1RKXA 3IAHA 3RC1A 4ALKA 1BXGB 3TOXA 4CQMA 4IIUA 4NHEA 4OIMA 1Y8QB 4Y98A 1PS9A 5AXDA 4FPXA 3D3WA 2FR1A 2O3UA 2RAFA 1ZSYA 1ZK2A 2H9IA 4MP6A 5JFOA 2FPPA 3HDHA 3GOHA 2B37A 1ISGA 3RUDA 4DIBA 5U1PA 4MVJG 5JO0A 4MP3A 4BHTA 2G0TA 1LDEA 1X15A 3GDFA 3W8DA 4B79A 5DCWA 3UN1A 2VHVA 3S2IA 1GQYA 2IYOA 2OOSA 1JVSA 1O9BA 3ZU4A 4XJTA 2UUOA 4YJGA 1DBVO 1RWBA 4LW8A 4F46A 1ISFA 1KY4A 3U4CA 2X5KO 5FI5A 1D3AA 3O38A 4KDFA 3BMCA 4WOKA 2DBRA 4Q3DA 4R69A 1O95A 2JD2A 4J91A 4YAJA 2XF8A 1YXMA 1XHLA 5AVOA 4YDRA 2QZZA 3CXRA 1TT5A 4QUKA 5DCUA 5LDHA 4XYBA 3DMYA 2ZJ0A 1P74A 4GX0A 3JQ7A 4JX8A 4BO8A 4IINA 4ND4A 1RM0A 5IAAA 1WNTA 2PV7A 4BO1A 3O9ZA 3DQPA 1ZNQO 3ZDFA 4WLOA 1ENPA 1ZUD1 1JLLA 5TJ9A 3BXXA 3DTYA 5HA5A 1DO8A 2FPGA 2DQ4A 4PG7A 2C29D 1CIVA 3CZRA 4KP7A 3VVBA 2EXXA 2X9VA 4F6LA 3PJDA 1Z6ZA 1UDBA 3JTMA 2IODA 3OIFA 4HP8A 3SC6A 1P9LA 3K92A 1YBAA 2JJYA 8ADHA 2PGJA 4NBUA 1F06A 2VT2A 3HADA 1A4UA 1BHSA 5TF4A 3S2EA 5FEUA 1CWUA 4BO5A 2JFFA 1X7HA 4K6FA 4B4WA 3F5SA 1IHYA 3PWZA 3JYLA 2I76A 2J3HA 1BDBA 3ASUA 5TJHA 4J43A 3OETA 3AK4A 3R1IA 4LN1A 3PWSA 1I3LA 3NDRA 2WE7A 3B1JA 1E1NA 1UZLA 5AXBA 2G1UA 3KSUA 5TRTA 1U7TA 3GVPA 3D1LA 5L7WA 4M54A 2G5CA 2YQ5A 2W4QA 3OMLA 3D5TA 5COAA 1E6WA 4IMPA 2X6TA 1HE4A 1LI4A 5K0ZA 6LDHA 4A10A 5HRUA 1B8VA 4J4BA 4AJ2A 1N8KA 1M2WA 1W6UA 2D0IA 3PFWO 3MTGA 3LDHA 3U62A 4FS3A 1DJQA 2HCTA 3WR5A 1XU7A 1E7QA 2NQ8A 1A4IA 4KZPA 1V9LA 1ARZA 1MP0A 5JAQA 3DHEA 2O3RA 3DFZA 4IUYA 4J16A 3DOOA 3TFQA 2C54A 1I0ZA 2HMUA 1WXDA 1L7EA 1ADCA 3CMCO 2BGMA 2C07A 3E8XA 1IOLA 2VRCA 4UUOA 2XXBA 1OOEA 5IN5A 1ADFA 3D3EA 3A4VA 1ID1A 3TN7A 3GPIA 3SEFA 1GCUA 4H3VA 1UUFA 3SX2A 1T4DA 3PQDA 3MZ0A 1HLPA 1ADBA 2X22A 3WTBA 1QP8A 3EHEA 3GPDG 3W4IA 2BF7A 3GGGA 4KMSA 1HLDA 1QYDA 3K73O 1VL6A 1DDOA 3V1YA 2D5CA 1Q1NA 2CD9A 2WD8A 5C7LO 2QQ5A 4CMKA 1MFPA 3H9QA 2HRBA 3AW9A 4YRBA 1HDYA 3RD5A 3TL2A 3VZQA 2DFDA 2ZQYA 2R00A 4WUVA 4CV0A 2H63A 2Y93A 1DPGA 5TGDA 2TMDA 1H5QA 3BAZA 3WQRA 4D42A 1U5CA 4OO3A 5JBIA 3PYLA 2P68A 3DZBA 1IPFA
chains in the Genus database with same CATH superfamily
5AMXA 1D9ZA 3F96A 3AWIA 3RSGA 3WV5A 1Z8NA 3ANLA 1UT8A 2QE7A 2WTMA 4FFOA 1BHQ1 4NDAA 4UHHA 4KIUA 1ETUA 3N2KA 4JDUA 4G8JA 1WSAA 2GCOA 1XTQA 1XRPA 2D6FA 3OX4A 5JNSA 3U4QB 2PX0A 1GTVA 1JT9A 2VHEA 3WHLA 4Q00A 3I6IA 2JJ1D 1UEXC 2XWJI 3FN4A 3NDPA 3OPYI 5KNLA 4HNQA 1OLUB 2MSCB 5CDUA 4A8HA 2HC9A 3G0GA 5H4HA 3N2IA 2R4QA 3TOCA 1DQYA 2V5VA 3ZQ4A 4DR2B 5I7RA 3OZDA 1KDTA 1T6ZA 1ZY2A 2PMKA 2X0IA 3DV0A 4G9EA 4KWTA 5B4UA 4X20B 5IH7A 2W2XA 1YOBA 2EWWA 2FA9A 3CO0S 1VIDA 1W44A 2J7KA 3C1TA 1BFDA 1FFWA 5H1YA 3ROMA 2VP6A 3TD6A 4WAUA 2ZWOA 1KYZA 5BWOA 1E7WA 3FROA 3MQ4A 3QV1A 4K9OA 5FNZA 1BVUA 