2PD4A

Crystal structure of the helicobacter pylori enoyl-acyl carrier protein reductase in complex with hydroxydiphenyl ether compounds, triclosan and diclosan
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
274
structure length
274
Chain Sequence
b'GFLKGKKGLIVGVANNKSIAYGIAQSCFNQGATLAFTYLNESLEKRVRPIAQELNSPYVYELDVSKEEHFKSLYNSVKKDLGSLDFIVHSVAFAPKEALEGSLLETSKSAFNTAMEISVYSLIELTNTLKPLLNNGASVLTLSYLGSTKYMAHYNVMGLAKAALESAVRYLAVDLGKHHIRVNALSAGPIRTLASSGIADFRMILKWNEINAPLRKNVSLEEVGNAGMYLLSSLSSGVSGEVHFVDAGYHVMGMGAVEEKDNKATLLWDLHKEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
publication title Crystal structure of the Helicobacter pylori enoyl-acyl carrier protein reductase in complex with hydroxydiphenyl ether compounds, triclosan and diclosan
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Oxidoreductase
total genus 91
structure length 274
sequence length 274
chains with identical sequence B, C, D
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2007-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2pd4A00
2CDBA 3D3EA 4WNIA 4CQMB 3QJ5A 2ZTMA 4UVEA 3N58A 2RH4A 4DQXA 4YAGA 4FN4A 4UULA 1HE3A 1HZJA 1HDRA 5KVVA 1U3VA 1HSOA 3AI1A 3DBLB 4DA9A 3PFWO 2PA3A 4JP3A 3R3JA 3R0IA 1JWAB 2JJYA 2PKQP 3DONA 3DZIA 5C5IA 3VOSA 4YJGB 4D3SA 1KERA 3CE6A 2JD1A 4YAIA 4IY1A 2BFPA 1J49A 5KNLA 3PI7A 1Y5MA 4BO7A 4BKRA 1CERA 3GGOA 1X14A 2VNAA 1F12A 5IDYA 3UAGA 4JN6B 2NU7A 3G1TA 3Q3CA 4IS2A 5EINA 2A35A 3L07A 2I3GA 2C59A 5HRUA 4N7RA 3FN4A 2BRUA 2X9NA 1UDBA 1P9LA 1P31A 1E92A 3U4CA 1E1NA 2VHWA 4KUGA 5F5NA 4DPLA 1ENPA 4OSPA 1KEWA 4O5OA 4YBZA 1Q7CA 3WICA 2ZIZA 1P45A 3IC5A 2YQ4A 4NNJA 1FMCA 3C1OA 4J1QA 1DXYA 1NWCA 3H9UA 2YHIB 4Y6SA 3DBHA 5I8ZA 4WEOA 2WDZA 3U4HA 3GAFA 3CTMA 4OKIA 1C1DB 3K31A 2NSDA 1K89A 1XWFA 5H83A 4D3DA 2E6UX 2H1SA 4FGSA 1K0UA 5F1PA 5JPIA 5CG1A 1PIWA 1DB3A 1I10A 2AQHA 3IUSA 2JCVA 2JCXA 1E0DA 1PL7A 4BNLA 1CETA 1ZXBA 4MDHA 4BNWA 3KLPX 4AICA 1QSGA 5L95A 4FC6A 3HADA 4XD2A 2W2LA 4XIJA 4E5PA 5CAEA 3E9NA 4J7XA 5T8KC 4CJXA 5BSFA 4GWGA 4WUVA 2O3RA 1VKNA 3KEQA 3HDJA 3RC9A 3U49A 1LJ8A 3ONEA 3RCBA 3FRJA 5A04A 4LSWA 3UVEA 4RVSA 1U9JA 3ZH2A 3K96A 1CF2O 4GLOA 2WD8A 2IXAA 4IQ8A 1RM5A 3TDKA 2O7QA 2DM6A 5COQA 4PLHA 1DIBA 1CDOA 3BXXA 2RHCA 3GGGA 4IQGA 4Y8VA 3HG7A 3PJDA 3GK3A 1I30A 3P5SA 4R1TA 5KKAA 2Q1TA 4OGWA 4URFA 3PHIA 1LRLA 3L9XA 1Q0LA 1M75A 3G0OA 1JKJA 4OYRA 4II3A 2X5KO 1UXJA 1ZSYA 1D3AA 3VZPA 2EGGA 4PRLA 5AXDA 1TT7A 3VZQA 2VNSA 2X5JO 3Q11A 1PWZA 2CUKA 5FI5A 4PRKA 1HWYA 1PL6A 5C3MA 