2PD4A

Crystal structure of the helicobacter pylori enoyl-acyl carrier protein reductase in complex with hydroxydiphenyl ether compounds, triclosan and diclosan
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
274
structure length
274
Chain Sequence
GFLKGKKGLIVGVANNKSIAYGIAQSCFNQGATLAFTYLNESLEKRVRPIAQELNSPYVYELDVSKEEHFKSLYNSVKKDLGSLDFIVHSVAFAPKEALEGSLLETSKSAFNTAMEISVYSLIELTNTLKPLLNNGASVLTLSYLGSTKYMAHYNVMGLAKAALESAVRYLAVDLGKHHIRVNALSAGPIRTLASSGIADFRMILKWNEINAPLRKNVSLEEVGNAGMYLLSSLSSGVSGEVHFVDAGYHVMGMGAVEEKDNKATLLWDLHKEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Helicobacter pylori enoyl-acyl carrier protein reductase in complex with hydroxydiphenyl ether compounds, triclosan and diclosan
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Oxidoreductase
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
total genus 91
structure length 274
sequence length 274
chains with identical sequence B, C, D
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2007-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2pd4A00
3QVWA 2AG5A 1N1EA 3ENKA 3L77A 4H7PA 1RYEA 1TI7A 5C7IO 3BZUA 1EUZA 3DAFA 4CR6A 1C14A 4FB5A 1VL8A 3GEGA 3PHGA 1E3WB 3KSUA 1RKXA 2POQX 3PDJA 4HWKA 4GAEA 3TL2A 3VPFA 3S2IA 1YL7A 2FWMX 4XWYA 4ESOA 2DKNA 4NZ9A 5G4KA 4OKNA 2X9GA 2D4AA 3K92A 2X8LA 3GDGA 4EW6A 1MB4A 3WSVA 1LTHR 5DCWA 4YJFA 1EEHA 3F1LA 2X58A 4MP6A 3GPDG 1I33A 1WDKA 4O59O 4XZ3A 4YAJA 3IL2A 3I9OA 3PYMA 4A26A 2PKQP 3FSRA 3ZHXA 4DYVA 4XQGA 2C0CA 1WVGA 1M6WA 1PR9A 1U1IA 1LQUA 4DQUA 2DC1A 3Q6IA 4UREA 1ZVMA 2EGHA 3X2FA 1SB9A 3C24A 1YE3A 1KC1A 1C3VA 4XGKA 5ES3A 1NVMB 2JCYA 1WLYA 1MC4A 3LF2A 4FOOA 1I5RA 1X14A 2DAPA 2PGDA 3UICA 2VRCD 3GMSA 3O38A 4ND5A 3ZWPA 4CL3A 4J4HA 4B7UA 5G0WA 4EYEA 1HYGA 1LSUA 2O3SA 4IDGA 4HFJA 1YQDA 1YL5A 2IYOA 1YRLA 4DXHA 4E32A 4TVOA 3WYBA 4O0LA 4HNGA 3QY9A 4MIEA 2CUKA 2BI8A 2J5QA 4IDFA 3M6IA 1R6DA 4LGVA 2I3GA 3DHNA 2BGLA 1I3LA 2IXBA 2Y1FA 4J1QA 4XQEA 5BR7A 4MVJH 4WNIA 4BGVA 1ENZA 4GGPA 1ADGA 4J1TA 2VOEA 3TL3A 3HN2A 3LYLA 2PH5A 2AEJA 1QLJA 1GU7A 3SJ7A 4R1UA 3KYDA 3G1UA 1E5LA 1UDCA 3WJAA 4BKPA 4CM6A 4EJ0A 4E5YA 1PS9A 3KYBA 3AUSA 1P45A 4FFPA 1PJBA 1UXJA 3JYLA 2AQ8A 1P0FA 1EUDA 1YBMA 1OBFO 2GASA 2ZTMA 1EDZA 2I76A 4RPGA 2CDCA 1B7GO 2NUAA 5IG2A 3K9QO 4WE3A 1DO8A 2ZQYA 4L9RA 3VZPA 2B36A 1T2AA 2Q2VA 4BKOA 4BL5A 3LLVA 2Q1SA 3GZ4A 5A3JA 1LBEA 2PH3A 1BDMA 4U6SA 1F8FA 3ZV3A 4QO7A 3F3SA 3Q2IA 4GVXA 4FC7A 1U3UA 4P22A 4ZRMA 1PL8A 1SAYA 4MVJI 5B37A 1LDYA 3SC6A 2QW8A 1ZJYA 5IAAA 2UUOA 1E3JA 3LVFO 4NFSA 3UAGA 1DJNA 4CLRA 3VVCA 4FJ1A 5F1PA 1MG0A 3E6AA 1A7KA 4WOJA 2QYTA 2CZCA 3CKYA 2EKPA 2ZATA 5L4NA 2DBVO 4TSKA 3RUEA 1MXHA 4RQTA 1E3IA 2EXXA 1DB3A 4NK4A 5JC1A 4WLOA 1J5PA 4PLVA 2P9GA 2OL4A 1R4MB 2IEDA 4QEDA 2OBYA 3AU9A 5EESA 1UP4A 3FHLA 1FDSA 4ND2A 4FN4A 1NQOA 4PLPA 2D3TA 3ON5A 4CJXA 3NTQA 4R1TA 4JBHA 3QWAA 4E31A 2OFPA 1LC3A 3KSZO 1Y81A 3TWOA 3TZKA 5JLAA 3KV3O 4CQMB 4YACA 3OEWA 7ADHA 3ZNPA 4GX5A 1E7SA 1U5AA 3GHYA 4TQGA 3RASA 5FF9A 5JPIA 1XIVA 2X0IA 4KZPA 5FEUA 3NT4A 3SLGA 5CAEA 3GUCA 4AICA 2Q45A 3DXFA 3PJEA 3DHEA 3OECA 1G1AA 1ENPA 3RAJA 4BNHA 3B6ZA 4OXNA 3RJ9A 3H9GA 2YV3A 4YYZA 4AJLA 4J1NA 4CPDA 4IUYA 5B4VA 2EJVA 2W90A 2C20A 4Y6RA 2DM6A 1PQPA 3GDOA 5A9SA 2OUIA 1CQIA 4UEJA 3OJEA 3FD8A 1FK8A 1IHXA 4FBGA 3ONDA 4GGOA 1E1LA 4JXKA 3M1AA 5TNXA 3HDHA 3X2EA 1LXCA 4CR7A 4BHTA 3GPIA 3VH3A 3PYXA 1W8DA 2CDBA 2YHUA 4QTZA 1E7RA 3GVCA 1HSZA 3PDUA 4ND3A 3TSCA 1U3TA 4BMSA 3BHIA 3NT5A 4J7XA 3H6KA 2O2SA 1SNYA 1VSUA 3W8FA 2DUUA 2FN7A 4IZIA 4CV3A 4GSKA 5KJ1A 1MFPA 1J49A 2VT2A 4R3NA 3ZWBA 1WZEA 3KEOA 1DHTA 3E9NA 1PIWA 1CEQA 2BGKA 2HO5A 3V2HA 4CMIB 1KEWA 1MV8A 1E77A 1E1KA 1DC4A 2FOIA 2C7VA 1I3NA 4PLTA 3VPXA 4ITUA 3B1FA 4RGBA 4IDDA 4IJUA 5TGDA 3A1NA 3K2EA 3ROKA 5JMPA 3CPSA 1F17A 1BMDA 1Z7EA 2JL1A 5KVSA 1RM3A 4CMCA 3DAPA 3W4KA 1O6ZA 1GCOA 2I67A 3D7LA 1ENYA 4DL9A 4PLHA 4RZHA 5I8ZA 1EQ2A 1SOVA 3IMFA 3QP9A 5JDCC 3D4PA 3KHUA 3WIEA 4AJIA 3PQEA 3GGOA 3VZRA 1KVQA 1NR7A 4J4BA 1CETA 1E6UA 3V2UA 4FDAA 3OMLA 5A06A 1RM0A 3I23A 3IP1A 3MJTA 3Q9UA 4M55A 1C1XB 3UF0A 2YV1A 4A0SA 4NU5A 1ZSYA 2JAPA 1ZK2A 1Y6JA 2AW5A 2D5AA 4RORA 4A2CA 4KWIA 2NU7A 1GPJA 3PP8A 3OICA 2NQTA 1E7WA 3RU7A 4Z9FA 4EUEA 1IUKA 4BO5A 5MGBA 1TT5B 4Q3NA 3R3SA 3S8MA 2DU8A 3DBHB 3GG9A 4I5EA 3WR5A 4DTIA 5T8KA 3CZRA 4NPCA 1KIFA 1HWYA 5HS6A 1C1DB 5A5FA 3NYWA 2FR1A 1BXKA 1Y9EA 3ZWAA 4M8SA 4WCFC 3QLJA 2VHZA 1EBUA 1ONPA 1K89A 4RVSA 1BVUA 1T24A 1V6AA 4ILKA 2X0NA 4E5PA 2VHWA 2X0JA 3JQBA 3C7DB 3MJSA 4OGWA 4Q3BA 4BV8A 2B83A 3O8QA 4BMNA 3OETA 1NWHA 1BRMA 2OP0A 1TB4A 5KKCA 3I9LA 3BMNA 2XXJA 1YWGO 1DIAA 2EGGA 3NX4A 3G17A 4IY1A 3PHIA 4L74A 1N7GA 1U2GA 5HBRA 3FPCA 2HSDA 1QYXA 2VHYA 4XYGA 5I7FA 1GYRA 4Z9XA 4A7PA 1YB5A 2TMDA 5EQDA 3ZI0A 5G4LA 1LDBA 4YDRA 4JQCA 1I01A 1LSJA 3R1IA 3GY0A 2Z1MA 4JP3A 3K96A 4NBRA 4NG5A 4UVEA 1DXYA 1X0VA 4HBGA 2C5EA 1CYDA 4WUVA 4E33A 3PJDA 1GZ4A 4LMRA 4BNUA 3VKUA 3JD3A 2WWRA 4B4WA 5DT9A 4E4YA 2AHRA 3HDQA 3GT0A 2B4RO 2OBNA 4MKZA 4BB6A 4WPGA 5H81A 1PS8A 2Q4EA 5FI5A 2B4TO 4J16A 2XAAA 3R0IA 4GVLA 5L7WA 4QXMA 2PWZA 4E21A 3ORFA 1K2WA 1TT5A 5G0VA 4RQUA 5HWSA 4Z0HO 4W82A 1I36A 5TX7A 3WQQA 