1CB0A 2IP1A 3QM1A 4QDUA 1V16A 3ZWKA 3DWFA 4ZTZB 1SWWA 5FDFA 1RPZA 2IPAB 4Q1VA 3D9QX 1P8JA 2QL7A 2GK3A 2VBIA 3RU9A 4U8HA 5IM4A 5SZHB 4HUJA 3F6RA 3L07A 4BPRA 4CQLA 4TMXA 5CXXA 4H4DA 3X44A 1JHAA 3O0TA 4IHJA 5TX7A 3T94A 1GZ3A 5I7OA 2QR2A 3DVQX 4L4XA 1F8FA 2FRDC 4YB8A 1HTTA 3TS1A 1Q1EA 5E4FA 1MRSA 2OV2A 4NFHA 3D8NA 4PHTA 5G02A 3GJSA 4BCCA 3MM4A 2F8TA 4DMCA 4ZVNA 4Q7MB 5FI0B 3HL4A 4M9ZA 5DM60 5C51B 4HR7A 1EUQA 2X8JA 2XRMA 4G1CA 4CHGA 3DHVA 4LK3A 4XGRA 3WB0A 4YMWA 2QAJA 5HFJA 3JQBC 4J7XA 2E5LB 1YB2A 4G8CA 3TGWA 4AWBA 3TW8A 5CB4A 1WXIA 5FA6A 3W2FA 4CL3A 1U8EA 4MRPA 1T6BY 4XWGA 1KMNA 1CUIA 2NUBA 2AHOA 4A15A 4RENA 2GXSA 4C6HA 4G8BA 4JJGA 2WA1A 1XJCA 3MIIA 1NXOA 1GGMA 5E8RA 3OPYA 3S2SA 1CRZA 5K0BA 1GYRA 4KH1A 1PLLA 3FUCA 3EQ2A 2YW2A 4NC9A 4REQA 5C3UA 1JE0A 2QZ9A 1I5EA 2ZT5A 1ZMOA 3I5AA 2GD6A 4ENVA 3NTUA 1EIWA 5A0VA 1F51E 3JYOA 3NOVA 4FYVA 4KXYA 2QD4A 4PRKA 3QSYA 3KHTA 1TX4B 3RG8A 1Z4LA 5EXXA 2AN4A 1IHDA 3BTSA 4CV1A 1RWPA 1UBCA 2G5TA 3G2OA 2YNMA 2VCYA 2BBTA 1OF1A 2JLCA 2AFHA 4WFQA 3AO0B 1AY0A 4GBGA 4BMVA 3KR1A 5LLSA 1E1DA 2J3IA 1QO9A 1NAIA 3FA2A 5KNCD 1XFAA 2D5LA 3HMQA 3PD1A 1LI7A 3L02A 4TKUB 3HI4A 2CVZA 1ZH0A 2ONCA 1OB5A 4INZA 2XTZA 3DULA 1II9A 4Q3CA 2G9UA 4QRDA 3AR3A 3SEAA 5BNIA 3L18A 4TYNA 4N3BA 4Q4CA 1FMLA 1H22A 4QAJA 1UFKA 2IH2A 2BGUA 2B7BA 2PWPA 4AZSA 4DCCA 1X87A 4WTOA 4QGSA 2XADA 1NRWA 4G4SO 4X0EA 2RGDA 3A1SA 3ZJ5A 3VZBA 5KJCA 4AF8A 4EJ6A 2EKDA 4HEA6 2Q9UA 4BZZA 1U2EA 3RYHB 4EJSA 4QARA 2OO5C 3OZTA 3U2QA 1K1EA 1CUUA 1I9GA 5AQEA 3UCXA 3OFJA 2JJ1A 1MX5A 5TT0A 1GQQA 2BSXA 4GPTA 1K6XA 3Q7SA 5FOXA 3TRJA 2WHEA 2BRUA 1WXGA 1C3OB 2HSJA 3MWLA 4AJOA 4BMSA 1MC1A 4B85A 4KQ1A 1XZDA 1BQEA 3SQNA 3THWA 5DLEA 4LVNA 1UBSB 2REQA 4QDTA 3SZMA 1MG0A 2FXVA 5IDWA 3L0IB 3KWFA 4L6IA 5BN1A 3ZNOA 5C46F 3QTBA 2R8YA 4R3NA 1L3BA 3ESDA 1W9HA 3DE6X 4JJIA 3VTFA 3RKSA 2JJ2D 5LNK1 5CT5A 4B7XA 5A3RA 1C4KA 1GPKA 4R9UC 1E9AA 3GMDA 2PS9A 4M86A 1YO6A 3IB3A 1G60A 1OAOA 2HBYA 3K9BA 5CFQA 1E4EB 3LQ2A 4R9VA 2YX1A 4HFMA 3HO8A 5AJZA 3NDBB 3LGSA 1EDZA 3PXAA 1OFGA 4E6EA 1DNPA 4QVIA 4JD5A 4A6PA 2ZJ4A 3V4VB 3HCAA 2XV1A 3I53A 2VNJA 1GQRA 3TGPA 4BGVA 2HSEA 3EB9A 4DSTA 1YRWA 3JATB 4MKZA 4W1SA 1PNRA 3PRJA 4J7AA 4LE1A 3BE6A 2OC4A 4L07A 4F8YA 4RA9B 4Q24A 3CUWA 5I45A 2H8KA 2OORA 4MA4A 1M0WA 1Z6TA 4P08A 1M2VA 1MKYA 4EI7A 3WLEA 1TM4E 5U9CA 1KOFA 1IQRA 2WWRA 2OM6A 2Z2IA 4P34A 1YK1A 1TF2A 2MINA 5DSXA 3TCXB 4QICA 1W4CA 2EBFX 2ONKA 3KD3A 4ZI3A 3HFGA 4A8TA 1ULSA 3T4XA 1W5TA 3G2QA 4BKPA 3SY8A 1IXYA 1I4EB 3R09A 1F8GA 5NLLA 1W0KD 4Z1OA 1L0BA 3JS5A 5EINA 1BWQA 1M2NA 4OTZA 4X1IB 5C31A 1OKKD 2RGCA 4DA9A 2OAQ1 3INNA 3NKLA 1PJAA 1O94C 1VHDA 2C04A 2Y76A 