3JQAA 4UUOA 2VN8A 1U4SA 1V0JA 4ZU3A 3JQDA 5EIOA 3WQSB 1N92A 1GQYA 1PJTA 1YQGA 4RDHA 1IY8A 1T25A 4K6CA 1MP0A 3JQ9A 1LX6A 3LLSA 3QV1A 1BGVA 5DCWA 2D8AA 3DZFA 1DC5A 2OP0A 5CDGA 5IJZA 1NP3A 4A26A 3SC6A 3GR6A 1Q7BA 1ZXLA 1T2EA 3T7CA 2DBVO 3HWRA 3P7MA 1H6AA 3PFFA 1XLTA 3DEYX 3GVXA 2O2YA 4IJKA 3PZBA 3NJ4A 1F8FA 3NEPX 1DAOA 5F1KA 4M49A 4FBGA 3SLGA 3WGTA 4B7XA 1L7DA 1HXHA 5C7LO 2EWMA 1ZSNA 4CQLA 4J43A 1E3JA 1WDLA 1BW9A 2GD1O 5TX7A 3DWFA 1N9GA 1XU9A 1PR3A 3F1KA 2VHZA 3EGOA 4E31A 1FDUA 3CPSA 3UW3A 3M2PA 2J3IA 4QECA 3GUCA 3AOEA 4UEOA 5DZSA 4E5YA 1SOVA 2GUGA 2FY8A 4E33A 1HDCA 3DBHB 3I52A 4MVJM 5FI3A 2UDPA 5L7TA 4K28A 1XELA 2AG8A 2X9GA 5FF9A 5B4VA 3BAZA 4YT8A 2YFQA 5JC8A 4BKUA 1DRWA 1ULUA 1VLLA 2AMFA 2BGLA 2J5QA 2PZLA 4IMRA 1W4ZA 1VL6A 2V6MA 3A1NA 2AEFA 2BKAA 3QWHA 2E4AA 2X0IA 5COAA 1SAYA 1W0CA 2HJRA 3GF4A 2NVUA 4OO3A 4BIIA 4BNJA 3FHLA 2Y66A 4U7WA 1K5HA 2AHRA 2Q4BA 3E5RA 3TZKA 1SPXA 1UDCA 3N74A 1RWBA 2FR0A 3H9JA 3PRJA 1Y7TA 3B6ZA 4MKRA 4Q3EA 1DRUA 3UICA 1R4NB 4I1IA 2EKPA 2QRKA 2EIHA 5U9CA 1UZMA 2YV1A 1QKIA 2AQIA 3ON5A 2FR8A 4GMFA 4DBVO 5I7VA 1NXQA 4DTIA 5IZ4A 2DTXA 3JV7A 2B5VA 1NTOA 1R12A 1T24A 2BD0A 2OHXA 3AK4A 2DBQA 3WB9A 4FFOA 1MV8A 1N1EA 5G0UA 5TF4A 3HUDA 5FEUA 3ORFA 4BGUA 3RBVA 1UXHA 3C85A 2B36A 4B4WA 3DHYA 3ASVA 3ZU4A 1N7HA 1UH5A 2DTDA 3W6ZA 5A4DA 1XHLA 4LW8A 4IXTA 3CEAA 3IUPA 2OUIA 1HDOA 2AQKA 2WSBA 3RBZA 3AOEC 4YT5A 4BNNA 4YT2A 3GZNB 1U5CA 4HY3A 5JYEA 3IJRA 3JQ7B 3GC6A 3P19A 2W90A 4BGVA 1VJTA 3GVPA 1BXGA 3ITKA 2B4RO 1XCBA 5EPOA 2VOEA 5EERA 3IAHA 2POQX 3TOZA 4XR4A 1BWSA 4YEDA 2R00A 2J3JA 5AYVA 4P4LA 2YV3A 4CM9D 1BVRA 1RYEA 3S2EA 3W4JA 4EJ0A 3OEWA 1E3LA 4D79A 1B3RA 2HMVA 3OHSX 2PTGA 1FDWA 4MPDA 4N5MA 3ST7A 1X0VA 4M86A 4UUPA 5K6AA 4QFCA 2TMDA 3HQ4O 4IJUA 4M54A 3VDQA 2FOIA 4CM4A 3DDNA 4CMIA 2FPIA 3PWSA 1XU7A 5TT1A 1T2AA 4J2HA 1ZUD1 1XIVA 3NTQA 2JFFA 1MC5A 4A5OA 1OC2A 3I9JA 4E12A 1NPYA 1YH3A 3WIDA 2O4UX 1PZFA 4DC0A 3TZCA 1LNQA 1P1IA 3KVOA 4XYGA 2BELA 3CZRA 3TQHA 4PG6A 1I5RA 3N7UA 4IBOA 4ND2A 5LDHA 1A9YA 3E6AA 3K92A 3RBXA 2YY7A 5JCXA 2GERA 4XRGA 1ZIDA 1HF3A 4XYMA 5CPFA 4BMSA 5EN4A 3WGGA 4FQ8A 2DQ4A 3DZGA 2EW2A 5DT9A 2O3SA 1RPNA 2JKVA 2FPGA 2O23A 2V65A 3D4OA 4ND4A 4R1SA 3MOIA 4Z9FA 4XQ9A 3K5PA 3HDQA 3DAFA 3NT2A 2NVUB 5LDGA 4P4GA 8LDHA 1YBMA 3HNPA 3M6IA 1JA9A 1ZVMA 4J4TA 4AJ2A 4W82A 3LT4A 5KVCA 2ZKLA 3DMYA 3O8QA 3SC4A 1T2CA 1P1RA 5L4LA 2DUUA 4Q3DA 4D44A 2R00C 2OO5A 3JQEA 5JNLA 1EUCA 3WGHA 1L7EA 3ADOA 4JXKA 3VH2A 2AEMA 3JD1A 1U3WA 4UVDA 1F06A 1SB8A 4AVYA 3WJAA 3BHIA 2FZWA 4NBVA 