1T4BA 2GNAA 5EN4A 1ULSA 2GF2A 2BH9A 1JAYA 3PVZA 3B20A 1HETA 1KS9A 2ZCVA 2F1KA 4YWJA 1CERA 1P31A 4JBGA 2P4HX 4BGEA 2GN9A 4BO9A 2AXQA 3I9MA 3EY4A 1ZXLA 2CY0A 4QSMA 3H9JA 3B70A 1LNQA 4YJGA 3HFSA 4UUOA 1OC2A 4Q3AA 4KQWA 1SMKA 3GHHA 4LK3A 1QP8A 5LDGA 3ST7A 2EERA 3JQ9A 1GY8A 4YAKA 1GYQA 5EQFA 4UUMA 4NIMA 5ITVA 2ZQZA 5EPOA 3H2SA 1EMDA 3ZH2A 3DZGA 4NFHA 4MVJG 2SCUA 3VH2A 3E8XA 2ZB7A 5A9TA 1DRUA 3IS3A 3JQ7B 3PFWO 4BO1A 5IN5A 3OF2A 1K6IA 2VNSA 8LDHA 2Y67A 4CODB 3UFXA 1NTOA 3EUWA 4IDEA 2GRAA 1ZKMA 4PLGA 3U3XA 5B1YA 1Z82A 4E6PA 3S55A 5IDXA 1R15A 2X7HA 2WJPA 3HZZA 2J3HA 1CRWG 5BQFA 2HMSA 2JD2A 2R00C 1R66A 1YKFA 1TEHA 2RHCA 5CDSA 1PSDA 3ONFA 3W1VA 4JNKA 3DBLA 4L75A 1P1HA 4PLWA 2UAGA 4FJ2A 3UGKA 4A03A 1I24A 1WXDA 4MPDA 5AXBA 2OXIA 2J3IA 4M49A 4ZD6A 4CLOB 1R4MA 5IF3A 3RKRA 1QYCA 6ADHA 2GR9A 1FXSA 1KVRA 4ZGWA 4BO7A 4E3ZA 3KM0A 1W4ZA 4TKMA 1LJ8A 1WPQA 1GDHA 1PGJA 2Y1OA 3H4VA 2IYPA 5GZ1A 1P1JA 4M54A 4XQ9A 2WMDA 1NBOA 4G5HA 2YQ5A 3GGPA 5DZSA 4IIUA 3OJ0A 4R1NA 3TJRA 2VWQA 2DFDA 3L07A 4XIJA 4DYDA 2W2KA 3M1LA 3PPIA 4MIOA 1DIRA 1B8PA 3OP4A 4EGFA 2PD4A 3KRTA 5JDIC 3EW7A 2C2XA 1Z75A 3UN1A 5K9ZA 3LSYA 1ENOA 4MVJA 2PTGA 2NU8A 3EGOA 1GFSA 2X5KO 3D3WB 3DOCA 1HL3A 4RPHA 5JBIA 1GZ6A 1YDEA 2EKLA 2I3AA 1VPDA 4DPMA 1U7TA 2H1SA 3WGTA 3WWYA 4GI2A 4OMUA 2V6MA 4MVJE 2YHIB 4ZU3A 4BV9A 1KVUA 1H6CA 2AEFA 2LDBA 3Q0EA 3WLEA 2C07A 5KIAA 2DT5A 1G0NA 2R2GA 1D3AA 1EBFA 3ASUA 3HADA 3E18A 2ET6A 2ZB8A 3GN1A 1H6DA 4G81A 3WGIA 5KJCA 1SC6A 3VH4A 3I4CA 2B5VA 2B37A 1QLHA 4P8RA 4YJDA 4KUGA 1ZK0A 4D45A 4DIOA 2O3UA 1UAYA 4CLXA 1E6WA 4R16A 1A9YA 1QXSA 1YQXA 2AA3A 4H15A 3L6OO 4KWHA 2Q46A 3L9WA 2PNFA 1UH5A 3L4SO 4BNYA 3VAZA 2GDZA 3CMMA 1JWBB 1BW9A 2CD9A 3OIDA 1VJ1A 3ZWYA 4CLHA 1VE9A 3BMNB 4RLHA 4L0QA 2ZYGA 4EITA 1LLDA 1AUPA 4EBFA 3AY7A 2BRUA 3ITDA 4B4VA 5DP1A 1VM6A 1CDOA 4Q3EA 2IRWA 1LC0A 5JCXA 4YTEA 2FR8A 4D79A 5TRTA 3BTVA 1YVEI 3H9QA 4LCEA 5AOVA 1JQBA 3C1AA 3FRJA 3JQ8A 4IDBA 2CSUA 2PGJA 2WEKA 4Q3DA 4XX0A 4EJ6A 3JD2A 2O7SA 3TDKA 2QYSA 3DBVO 3N74A 5CDTA 1PU2A 1VL6A 3BTUA 1CWUA 4ZJUA 3GA0A 5BSGA 5JFOA 3UCEA 2A94A 2D1YA 5I9MA 4E5NA 1NPTO 1NASA 3GFBA 4BO2A 1IULA 1DDOA 1ZFNA 1C0KA 3AFNA 2X4GA 4FC6A 3AM4A 3WTBA 4A73A 4B4OA 3GGGA 4OO3A 4PGFA 1Q0LA 4BNNA 3KOUA 3U09A 4L4SA 4BO0A 4JX8A 1DC3A 1WNTA 4MINA 4ALNA 2UUPA 1N9GB 1MFZA 4FOSA 4OIMA 1PJ3A 1Z45A 4OSPA 4E2ZA 4NQZA 2HJRA 5AVOA 5A05A 1T1SA 3C1OA 3Q11A 4NJMA 1X1TA 4FGSA 4OQZA 3AI2A 3HUDA 4DREA 4AFNA 1D1SA 1UXHA 1ZK1A 4WCFA 5EIOA 3WNVA 3OJLA 2YQ4A 3PGJA 3H2ZA 1Y5MA 3ABIA 1C0IA 5J23A 5CHEA 1LLUA 4YJHA 3M2PA 3GH3A 2AE2A 4Y6PA 1NP3A 2OO5A 4MO2A 4G2NA 3H5RA 5JYDA 3ZNOA 1BW9B 1C0PA 3RC2A 4DGSA 1PS0A 4B8WA 3V5NA 2VNAA 5L40A 2O3RA 3JSAA 2P2SA 2P68A 4M1QA 5TT1A 1LLCA 3JQ7A 1WWKA 3AOEC 3ANLA 4KMSA 3V1UA 3ULKA 1KEPA 2A9FA 2JD1A 4FW8A 1YXMA 1VSVA 2GZ3A 4DBZA 5T57A 5K0ZA 3BMQB 3BTSA 3KLPX 4YCAA 5DOZA 5FYDA 4ALIA 1GADO 2C29D 4NMHA 4CMBA 1FF9A 1NQ5A 3NJ8A 4NFYA 1EVZA 2YFHA 5G0SA 1F14A 3WGZA 2P5UA 1X15A 1U4OA 3K5PA 1CQJA 3OJOA 5L9AA 4IJVA 3FF4A 2Y93A 2YY7A 2YJZA 1J4AA 3KTDA 4YQZA 2NSDA 4XR4A 1KBZA 5TQVA 5ENVA 4YAEA 1IB6A 4Z3DA 5A5EA 4B3HA 5JNLA 3OEYA 4FR5A 3RKUA 4CLOA 1LDGA 1A5ZA 3JQCA 2NV6A 4N5NA 1YQGA 4S3MA 5F3RA 1H9BA 1R0KA 4XEHA 5AXAA 4GLOA 1JKIA 4PVDA 1PWXA 2BFPA 2RCYA 2R00A 4Z0PA 3ZNQA 4BMVA 5B4TA 2H9IA 4LN1A 4WLFA 1I0ZA 1Z73A 1P77A 2Q50A 2X0RA 4MVJF 2HJSA 4Y67A 3VOSA 1D1TA 3WLFA 1LX6A 4TRNA 4AJ4A 4AJNA 1H2HA 3PWKA 1ZK4A 2QIOA 2WD7B 2W4QA 3ANNA 1MG5A 3TPCA 4D42A 3F46A 2NQ8A 3FWNA 4LISA 5L4SA 2YV2A 3HFGA 4J7CA 1LU9A 2X86A 2FZWA 5F1KA 4J2HA 2BI7A 2PD6A 4U7WA 4UUNA 3DR3A 3P2YA 3RBVA 3AY3A 4YT2A 2O4CA 9LDTA 1GYPA 1DIHA 4FFOA 1NYTA 4TRMA 4UVIA 4CR8A 1RPNA 1LRJA 2E82A 3CSDA 1B14A 4BNLA 4D46A 5IN4A 1PX0A 4LRTB 2RBEA 2YDYA 3W8DA 2PGLA 3GVXA 4L4XA 2NU6A 3BMOB 1XHLA 1T25A 1ZMTA 2W2LD 3MOIA 4QFDA 1V3TA 4UUPA 2DTXA 3MWDB 5L3ZA 3KSDO 3LZ6A 2NTVA 3DWFA 4LSMA 4YT4A 4R68A 2UDPA 1XCBA 5K6AC 3KLMX 1BSVA 2YFQA 1YOVB 2AQKA 3DBRB 3GUYA 4LVUA 3SJUA 5IJZA 1EDOA 1Q2XA 2CVZA 3GMDA 3D4NA 4R9SA 1DLJA 3I9KA 3OA0A 3WGOA 4CM3A 1I2ZA 5L51A 1QORA 3ZWOA 3JV7A 3LT4A 4ZQHA 3GRKA 4GH5A 4CM4B 2P91A 1BVRA 1ZNQO 2DPHA 4BO6A 3IP3A 2ZCUA 1GV1A 3H3JA 3NDJA 1P44A 4PFJA 4D3SA 4E2XA 2W2KB 1GPDG 1Q0HA 3PWZA 5DCUA 4KDFA 4GQAA 4K6FA 3EZYA 1OOEA 2GO1A 1HSOA 2VZ8A 3DZHA 4TVBA 1YBAA 3D3WA 4B7CA 1ZSNA 2D2IA 3P7MA 1M66A 3RFTA 2OGUA 3S2GA 4CQMD 4D0SA 5U9CA 3AUTA 2PFGA 3U4CA 2O2YA 1B2LA 1ISFA 1I8TA 1GR0A 4XYBA 1EUCA 3ZDFA 4CV2A 2HK7A 1JTVA 4OJNA 4DLAA 2NLOA 1T2DA 3AI1A 1IPFA 1KY5A 2RH4A 4Y98A 5L4LA 3HJAA 1CIVA 1VKOA 4DMMA 4GKBA 3IKTA 2P5YA 4PG4A 3HDYA 3CXRA 3BHJA 5HRUA 1DLIA 1KETA 4WCDA 3RCBA 3K8ZA 4Y6SA 1OI7A 1E6EA 2J5RA 1SOWA 4B3IA 4D41A 1Z6ZA 4M89A 4JIGA 4W7HA 3UKOA 2ZYAA 4XA8A 2IE0A 5JCJA 3ZNNA 5JE8A 3I9NA 1XU9A 1YDWA 4ALLA 4A5OA 3ZHYA 4YBZA 3OIFA 3QJ5A 5COQA 4CMHA 2NNLD 1NFFA 5CFZA 3S2EA 4R41A 4HKTA 4IDCA 1BGVA 2J3KA 4W4TA 1LEHA 4BOYA 1IL0A 4NJMB 3STHA 5I7SA 4DBVO 1PJ2A 5ICSA 2FMUA 4UVDA 3GN2A 5EINA 4CMIA 1WZIA 2EIHA 4I1IA 3H5AA 3IUSA 5THKA 3DTYA 1XELA 5KJEA 2CNBA 3DZFA 3NTRA 4EUHA 4D3DA 5L95A 3OM9A 1KERA 1X7DA 4TRRA 2WE7A 2NVUA 5FWNA 3P2OA 4Q39A 4R5HA 3AY6A 4P4NA 