4XB6B 3GJ4A 4ZQFA 2VHUA 1V8DA 5E2BA 4JBIA 4OEHA 4Z99A 1ACLA 2NAPA 5JS8A 1A9XA 2XYRA 1DQZA 3FVTA 1H94A 1SD2A 2BSQA 3MTDA 2WAOA 4UEOA 4Q4JB 1CUXA 1R4NA 3HEBA 4OIFA 4UM7A 5T41A 2IE0A 1M54A 2NU6B 2QLBA 3PK0A 4KRXA 3TLJA 1L7VC 1VSQA 2DU8A 3DBRA 3DEFA 3K09C 1CYEA 1OGIA 3NXSA 2IU0A 3D5QA 4LZNA 4AULA 2HCFA 3QVTA 3DTVD 3DJYA 2UXBB 3ASYA 2BUCA 1X13A 1VMAA 4H4CA 4IJ5A 4M37A 3JQFA 2FWJA 3B2QA 1CUSA 5DTQA 4CM8B 4DZZA 4OH1A 3PQFA 4NMWA 5KNCA 5GP1A 2CLSA 1KS9A 4EPXA 1G38A 1K8XB 3LOQA 1XMXA 2X1HA 2Z9CA 3A9WA 4ON9A 3EPKA 4B9AA 3UHPA 1MHPA 1PX0A 1Z47A 1ONNA 1T3TA 1ZCJA 2JFHA 2NO9A 2O0MA 2PU7A 2WSBA 3GJTA 4CCSA 3BXGA 4YR9A 1UJ4A 3CVOA 5AI8A 1XKXA 4GKVA 3QEOA 4D3ZA 3OCWA 5DX0A 2YQZA 3IMKA 1Q15A 5FBRB 5KWSA 5JVDA 1VJRA 2PS1A 2V96A 2GKOA 2OFWA 1AIPA 1VECA 2QPLA 2VP2A 3OI7A 1FRFS 1I4WA 1QIMA 1YIOA 3NETA 5EMKA 3JQAA 2VQ6A 4RTNA 2FZLA 5KVVA 5FLKA 5IC5A 1CQXA 3P2YA 4R6XA 2XT9A 3UWMA 3W6OA 4NZMA 1ACMA 1D9XA 1OLSA 4JOQA 4CMHA 1LPMA 1Y9ZA 5MN5A 4K7JA 3D7KA 2VP5A 4ZV9A 1J90A 4JGGA 4AMUA 1GR0A 1P2SA 4R4JA 4UBNA 5A3JA 2ZUWA 5FBWB 3GMTA 2V55B 2OUIA 4MDYA 1PL6A 2PO5A 4LE2A 2ZIFA 3NGLA 1ABFA 2DQZA 3K1JA 4OHMA 3QG5A 4NEHB 2JJ2A 5FBVB 3QVVA 2Q5JA 5HQ3B 1YR9A 5ALLA 2J41A 3DYBA 1NSTA 1JILA 1R16A 2ZAMA 3CNEA 4W7SA 2EL7A 3DFKA 3UQZA 5FJIA 2GRAA 4IFEA 3LLCA 4HQRA 3RGGA 4PNHA 4C0SA 4R3WA 1T5OA 2MU1A 1KOLA 1QLHA 1D7AA 1U0EA 4KFTA 4J76A 5DI3A 1SVOA 1D7OA 1P4AA 3P8ZA 4NCHA 4P98A 2G7ZA 2QT0A 3IXQA 1FDWA 2RI6A 1EM8B 4MYSA 4U6QA 4I9FA 5ILGA 4JJFA 1XDDA 1HZZA 4LMRA 2JW5A 4C07A 1FS4A 1IH8A 2ZUBA 3CV3A 3N9IA 4K26A 4W9NA 1FW6A 3H5IA 3P0HA 1FFXA 1TF5A 3ZNQA 1ML4A 2HPZA 4URXR 3O8RA 3E7WA 1W30A 2VUSA 3UJHA 3G9UA 1BVRA 1T2EA 1X77A 2CMFA 4PEVA 4PLZA 3HXQA 4DXHA 1F5NA 1P80A 1CSEE 1UPCA 2ZTUA 4KN8A 2CFCA 4P1ZA 4H7IA 5DYWA 1MHTA 4FE7A 1V96A 3QU7A 3DHYA 4FYMA 1JSXA 1U31A 1SUFA 4LHVA 3LXMA 4YDSA 4N82A 4HNTA 4GMKA 4JVMA 1W0KA 1EFCA 4WXMA 2FEKA 5BVHA 2K7FA 1WPQA 1GAWA 1OKKA 4O3MA 3GEBA 1GTJ1 4UHEA 2HA3A 4WHMA 4BDTA 2HEGA 3H1GA 1NQOA 5A3VA 1NWHA 1DP4A 5ALNA 1XXHA 1ECLA 1Z0DA 1M8PA 2CMKA 1YZTA 1FEZA 3TTYA 3GQVA 4UULA 1T9GS 4RDCA 4Q21A 2SICE 5H3CA 2PZBA 1NXXA 3R8XA 3F5FA 5TE9A 2KMLA 2FOLA 1LDMA 3L6BA 4E3WA 1NKSA 3RWBA 1DTSA 1JFTA 1XD2B 4MQFB 3FGPA 1OU4A 4Q7EA 1HI9A 3UJNA 1Q19A 1UPFA 3GVHA 2E9SA 3NVDA 2VNIA 4DRXB 3ZWOA 3KRTA 4PYKA 1X7XA 2FEXA 1P9WA 4HFNA 2GAOA 3DTVA 3UPUA 3FNGA 4LGVA 4EGFA 4PQGA 3VGJA 5KNBH 1OYOA 4RPHA 4U8GA 4WSOA 1CUCA 1F3OA 3L9WA 4OFBA 5FQOA 2D5AA 4WGGA 5TXGA 2QTGA 4TYWA 3EXHC 4MAFA 2HLDD 3W6UA 2B83A 2P2GA 4I9UA 3U9LA 1ACJA 3EIWA 3RIYA 3VH3A 2CL5A 2XNDD 2YJZA 4LXTA 4BE4A 3E4CA 1GD1O 4O4IF 1KAGA 2ZRAA 1G4HA 4JEUA 3OCZA 4C0BA 