3M2TA 4HADA 4IM7A 4KMSA 2C20A 1FXSA 3O26A 1E5QA 2D5CA 4RQTA 5B12A 1DRVA 4GMGA 1QYVA 4E3ZA 4JP2A 1ZFNA 2BGMA 4QO8A 1MGOA 3STHA 1F17A 1LDYA 1HTBA 1G6KA 1JAXA 3WMXA 4QX6A 3KM0A 1C1XA 3BYZA 4KDFA 1I2CA 4HFRA 5IF3A 3LC2O 1YL5A 3KSUA 4H7PA 2ET6A 2B4QA 1MXFA 2CDCA 2CVOA 3QA9A 3WGQA 1CYDA 3EMKA 3QRWA 4NJOA 1IZ9A 2NU8A 3PLRA 1KETA 4Z9YA 4ILKA 2WM3A 2V7PA 9LDTA 3ROKA 1NNUA 3D3WA 2BI7A 4N54A 1BXGB 4DLLA 3ZGYA 4J3FA 4K26A 3DTTA 4TQGA 4RL6A 5CDTA 3OA2A 2AA3A 2EP5A 3L6DA 4DIFA 2NADA 1YGYA 3I5MA 4Q9NA 4J4BA 2RIRA 2YYYA 4WPGA 6LDHA 3AWDA 2FR1A 5I9NA 2XF8A 1GCUA 5B1YA 2VYVA 1N2SA 3JYNA 4ZQFA 1H2BA 2AXQA 3B1KA 4WCDA 3ZWXA 3BMCA 3H9EO 4L4XA 4NU5A 2W2LD 3VH3A 1WWKA 4CM4B 3ZW9A 1ADCA 1VRWA 1ZW1A 2HMUA 1VE9A 4IQ0A 4O59O 5CG2A 3W8EA 1BDBA 2QQ5A 4Z9XA 1IULA 4IDFA 1A71A 4JBGA 4QSMA 1IYZA 2LDBA 4AJHA 3EHEA 4IDEA 3GT0A 5A5FA 4B7UA 2NM0A 1EQUA 2IE0A 4DC1A 3OA0A 1JN0A 3E9QA 3DTYA 4D43A 2WYVA 1NR7A 1Z7BA 5KTKA 4TMFA 2ZTLA 1GD1O 1OFGA 5U4QA 7MDHA 4WE3A 2VRBA 1B26A 2GZ3A 2FSSA 1IE3A 1VJ0A 2ZTUA 1LQTA 2EKQA 3S2GA 4FFRA 3TN7A 2IEDA 1GCOA 2VZ9A 1JLLA 1Y9EA 3NJ8A 2P5UA 1I3MA 1O95A 4EEZA 3TFOA 4JNKA 2PZKA 1M66A 1DEHA 1HLPA 1QR6A 3ROQA 1ZMOA 5CP8A 3GAZA 1W6UA 2ZYDA 4WK6A 1H2HA 1H94A 1PZHA 4TRMA 2JAPA 5ER6A 2QW8A 2UUOA 3PQEA 4ZD6A 3U9LA 4DVJA 3JQAD 1QXSA 2FRDA 4AJLA 3O8QB 2O2SA 4E4YA 3JD2A 3GFBA 4NFYA 4BL5A 2C7VA 3MJSA 2R6JA 2Z1NA 4NBTA 2FP4A 4RVHA 3TPCA 2X4GA 3RASA 3OIGA 4CQMA 2ZQYA 3FF4A 3W8DA 1ZKMA 2Y1CA 4YJFA 3KTDA 3EZYA 1EBFA 2VUTA 3V1YA 4F46A 1NQOA 5JXWA 1F0YA 3OJLA 3DBLA 5I9MA 3GQVA 1LDMA 3P2YA 5JY6A 3ZV5A 5A02A 3RC1A 3QQPA 3KO8A 4Q3AA 4PG7A 3INRA 4YJGA 2Y1GA 4OHUA 4NFHA 3F6YA 4GH5A 4OMUA 3QWBA 4BKPA 4M87A 1N1GA 4XJSA 1QORA 3H3JA 1GEGA 1TVEA 1I3KA 1S7CA 2G5CA 3ETDA 1MX3A 3UCXA 1PJ3A 1O94A 3IIEA 5L7WA 1KBZA 5L45A 3K30A 3FR7A 3SEFA 3ZWWA 5JLAA 2I67A 5A03A 4GSLA 1ZK2A 3W6UA 1G0OA 1QP8A 1PJCA 1ADBA 1P77A 1PGQA 2C2YA 1E7RA 3VH1A 2GASA 4R9RA 3WR5A 1YQXA 2GO1A 3F46A 3VHRA 4J7CA 5KVQA 1KVQA 3ICPA 3ROPA 5T67A 1QV6A 4ND1A 4D42A 1IUKA 1Y5RA 3D5QA 1F14A 1OOEA 4DXHA 3IDSA 1ADGA 1ISHA 2PZMA 4A7PA 2Q50A 2HO5A 1WZEA 2YHIA 1DLIA 4DLAA 3CKYA 4GLLA 5TS3A 4A03A 5TLSA 1QRRA 5HTOA 3QVOA 1C1DA 2AQ8A 4IINA 4YRAA 4R01A 1ENZA 1ZEMA 1VL0A 3VTFA 1YDWA 4E0BA 2GF2A 4LN1A 1MG5A 4CLRB 4FFLA 2I76A 4CLXA 3TJRA 4FS3A 2NTJA 1PJSA 2HK8A 3D7LA 4B7CA 2PV7A 4E6PA 3D1LA 3HFSA 2QRLA 3DO5A 1BHSA 1N7GA 4R69A 1GUFA 3MOGA 3OJ0A 1P0CA 1HDZA 3OM9A 4J9VA 3Q9NA 1YXMA 1N8KA 4J49A 3B20A 4I5FA 4IGFA 4BO6A 4CV3A 1GZ4A 2OGUA 5EQFA 2P4QA 4MVJE 1CWUA 