3FNHA 1Y5RA 4RF4A 1SB8A 4DA9A 4NJOA 4WLNA 5JO9A 5CEJA 3QVXA 3D5TA 1KOLA 4ZN6A 1HDCA 5KNLA 3QWFA 3K30A 2HMVA 4XJSA 1PJQA 3UH1A 4NI5A 1Q7GA 1QKIA 4YAGA 3U62A 3GVIA 1JVBA 3JYOA 3FTNA 4YR9A 5TJHA 2DVMA 5C37A 4W99A 4F6CA 1U28A 3I83A 1JWAB 5DP2A 2CMDA 4I5FA 4RCVA 1O0SA 4BGIA 4OHUA 4RF5A 3U4IA 3KB6A 5KOIA 2E49A 1FJHA 1PQUA 3OSUA 3CINA 4NBVA 1R4NB 2QRLA 4K1LA 4RDIA 3K31A 4JN6B 2YYYA 4XB2A 2PZKA 1U9JA 4YJGB 2DTDA 1V3VA 1ULUA 2V65A 2A4KA 3C8MA 1G0OA 3E03A 3PJFA 2H5LA 4QO8A 5CG2A 3W8EA 3KBOA 1DJQA 2VTEA 1HZJA 3PFFA 4B7XA 4BNIA 1JN0A 1CJCA 2X6TA 1EE2A 3RBZA 4U8GA 1H6AA 3LC7O 1PZEA 2OZPA 4IPTA 1W73A 3L6DA 3ZHBA 3DL2A 1PJSA 3L0DA 1LI4A 3ADOA 3LC2O 1ISGA 2HCTA 2I66A 1PWZA 2Y0EA 3W6UA 1MUUA 2HMUA 3GZNA 2QRJA 1NXQA 2R6JA 3WQRA 4CV1A 5C5IA 3RUIA 3LT0A 1IYZA 5DNAA 4TRJA 3G3EA 1SEPA 1JW9B 1XG5A 1UP7A 4FJ0A 2Q4BA 1HE5A 3MJEA 1EFLA 8ADHA 1SCUA 4DLLA 3DBLB 3NGLA 1NFRA 1QG6A 1WP4A 4A27A 2Z1NA 3EAGA 3ZWWA 4ZQGA 1EZ4A 2VQ3A 1SBYA 3Q3CA 4EEZA 4IJKA 3QSGA 4FFNA 1TXGA 4CL8A 4EEXA 4HFNA 1EQUA 3DDNA 2JD0A 3INTA 1B3BA 1YL6A 1ONNA 1RM4A 5IDWA 3ZV4A 3CUKA 4LVCA 5JXWA 1VJTA 3LT1A 4IIVA 3ANMA 3U4HA 2RIRA 1A9ZA 2JFFA 1XQ1A 3ZWNA 2IXAA 4NDNE 5BT9A 1J6UA 3KYDB 2JFHA 4ZA2A 4CQLA 2VZ9A 4FSHA 4KQXA 2E48A 2Q99A 4XJTA 3GK3A 1DOHA 3DMTA 3ENNA 1H9AA 5C7OO 1BXZA 2RH8A 3I5MA 1UUFA 2HMWA 1ID1A 2PZLA 2ZJ1A 3H7AA 2Z5LA 1QR6A 5FFFA 3DZKA 1H93A 5A4DA 3AM3A 2A92A 3ZWCA 3V8BA 4RV9A 4DC1A 2PR2A 2XXBA 4EUFA 3LLSA 2C5AA 2GERA 1P33A 4DRYA 1E7MA 4NU6A 3AJRA 1ZH8A 3PXXA 4AVYA 4A10A 3HB4X 3WNQA 2IZ1A 3TZ6A 2J3JA 4W7IA 5DOVA 5JW6A 3BHMA 4PLYA 4JP2A 4CMKA 2OP1A 4IXTA 3NT2A 1FDWA 3NRCA 1NPDA 4CM9A 3OHSX 5T67A 4BKRA 2HQ1A 4CV0A 1PL6A 3UCFA 5CDUA 4IINA 1HF3A 4NH4A 2B5WA 4PZDA 2O23A 5U4QA 4UULA 2QQ5A 3RFVA 1P3DA 3GDFA 3GEMA 3QWHA 5EJ2A 3I9JA 4RVHA 4LW8A 3ZCXA 3E9QA 3U9LA 1V9LA 1XDWA 5G0UA 3WTCA 4EI2A 1GQ2A 3ZN2A 3D64A 1PJCA 5JDIA 1NFQA 4OM8A 1EK5A 1UJMA 4XDYA 2OMEA 2ZB4A 4DQXA 3DZBA 2HDHA 5GZ6A 1NAIA 4CM4A 3UUWA 2V6FA 3AOGA 3GVPA 4KTVE 4GX1A 3AWDA 3ZU5A 4R51A 1ZUD1 3RI3A 3ICPA 3GR6A 3TN7A 5B12A 4GKVA 3DMYA 1H94A 4NNJA 2DFVA 2Y1CA 4IQ0A 5A9SB 3TZHA 1PL7A 5L45A 3F9IA 4ZICA 2EW8A 2NVUB 2D8AA 3ETGA 1HE3A 2GYYA 2VUUA 1X1EA 3EVNA 3OJFA 3QW2A 5THQA 4BNTA 4O6VA 1GUZA 2Q2WA 4CM1A 3GRPA 3QHAA 1LRKA 3VTZA 3QVTA 3WFJA 3RROA 1BWSA 1B3RA 1I32A 1LDMA 3MTJA 1HDGO 1WMBA 4XD2A 5TSDA 3WMXA 1UDAA 1N5DA 4I08A 1QRRA 1NQTA 4MP8A 1E7YA 3E9MA 1N9GA 2NWQA 5BNFA 4BKUA 4PVCA 4RVFA 2D59A 3KUXA 4E13A 5L53A 4PG7A 3TOXA 4Y9DA 2VOJA 4TMFA 4D43A 3M2TA 2IODA 1XWFA 1E1MA 4II3A 1E3LA 4WK6A 2BFAA 5A03A 1PGQA 3WWZA 4J2OA 4ZQFA 1ZXBA 3GG2A 4IBOA 2AMFA 4RVDA 4BVAA 5JMWA 1XLTA 4Y8VA 3IQDB 3GNQA 4BB5A 2C59A 4RLSA 2BF7A 4HP8A 4EZBA 2TMGA 3W4JA 5ER6A 4HFMA 4DLBA 3PQFA 3H65A 5B4UA 4AJPA 2X9VA 1F06A 1GQQA 1PTJA 1U7HA 2WYWA 3A4VA 3WMWA 2FY8A 3JCZA 3VZQA 2WSBA 2GZ2A 1Z74A 3BIOA 4IMRA 3QV1A 4K9DA 2I9PA 3T4XA 3BMCB 1UAGA 4R5MA 2EWMA 3IC5A 4RL6A 4ZRNA 4IS3A 5DBIA 4CM8A 4PZEA 2CVQA 1SZJG 1SPXA 1XYGA 3DFUA 3IJPA 1AE1A 1LSOA 1IPEA 2PKRA 2BFMA 1ML3A 2JCXA 2ZYDA 2NU9A 4XRRA 5CEEA 1IZ9A 5ITWA 3HB5X 3AUUA 1TA4A 4INAA 2IZZA 3JD1A 3VH1A 1IE3A 2EF1A 2FR0A 2NTNA 4W9NC 3RUAA 3ZWMA 1ZK3A 4JLWA 4GL4A 1XA0A 2O4UX 1JA9A 1XU7A 1QMGA 5C7LO 5KVVA 1ZIDA 2WYVA 2VUSA 3RUCA 5DF1A 1N1GA 3PLNA 3RC1A 3QVOA 3H8VA 2I6TA 1HDOA 3UXYA 4BNGA 1OAAA 1NNUA 4WKGA 4DWVA 1CF2O 4YRBA 3F4LA 4TZTA 1NHWA 3OH8A 4GLLA 4URFA 2FRDA 3GAFA 2FPIA 4YAIA 5TF4A 3DB2A 4OQYA 2W98A 4L76A 1OC4A 2EP5A 1BXGA 2NADA 1HDZA 4FCCA 3RJ5A 5KWEA 1A7AA 1PGNA 1P1IA 4ONEA 5ENDA 4TROA 3GFGA 2CVOA 1DIBA 3BTOA 2PA3A 2Z95A 4QECA 7MDHA 2O3TA 4EJMA 4U0KA 1L1FA 2YUTA 4K28A 1F12A 1YONA 3JQGB 3VPGA 4ALJA 3IIEA 3RFXA 1Z7BA 3PK0A 3RVDA 3TRIA 3C3XA 1DC5A 1FMCA 1BG6A 2QHXA 1R0LA 3IDSA 1VI2A 1X0XA 3VDRA 1GZ3A 2UYYA 1DRWA 4BS9A 4I9HA 3CEAA 1YGYA 4IJWA 4H16A 4J3FA 2Q2QA 3BMCA 3OFSA 1V0JA 3GF4A 4C7KA 2B35A 3Q2KA 1XSEA 1LQTA 2RAFA 4IGEA 1D7OA 5ER9A 3O4RA 2WDZA 3E82A 3F5SA 4HUJA 4YJHB 1ADFA 3WICA 1T2FA 3JQAD 3RD5A 3RIHA 3E48A 1NVGA 4RVUA 3C7AA 3DAGA 4DIBA 4PCVA 5A1TA 3ITKA 5A9RA 5U1PA 4RPKA 2EEZA 3C7CB 5H82A 3PTZA 5IFLA 3A28A 4MJLA 3WJ7A 3WGQA 3JYPA 2J6IA 3BAZA 2GN6A 4RPLA 2PLAA 5T5QA 2EW2A 2G1UA 4ALKA 1C0LA 1VL0A 3OA2A 4YB8A 2CFCA 2JHGA 3FI9A 1ISJA 4IDAA 3LF1A 3B1KA 5EMHA 2X5OA 1M6HA 1K6XA 3CH6A 1S6YA 1B8UA 4F45A 3U0BA 1XQ6A 1HLDA 3DZIA 4I9NA 4MP3A 1UDBA 3WQSB 2HLPA 2VTDA 1F8GA 3WGGA 4E2YA 1F0YA 4PIVA 5IZCC 1VRWA 3SEFA 3ETDA 1DHRA 5JS6A 2JCVA 1NAHA 3JQFC 3AW9A 2GLXA 4E2WA 1ORRA 4CMEC 1U2DA 2GGSA 2AE1A 4GMGA 3K6JA 2DQ4A 4PN3A 1AN9A 5AXDA 3FNGA 3H9EO 1LUAA 3HNPA 3SXPA 2WD7A 2JHFA 1JKFA 2Y0DA 2GPTA 1PZGA 1Q7BA 3IUPA 4IS2A 3G79A 1UZNA 2WTBA 2B69A 5BNIA 1NWCA 1PQWA 2NACA 1GEEA 2QG4A 2PK3A 4TKLA 3LK7A 1QYWA 3W4IA 1IY8A 3JQ9C 4M86A 4M87A 3RWBA 1ZCJA 3U4DA 3RBXA 5I9NA 5TJ9A 3RUDA 3AFMA 3DQPA 3PRJA 1OZAA 4GBJA 4ND4A 4RF3A 2FHSA 1QV7A 1PJLA 1VKNA 1WMAA 2Y1DA 4J7UA 2C54A 5I9LA 3RQSA 4E12A 3QWIA 2AEMA 3ASVA 1DRVA 3TF5A 4CUJA 5JY6A 3O03A 4Z9YA 1JLLA 1GD1O 1WW8A 2EP7A 3EMKA 4JJIA 2Y1GA 4O63O 1NHGA 3ZU3A 1SO8A 3DO5A 3PZBA 4K6CA 4HFRA 3PEFA 3B1JA 5HS4A 5DDIP 4YT5A 3QA9A 1GUFA 3KYCB 2X9NA 2GZ1A 4RVGA 1Y8RA 