2HK6A 3NDIA 4F45A 3PDCA 5HJEA 1I24A 1TYCA 4RKYA 5J23A 3OECA 2IX9A 4TQAA 5AVXA 2A7QA 3GJ7A 3OFVA 5EXEA 1A5ZA 3WL8A 4BNKA 4IQ4A 3ZVMA 1U04A 4C4YA 4D44A 1M75A 1YOVB 2YXEA 2W6PA 1EWTA 1VMKA 2QD5A 1MTZA 1M34E 2DPGA 4FYKA 4JJ6A 1VKJA 3MUOA 5I9BA 3B13B 4BKUA 3HJFA 5IP5A 2QSUA 2PSSA 1JQ3A 2CHEA 3KLBA 3KLPX 4Q7JB 5DX1A 4YLYA 2QYTA 3KSDO 4L8YA 1EP3B 3ORRA 4CLHA 1ZGAA 4ZJPA 3Q8LA 1WCYA 4QAQA 4IIFA 4MWDA 5CRIA 4Q9HA 1LS6A 1SCQA 4XQCA 1DBPA 1N2GA 1QE3A 4ZGWA 4R8MA 2WFLB 4GXRA 1OTYA 1WUIS 3ICPA 1UPTA 3FFBA 3NONA 1UMDB 1FK8A 2HDHA 1N9KA 2PQ6A 1EK1A 3SNKA 4D92A 4CR6A 2DWUA 1GL3A 3ZE7A 3AP2A 1MAHA 4TVBA 3MUNA 4QM6A 1ZQ9A 4K46A 4O5OA 4BMPB 4MR7A 5E95A 4HV4A 3T7DA 2ZYAA 3DV2A 2IPOA 3ZCRA 3ICEA 3FWZA 1C7EA 3HP7A 2CDCA 4OA8A 1EX9A 1HOXA 3BFXA 5FBZA 1HX7A 1CUVA 2NVBA 5ELMA 3KB1A 5EWMA 3W1VA 4BXOB 3TSYA 4O4JA 1AE1A 1CE8B 2AMVA 4PIPA 4BEBA 4D0RA 4EELA 4ZYUA 3SSMA 4CKWA 2OK7A 3GVXA 1HTWA 3GG2A 4QHSA 5F5NA 4EK9A 3ZDZB 2ZSAA 1B6GA 1SHLA 3AUAA 3FTDA 4AJKA 1TA4A 3R5TA 5FQNA 6ADHA 3NVAA 2FR8C 3SICE 1TJ3A 1RBQA 2AZMA 3NCTA 3NV7A 3KV1A 3EAQA 1MGPA 1PG5A 2FW7A 4G1UC 4I19A 4KACA 4NKRA 3TUZC 4YEDA 3I61A 4MLPA 5JASA 2BR3A 4DEYA 1V7ZA 1FC0A 5L40A 3SM3A 2AYZA 3EXHB 4CLOA 1QKJA 3PEYA 3WDLA 1EM6A 2CMGA 2G28A 1RC0A 4C0LA 3QU5A 4MYTA 3OX2A 2IUYA 5FWNA 4DA7A 5EHXA 3U0VA 3P4XA 4KLCA 1BJRE 4IR7A 5A2GA 3QLUC 1RI5A 3K9HA 3RVJA 1KOGA 2C7BA 2I2FA 2VPIA 3N5CA 3UAOA 5A06A 4RTOA 1DFHA 3CEJA 4B7ZA 2EW8A 3ROPA 3GNQA 3K5WA 2B5WA 3AW8A 4V1CA 4TTTS 3CNHA 3BZBA 2J9XB 1PG0A 3EVDA 3F7OA 3FGZA 3ORYA 4NNOA 1PSZA 1WABA 4WZAA 3WOVA 3WLPA 1Z0FA 3DVAB 4EF4A 1DKRA 1U99A 3LPAA 3R7FA 1AS3A 1GAEO 2XB8A 4PV7A 5IJ0A 5JSUA 4X44A 2Z0MA 3W04A 4H1VA 3AP3A 2AG5A 2YTZA 1J49A 2A0KA 4Z4EA 3ER8A 3S1SA 4LSZA 2C9ZA 4JH0A 2Z8ZA 1U0FA 3G6KA 5CFMA 4QQFA 4WASA 1DCKA 4BY9E 1MAVA 8GPBA 3GNSA 3E7PA 3H0CA 3K5HA 2GYYA 1LKZA 2HLDA 3CLRD 4LNUA 4UEJA 2J9FB 2XCIA 3PNMA 4W9MC 3AB7A 3K05A 1E4OA 5HKLA 3OZGA 3I8SA 1KI2A 2XNDA 1P18A 3KEGA 5ENDA 1U1GA 3A1DA 1ODSA 2YJGA 1PU2A 3HCBA 3RAFC 2BPOA 1XO1A 3BB3A 3EE6A 2VJMB 3ILHA 3I1JA 4K87A 5C3MA 2OM2A 2R97A 4LXQA 1QPZA 1I3NA 1IZYA 3NUQA 1ISIA 1RYEA 1A9SA 4O4IB 4U39A 4DS3A 4ZI7A 2DT8A 4LCEA 2CBZA 4HDCA 2E87A 4NESA 2WWHA 3IVCA 1AZWA 4R9SA 5BXQC 1M0TA 3DDNA 3I9FA 4YR7A 4FZJA 2V6BA 4DADA 4JC4A 4HUQA 4IZIA 3CZPA 3PFBA 4WLNA 4E2ZA 3D6NB 3KDAA 4BMYA 1SQSA 1YMVA 1ZMTA 1IY8A 4FYXA 4Y2RA 1I0IA 2I66A 3LP6A 3CZ5A 3DZFA 4XPZA 5CNMA 2HA6A 2ZBPA 4K9QA 5DBHX 3TKYA 4HGYA 1ULZA 1LD3A 4RZUA 4X00A 1LWOA 1NUSA 3GGOA 4TM8A 5HDBB 1C1DB 1QM5A 3CLSD 1NZFA 2PKQP 3DJFA 4HI0E 4LJSA 4ND1A 3DV9A 3G9QA 4NNJA 4Q3KA 2CLOB 4X85A 1IM8A 3H9EO 5FYDA 3T1TA 1KI8A 3T5PA 