4EJMA 4XX0A 3L6EA 3EUWA 3MJCA 5IDWA 1TLTA 3VPHA 2Y1EA 1CEQA 4ALMA 1LLUA 5JC1A 4XYBA 2Q46A 1XQ6A 3BMOA 3VTZA 3Q2KA 2XOXA 1U3TA 4WNCA 5DOZA 4E13A 4OM8A 3T7EA 1TT5A 4EJ6A 1GDHA 1K6IA 1GV0A 3C1AA 4WECA 3ZWAA 2G1UA 4ZICA 5F21A 2OOSA 1T4DA 1I36A 2OFPA 2JCYA 4U8GA 2UV8A 3PQFA 3KRTA 3JQBA 3KUXA 2VHYA 1IZ0A 2DAPA 4WLEA 1R0KA 1AE1A 3PHJA 3JYLA 1OMOA 1WPQA 5TNXA 2Q1SA 2ZJ1A 4YJFB 1GQQA 4BGIA 1U1IA 3DZBA 4XQCA 3RROA 5CDYA 1JVBA 1GADO 2O3QA 5BNFA 4NHEA 4BUCA 3OF2A 1UZNA 2PGLA 3RUHA 3I1JA 3KV3O 3L4SO 3MJVA 1VL8A 3OJOA 4JJFA 4J0EA 3V2GA 4EZBA 4YPOA 3QWFA 2EKLA 2HK7A 5DF1A 1T4BA 3DL2A 4XB1A 3H8VA 2HK9A 2A9FA 2BFMA 2Q1UA 2TMGA 1LC3A 1R16A 1LRJA 4WLFA 3GMDA 1UZLA 5AOVA 1HYGA 5ER9A 4QT0A 4JBHA 5G0TA 3C7DB 1S6YA 3QWAA 5IXSA 4R68A 4RVFA 4YAKA 1KVUA 3JQCA 2C5EA 3K6JA 1B8VA 3KYDB 4ND3A 3IKTA 1WW8A 4M8SA 5GY7A 4BNZA 2A94A 2ZB3A 1NAIA 4TWRA 3I23A 1ZK0A 2Y68A 1DFGA 3CMMA 5T57A 2FWMX 4DPKA 1FK8A 2HMWA 3WFIA 1DJQA 4RVUA 1GU7A 4LCEA 2EGHA 4W7IA 3AUAA 2Y0EA 2P9GA 4RF4A 5DBFA 1A4IA 1N5DA 2X22A 4L9RA 2GLXA 4CM1A 2E48A 4TZKA 3MWEB 3NTRA 2PGJA 5TT0A 1OC4A 1UDAA 5DBGA 4D0RA 3H6KA 1VC2A 2BMAA 3H9GA 4DWVA 4FOOA 5IDQA 4IJWA 1NAHA 1W8DA 2Y99A 3H5NA 3RQSA 2I99A 1E3WB 3KOUA 4YRBA 1R4NA 1HE5A 1DIHA 5DP1A 1YOVB 4L0QA 2ZYAA 4YJHB 4I8XA 5GMOA 4J7UA 3W1VA 1U7HA 4CLOB 3PWKA 2VRCA 3ADPA 4R54A 1TA4A 1V6AA 1MUUA 4AJOA 2QYSA 4YCAA 1GUZA 4IDCA 4WCFA 5C37A 4OJNA 4PLYA 2VQ3A 4D3FA 4R51A 1D8AA 3BMOB 3WX0A 2NNLD 3IP1A 3I83A 4Y9DA 4KOAA 1TT5B 4JBIA 4TZTA 4B4VA 1LSUA 4PLVA 2WE7A 2CSUA 1ISIA 1PU2A 1PJ4A 5G0SA 1SB9A 4U6SA 4ZGWA 1X7HA 4GX2A 1YVEI 1E7QA 4XJTA 1MFPA 4TSKA 5BSEA 4CM6A 2YW9A 2DC1A 2X1HA 4DRYA 5KJFA 3I4FA 3AY3A 1ORRA 3RI3A 3HN7A 3PDJA 4PG5A 3V1UA 3E8XA 1V9LA 4J2OA 2GCGA 4FFMA 3GZNA 3U4IA 2H9IA 4DQVA 5C7OO 4RGBA 2IYOA 3JQ7A 2HMSA 4Z3DA 3AM5A 5CFZA 2RBEA 4CMEA 1DAPA 3NGLA 5HA5A 5ENDA 2VUUA 2HAEA 2VYVD 2NV6A 3WOHA 3H2SA 5IDXA 1E1LA 3HDYA 4KQWA 2GSDA 4GVXA 5KVSA 4BNTA 3KZVA 5KWEA 1DDOA 2NVBA 4FPXA 1I3NA 4WLVA 5GZ1A 4XRRA 3GUYA 2CY0A 4BO8A 1EVIA 3L6OO 2V6BA 1CQIA 2WYUA 4N5LA 1PJQA 1AN9A 3AOGA 5CPBA 3GH3A 4TRRA 3RC2A 3VAZA 1A5ZA 4YAJA 2O3JA 4R16A 3KYCB 3DMTA 1NX6A 1SOWA 5A5EA 3CUKA 1PZEA 2P68A 3EZLA 4CMHA 1R6DA 1UXIA 1Y9AA 1E7MA 4CMKA 3CXRA 2R2GA 1IHXA 2WEKA 2A4KA 4PZDA 4TKMA 4O6VA 3H7AA 4WLNA 3GVHA 1LLCA 1XGKA 3T4EA 4GQAA 4Y6RA 4BVAA 1O5IA 2ZJ0A 2FHSA 3ANLA 3EC7A 2FZEA 1FDTA 3JYOA 1NYTA 4FGWA 4KWIA 3JSAA 4CMJA 1KYQA 3RKRA 2VWGA 4LMPA 1PZGA 1VM6A 3VVBA 1A4UA 3HE3A 4A2CA 4ZQBA 4PVCA 1EK6A 4INAA 4MVJH 3C1TA 2Z5LA 1PQUA 