2V6GA 3KXDA 3ZV5A 4XYEA 4L8VA 3T7EA 1V3UA 4WASA 1L7EA 1PEDA 1PZHA 1ISHA 4DPLA 3JD4A 4CM9D 5CDGA 1A71A 2VYVD 3TNLA 2BGMA 4O1MA 4CMAA 2BLLA 1M2WA 1ZMOA 2VHVA 3WS7A 1PZFA 2DBQA 3I3OA 3T7CA 1I10A 1HTBA 3HN7A 3H9UA 3D1LA 1E5QA 1YO6A 3L6EA 4ROSA 2NTJA 5L7TA 3QWBA 1RM5A 2YHIA 1NQAO 2PZJA 3EDMA 3LC1O 5DULA 4YPOA 1WDLA 2PY6A 3D0OA 3GQVA 4UEKA 5KKAA 3OIGA 4E5MA 3QIVA 3HWRA 4MVJM 3PJGA 1ZBQA 4K26A 4H3VA 1P74A 1ARZA 2DTEA 1B15A 1YJQA 3QQPA 3IOYA 3INGA 1XR3A 2EKQA 4NHEA 2ZK7A 3DOOA 3JQBC 2Y68A 4GX0A 3JQ8B 3F5QA 1Q1NA 5CG1A 4OYRA 4P38A 2CF6A 4CUZA 1H2BA 1Y8QA 3PZRA 5KTKA 2OOSA 2HK8A 5LC1A 4OL9A 4O5OA 4J6FA 5EERA 3E1KA 1NVTA 1U3WA 3V1TC 4XDZA 3V2GA 1RYDA 1TLTA 3QE3A 4WEQA 1UZMA 2G5CA 4BNFA 3VKVA 3L4BC 4QX6A 1X13A 4XQCA 4XRGA 2I5PO 5KVQA 3JQGA 1I2BA 2PD3A 4BQPA 4GWKA 4NBUA 1X7HA 3EC7A 5IXYA 5JAMA 4RPJA 4BQRA 1BHSA 2AQHA 4TZKA 3E5MA 5A04A 1DFHA 1HDXA 2P9EA 3BA1A 4UAGA 1XGKA 4KDEA 3LQFA 1YH3A 3GAZA 4IQ8A 4F46A 3DHYA 4QT0A 4WCFB 1UXGA 4CM7A 5ILOA 4BO8A 2VWGA 5AXCA 4C4OA 1JDJA 3JD0A 1LLQA 5JDCA 1DAOA 5JCJD 4D44A 3JQ6A 5GMOA 4BNKA 4XR9A 1KC3A 2W2LA 1BTOA 3HQ4O 3V1YA 4CM5A 1ZZEA 5CDYA 1AHHA 1M76A 2VHXA 4WLUA 3IJRA 4Z3KA 4J0FA 4BNJA 2E37A 2AG8A 4IM7A 4JROA 2JFGA 4W9NA 1HEUA 1N2SA 4DVJA 4J43A 1PGPA 3EZLA 2VT3A 1YB4A 1U8XX 3VTFA 2FP4A 4MKXA 3DC2A 5G2OA 3BMQA 1BDBA 4UVGA 1ZSVA 4MVJP 4BNVA 3DFZA 5IZ4A 1T1RA 2GN4A 3TZQA 5GY7A 4MIYA 1C1DA 3VDQA 1Y8QB 4BNZA 1N7HA 4YQYA 3A14A 4WGGA 1H6BA 1U5CA 4E5KA 3R3JA 4XCVA 4EDFA 1QYVA 3DOJA 2DBRA 3FWZA 2C2YA 1JVSA 3G49A 3I6IA 3ZWXA 3EHEA 1K6JA 2B4QA 1XKQA 3SBOA 3DBHA 3KO8A 1E0DA 3MTGA 3NAQA 1ADBA 2X5JO 2X23A 3ROQA 2O48X 5KCZA 5IXSA 3WG9A 3C85A 4P4LA 3PLRA 4P4GA 2VRBA 3WYEA 4R3WA 4BNMA 2IEBA 1HE4A 2HRZA 1HDYA 1E3WA 1PR3A 1MX3A 3FR7A 3FNFA 4XGNA 3D3EA 3HDJA 3EYWA 2ZTLA 1N8KA 3OBBA 3CE6A 4ZHSA 1WAMA 5G4KB 4CMEA 1A27A 4OKIA 3JYQA 2EG9A 2ZKLA 3FTPA 3O8QB 3JQFA 2LDXA 1O95A 4RJTA 1I2CA 1O94A 4ALMA 3UHAA 1B0AA 3DONA 5IZCA 1GUYA 5T8KC 4RF2A 1AXEA 1ZEMA 5BSHA 3VPHA 3ETEA 2QZZA 4UEOA 4LMPA 4II2A 2QZ9A 4QQRA 4GSLA 1OFGA 5F21A 3ZW9A 4BIIA 2VWPA 6LDHA 3UVEA 3EK2A 1QYDA 3MZ0A 1DEHA 1U3VA 3O9ZA 3ADPA 3MJCA 3RUFA 3VPSA 3HE3A 4FS3A 4Q3CA 4CQLB 1YOVA 2G0TA 3DBRA 3GOHA 4RO0A 3A06A 3VHRA 4MOWA 2GCGA 3ZU4A 2ZTUA 4BNXA 4C7JA 3AK4A 5TLSA 2HU2A 5ICMA 3NDIA 4CLDA 5C3MA 1YBVA 3PHLA 3Q9NA 2GD1O 5CP8A 3DZJA 2XPCA 3MWEB 3PIIA 4I8XA 4WLEA 4AJHA 3OQBA 3H3FA 3PIDA 4FD3A 1UXKA 4PG8A 5KJFA 1EE9A 1YB1A 3FNEA 1DIGA 3I52A 2VWHA 1GQYA 4J9VA 3MJVA 5F5LA 1PGOA 1DSSG 2VYVA 2OORA 2Q1WA 2Q1TA 3K73O 5G0TA 2QRKA 2NVBA 4DIFA 2PKQO 3RSHA 4PG5A 3SX2A 1EVJA 4WOKA 3JQEA 1HT0A 1R0SA 5T64A 4CUKA 1UXIA 5I8WA 2FPPA 3AI3A 1QV6A 3GEDA 3TFQA 4N5LA 4R69A 3MOGA 1YS4A 4I9UA 4JBIA 4HX5A 3NKLA 4YA6A 2VN8A 4B3JA 4NBTA 4YVFA 1K3TA 2BHLA 2Q49A 1P1RA 4I5DA 4OOEA 4PG6A 3WYCA 3O26A 4KUEA 1MGOA 1WDMA 2JJYA 3OQ6A 4JK3A 1LRLA 1Y8RB 3TFOA 1P1KA 2BFOA 2O50A 3I1JA 5KJ6A 1P1FA 1JKJA 1PJTA 2ZIZA 1VJ0A 1ZEJA 1B16A 1SEVA 3VC7A 4AJOA 2JKVA 5CPFA 4CLRB 3Q1LA 4FIZA 4GX2A 1VC2A 2F00A 4XGIA 3ROPA 1ISMA 3F6YA 1P9LA 1G6KA 2A35A 3DTTA 4YRAA 2P4QA 4Q9NA 1HKUA 2Y0CA 4QFCA 3EVTA 5LCXA 4J1SA 4BGUA 4YT8A 3LT2A 1V8BA 2C7GA 4R1SA 4RZIA 3RUHA 1V35A 4L73A 1UR5A 3ZW8A 4FFRA 1DC6A 2QX7A 2BKAA 2VYNA 2OHXA 4PRLA 4R54A 1KEUA 5JAQA 1R37A 1B26A 1IZ0A 1UZLA 4MDHA 2UVDA 3ROMA 1DFGA 1BXGB 4ND1A 1DFIA 1Y9AA 3D4OA 4JJGA 2V7PA 3ZGYA 4R4JA 3PQDA 3KVOA 3FN4A 4R9RA 2E6UX 1C1XA 2G17A 4CQMA 4GPD1 1KY4A 3ZZNA 4IMPA 2ILTA 4TWRA 2WM3A 3HHPA 3C1TA 4KOAA 3PHHA 4J90A 3JTMA 1EVYA 2C82A 2DPGA 3HG7A 1UP6A 4OAQA 3U49A 3WFIA 5JSFA 3L4BA 4ZQEA 4HXYA 4AJ1A 4OH1A 1Q0QA 3F47A 4DQVA 3F1KA 2I65A 1H5QA 1LDEA 3NUGA 3H5NA 4RDHA 2NM0A 4OOFA 3WSWA 3ZHZA 3MJ4A 1DPGA 1I30A 3G1TA 2XOXA 1TVEA 2HK9A 3TQHA 3AM5A 1X7GA 3GC6A 1I3MA 4B4UA 4G65A 1ISIA 3RC7A 1HYEA 4D7AA 1T4DA 2HMTA 2ZB3A 3GZNB 4HNHA 1JU9A 1NX6A 3G0OA 1Y7TA 1A72A 2V6BA 4OXKA 3T4EA 3WOHA 5CEFA 1OMOA 2VRCA 3W6ZA 1PJ4A 2PV7A 4BUCA 4F6LA 1TT7A 2YDXA 5DN9A 5AYVA 5COAA 4GMFA 3GVHA 5HA5A 2AQIA 2YZ7A 4GWGA 5H83A 1O5IA 4QUKA 3QRWA 4U6QA 1R12A 3RU9A 2HUNA 4JJFA 3IKVA 1XEAA 3P19A 3PGXA 3GNTA 4Z6KA 1ZJZA 4HY3A 5A02A 5COBA 3ICCA 2FZEA 1A4UA 1RJWA 4ID9A 2GSDA 1AXGA 1R4NA 1EK6A 1LA2A 1MXFA 3VZSA 4E30A 3L9XA 1D8AA 5T6BA 2PZMA 4YXFA 1KYQA 9LDBA 4AG3A 4XIYA 3IAHA 1ADCA 1R16A 1MLDA 4J0EA 4IXWA 4PZCA 5DCYA 3WDSA 3ZWVA 4DUPA 3TZCA 3GLQA 1MA0A 3WXBA 5BNTA 3KETA 3PHJA 3WB9A 1HLPA 2H63A 4FFMA 1L7DA 2J5KA 3WBFA 5TIIA 4D0RA 3WBBA 5HM8A 4N18A 4AJEA 1LSSA 1FDVA 1O9BA 4AJ2A 2H6EA 3DEYX 2I99A 1FDTA 4U0JA 5HTOA 3INRA 3KZVA 2WD8A 3N58A 1GTMA 3ONEA 1A4IA 4YEDA 3COSA 2X1HA 2P9CA 1M75A 5BSEA 5TT0A 4XKJA 1ONOA 3FCOA 3NGXA 5BSFA 5IDQA 4JGBA 4CLEA 2DBZA 4PLCA 4N7RA 2FSVA 1HDRA 1VLLA 3I6QA 1Q7CA 1E3EA 1B8VA 3K2BA 4J9UE 4L4RA 4B79A 5AQ1A 4IQGA 2DUWA 3UW3A 2CDAA 4PLFA 3P5SA 1MC5A 3CMCO 3BYZA 1S7CA 1GCUA 3S2FA 4NBWA 4OXYA 5I7VA 1P0CA 2Y05A 3R6DA 1O89A 4PLZA 2XF8A 3NTOA 2GN8A 3PYLA 3HSKA 3OQ1A 5JO0A 4B8ZA 1M67A 3UCXA 1K0UA 4WLVA 1KEVA 4BNWA 4XYLA 2D5CA 3KYCA 1W0CA 1HRDA 1H0KA 3CTMA 1GL3A 4J4TA 3SLKA 3JQAB 5EL0A 2D0IA 2Y1EA 4IGFA 2CF5A 4LRSB 4CMGA 4BKQA 3FBTA 1T2CA 2B0JA 4XB1A 4KTTE 2ZJ0A 3MEQA 3E5RA 