4PZYA 13PKA 3STUA 2ZUFA 1T0JB 2O7VA 2D2IA 4YHHB 3PQCA 3LPNA 2GAIA 2ZG6A 4K2HA 4OQQA 5F3WB 3F46A 1AUOA 3IDZA 4FB5A 1A7AA 1I2ZA 1T2FA 1ZXXA 3ET5A 5BW5A 1RJ9A 4WGFA 4NYMR 2GEBA 1MXFA 2NU9B 4Z54A 5DRTA 3BIWA 5FT9A 1LW6E 2C4UA 2WJHA 3DP9A 1V8OA 4O2AF 3M6WA 3RNOA 3UK7A 3DCNA 1GL6A 3CLUC 1FJHA 4G85A 2B6NA 2YXLA 3F6YA 4OV6B 4E33A 4XWKA 2R6CA 1YVDA 3AEQB 3GB9A 1I6KA 4E2WA 1RACA 1NN5A 2IIBA 1XOIA 2X1MA 1QK4A 2AB0A 3MTJA 1XJ0A 2Y1CA 2R3SA 3X1MA 1AS2A 1NJ8A 1VCIA 1HYQA 1U0TA 2EKLA 3QFRA 1SHZA 4NJOA 2JATA 1IC6A 5IXYA 3TTWA 2BMEA 2XUOA 2ZB2A 3CMMA 4HUTA 1DBRA 3ESRA 3G5UA 4IQFA 1E5VA 2OGUA 1BOOA 3A70A 3MGBA 2ATEA 4UAGA 1QGUB 3WRVA 4V3BA 4BNGA 3T3NA 3TQOA 1KXJA 2HMVA 2KM1A 1B14A 2QM7A 1JNXX 3TOZA 1EZ1A 3U44B 2V59A 2YZMA 2OWDA 1KZYC 3AY3A 3H4VA 3MCUA 3SS7X 4G5RA 2AN9A 3DZGA 3FHJA 3VVLA 3MJDA 5CIQA 1Q57A 2GBFA 1RM3A 3CT6A 2KLBA 4JN6B 2OMKA 3LO8A 3RBAA 2D13A 1AXGA 4HWOA 4H7FA 2GCNA 1CZRA 3K2IA 1IONA 1OWOA 2YZKA 5KOIA 1NI4A 1YZVA 2XVYA 1YZKA 1ZCBA 4WVFA 3MCAA 2D3TA 1OLXA 2ZSUA 4KAJA 1QDLB 2FPIA 3B1WA 3CF0A 5F52A 4FNAA 4NF2A 4CF5A 4EG5A 3DQZA 2H1LA 2NVUB 3G85A 4UDOA 3DA8A 3IR5A 3ND9A 3VKHA 1JG1A 2YCLA 2AZTA 4OHVA 2JFVA 4IWYA 4OCZA 3ZLVA 4F96A 9GPBA 2ZYRA 2VRBA 2YFHA 5ER6A 1O4WA 1II8A 3QLTA 2IYYA 2P79A 3C1UA 2GLXA 4DLLA 3GPLA 2A67A 1LA2A 2J33A 3AR9A 3FOAA 2X2EA 3H1PA 2V6GA 3W5VA 3ZE0B 4BGIA 4L73A 3W34A 2XQIA 5T4FA 1N5RA 1SVWA 3KELA 5CFLA 2BKEA 2GBGA 5FHRA 4Y7CA 1EX6A 1WDMA 1LJUA 4A92A 4M1OA 2BGLA 1OYYA 2ZYUX 3CRW1 5BN5B 1RPNA 3FAKA 2OCBA 3KKMA 3UAWA 1A7KA 3GK3A 4F4IA 3BFKA 2OCGA 2VBGA 3CUVA 3Q8WA 2A1UB 4BYGA 4V0LA 1Z5WA 4XD7A 1VBNA 3UWKA 3RVRA 4EO7A 3C3BA 5IKXA 4CEIA 2B1QA 4R40A 1IQ0A 3RFVA 1S1CA 4A5OA 4FOLA 1PDVA 4GI7A 1QHXA 1V11A 1NZDA 2BFFB 3H8WA 3BD7A 1LPSA 1EVEA 3L06A 1B23P 2YV2A 3W8FA 4TXNA 3T5MA 4DWWA 1RXCA 2VATA 3HZZA 4X66B 3IP3A 4BB6A 4HRXA 1OIXA 1UXHA 1X14A 4HSEA 4MS3A 4HVTA 2Y2VA 2OBFA 2QPAA 3SKYA 4DSNA 1U5BA 3GEPA 1D2AA 1DIAA 4P6VF 3ZHTA 2DUUA 1OIWA 1SUBA 2FTKE 3WHPA 1SZCA 2FVYA 3H4IA 4NARA 4GH5A 4QU8A 1E7SA 4C6SA 4BQFA 1PZGA 4BAZA 1T2UA 4IRUB 2IUSA 2FMUA 3PKJA 2O1SA 1W8DA 4EVQA 5KHOC 4RVGA 2ZROA 1EK0A 1EUYA 2JGAA 4PHCA 1QTIA 1E8MA 2O1XA 1H93A 3G0IA 3VPHA 3WGLA 4EBBA 4F1JA 2FW0A 2H18A 3GI1A 1RQLA 4GL2A 2GX6A 1I3CA 2V5AA 1T9BA 3C24A 4XVRA 3I6BA 2B4AA 1G8MA 1C0LA 2AC2A 3QNMA 2NV6A 4OBEA 1M0SA 4CKBB 1C8VB 4V0RA 4PYIA 4QSHA 2XSZD 3BE5A 4PYMA 2I3DA 2QPOA 1IPHA 2TMYA 4JLAA 1DX6A 1KO7A 2CY0A 4O2AB 3H5OA 4PPNA 3HGTA 3T5AA 2D5BA 2VAPA 2E89A 3WNZA 3W2EA 5CX1B 2RB5A 1KK0A 1CRWG 2F00A 2A9JA 1FDVA 5EN4A 3PDIB 1IYZA 3RBZA 2H4FA 1Q12A 2IXFA 4Y6LA 4QWMA 3NTOA 4PSDA 1W96A 2XUKA 3QXJA 2XUIA 1KMQA 4NOLA 