2B35A 5JCJA 1YJQA 4RCVA 3R6DA 1E3EA 4CQMD 1Y1PA 3TZQA 2X23A 2NWQA 3JYPA 5BSGA 1OBFO 3A4VA 1IL0A 3ETEA 3S2FA 1BG6A 4FIZA 3ULKA 4CMEC 1YKFA 3JQ9C 4OXYA 2PKRA 3WGYA 4MIOA 3UFXA 1AHHA 4RPLA 4BNIA 3OETA 1B15A 4A27A 2PZJA 2PFGA 4GX0A 2B0JA 3RAJA 1ENOA 2JFGA 1P1FA 3ZCXA 3IS3A 3GEGA 3GGPA 1LQUA 4FSHA 4Z0HO 4NR0A 1XA0A 2EXXA 3PJGA 2W98A 4TVOA 3DOJA 2CD9A 4HP8A 5THKA 1YO6A 3M1AA 4WCFB 1KY4A 2H5LA 3EYWA 4XEHA 3VZRA 4DREA 2W2KA 5BSHA 2GN6A 5GZ3A 3ZWNA 5KKCA 4DBZA 2FSVA 2BGKA 3ZWVA 3F5QA 2Y1FA 4GVLA 2BFAA 5U1PA 3ZN2A 5DULA 4OQZA 5CDSA 1OAAA 5JW6A 2P9CA 4BNXA 5HS4A 3PYLA 1QYXA 2PLAA 2YDXA 3SJUA 2GN8A 1LDEA 5LCXA 1NWHA 3WJ7A 3WDSA 3V5NA 1YL7A 3RIHA 4ZQEA 3M1LA 2GRAA 2IZZA 4FOSA 3GPIA 2PR2A 1KOLA 1V3UA 4PCVA 1HKUA 2VZ0A 2Q2VA 3I3OA 1JAYA 4U0JA 5BNTA 2NU6A 4CM7A 1M76A 1Z7EA 4BNGA 1EQ2A 4JCOA 3E82A 3W8FA 3ENKA 5CEFA 1ONPA 2F00A 3L0DA 5C7IO 1ENYA 2E82A 4YRDA 5KIAA 1H9BA 2PK3A 3RUIA 1KEVA 3OBBA 2CFCA 1I0ZA 1U5AA 4H3VA 3ZZNA 2DFVA 3Q0EA 1ZK1A 3H3FA 2X9VA 3WWYA 4ITUA 3HB5X 4NDNE 4KZPA 3HDHA 3GG9A 1ML3A 4B3IA 2VZ8A 1WDKA 3UKOA 4B3HA 4FW8A 2HUNA 2CF6A 3H65A 1ONOA 3OSUA 3WYCA 3ZI0A 4BNKA 2DVMA 1B0AA 1DOHA 1HYEA 2D3TA 5KJCA 1NFFA 4CM8B 2Q49A 4RLSA 2W8ZA 3AI2A 5IZCA 3VPSA 1WAMA 4MP3A 1ZK4A 5TQVA 1GQ2A 1SEPA 3MCVA 1M6HA 3E18A 3CIFA 3RD5A 5EQDA 5AXCA 4WLOA 1XSEA 3S55A 1EBUA 2C5AA 1PL8A 2B4TO 3U62A 3TZHA 3GRPA 1YBAA 3ZWOA 1UP7A 1V3TA 3FD8A 2WYWA 3LF2A 4Q39A 3WBBA 4BO9A 4D0SA 4F6CA 4UVHA 4RF2A 3JD3A 3VDRA 1G1AA 2JAHA 4NBRA 1H6CA 3KLMX 1PS8A 1NASA 3GRKA 1PGPA 4PLCA 3WTCA 4RJTA 3WBFA 1WMAA 3V2HA 4I9NA 1P33A 1BXKA 1ARZA 1YDEA 4UUNA 5TC4A 5KJEA 4I5GA 3OQBA 2XXBA 3GHHA 4LSMA 3BHJA 2HSDA 2QZ9A 4NBUA 2J6IA 3O4RA 4L4RA 3QIVA 1LTHR 1KC1A 3FR8A 4OIMA 2Z1MA 1XDWA 4CLDA 4MP6A 4IJVA 3HJAA 4CUZA 2Q4EA 3LC1O 3UUWA 4R3WA 3OFSA 1R0LA 4FD3A 4YVFA 3KSZO 1I3LA 4AJEA 1Y8RB 5A9SB 4II2A 1X13A 4IIUA 4XYLA 2CVZA 5K6AC 4CLHA 1KS9A 3FTPA 5TJHA 1WMBA 4XA8A 2W2KB 4C4OA 1HL3A 3FBTA 2FPPA 2GPTA 1Y6JA 3F5SA 3GA0A 3FNEA 4HBGA 5ES3A 2W4QA 3VPFA 2O48X 4Z0TA 1IOLA 1KVTA 3FSRA 3DFZA 3C8MA 3F3SA 5IAAA 1EDZA 3I9MA 3MWDB 1HE2A 3DZJA 4J16A 3C24A 4PZEA 3RUAA 3ZHYA 1GYRA 2HU2A 5I7SA 4XYEA 3AFNA 4J1NA 1DHRA 4JX8A 5DOVA 4J91A 1C0PA 1CRWG 4CMGA 3C7CB 1DHTA 4RVGA 3LT2A 4TRNA 1DBVO 4JGBA 3OIDA 4GGPA 1NHWA 4KTTE 3ZU5A 2AE2A 4K1LA 1J0XO 1P74A 4J9UE 5L9AA 3NT5A 1LI4A 4WJZA 3ETGA 3PK0A 2O3TA 3K73O 4ZJUA 1KVSA 1T26A 3HHPA 2DPHA 4L4SA 4TRJA 3AI3A 4NK5A 1JW9B 2CVQA 1EUDA 3L9WA 3LQFA 2Y93A 3TFQA 3JTMA 1C0IA 1Q1NA 4LK3A 2OL4A 2Q2QA 5BR7A 4PLZA 1L1FA 