2G82A 3WGHA 2EJWA 2WYUA 4FFLA 1HZZA 3FR8A 3NEPX 5TC4A 4CMJA 4J91A 3JYNA 4MKRA 5F1OA 2VUTA 3SC4A 4PRKA 1E92A 1HE2A 3BXXA 3AU8A 2Y99A 4FGWA 5F5NA 1N92A 4I5GA 2IZ0A 2EV9A 2WE8A 1HXHA 2JAHA 2O3QA 1ZW1A 5I7EA 5K6AA 3QVSA 1NM5A 4UVHA 3RC9A 3D5QA 4AL4A 3TOZA 1DBVO 4MVJD 3WX0A 2BELA 2HKIA 2Q1UA 2Y66A 4ZQBA 5GZ3A 5JAZA 1GEGA 5CPBA 4J49A 1IHYA 1NPYA 4ZVVA 3ZU2A 2E4AA 3KEQA 4X54A 1HYHA 4NK5A 2X22A 1GV0A 2EHDA 2O7QA 3CIFA 1D4FA 2HRBA 2VCYA 4U5QA 2O3JA 1AHIA 1IOLA 2RHRA 3F4BA 1AGNA 2Q3EA 3LDHA 4WEOA 1U8FO 1U4SA 1JAXA 2VYND 2FSSA 4BO4A 3S1LA 4F3YA 1DAPA 1T2EA 3JQDA 4FPXA 5DBFA 3BMOA 4WECA 3AUAA 5A3VA 1QSGA 5ADHA 1Y1PA 5JY1A 3I4FA 3JQAA 4N5MA 2NVWA 4DPKA 4W6ZA 4S1VA 5TS3A 2GUGA 1KVTA 2HAEA 5JAIA 1KVSA 2UV8A 4OSOA 4HV4A 2J8ZA 4LCJA 4AJJA 4WNCA 3GNSA 3N7UA 4CM8B 5JYEA 1J0XO 2DLDA 4HADA 4YJFB 3ZV6A 1LDNA 4R01A 5LDHA 3PI7A 4BO3A 1FDUA 3U5TA 3FBGA 1EFKA 5MDHA 1O8CA 2G76A 4YRDA 5JC8A 1EVIA 3DMTC 3NV9A 1E3SA 4JCOA 4NR0A 4Z0TA 5L7YA 4LSWA 4DC0A 4IZHA 3WGYA 3CZMA 1W6UA 2VZ0A 3NDRA 4N54A 3FPLA 2YW9A 1GAEO 5DBGA 3LU1A 1MP0A 2BMAA 1YJ8A 3MCVA 3PWSA 4FQ8A 2BD0A 1E1NA 1ZO8A 5IDYA 2FPGA 2W8ZA 4DMLA 3UOGA 1E7QA 1K5HA 2IDZA 1RWBA 3AOEA 3SVTA 2ZTVA 4WJZA 4E0BA 5ILGA 1NR1A 1I3KA 3NJ4A 3VVBA 5KVCA 1T26A 4XYMA 4KP7A 3WIDA 4D3FA 5FI3A 4AJKA 4KUHA 3A9WA
chains in the Genus database with same CATH superfamily
1QDEA 2BP7A 4A2QA 4FHEA 2NU7B 4ZP1A 3BL8A 3HYCA 1UPBA 1TI7A 4KXQA 2Y6UA 3L1IA 3BZUA 3ZKWA 3FYTA 1EUZA 3E0QA 1V5GA 2E4XA 3QNMA 4HB0A 3RJTA 4CR6A 2XNDA 3NVAA 1C14A 1YZQA 1GQRA 3ORHA 1CKEA 4GP9A 1E3WB 1RCUA 3KSUA 1BOOA 2CCKA 2BKXA 2GWHA 1KK1A 4K8RB 2OVBA 4GAEA 4NCKA 3RNLA 3TL2A 3VPFA 4TLAA 1YL7A 1F8XA 1RQ7A 3NFRA 1Y7LA 4ESOA 3SE7A 1LNZA 4IUCS 4OKNA 2BSAA 4BQNA 2ZRLA 1C4OA 5BWOA 3GFTA 1YJXA 4LNAA 3WSVA 3DMDA 3QPDA 1YQWA 4YJFA 2RGWA 1U8AA 3ONWA 2CNOA 4OPMA 3GPDG 1Y80A 1HFKA 1E9RA 4RKFA 4TM8A 3AC0A 2OV8A 2OXFA 4O59O 2A9RA 3MMPA 4LJ8A 4XZ3A 3LX6A 4Y2SA 4YAJA 1L5QA 2W6PA 4A26A 3ZJUA 5I4CA 4DYVA 1SHTX 2R8YA 3BXHA 1U8UA 4UNNA 3BJRA 1YQQA 1WVGA 2C0CA 3IESA 1M6WA 4AWAA 3I76A 2ID9A 5ALHA 1LPOA 2FTKE 2VDQB 2DC1A 2IUFA 4I2VA 2X19A 3BX1A 2FZCA 1T3ZA 2J46A 4R2MA 4TN5A 2HDOA 2VT6A 1KJYA 1CUEA 3KEFA 4G4GA 4U9IS 2VPPA 1C3VA 2QX8A 4MI9A 1NSTA 3OAAA 1JFVA 1WLYA 3FHOA 4FGZA 4FOOA 1DWPA 4H3KB 3E70C 1I5RA 3PLAE 2BTOA 2FJUA 4ZI7F 2FR8C 2W8BB 1TM5E 5DLYA 3PX2A 4XDGA 2A14A 4M7PA 1V6CA 5G0WA 1HYGA 2C1XA 1R00A 2O3SA 4WTOA 1ICEA 4UC0A 2ZRFA 5AM4A 4AMYA 2PVPA 3G0BA 13PKA 3NGMA 1MAAA 4TVOA 4E32A 4O0LA 4E2FA 3BJEA 2HZ7A 3H1TA 4MIEA 4ZQIA 8GPBA 3DF7A 2CUKA 2J5QA 1W85A 2ID4A 3JS5A 4GP7A 2WLTA 5JQGB 5HKBA 1ZY2A 5IH7A 4LGVA 2I3GA 2KM1A 1WCYA 5ALYA 3HGMA 4K6GA 4RKQA 3RS5A 1BKSB 3OQHA 2WVJA 5IKPA 3BXPA 1EFPB 4OP2A 3LQRA 5BR7A 2WD9A 2NZUG 4BLRA 4C1NA 4MVJH 2WJYA 4GGPA 1NJ5A 4EF6A 4D26A 3LYLA 2VHCA 1FTSA 4JJAA 1W5BA 3UT6A 4B31A 4Z7QB 3LXMA 3TGLA 4BCDA 2H3EA 1DWOA 1KPGA 2AN3A 3L1KA 5A62A 4F4UA 1BKDR 4EJ0A 3OPMA 1T15A 2Z5GA 3NHFA 4G01B 4Y9RA 4AECA 2WM2A 4JU8A 1SCKA 2VF2A 1KAEA 1PJBA 2J08A 2CMHA 2WDPA 1H2WA 2XA1A 2XAUA 4QOFA 4RPGA 4EFNA 3D1VA 2I76A 4FS8A 1PI3A 2OECA 4RKEA 1B7GO 2NPOA 5K2MA 5IG2A 1V8DA 4WE3A 2ZQYA 4L9RA 5T4FA 3UT5B 3W90A 4EFKA 5ALGA 3JR3A 2XH8A 3WOVA 1AKYA 2EFCB 3TD9A 1D2EA 3STYA 3PL5A 2XMRA 5DSTA 1RAFA 4KAXA 2Q1SA 5FBQB 3KAPA 1QQTA 1F2UA 4KX3A 1KGSA 4Q3LA 4X60A 2PH3A 3OCXA 1VE1A 2H29A 2WTNA 3V1KA 3ZU6A 5BSWA 2JLZA 2V8OA 3MM4A 3L41A 1ODIA 4GL2A 4RNCA 4ER5A 5EZYF 4DMRA 3Q2IA 4OHMA 5AJZA 2A1IA 4FC7A 1KAOA 1X2BA 4LKRA 4YV0A 1YSCA 4ZEWA 4MVJI 1P61B 3HTXA 2UXDB 2BFDA 3D8HA 3QA3E 4W7SA 2B30A 1E3JA 1U2SA 2W8BA 3LVFO 4O02B 1DJNA 5F73A 4JSYA 3IKLA 3VVCA 4C0XA 4HDSA 1ZUNB 3LLCA 5G41A 5AVUA 1A7KA 2QYTA 2V03A 2V9PA 4QXQA 4RSRA 1RWNA 2NV0A 2R6R1 2ZATA 1NUSA 4TSKA 4N40A 3FPFA 3AESA 4BLWA 2QROA 3B52X 4H2DA 6NULA 4MARA 1YHZA 1YR8A 1ZIYA 2FCAA 4RY2A 2BYTA 4BFZA 3W5AA 5JC1A 1QF7A 4UTOA 3ZY6A 3K1JA 4J3NA 1FP4B 2IEDA 2NT4A 1Z4MA 2Z4TA 3ZGXA 2VJQA 2OBYA 2O8CA 3SCZA 2YMLA 1UP4A 1JHXA 1EFAA 2XADA 2GAFA 3L8YA 4ND2A 2WU8A 4PLPA 2YNMA 2TMKA 4LNUB 3ZHUA 4AQYB 3GT7A 3MJRA 1Z7YA 2HBZA 1ONSA 1WXGA 3KKPA 1V9CA 2YWFA 4JBHA 2V96A 5GVRA 4YQFA 2QU8A 2RG7A 1Z8NA 3ZD9A 1H2ZA 1OPXA 1XDSA 1JTEA 1UJBA 3H5WA 5JLAA 3ID6C 4LDZA 5KC9A 1CR6A 2G04A 3GBSA 1XTJA 4DDTA 2YIDA 3DOIA 3QENA 1GAXA 1CW2B 2Y0PA 3DEIA 3GLHB 3N75A 3DAHA 3OEWA 2O1EA 4HGQA 7ADHA 1U5AA 3WFJA 3RASA 3PL1A 1MO4A 2IHZA 1R18A 1FQWA 2VP3A 2KWIA 1WJGA 5HG0A 6AT1A 2QD1A 3U7QB 3GUCA 2BWJA 1GPMA 1OXTA 2Q45A 3C3AA 3PB3A 2P7HA 1GNSA 3OECA 1TCVA 4BNHA 2O07A 4L15A 4OXNA 2BGRA 2FXIA 2PZBA 1R10A 5JQGF 4AJLA 1USKA 5KREA 5DM60 3PVCA 3V7FA 5B4VA 3AUKA 1ZIOA 1OAKA 4P2GA 2W90A 5JJIA 3I04A 3OPVA 2DM6A 3L6UA 1N3IA 2FF5A 4L8WB 4U4AA 4Y6RA 1CRQA 4H4DA 4C3VA 5I45A 4AQ7A 1JRLA 2GEVA 2RONA 2QRQA 3NG1A 1VCMA 3ONDA 4EW1A 1E1LA 1X1BA 3M1AA 2CD7A 4UDYX 4CE6A 1D2CA 2REQB 3IBSA 4HPJB 2GSWA 3F0TA 3GPIA 4PTZA 3TTVA 2ZXFA 4C6RA 4DDHA 5AVXA 3R9WA 4WMLA 1L5HB 5D6OA 3MWLA 2HI0A 2YHUA 2IHJA 3FOEC 1WBBA 4K05A 1HSZA 2DECA 3VNQA 4O2LA 1CZOA 1I4DD 2I54A 4ND3A 1G4UR 2PKYX 4RESA 1U3TA 5TPWA 4C5BA 2IHBA 4DV4B 4E4RA 5AT1A 2XITA 4J7XA 3ZE7A 5EZ5A 4L16A 1DJLA 2OQ2A 3ES9A 3GH1A 