1EVLA 2JA1A 4LRWA 3BXFA 1CEXA 4QDJA 4C6TA 4UOEA 4O2LA 1BKDR 1XEAA 3F8SA 2OYRA 4A82A 3B38A 1NPTO 2R87A 4H18A 1HLGA 1MA0A 4YAUA 1FTQA 4GX2A 5ULLA 2BYTA 1QHGA 2R25B 3GJYA 5H9WA 2YV3A 2D0PB 2ZW9A 3D8TA 3LMKA 3ZE6A 1B93A 2BD0A 1PVOA 1Z06A 3JYQA 4CIVA 4CR7A 1XALA 3KJQA 4M3NA 4J1SA 2XA2A 1GSAA 3N28A 1AURA 1C7IA 4JQSA 4DUGD 1P61B 2YRXA 3M2PA 4N5MA 1QIDA 1IWBB 3C5WP 3LZ6A 1P2VA 3AG6A 1TIBA 2C3OA 2Q9BA 1ZM9A 1ZX1A 3KJIA 4D0NA 5KSZA 2DKFA 3LD9A 3OURA 2VYFA 3B6EA 2REOA 5JADA 2CZGA 3C3DA 4FYWA 4IP0A 1KAMA 4EB8A 1WP4A 4FGKA 4TL6A 2C97A 3FMVA 4IOJA 1ML3A 2ORVA 2F4NA 2I8CA 1Z0KA 1UOEA 2AFHE 2XA9A 4N5IX 2C99A 2CWWA 1LX7A 4L28A 5CLHA 5HCIA 5ALVA 1PS0A 3I9JA 3L1IA 2WNSA 1CW2B 3BICA 4G0OA 3TWOA 1IOWA 5C37A 5HKBA 4DMHA 3GZNB 2Y92A 3PUIA 4HRYA 3GRPA 9ABPA 2ODTX 3ZHXA 1ZJ5A 3DDHA 1USVA 3SC4A 2CKMA 5EQFA 1EFHA 2C77A 2SECE 1K8ZB 2VWPA 3KKKA 3UOWA 3N2KB 3DE4X 4OXRA 4RD0A 5EHZA 1JDPA 1O9GA 1FU4A 1W73A 2OY0A 2ADOA 2R8EA 1Z2DA 2J3QA 1WHTA 1R0ZA 1ZKDA 3GUYA 3HJCA 4H35A 3C1AA 3DTTA 2RARA 5J40A 1A3CA 4A8JC 3P2JA 5EKDA 1MV5A 3QLVA 3OOYA 3EVBA 4H7PA 4RK1A 3E9DA 1KBQA 1L7MA 2X0KA 2O2YA 1NY6A 4QRIA 4Z3DA 1KNXA 4N8DA 1II0A 1NN0A 2FRVA 5LCXA 1MMFB 1NYRA 3DV0B 4QEDA 3IAAA 5THXA 5IEJA 3GEDA 3OD1A 2RB4A 3QOFA 2V4MA 3BD6A 4D3XA 2XOKD 4NCNA 4KJXA 4O1HA 4X1OA 3KT6A 3O4RA 2ORED 2GLTA 2GT1A 3CF4G 3THYA 4UW9A 3HZRA 1XX6A 4N5LA 4EFDA 5E9AA 2Y1FA 1V16B 1JXAA 1WB6A 4PGHA 4L0MA 4ILEA 2EFHB 5AK0A 3USES 5A7FA 2RGGA 2OUKA 4LGCA 1U3WA 3DDOA 4QLBA 1CULC 1CQJB 1ZN7A 3B3AA 4FI3F 2IS2A 1ZCAA 1PL0A 3FPFA 3VDNB 2JLYA 1H2WA 1X74A 2PD4A 4QBFA 3ET4A 3ZPXA 4A27A 4AFNA 5KYYA 2QVBA 2CN1A 1RZUA 4ZRDA 2R65A 3FUUA 4GZMA 4CBVA 4E2FA 1VBFA 2C5SA 4KHZA 1KMHA 2XSZA 4EMTA 3K0BA 3SP1A 4II2A 1FTGA 4JC5A 5TQVA 2OHVA 2WA2A 3ZHOA 4EZBA 4YAWA 3SS8A 1N5IA 3HNPA 5SY4A 2X8JB 4EEKA 2GA8A 1D6MA 3EXFA 1CRLA 2H2IA 4NZPA 2BTQB 4PC7A 4FFWA 3DG9A 4RVHA 4TS1A 1UZAA 2WWTA 4XYGA 4CMEC 10MHA 4QJIA 5ITZB 3BQNB 4K8OA 5HX7A 3M81A 3TW8B 5K4GA 2PZ8A 3WLJA 2QB5A 4MWBA 4BUZA 3HBAA 1OB2A 2GCEA 2YN0A 2VBFA 4ACAA 3LCJA 2GUWA 2A57A 4IKOA 2JHGA 2P4EA 5E2AA 1OY1A 2QJOA 4H27A 2LZ0A 3ANNA 4TKLA 4FWIB 3BWVA 4DLUA 1L7PA 1T2NA 2HA2A 4B6GA 3IXMA 3B48A 4QBIA 3QVWA 1TU4A 1DTEA 1QDEA 2IELA 4REQB 1BE1A 1Z34A 2Q6KA 3NHJA 4FDUA 1G3UA 3GRAA 4MROA 1VP9A 2B20A 3KOUA 3OOWA 1TZCA 1UBEA 4N39A 4DMFA 4DUGA 4MPRA 3NTXA 1Q92A 2OWEA 5CCXA 4IV8A 4EM6A 4JB8A 5GADl 3GT7A 3WGKA 4MB0A 4GSLA 1P39A 1EE1A 3RLIA 1UWVA 4B47A 3PLNA 4A8JB 1UBRS 1SUEA 3GX1A 3WLNA 2E5FA 3BA6A 3OQIA 1Q91A 3UK2A 5HNKA 4PAMA 4XIYA 4JOCA 4CCWA 2QGNA 2WKPA 4POAA 5IF9A 4U7HA 2JLRA 1ISRA 1PR4A 5EIFA 2W71A 2VPXA 3AY0A 4IDOA 4E70A 1LV7A 5EZ6B 