2GN4A 1TI7A 3DQPA 2IZ1A 4E5MA 3NTOA 1H5QA 1SCUA 4JJIA 3ONDA 1Y81A 4NK4A 4CLRA 3JQFA 4RPGA 3B1JA 2WD7B 4GGOA 5KJ6A 3PHGA 2C7GA 4HFJA 4PZCA 3RVDA 4BNVA 5A06A 4ALJA 3AJRA 2JHFA 4E2XA 1PGOA 1GUYA 2VRCD 2NTNA 3E1KA 3ZDFA 1LDNA 1OZAA 4G81A 1MXHA 3UCFA 3ZWBA 4HFMA 2QIOA 1GPJA 3TOXA 5L3ZA 5K0ZA 3WQRA 4FB5A 2QHXA 2XXJA 1V8BA 5JFOA 3LC7O 4RZHA 4WOJA 1MLDA 3GVIA 1BDMA 1GPDG 2GNAA 2PWZA 3COSA 3F1LA 3NDRA 5JSFA 1QLJA 4CODB 3S2IA 1GZ3A 1M2WA 5G4LA 4NJMB 1DPGA 1KY5A 4ZRNA 2EHDA 2PKQO 5AXAA 1J4AA 2VYNA 1KIFA 3ZWCA 2ZCVA 3CMCO 4R9SA 4YDRA 4NZ9A 2OP1A 3WNVA 4BO1A 1M67A 3FNFA 3PLNA 1A7KA 3A28A 1BMDA 1GAEO 5KJ1A 2NQ8A 2WE8A 4LCJA 4BMVA 4FC7A 4YA6A 3BTUA 4ZVVA 5ILGA 3GEMA 3VH4A 4BOYA 2NVWA 4R41A 5G2OA 3NGXA 3IOYA 4NMHA 4RV9A 5JE8A 1MG0A 1U7TA 1ZNQO 1H0KA 2OBNA 3VZSA 1SMKA 4RF5A 1DSSG 4MVJI 4U0KA 4IDDA 1A72A 4E5NA 3EW7A 4WASA 1BRMA 4ZQGA 3PEFA 2GN9A 2O50A 2Z95A 5IG2A 3ZHBA 1X15A 4KTVE 1ZH8A 4HWKA 2X58A 3DC2A 3SJ7A 5CDUA 2P91A 3DXFA 3T4XA 3PWZA 4D41A 5JMWA 3OICA 4J4HA 1EVJA 3SXPA 4JQCA 4FR5A 2VUSA 1X7DA 3CSDA 1YRLA 4JIGA 1K6JA 3R3SA 4H15A 3UOGA 4GX1A 5AVOA 1WLYA 2GR9A 5EMHA 2BLLA 4R4JA 4AJNA 3VKVA 4OOEA 3WLEA 4A73A 4EI2A 4IPTA 1NBOA 5T64A 1X7GA 2C29D 3RUFA 4J0FA 2JHGA 4QQRA 3C3XA 2C07A 4P4NA 4HNGA 1A27A 5TRTA 3Q6IA 2NLOA 3KYDA 4ALNA 1VKOA 3CZMA 2I66A 9LDBA 3I9KA 4GKVA 2VCYA 1Y8QA 4MINA 1DIGA 3WGIA 3DBRB 4E32A 1SC6A 3DBVO 1YQDA 4GWKA 4IS3A 4FFNA 1H9AA 1P3DA 4S1VA 3PXXA 3QVXA 4S3MA 4CMBA 5JCJD 3U3XA 2B69A 3EVTA 2D2IA 1DIRA 4AJ4A 3D0OA 2DTEA 3QP9A 2Y1OA 4NIMA 1FDVA 4NBWA 4TROA 3LYLA 2Q1WA 4N5NA 1I33A 5F1OA 5CEJA 1AXEA 3E5MA 1PEDA 1JWBB 3GOHA 3ZV6A 3QY9A 2JFHA 3AW9A 3B1FA 3Q1LA 4GI2A 4L8VA 3ASUA 4XGIA 1I2BA 4HXYA 1E3WA 4B4UA 1DFIA 1GYPA 4RDIA 4YQZA 2YV2A 4J6FA 5EESA 2A92A 2PH5A 1QG6A 1U8FO 1YOVA 2QRJA 2GZ2A 4FJ0A 3AUTA 4LVCA 2Y0DA 3L4BA 3MEQA 2E49A 4YJHA 3FPCA 3EAGA 3KBOA 4GPD1 1EZ4A 4CLOA 1QYDA 1LBEA 1ZMTA 1YBVA 4W7HA 3IL2A 1SNYA 2ZYGA 1X0XA 1Z82A 2IZ0A 2PNFA 4XWYA 2X86A 5F3RA 1K6XA 3LSYA 1HDYA 4W9NA 4BNHA 4DIBA 2B83A 3BZUA 4YWJA 4BO2A 5TJ9A 1E5LA 1NPDA 4BO3A 2ZQZA 3ZNPA 1UAGA 1C0LA 1O9BA 4ZQHA 3AY6A 3I9LA 5L53A 3KSDO 3VC7A 2DU8A 2UVDA 3WYEA 3JQGA 4EGFA 2PY6A 3ANMA 2X0RA 3MJEA 4AJ1A 5KOIA 2ZCUA 4O1MA 3FPLA 5JAQA 3GLQA 3HN2A 1YL6A 2Y0CA 3PP8A 4FDAA 4BQRA 5BT9A 4KP7A 3JQ6A 4HUJA 1E77A 1E7SA 1R0SA 1ZCJA 3IP3A 3QHAA 1AUPA 4Y98A 1PSDA 5KCZA 3I9OA 4JROA 4RVDA 1HETA 4CV0A 1HE4A 2GYYA 4WEQA 3U09A 2FN7A 1PS0A 3H5AA 3GDOA 4EUHA 4IXWA 3DZHA 1C14A 3RC7A 5A9RA 1GFSA 3ABIA 4OSOA 5JAIA 1B7GO 4UVIA 