2O2SA 5CJ2A 2QRUA 2A9VA 4NP6A 3Q5GA 4TTRA 3W8FA 2GTPA 1A8PA 1XYVA 3ETHA 3FRHA 4TV9B 4UZFA 2OG1A 3SQXA 2D0OB 5L6LB 4CV3A 1SCIA 2Y6VA 1J49A 2VT2A 5F77A 2PMKA 1WZEA 3KEOA 5JS2A 3C39A 3E9NA 3PG5A 1NBEA 1CEQA 4MGZR 3UO8B 4YV7A 5B2FA 4KAJA 5JZ9A 2HO5A 3V2HA 4CMIB 1X80A 1E2BA 4X3PA 3L05A 3E9EA 4B0PA 2C7VA 4UZEA 1I3NA 1KMHA 4FGKA 4PLTA 6REQB 3VPXA 4ITUA 1OWNA 3E3OA 4IDDA 3GJZA 2BRUC 4IJUA 3RQIA 2PKXA 1T9BA 2N0SA 1GPH1 2QSYA 4RETA 3TSOA 2CT8A 4HGYA 4TMKA 3CPSA 1SVUA 1POWA 4M9ZA 1MIOB 3C4JA 3P9SA 2FQQA 5FT9A 1GA4A 1RM3A 1X86B 2Q8PA 4J0CA 1C8VB 3BE5A 4KHZA 1QZUA 1GCOA 3MRTA 5FP0A 3W4KA 3G5AA 3KAQA 3B9RA 5BVHB 2PEYA 4RYLA 3QP9A 2D7JA 3IMFA 2GN0A 4YV1A 3SYMA 4DIUA 1TEXA 2WRZA 5K4AA 5K0SA 3GGOA 3T7TA 3B60A 5CLJA 2PE5A 3G2HA 1P3Y1 1KVQA 2BDTA 4UAJA 4IV8A 1E6UA 5EEHA 2AFIE 3OMLA 1NIJA 1M3SA 1RM0A 3BFPA 3I23A 3GW8A 3Q9UA 1BEZA 1FFDA 2C57A 2JATA 2NYUA 3PS9A 4B6QA 1AY0A 4LE2A 4EHLA 2YXBA 5K6RA 1VP3A 2REQA 2YTZA 4MRMB 4LQLA 1ECGA 1RPJA 4Q19A 5E0OA 2G80A 4F1KA 3KOZA 4F4JA 1RRMA 1BHQ1 5ILQA 4PAMA 4AF6A 2QTTA 4W1RA 3WHKA 4Q3NA 1CY0A 1RWKA 3H18A 2WF7A 2DU8A 1U99A 3DBHB 3WR5A 2ZAYA 2XSZD 2K2QB 3X0DA 1Q5PA 2RHJA 1SXPA 1IWOA 2FPOA 2QU7A 3NM6B 5D84A 4AK9A 3L1UA 4ZKEA 3C3MA 4YUXA 2CNWD 4YMLA 1BXKA 5IAGA 4XQGA 3GLFE 3QFHA 3KTAB 2I2BA 2GM5A 2FUG1 4MKFA 4YNBA 2DY0A 1E94E 2QY6A 3E58A 4DLKA 5IUNC 1VBFA 4H7DA 3OTWA 1DKRA 1BVUA 2PQ6A 5CCXA 4RK1A 5TEVA 4ACBA 1EUYA 1XZQA 2DULA 1PFQA 2J9RA 4IIJB 1G7CA 4E5UA 3NB0A 1C0EA 3BHNA 4KVGA 4ZXFA 3JQBA 4D9EA 1EESA 4OGWA 1A1VA 1FRVA 3P9QA 3QPBA 4G63A 4WK0B 1O08A 1YC2A 4JQSA 1ZL2A 2XXJA 1YR3A 5AW3A 3M6UA 3H16A 1DTEA 2IGBA 3NX4A 3RREA 4I1RA 1P9NA 4FFDA 3LNTA 3PHIA 2V7BA 4IY1A 5AQEA 3LUGA 4ZCTA 1U2GA 1ND6A 1WY7A 3BWVA 3C5EA 3FPCA 4MW2A 1L4YA 5EY5B 1MIOA 4JI7B 1SQ0A 5TMEA 1YB5A 2FPWA 4RX1A 1LQ2A 4NS4A 5EQDA 4BVGA 3UMCA 3HVRA 3HK2A 1XZGA 2Q0XA 3OOJA 4UOEA 2VQDA 4NCBA 1KEEA 4J8PA 3R1IA 5FHQA 4JP3A 4PSDA 1RZRD 3BQ9A 4PC1A 1DXYA 4HBGA 1CYDA 3JVDA 4E33A 3PJDA 4HYQA 2I7TA 4LMRA 4DLZA 5DT9A 2XYPA 4ZVSA 4E4YA 1O96A 4PEVA 4BRZA 2PSFA 4P32A 4YPFA 3A2KA 1OZGA 4OXXA 4C04A 4CNQA 1Z3IX 3OLYA 4Q7KA 4CGYA 1EP3B 3R0IA 1FXWA 2I62A 4EHHA 4M7RA 4G5XA 4YPVA 3PFBA 2GEJA 1KNXA 4QXMA 4DDMA 1XPOA 4E21A 3ORFA 4DCSA 5DN6D 3W05A 4B3TB 3DKIA 4MB2A 2WSMA 4G0MA 1RRGA 2VLIA 4PXYA 4QXPA 4RQUA 5AWFC 2CBXA 1KI2A 3WQQA 4NOJA 3BT7A 2QLTA 2GNAA 1VJGA 1IJEA 1JSLA 2BH9A 5BQPA 4AG5A 2ZCVA 1MJGA 1DKPA 3VR0A 4JBGA 4PE5B 3HVKA 2R66A 4P58A 1M5TA 2C2BA 2GN9A 3I9MA 2CVFA 2H2IA 4BO9A 5CLIA 1QYIA 1ZXLA 5JWHA 5LZ2A 1F6BA 3IRUA 4QSMA 3SF8B 1LNQA 4TSFA 3LG2A 4BVHA 5CFMA 4UNPA 4U2BA 1COWD 1OC2A 2HCRA 2HF2A 1BYUA 1FUUA 1M2GA 1P1BA 4KQWA 5C1OA 3IQGX 2VH5R 2EERA 3JQ9A 1GY8A 4JT4A 1GYQA 1II8A 1UFRA 3A1TA 4QWMA 2WAXA 4Y2QA 1MEEA 4NYJQ 3TRDA 1CUYA 3D4LA 1QQ7A 4B6FA 4KIUA 2OHVA 1Z6TA 4MVJG 5J43A 4P35A 3UNXA 4BATA 1RFGE 1YI0A 2R47A 3FYCA 3HSYA 3MWJA 1J9ZA 4FI3F 3JQ7B 1R5BA 5D6NA 3ADBA 1GLGA 4BO1A 1KYIA 8LDHA 3TUIC 2Y67A 3OZXA 4CODB 3UFXA 4ENSA 4DBLC 3AJDA 2GRAA 4QYWA 5B1YA 1BE0A 1Z82A 1V1RA 4KLNA 4CCSA 1VLQA 4HMQA 5JXIA 1R15A 2BFDB 2IYTA 5FOVA 4F7DA 3HZZA 1UPAA 2J3HA 2WPDD 2IOFA 2YXPX 3T5GA 5BQFA 4YP6A 1GG9A 1K92A 1N2CA 1QX3A 2AR0A 1YKFA 2IVFA 3NYIA 4GF5A 4E6EA 1LF5A 1PSDA 4EW2A 3OHMA 2ESRA 3G7NA 3I73A 3DBLA 3OWOA 4LGMA 2M6KA 1P1HA 4PLWA 4FJ2A 1D07A 3P9CA 3UGKA 2ZBEA 2G9UA 4XUDA 1PR2A 4Q4LA 5DTQA 4AY4A 2OXIA 4HAXA 2J3IA 2B1QA 4MA0A 3Q8LA 4CLOB 1XKTA 2Q3JA 1XTTA 1E9FA 3RKRA 3QYPA 2BSXA 1E1RA 3QPCA 4PYLA 1FXSA 4RD2A 3WV4A 4KV9A 4E3ZA 3KM0A 1W4ZA 3FCXA 3AKDA 5EXTA 2BHSA 1PGJA 4G9BA 1TM1E 5CW1A 4L22A 3VISA 4CEIA 3O93A 1T8TA 3HKEB 3BFKA 6PFKA 1QU3A 2WMDA 5KSYA 5SICE 5ALRA 2B4AA 1KAGA 5IUKC 3SXJA 4REQB 3GGPA 5EJAA 3WB0A 4YMHA 4LHSA 4QRDA 4IIUA 5K1ZA 2P9BA 5AW9A 3TJRA 4AURA 4MYCA 2DFDA 4DG5A 1V71A 3URMA 1RIIA 3PPIA 7AT1A 5GJBA 1B8PA 3OP4A 4PQRA 1JALA 1YNOA 2PD4A 4EGFA 2WHEA 2C2XA 5JDIC 1Z75A 3UN1A 5K9ZA 3AXSA 2PBFA 1ENOA 4XIFA 1KMQA 3C43A 2PTGA 3EGOA 1FP6A 4GUAA 8ABPA 2FNAA 2OZLB 2I3ZA 3MMSA 4BEWA 2AZTA 4BMOB 3HZOA 1YDEA 4PPFA 5CW2A 5KQGA 3KFLA 1SUFA 3H4MA 1TO1E 1FLDA 2I3AA 1WDWB 3P9RA 5FXMA 5LNK6 3FPEA 2ODTX 2AF4C 3KHKA 1H1LA 3OP1A 4QUBA 3WRYA 4OMUA 4ZARA 3G2MA 3FMOB 3KXKA 1KK3A 4MVJE 3RTDA 5BN3B 1B23P 1AV7A 2XDAA 1EGMB 3VU9A 1NW8A 2AEFA 2VLBA 1XNRB 5F2KA 2PUDA 4M46A 2JEOA 2B7BA 3WLEA 1Q74A 2XUGA 3SPXA 5AM2A 3K7EA 3B2EA 5ALUA 1T5IA 2AC4A 4PNHA 1AO0A 1NVDA 1QZXA 2R2GA 2WI8A 2YOHA 4NZYA 4EPRA 1H4TA 1JQ5A 1YA8A 3HADA 3M6VA 1Z8DA 1G2OA 1GPNA 1YIAA 1X7ZA 4V0NA 5J4LA 3TGPA 2IS1A 1XZ8A 3WGIA 4JQZA 5KJCA 5LP1A 1SC6A 1W88A 2B37A 2PS1A 2QTRA 3T3EA 1XDDA 3DNMA 3WYFA 4DNQA 1RPTA 1ZK0A 4D45A 4NCHA 5JZVA 3T1QA 1E6WA 4X24A 2PGNA 4R16A 1KMHB 2AA3A 5CUQA 3L6OO 3O83A 4YMWA 1H5UA 3L9WA 3LY7A 4Q66C 1I7DA 4L85A 4TS1A 1DKQA 1PSWA 1EFTA 3CMMA 5D01A 2G09A 4ZGGA 1AVTA 2Z09A 4EJSB 2FDRA 3AR6A 2ZRKA 2HXGA 4ZVKA 1RXVA 1VE9A 3BMNB 2QTGA 4L0QA 3VDNB 4L95C 1QGAA 3VSEA 4YAKA 1PYGA 1AUPA 3ENZA 3IKJA 5ED0A 4I36A 2ZJ8A 4A15A 1CDOA 3R8FA 3BUSA 2H1CA 3OY7A 3VV3A 1O2DA 5MHTA 2HHAA 3FTFA 3EUEA 3F3YA 2ZYTX 3PGVA 4FIDA 1YVEI 4LCEA 4GO1A 5AOVA 5C8YB 2QE7D 3C1AA 3IPRA 2OZLA 2OCAA 1QAMA 2FSHA 2WEKA 