3FMGA 4ZO6A 3TLCA 3OU2A 2MSEB 2PLAA 1MQAA 4Q6WA 4OD0A 4RW0A 1QB8A 4TOIA 2P41A 2XT6A 4TYPA 1O0BA 1NDHA 1Z7WA 4FJ1A 2HU5A 1SEPA 1K75A 2XZDA 3T7RA 1JFSA 1C0KA 4G9GA 5BMVA 5KYKA 1J4AA 1ZN8A 3HCNA 3HJTA 5ALWA 3PVCA 4KSCA 2IU4A 4FJ2A 4QJ4A 2FLKA 1DAPA 5CEJA 3AGPA 2DR0A 2WW8A 1EB8A 3DO6A 3QIAA 5SY6A 1PUJA 2VLIA 4EJSB 4RCYA 5LBIA 3L46A 4BE7B 3A10A 4GLJA 3BWDD 1BEUB 1YRLA 2COUA 1PL8A 3QEJA 3LCMA 4H6XA 2AJBA 3RGWS 2RGNA 4BO3A 1KEEA 1UXIA 1OWMA 2HDNB 4Y9SA 2XQVA 1IEQA 4D9BA 1T26A 4JGBA 3ACCA 4ZVUA 4LRUA 1PTJA 2AQIA 4ZFNA 4WDRA 5KOHA 2IOHA 1QLWA 2IP2A 5I7SA 1I33A 1X92A 3G3EA 1W5AA 3HPRA 3TLBA 3C48A 2XOKA 4ZOLA 1T8RA 3GEMA 5K3EA 1JFLA 5L3VA 1YK0A 4CRWB 1ZRHA 3UIEA 2R5FA 3EXEA 3OM8A 5IDVA 2SKEA 1A71A 4A2PA 1HDCA 4Q4HA 3TAXA 5EJGA 3PPXA 2ODNA 3NGMA 3RHTA 2GERA 3R0IA 1NP6A 4UVIA 4JI5B 2G1JA 5JDCC 1S0UA 2Z95A 4HNAB 1IBRA 1KFKB 4TT8A 1NU8A 3CNOA 3TRFA 2VJQA 3GCXA 3TQHA 4OGKA 5CG2A 4E5PA 2O9JA 5E9QA 3ZW7A 1OZAA 1YB5A 4KE7A 1GRQA 1ZU4A 3P2EA 4ZO9A 3H8SA 5DE3A 1NMXA 5E9WA 3SQWA 1BXKA 5D85A 1NMQA 1P9OA 2G08A 5E3IA 2YYZA 3DBLB 4QTTB 2O7RA 3X1DA 2QMYA 3L8FA 3LCUA 2V45A 1CKEA 4HAVA 5GOZA 1CUWA 5I9MA 1WEHA 1RP1A 4UTNA 3FUWA 4TMFA 2W2NA 1QGYA 1GGHA 2PV0A 3U60B 3TW4A 4XX0A 2C78A 2IZ5A 4PYLA 3DE0X 4FBGA 3SJAA 2BFEA 2FWRA 2ZUEA 4RNDB 3BF8A 3KXIA 5EXSA 2R9VA 2P35A 1T2VA 1T2CA 4O2RA 3K9FC 3GOQA 3JQDA 1F2TA 1Y1KE 2P0YA 4BWGA 5KIAA 1WA5A 1DC7A 2ZJ1A 3H42B 3SXUB 1V71A 2Q0HA 3HUUA 1AMUA 3ID6C 1A8PA 2CFTA 2HKIA 4OYLA 4QTXA 4IXDA 4GPD1 3DNFA 4QG3A 5E7MA 2R0QC 5CURA 3SE0A 5B3AA 2F6RA 4I1PA 5CYPA 2ORWA 2VPWA 4K03A 2YRFA 2LCIA 3ICOA 3FG9A 2XRZA 1VLZA 1OYWA 2BE9A 1R4NB 1RKQA 1P1JA 2CUZA 1EFAA 2J4CA 3GZ4A 1IFXA 1B26A 1V3QE 2N3ZA 1W85B 1XXHE 1Y3DE 2GF9A 3IDQA 4P92A 4ZT5A 3EIUA 5I01A 3ONVA 3C3WA 5BWNA 3BKXA 1ADYA 3PXGA 3H2BA 4YRLA 5C7OO 2BH9A 1YT5A 5ADVA 3HUFA 3GROA 1WCIB 1U0OC 5D3MA 4EYGA 3TSZA 3BUSA 4ZO8A 1F2VA 5JYCA 3PGVA 1MH9A 2X9QA 3OUUA 2V97A 1W19A 2W6ID 3DAHA 5DBGA 1LK7A 2D4HA 4AJ4A 4IJUA 1LSJA 1E2EA 3RRYA 2V58A 1KERA 1Z4NA 1GGKA 1ECCA 1YC2A 2QUJA 1N5OX 4RD2A 5J4HA 2IEIA 1E3WB 4AD8A 5LLDA 3C6QA 2O23A 4W99A 3RASA 1ZN9A 4C88A 2Q4OA 3DWEX 4REOA 1BCRA 4YRMA 5LQRA 3KPWA 3AY6A 1TA9A 4FFBA 1ELOA 1GNSA 2F17A 2QX8A 4QYXA 3RB8A 4BUJA 4CMCA 1FFBA 3IGFA 3E05A 4EHNA 2C3PA 1V6CA 1L4UA 4LV6A 3JW8A 4S1WA 5LZ9A 3N2GB 4S1OA 4PO1A 1ONSA 1OV4A 2B8JA 3HN6A 4PGGA 3IP8A 4TRRA 3JQAB 5U4XA 3E9YA 3R5JA 2WWYA 1CUAA 4KWEA 3KFXA 1PT5A 3SJ7A 1NUAA 4YJHB 4KR3A 2E4WA 1W29A 3B1YA 3GNTA 1E0DA 3A6EA 1F9EA 2XPCA 1SD5A 4NG5A 3ZS8A 5J4LA 2WD9A 2A5GA 2J6HA 3HRIA 4PYJA 4OMUA 1NMEA 3JTEA 4R8SA 3E0QA 3IC5A 5FKJA 5MHTA 1LI5A 4LF7B 2EW2A 3LW7A 3RLFA 1NNI1 