1EVZA 4Y6PA 4QO7A 1EEHA 1PQPA 4LVUA 3I6QA 1UR5A 4MVJF 4E2WA 3UF0A 3H5RA 1WZIA 3DFUA 3CINA 5DBIA 3IQDB 1MFZA 2ZATA 5G0VA 2C54A 2PD6A 4O0LA 3C7AA 5T8KA 2EEZA 2O7SA 3WSVA 3WWZA 4OH1A 4CV1A 2D4AA 3IJPA 3L4BC 4D7AA 3KYCA 3HZZA 3O38A 3E9MA 4MOWA 4YB8A 1GL3A 4ND5A 2XPCA 3OQ6A 4DIOA 5THQA 3I4CA 5IFLA 1RM4A 3NRCA 3W4KA 2IRWA 1CQJA 1VI2A 2SCUA 3O03A 4W9NC 4P8RA 4RZIA 4E2YA 1Y8QB 1H93A 1HLDA 1F8GA 4G2NA 5ENVA 4BNMA 1E6EA 2EJVA 1P44A 3JQ8B 4TVBA 1A9ZA 1DO8A 5DNAA 3SBOA 1NVGA 4E21A 1E7YA 3RFVA 2UYYA 2HCTA 2Y05A 3DOCA 3JQBC 5DP2A 2Q99A 4HFNA 4Z0PA 3LT0A 3FNGA 1H6BA 1I8TA 5HS6A 4LMRA 4IDAA 4X54A 4RO0A 3PJFA 4Z6KA 1DIAA 5JDIA 4CL3A 4DGSA 3FWNA 3ZU3A 3WIEA 1I2ZA 3LF1A 4B8ZA 5JYDA 5G4KB 5A9TA 3TL3A 3DHEA 4YTEA 1I01A 3Q9UA 4B3JA 3EY4A 3FWZA 3PYXA 1ZBQA 3ITDA 4PG8A 3IMFA 4CR8A 3FNHA 4IMPA 1PJ2A 4NI5A 2EF1A 4NPCA 4LGVA 1E6UA 4RQUA 2J8ZA 4XB2A 1UAYA 5L4NA 5ILOA 4EDFA 2BI8A 2CF5A 3GNTA 4XIYA 1NQ5A 4KUHA 2CMDA 1HRDA 4BNYA 4UREA 2VT3A 5IN5A 4EITA 5JY1A 1YS4A 3PPIA 5J23A 4W4TA 3OH8A 2VTDA 3DZKA 5FWNA 1B3BA 1R15A 4D45A 2RAFA 3JQGB 1XR3A 5G0WA 4BMNA 2C82A 4KWHA 1U4OA 4YR9A 1NFQA 2G82A 3QSGA 3B70A 2I5PO 1UP4A 1QYCA 2YUTA 4H16A 3PIIA 4CR6A 4NH4A 3G49A 3BTSA 3UXYA 3MZ0A 2RHRA 3BMQB 3OP4A 2V6FA 4GAEA 3ZNQA 3H2ZA 3K2BA 2YDYA 1Z73A 1ZEJA 3GNSA 4ID9A 1LSOA 3HFGA 1SEVA 4ALLA 5JAMA 1YE3A 4NU6A 2X7HA 3KB6A 3RU9A 1IPEA 1EDOA 1ISMA 1LU9A 2DBRA 1XYGA 4R1NA 1GV1A 2IXBA 1DLJA 1PGNA 5JDIC 2OMEA 2H6EA 3GG2A 2DUWA 2FMUA 4PG4A 2OBYA 3RSHA 4ESOA 2AE1A 4I5DA 1WXDA 1XQ1A 3UN1A 4BKOA 3BTVA 5MDHA 1WDMA 2P5YA 3GFGA 4QUKA 1EE9A 3PYMA 3MTGA 1Q2XA 5GZ6A 4IDBA 1AGNA 2HLPA 5B37A 5JMPA 4CM8A 4XGKA 4IZHA 2DLDA 1VSVA 4RF3A 4WCFC 3K2EA 2X0JA 2GDZA 4BS9A 4GL4A 3X2FA 2EJWA 5T5QA 4OOFA 3RUCA 4B4OA 1FDSA 2EW8A 2GGSA 2VYND 2J5KA 4KQXA 2WJPA 3ONFA 2NUAA 2VWPA 3GZ4A 2EG9A 4YYZA 3DAPA 3AUSA 3U4DA 3ENNA 3AM4A 1U2GA 1VJ1A 1YONA 2P2SA 3W4IA 4Q3BA 3KEOA 3LT1A 3RJ9A 1KC3A 3D64A 4J90A 3FBGA 4GSKA 1DC4A 3I9NA 1EE2A 1JKFA 1MA0A 3D5TA 2DPGA 4QTZA 1D7OA 4CMCA 2YZ7A 4NQZA 4AJIA 4L73A 4M1QA 4DMLA 3ZNNA 3GN2A 3V2UA 1J5PA 1HYHA 3KYBA 1U8XX 2UUPA 4JLWA 1X1TA 3NT4A 4MVJA 3PHHA 3X2EA 2P4HX 3U5TA 3HSKA 1NFRA 1AHIA 3FCOA 1NM5A 2VTEA 3WSWA 3WTBA 1T1SA 1E6WA 4MVJP 1J6UA 3PGJA 2HMTA 1Y8RA 5A9SA 4IIVA 5FFFA 1DJNA 1K3TA 4BQPA 3JYQA 4BB5A 5EL0A 3TRIA 4YACA 2ZTVA 2AEJA 3K9QO 3QW2A 4BO0A 4HV4A 5DCUA 1NR1A 4OL9A 4PFJA 3DMTC 3GHYA 2IEBA 2QX7A 5DCYA 3ZU2A 4IGEA 4YXFA 1LDGA 4I08A 5T6BA 4BNFA 4BO4A 3G1UA 5TGDA 2NACA 1PTJA 4XGNA 1KEUA 4UVGA 4F6LA 1EFLA 1ZZEA 2CNBA 