4J3JA 3PXAA 1EAMA 2QYSA 3D54D 2VAWA 4KRXA 5CDTA 1PU2A 1RFLA 2LNDA 3BTUA 4DA0A 4ZJUA 3GA0A 4ID3A 1FUYB 4LIPD 1QRTA 1R8YA 5DW0A 1IM5A 1WSWA 3HCOA 3ROFA 3PITA 2B25A 5I9MA 4TMWA 4C22A 5DGTA 1TYZA 1S1CA 3GFBA 5BYJA 3TQQA 2GXQA 1IULA 1ZFNA 4ZV7A 3ZCUA 3ZIUA 1V8FA 2X4GA 4NBKA 2VRNA 3AM4A 4LOJA 3ENQA 5TQJA 1WF6A 3ML1A 3EOAI 4OO3A 2YICA 2HOQA 3KOUA 1ZITA 1FC0A 4AP5A 2MSNA 4GR9A 3THSA 1WNTA 2QLBA 2GTHA 4MINA 1OZFA 4IQ4A 1L4EA 4KFTA 1DJPA 2ON6A 4OIMA 1YA6A 3OZBA 1ND5A 3T06B 3IP6A 2I2WA 4LZZA 4E2ZA 4EPXA 1WD7A 2XMQA 4DV5B 3MBIA 4DSAA 5AVOA 3AMVA 1RKUA 2GAJA 2OFXA 3BWCA 4ZO7A 1U3FA 1UJ4A 1Z33A 4UATA 4WACA 3ZGLA 1X1TA 4HDKA 1A50B 4UDXX 4C1BA 1MX1A 3AI2A 4AMVA 1D1SA 2A9KA 1NN5A 2I7XA 2GA9A 2ZWIA 3DKVA 4MCIA 1SVNA 3EXAA 2B3DA 5FCDA 3R6WA 3PGJA 2PAAA 3ZWKA 1Y5MA 3GNLA 1TU3A 1C0IA 1P3JA 1QHFA 1V2HE 3WLOA 3M2PA 3ZDYB 1GPYA 3TLCA 3KQLA 2XZLA 3L8FA 3WLMA 4G2NA 3V8NA 2JGKA 1PV1A 5JYDA 4GXQA 3ZNOA 4ZHQA 3UAXA 3L4JA 1TK2A 2RK6A 3J80A 1PS0A 1UC9A 2VNAA 3NBMA 3UG7A 4G5FA 4K8OA 3STXA 1F9AA 2P2SA 2CC2A 5TT1A 1LLCA 4GBED 3CA8A 5EP1A 1WWKA 3QBJA 5E8RA 1UM8A 5EHGA 3OE7D 3ULKA 1KEPA 2A9FA 5AVJA 4YCSA 3LO8A 2C5BA 4LJ4A 4ALIA 3UMBA 3A4YA 2P67A 2QJRA 2JAXA 1W5EA 4NMHA 4ZOLB 3V97A 4NFYA 4ZVMA 2JFPA 1DUVG 4CU5A 1CC1S 2GKOA 3AGPA 4WOCA 3O6VA 4DLXA 1F14A 4MV8A 1X15A 1U4OA 3P71T 4YMIA 3C15C 3EVBA 2NXEA 4FM9A 2OG2A 3COVA 1YC5A 1ZBDA 3FF4A 2IOQA 2YY7A 3BN3A 4OHBA 3KTDA 2VDUE 3IULA 3PNKA 1NSYA 3HZRA 3VNAA 2C00A 4RTPA 4GZLA 1NZJA 1ODTC 1IB6A 5AHXA 3T0GA 3NS7A 4QGBA 5HZGA 3OM0A 5E9QA 4HWSA 3RKUA 3U3MA 3GA5A 3KTOA 4ICIA 1DQYA 3JQCA 3S2YA 3UY4A 4KBYA 5F3RA 4EB3A 3BM5A 4TTAA 1CJUC 1TMKA 5AXAA 2O0LA 1JKIA 4V0SA 1PWXA 2BFPA 2JH3A 2QTMA 3K9LA 1ZNXA 3NASA 3CPEA 4Q7JB 2NG1A 3AV0B 4FT2A 1NRWA 1Z73A 2Y4OA 3H1FA 4OGFA 5E4JA 4MVJF 2F64A 2HJSA 1KXJA 5C8YF 3FRIA 3H97A 1WPXA 3OU6A 5T4EA 2PMFA 4AJNA 1RQLA 4L8FA 4PYQA 4RK0A 4YMUA 5CFLA 3GEIA 1ZK4A 3IR6A 2QIOA 3THXB 2CXUA 3EODA 4D42A 1MB0A 5JXGA 1GA1A 5PNTA 3IV6A 2DB3A 2W2TA 3BDAA 2QUZA 4J7CA 1AT1A 4HEQA 1SBQA 2FZWA 1XP5A 2V54A 2P30A 2AI1A 3DR3A 3PFGA 5ALZA 1P75A 3ZVNA 3S2EA 1C9YA 4NEHB 1LPSA 1XNJA 4G8BA 1DUIA 1LRJA 4BVLA 4HGPA 5A5VA 1TU4A 4KE9A 2A5LA 4H18A 5E4TA 2P9TA 3CSDA 4RSHA 5ISMA 3NEAA 4D81A 1JSCA 2OV2A 4LRTB 4PZZA 3U39A 3KFXA 3NJRA 4HAWA 4YRJA 1R9GA 4XOUA 1FB5A 3W5VA 2QD2A 2NU6A 1NONA 1EVKA 2NZJA 4NZNA 5CT4A 1T25A 1IZZA 1TUEA 2JCBA 5DXAA 2GPNA 4QFDA 5B53A 1I9GA 2ZJ4A 4PHGA 1Z18A 2QM8A 1RADA 2ZI7A 1XMJA 3WMGA 4IO1A 5L3ZA 1R7RA 2JI7A 1R5JA 1LFDB 4LSMA 3O1HB 1JHUA 2GPBA 4LBWA 3AB8A 3WDLA 5E8JA 3WLLA 2UDPA 2Z1DA 1M2HA 3DVSX 4FCTA 4CETA 1BSVA 1SCBA 2YFQA 3PPYA 5ALFA 1Y0BA 3LCMA 4EQZA 4KZKA 1PW5A 3DBOB 4RCZA 1CUGA 1EDOA 2CVZA 1T9AA 2NO6A 4J16C 3T7RA 3D4NA 3TCKA 2FB9A 1BCRA 5KMGB 1IN4A 2ZBVA 3WGOA 2P3LA 1I2ZA 1ILWA 1EVQA 2YJ3A 3UJPA 3H17A 4A8JA 4C6TB 1QORA 5KOJA 3SHTA 3H9CA 3A1WA 1SG9A 4BN4A 5HOEA 3GLFB 3GRKA 4MUNA 1N5RA 4ERNA 5B6PA 3OY2A 2E85A 4CM4B 1BVRA 2ZCUA 3HU5A 2JA1A 4I55B 4YBRA 3KDSE 4ZOBA 4ZOAA 1P44A 4ZU1X 4E2XA 1Q0HA 2IF0A 3S8EA 2AJTA 3WRWA 1ZN7A 2JVIA 2XD4A 3WWPA 2V98A 3MWKA 3G5UA 1G3UA 1A8UA 1T1JA 1N25A 1THTA 1TVCA 2XYGA 3EZYA 3MYRA 2CL0X 4IVNA 4C7VA 1FS5A 1QFJA 4TVBA 5C32A 5CLLA 2XQGA 2AL7A 4LBYA 1L0BA 4D0SA 4I6EA 3TUJC 3FCSB 5DNYB 3GV0A 4R2WA 3D6NB 2V5UA 3LPDA 4AX4A 1ISFA 5JH7A 4XYBA 1H42A 4I2NA 2CYCA 3ZI4A 3NONA 1R8JA 1GAWA 4CV2A 1JTVA 4DLAA 1XNQB 1SZDA 4HAYA 4OIFA 5LMNB 1RWPA 1B93A 1TTPB 1KY5A 1VYHA 4Y98A 5FO1A 4B4DA 4C4TA 1XCPA 4I4IA 1CIVA 2V9CA 3EOZA 3GB9A 4GMKA 4EKIA 5JROA 1L4BA 3BF8A 3IKTA 5EFOA 3E22B 4PG4A 4XFDA 2FMXA 3BHJA 3B8EA 2P6OA 1VECA 1KETA 4WUTA 5LUBA 3RCBA 1JKMA 3KQKA 2O8EB 4GMDA 5U4XA 1OI7A 5ERXA 1X1QA 1FJGB 3OU7A 5LQJA 5I9IA 1JQDA 2ZI4A 5F2EA 4B3IA 3RAFC 5CLHA 3ZNNA 4BTVA 1QAOA 1C1YA 2XUJA 4KW7A 1OA1A 5JE8A 4QU0A 1R27A 1RP7A 2AK3A 2PZ8A 3WZ2A 2GCPA 4ALLA 4ZO8A 1Y4ZA 2WG2A 5EKXA 4ZT4A 2WKQA 3UGQA 4ZCMA 1A8QA 1KJIA 3OIFA 3QJ5A 1JMVA 4CMHA 3AR4A 3CNEA 2FOLA 1Z16A 2YJGA 4HKTA 4IKEA 4LJLA 3AI7A 2HBRA 4WA8A 4W4TA 4XIGS 3WGNA 4F2DA 3D9QX 1TKCA 2Q1YA 4NJMB 4QOJA 4UEQA 4X84A 2IELA 3NC1C 4FYMA 4UVDA 1L4LA 1ZW6A 1QVRA 2VPWA 3IT3A 2EOAA 4HQNA 5EINA 3GXOA 2HFJA 1I4EB 4B71A 4HO1X 1Y4DE 1LBHA 1XELA 3SF0A 4QATA 2CNBA 4OBXA 4IRXA 3Q8KA 1X1CA 4ACAA 1THMA 2Q9AA 1SCUB 4B83A 4TRRA 2WE7A 4Q34A 1SM4A 4ZI7A 5JRDS 5KX5F 3UPTA 2QQ0A 3N2GA 3KQHA 1Z22A 2Y9MB 4M0CA 3IP7A 2HQRA 4LWOA 1P0PA 1XJQA 1KP9A 1Y5RA 3BGSA 1SB8A 1YFJA 2I29A 4NJOA 2AUMA 5C8ZA 5JO9A 2O7NA 2W2PA 5REQB 5CEJA 3D5TA 4MEJA 1KOLA 4MR7B 2QJOA 3NETA 2PH7A 5KNLA 4HDCA 1SKMA 1PLLA 2HMVA 3OMXA 2C8LA 1IJKA 2ATIA 5LQSA 3V8VA 2H59A 2P41A 4JLSA 4YAGA 2G67A 2LBPA 2ZE8A 1VA5A 2R5NA 1EIZA 2ZAGA 3C6QA 4HHEA 3U62A 3UAVA 1YR6A 1DEAA 4D82A 2DVMA 4MPRA 2ZYUX 3KWMA 1JB9A 4W99A 1G19A 1NMQA 1U28A 4QRIA 1JWAB 4QUJA 2C5HA 5CCDA 4RCVA 4AP6A 4RWEA 1NI4A 1O0SA 2FRXA 2GEDA 3DPSA 3OQMA 2AT1A 2R6CA 2IOYA 2X9QA 1KDZA 1NVAA 3RK4A 3CINA 3O95A 3QEMB 2QPAA 3B12A 1GZ7A 3K31A 3LUHA 2YXNA 2YYYA 3WLAA 2PZKA 4EYSA 1U7DA 4J0IA 3IOEA 4DE5A 1ZI8A 2AH5A 2DWCA 4BUJA 2B9VA 3HRIA 4GEKA 1V3VA 2OO5C 4OEHA 4UHDA 4A82A 4MWDA 1R0CA 3C8MA 3E03A 3PJFA 2H5LA 1SHKA 3NRBA 4QO8A 3QXSA 