1HSOA 2BAGA 4CM6A 1VI6A 1E7YA 2FK8A 4W7HA 1Q2XA 2M6RA 4KEAA 1F6DA 1Z2AA 2FN3A 1CX9B 2D0DA 1ORVA 4JEHA 4Y2XA 1MN6A 4C0KA 3QPBA 5LPNA 5CCBA 4F7DA 1GGVA 1HT2E 2HJSA 3QVXA 1JJFA 5EYPA 3GFRA 3SBXA 3HU2A 5F21A 4GMDA 3ZZUA 4F7WA 2I3AA 1KFEB 3ASVA 3OOHA 3DBVO 2NNWB 2J85A 4L1KA 4YRCA 2AH5A 1CUFA 3TTXA 2ZIZA 1EUDB 3G8AA 4KFUA 3SR3A 3WMWA 4GX1A 3STVA 4BMCA 5DI3B 4ZAFA 3MWDB 3V6MA 1EWYA 2PVSA 5AKEA 4Q39A 3HXMA 1I1OA 1W6RA 2VOEA 3HFRA 2IYFA 1WB9A 4OGGA 5EJ6A 2BVNA 2EDAA 2HI0A 4KDRA 1ZITA 2DUMA 3AJAA 1Z15A 4D4KA 1YMQA 1FFXB 1N33B 2XYPA 1EFUA 4QU5A 2AMLA 3L0OA 5E6SA 2CBGA 1GUFA 2CXUA 3GCDA 4KK3A 2A6PA 1H66A 2I2BA 1OJ7A 1UAGA 4MW6A 4X71A 3V8NA 1IHXA 3I0MA 4B3IA 3HY3A 1T36A 1QS0B 2X4LA 2IDMA 2YHAA 3R7DA 5JZVA 4H3KB 4ND2A 2IUTA 3P9XA 1CZKA 1S2GA 7AT1A 5L45A 3UG6A 4Q48A 3NHBA 3K8ZA 1JKJB 3WTCA 4RDIA 2KHZA 4B33A 5DT2A 3RODA 5LQCA 4I55F 4MB2A 2R85A 1QXSA 5BSRA 1QQAA 4BO6A 3LUFA 1S3IA 1PZMA 1N6KA 3GGSA 1YQEA 1YDEA 2BMVA 2NXEA 3HSKA 3FOBA 3K0AA 3PWTA 4JLDA 1YQTA 3RQIA 1IBKB 3PB3A 3PGA1 3T41A 2CJWA 3DE7X 3IR7A 5EJ4A 5EJ5A 1VLVA 3ND8A 4RS3A 2TECE 2EDCA 5DMXA 5T8KC 3IXLA 5EIXA 3SHVA 5JTUA 1JEYA 3X1ZA 3ZXYA 1CT9A 1VHTA 2ORIA 2WWVD 2XVXA 2Q99A 4F8EA 4AU1A 3A8TA 4NAHA 5JH7F 4WZAE 3QKRA 3CX7A 1V7QA 4RZIA 5KO2A 2PLFA 4F5EA 4ZJUA 3IMCA 3A6ZA 821PA 3EJWA 1QOPB 5L3QA 4BFCA 2W6IA 1T3LA 1NJSA 3EBLA 3H2HA 3IJPA 1OT3A 1NNEA 1L4FA 2E0IA 1ORDA 3ZBTA 5ES3A 5AVRA 2JCXA 2PUGA 1WLYA 4OXNA 2JFBA 3H13A 1BXZA 3IYLW 1DC6A 4I4CA 3KZVA 2CB9A 3TLGA 5INTA 2BUBA 2GPTA 3EGVA 1KMCA 5EI5A 2GZHA 1VYVA 1RPJA 4US0R 3KL2A 5ALRA 2GK7A 4UE3S 1ODJA 5A71A 4F5ZA 4MKFA 3NBKA 4XKJA 2XBUA 1JAIA 2UZAA 4R1QA 3HYSA 5IDQA 7YASA 3UJAA 3GLGA 4CQNA 4BVGA 1BTOA 3KHUA 1JGTA 4Z0TA 2C31A 4DCOA 1X94A 4QM7A 1TIPA 1G5HA 3WLOA 3OE1A 4QSMA 2BH2A 1SCDA 3CTMA 1ICEA 3OFSA 3CCFA 5CVUA 2CE2X 3RIHA 1C9KA 4BEWA 1FP2A 3VPCA 1FS5A 4FGLA 4MWCA 5DTMA 3ZVNA 4IL5A 1QV7A 1KZ6A 3UJPA 4DMUB 4EVIA 3OIGA 2NPFA 4ZMBA 1IVSA 1VCOA 4MW0A 3PTAA 5AOBA 5A9SB 4TTJA 1YQ9A 4YGYA 4FD2A 2MSKA 2P8JA 3LFHA 1IRIA 3F9CA 4BFVA 5J43A 3E22A 1T4CA 2YC4C 3OLWA 2C4KA 2GO1A 2CD7A 2Y0BA 4LUCA 5EHNA 1CDZA 2HAEA 2X8WA 5JAHA 1AMNA 3MNFA 1GZ5A 1ZO8A 3IUBA 3LI2A 4J6FA 1V37A 4HB4A 3PPVA 3SOZA 1Y1SA 1US8B 2X6RA 3PE4A 4HSGA 3A1FA 3ZU3A 2BM9A 3AB8A 4NRDA 2W48A 2LKCA 1OZGA 2QLNA 3B3GA 3C4JA 4RPKA 1RKVA 4C87A 3AJEA 2VVTA 1B0AA 1X8LA 1YZLA 2C0PA 4G2TA 4H6VA 5DYYA 3S0JA 4H9GA 4UM8B 1EGVB 1EG7A 2VEOA 3EXAA 3H2JA 4WI1A 1ZM7A 4LQLA 1M1UA 5EWMB 1QYWA 3LC1O 3EQ6A 1E2LA 4FHFA 3CU5A 3ZHQA 1QPBA 4RVOA 5JJCA 3CLHA 5EIHA 4Q02A 2DUNA 2W0MA 8ABPA 4GMHA 2C2HA 4HHEA 1TB4A 1MIHA 1URPA 1XRMA 1XDUA 2QJRA 5DNDA 5BP7A 5IJWA 3H99A