2XE8A 4G5YA 3KBOA 2VTEA 1HZJA 4EA7A 4L0CA 3MHPA 1QR2A 2J4CA 5TGZA 4R0MA 2EQAA 3KWLA 1ILEA 1R0XA 2OPBA 1LFAA 1YAHA 1H6AA 3LC7O 3NOXA 3EGCA 4MQBA 4U8GA 4BN5A 3B6IA 1NE2A 1DQRA 2ODBA 5K09A 3S29A 1IZ7A 3OU2A 2NQ2C 3PGMA 2R7KA 1PWZA 4KPGA 3TEMA 4KYVA 2HMUA 2X5XA 3A1VA 3LLMA 2CE7A 3C8DA 5C5IA 3RUIA 5DNAA 4DLPA 2AJDA 4REMA 3CZPA 3IR7A 4G4JA 3GFPA 4FLMA 2ZJFA 4OYHA 1TGYA 1EFLA 2IW1A 2VXBA 1QP4A 3C16C 4GRDA 3DBLB 4IH9A 4DLLA 3NGLA 1IB0A 4RZUA 1QG6A 3UA4A 2WR8A 3W8RA 2Z1NA 2WW8A 3R5TA 5CGZA 3ZWWA 1DEXA 2YBEA 3D4BA 5CX1A 2E87A 5JXJA 4IJKA 3WIOA 4EEXA 1J2YA 1OFHA 3I28A 4M2LA 5IT4A 4PCAA 2FG7C 3G23A 3UMMA 1JHVA 4JBYA 3P0HA 2JD0A 2RB4A 1B3BA 3UAOA 4JZKA 4C43A 3ANSA 2WVHA 4LKOA 2FW8A 3CUKA 1NBWB 3K8QA 4DMHA 2EBUA 3ZZ1A 2E5FA 4LYAA 5AI4A 2YXDA 2FVXA 5AHRA 4U63A 1OROA 2RIRA 1A9ZA 4M7OA 3TMKA 4F4FA 2LUOA 1XQ1A 3ZWNA 3ZLJA 4MVYA 1KAQA 4A8JC 2R62A 4CCYA 5FUWA 5JNUA 3EDQA 5B55A 1F0NA 1J6UA 1QDLB 3OT1B 4MYDA 4YP9A 1NI4B 4MV3A 3LUPA 3F5MA 4CQLA 4LXXA 1IUPA 1X7XB 1E4OA 5LYJF 1L6IA 4KQXA 1NLZA 2AHOA 1A2QA 1NURA 3AHCA 4GYWA 4LRYA 4NDAA 4NU8X 3FLMA 5D3KA 3A2MA 4RHTA 5EVCA 4AP9A 2H57A 1JA0A 4F38A 4X1YB 1UOOA 5LZ7A 1UKCA 3PPVA 1H9AA 1DKUA 1RI1A 4MWBA 2RH8A 5BR8B 3I5MA 1UUFA 1IY0A 1KDTA 5IVIA 4P5EA 2HMWA 2H0RA 3PQ7A 5EWJA 1OB5A 4KQMA 1GT6A 2PZLA 1DCMA 1S9DA 2AMJA 5LD2C 2ZJ1A 1RXEA 3H7AA 5CA0F 2Z5LA 1KJ8A 1G8PA 1NDUA 2C2GA 4FMPA 5A4DA 2A92A 3ZWCA 3HJCA 1T9GS 3IVGA 1JDPA 2QT0A 1KWGA 2GBCA 3P9XA 2ZR9A 4KNWA 5EE3A 2GCOB 4YGXB 1F3OA 2FSUA 1V26A 5HKAA 4UHHA 3IUNA 4GZ6A 1M8JA 2AFIA 1AS3A 2ZE7A 3KQOA 4NU6A 1GL7A 4DRYA 3AKZA 3HEBA 3NNDA 3ZLTA 4MQ5A 3ABOB 3HB4X 5C8DA 2IZ1A 1FX0A 1D2AA 5C4GB 1ZD9A 3ZJTA 3VR5D 2F17A 4D0NA 4W7IA 3PFNA 4MUEA 4QBFA 1OLSA 3VFDA 1TFUA 4PLYA 2QN2A 1UMBA 4CMKA 3PUVA 1D5CA 1KMIY 3NPAA 5F51A 1U7UA 2REBA 3L7AA 5FRDA 1FDWA 1ZD2P 2G77B 1C30B 1NPDA 4R40A 4MRVA 4PBTA 1HTTA 1SA0B 3AEUB 4PGHA 3V8MA 3JATA 1GUAA 4YI5A 2XDQA 3CUWA 3DL7A 2I2CA 4Y2JA 3DEZA 1RHQA 3DVAB 3O9MA 4FSDA 2B5WA 4G23A 2AMVA 2O23A 4LY3A 4UULA 5FPKA 3MT9A 1E4EA 1ZJJA 3GDFA 1UK9A 2DPMA 3KAKA 3N8GA 3A1CA 4G6ZA 4IYJA 3DP9A 2HREA 4MI1A 1VA4A 4BLPA 2WT4A 3ZCXA 5K3OA 4FEEA 3LRPA 3NAZA 2UZAA 3PEUA 3CR8A 3QGMA 5G0UA 4TYWA 4X6XA 1HOXA 2GFQA 1NFQA 1XUOA 3AETA 3HA2A 4BCCA 1YFLA 3THYA 1TOAA 3AKYA 3NR2A 4EHBA 3TJZA 4LZAA 2V6FA 3E2PA 1RLUA 1IDN1 3KALA 3VPAA 5L3SA 5FUBA 3C3EA 3NAMA 4S2UA 1NVKA 2PWBA 1UFKA 4KXVA 2PXHA 3V1LA 4E09A 1DINA 3ICPA 3TN7A 4MS3A 3INYA 4MVXA 1WSDA 3BSSA 3G82C 1RMYA 1YDGA 1PJZA 3UMGA 4TXJA 3RS7A 4EUNA 3IAUA 1T0HB 4L4UA 5L45A 5B1HA 3QJGA 2Q0SA 1SZCA 4YFVA 4FINA 5C2JB 5B30A 3STUA 2D8AA 5CDHA 1VL5A 1SXGA 3OZEA 2GYYA 1AH2A 1M0SA 3EXEA 1FW8A 1G59A 4JYAB 1UPXA 2GCOA 1WCXA 4O6VA 2VBIA 3BDIA 1RABA 3GRPA 1XAJA 2OV3A 5G3YA 4ADSG 1ACLA 4ZTZB 5IX8A 1I32A 2Q1XA 4O2BF 2ECPA 1N5JA 1L8QA 1UDAA 4KMOA 2FI1A 3UBMA 3VOAA 1QRRA 2XBMA 5BXYA 2NWQA 3I2FA 3P97A 3BB3A 4Z8XA 5B3JC 4RVFA 4LF6B 4N41A 3KKQA 3KUXA 4E13A 2PLRA 1VPTA 2VOJA 3ZTTA 3B3AA 1IN5A 2OAEA 2IODA 2EZUA 1E1MA 3M2TA 4LI0A 4B1FA 5K3FA 3EAFA 3QVJA 4OI0A 3AVYA 3R24A 5EGSA 1PGQA 4L0MA 1J2JA 3OIWA 2G9VA 4NAHA 3BWXA 3FFBA 4F9TA 4IBOA 3TCNA 2Z2IA 1OVMA 1SXJB 4MQ4A 4BX9A 1XLTA 4V1CB 5JMWA 3IQDB 5CA0B 3B48A 4RLSA 3BH7A 4EZBA 3W4JA 1MGPA 3A1DA 5ER6A 3ADDA 4DLBA 4FEYA 3JARB 4PYNA 3H65A 5A0FA 4PZPA 1NUUA 4MUXA 3BK1A 2IYUA 3REQB 3U1VA 5JUWA 4W5OA 2X9VA 5MN5A 4J0QA 3P9IA 4GPTA 1SG6A 3KSAC 5K3EA 1TJNA 4MS1A 2BPOA 2H1IA 1K4MA 3AF4A 2Y2UA 2WSBA 4AMBA 3TAUA 1M8PA 4C2UA 3VAYA 3H4IA 1XJ0A 2PWPA 4CIBA 3G9UA 4HAVA 4F5YA 1QVAA 3M6XA 4ZXPA 1UC8A 2W6ID 4C7OA 4PZEA 4ZV9A 3VJMA 2I9KA 2QTCA 3P2JA 3WYGA 4FZJA 3SHOA 2QL7A 3DFUA 3IJPA 3LO5A 5AI8A 2RDMA 2PL3A 4UXJA 2ZCJA 4JJEA 4MR8B 2JCXA 2F1RA 4PX3A 4PXSA 2G4CA 3CKMA 3KHSA 2XUQA 2QV0A 4URYR 2KJQA 3OT5A 3ZG6A 5CEEA 5ITWA 3OAAD 1JLKA 3JD1A 1IE3A 2FR0A 3QVGA 1D2RA 1OT5A 3B6MA 4NYIQ 3T8YA 5C7YA 1J8DA 2R97A 4CZ2A 1M73E 3N2YA 4GL4A 3IPLA 5LA6B 1IMJA 1JA9A 1VDZA 2JIQA 2WU3A 2G63A 5TPZA 3WWEA 5FWDA 1D0IA 1TA0A 3URKA 2VUSA 4KITB 5DF1A 1N1GA 3B9QA 3RC1A 1RHRA 3SDSA 5IT5A 3ZIAD 4BNGA 4JA0A 1QCDA 1TUIA 1NNUA 3WDMA 4UPEA 5CTJA 4F3KA 2BUCA 4DWVA 1CUXA 1QC5A 4TZTA 4YRBA 2WJJA 4F0JA 4OK6A 3VKWA 4YRSA 1YBHA 5K4HA 3WNBA 2X2OA 2FPIA 3DD1A 1JFRA 2QMEA 3QEMA 2W98A 3THRA 1QF6A 1OC4A 4MS4B 5E9AA 2NADA 4EL5A 1HDZA 4WY2A 4WY5A 1JDNA 1H2AS 1P1IA 1PGNA 3OZGA 2G0NA 1DG9A 3HV2A 4ONEA 2C0PA 4P33A 3CX3A 1DIBA 4TROA 4AF7A 2Y1WA 2IIQA 1KU6A 2O8DB 3DV0A 1JQEA 7MDHA 2O3TA 1CY1A 1SVKA 4HB3A 4MUGA 5FNVB 1T4GA 2FFJA 4J0HA 3C3JA 1YE8A 3KOYA 4GXTA 4U0KA 3SIXA 4B32A 2FK7A 2QE7A 2YUTA 3Q7PA 4GYKA 5BO5A 2YWXA 1DU4A 2EEPA 2ZJ6A 3H87A 4FOLA 4W6QA 2W2XA 4FGLA 5LZ4A 2XKKA 2OLKA 1UKAA 4CN9A 2ZJZA 2P11A 3RRYA 1QFSA 2O2IA 4JT2A 3RVDA 1Y63A 2JVKA 3TRIA 1TCBA 2QHXA 4O2BB 5DK4A 1VI2A 1X0XA 1BX0A 1PHRA 1GZ3A 2JZCA 3UJAA 1EVLA 3L40A 4BS9A 1ORVA 4DEVA 1ITZA 3LCCA 1G9XA 1UEIA 4IX1A 3CVWA 2GCIA 2R9VA 4J3FA 4PNPA 1HORA 3BMCA 4WK2B 3WRYC 2P5TB 1V0JA 1Z9BA 4RD4A 4IOKA 3TLYA 5SZHB 1VIAA 1GGJA 3Q2KA 4KAFA 2I55A 3DHVA 4P81A 5ER9A 2VC2B 5DW3A 4L8LA 4PYKA 3CWZA 1RYYA 2Q5LA 1T43A 2C3OA 3GRUA 4B76A 2F3UA 4CL2A 1ZI9A 3TEFA 3ZXIA 1PFUA 4DADA 4K7J