4XZ3A 3D4NA 4QEDA 4CR7A 3QWIA 3F9IA 4ZN6A 1NVTA 2ILTA 2DKNA 1VPDA 2OXIA 4BV9A 2RH8A 2X8LA 4LRTB 3RKUA 5IXYA 1I32A 2E37A 3CH6A 4C7JA 3AM3A 3ROMA 4FJ2A 2J3KA 1NQAO 3RUDA 4UUMA 4EYEA 2D59A 3IKVA 5I9LA 2PGDA 4AJJA 3VPGA 1RKXA 3BMNA 3QVTA 2QG4A 3P2OA 3JQAB 4YAEA 4RORA 1E7WA 3LZ6A 4MIEA 3AU8A 1WP4A 1WVGA 3KETA 5ADHA 1ZK3A 4OXNA 2X6TA 4MIYA 1LDBA 4J1TA 4M55A 4D46A 1KEPA 4DLBA 2WD7A 5CHEA 3PDUA 4P22A 4W6ZA 5JAZA 2VWHA 5A3JA 1GEEA 4ZA2A 1EFKA 4Q3NA 5JO9A 8ADHA 1V35A 2OZPA 3ANNA 5I7EA 1QV7A 1DC6A 4QXMA 4P38A 3AU9A 4YT4A 5JDCA 3UGKA 3FI9A 1P0FA 3LVFO 4DUPA 3DHNA 3VKUA 4CUJA 2CZCA 1R37A 2NU9A 3Q2IA 4OKNA 1YB4A 1T2FA 1QMGA 4CQLB 1ZSVA 1BW9B 4NJMA 1I24A 1GR0A 4WOKA 2C2XA 1HEUA 3GMSA 1EK5A 4KUEA 1N9GB 4PLWA 3WGOA 3BTOA 3PHLA 2G76A 4Q3CA 2YFHA 5A3VA 3OMLA 1W73A 2DT5A 2NQTA 4EBFA 2X0NA 4XR9A 2EERA 1YB5A 4B8WA 3DAGA 1NHGA 1C3VA 3AY7A 4EEXA 4UEJA 2EP7A 1H6DA 3G17A 6ADHA 4CV2A 3GDFA 1ZO8A 1CIVA 4AG3A 1BTOA 1O0SA 1ISGA 3JCZA 1YB1A 4IDGA 3OJEA 2HKIA 5EJ2A 5H82A 3RWBA 1HSZA 1BVUA 1KVRA 1U2DA 2Q2WA 3WLFA 4MJLA 2WTBA 4FFPA 3L77A 4RPJA 3JD4A 4MVJG 5ITVA 5L51A 4PIVA 5L7YA 4A0SA 1SO8A 1Q0QA 4MP8A 5L40A 4DL9A 4R5MA 4R1UA 3OQ1A 5B4TA 1IB6A 4W99A 3INGA 3TSCA 4CMAA 4OXKA 5IZCC 3ZV3A 5HWSA 1RJWA 1JU9A 3HB4X 4RPKA 2Y67A 3SLKA 5MGBA 4CM3A 4ZRMA 5JDCC 1CJCA 5H81A 1PGJA 4LRSB 5JBIA 4XKJA 4K9DA 4I5EA 3ZHXA 3I6IA 4FCCA 5I8WA 1U28A 4ALKA 3E48A 2WWRA 2AG5A 4C7KA 5IN4A 4RLHA 2IYPA 1LLDA 3A9WA 1NQTA 1M6WA 1O8CA 1IPFA 3TF5A 3PGXA 1YJ8A 1HDGO 3DBRA 3AFMA 4I9HA 4ONEA 3LLVA 5F5LA 3BMNB 3LU1A 4PLFA 1RM3A 3S8MA 4WKGA 5JS6A 1MB4A 2DFDA 1QYWA 4BHTA 4JK3A 3ZWPA 3OIFA 1E1KA 3WXBA 1OI7A 3NDIA 2BH9A 1BXZA 1D1TA 1XEAA 2VWQA 2BF7A 4NFSA 2ZK7A 3ZW8A 2BHLA 4HKTA 1ID1A 4CLEA 1T1RA 3QE3A 3MTJA 4BGEA 4WLUA 1PQWA 3GN1A 2H63A 2XAAA 4TKLA 1ZJZA 1EMDA 1LC0A 1NVMB 4E2ZA 3NYWA 2D0IA 4AFNA 2WMDA 2DBZA 3OJFA 2I9PA 3UHAA 1RM0A 1O6ZA 1PS9A 1B2LA 1DFHA 1LXCA 3QVWA 4NG5A 5AXBA 3ZWYA 2B37A 3EDMA 4XQEA 3QVSA 4CMIB 1ONNA 3GDGA 1HT0A 4XDYA 4MKZA 3EVNA 1MC4A 1Z6ZA 1R4MA 3ICCA 1FJHA 1TEHA 2VHXA 3KHUA 2B5WA 4XQGA 5HBRA 4OAQA 3ZHZA 1Q0HA 1UXKA 4AJPA 3K8ZA 3NX4A 1E3SA 4CM5A 1B8PA 2JD0A 3TNLA 4EW6A 3AUUA 3MJ4A 4HNHA 4Y67A 5L4SA 4F3YA 3LK7A 3WFJA 2I6TA 4PLTA 1AXGA 3MJTA 4R3NA 1EUZA 2YHUA 4AL4A 1G0NA 2OORA 3DOOA 4G65A 1TB4A 2EV9A 2IDZA 4DYDA 5K9ZA 4ALIA 3UCEA 2C0CA 1JDJA 1P1HA 2G0TA 4WGGA 1K2WA 3F4BA 3JD0A 3PVZA 3E03A 4PVDA 1BSVA 2ZB4A 3S1LA 3V1TC 4AJKA 1LSSA 5HM8A 3VPXA 2VT2A 3BIOA 1SBYA 3BHMA 4GX5A 2VHVA 5TIIA 1PJLA 2GZ1A 3H4VA 4BKQA 3PIDA 4ZHSA 1U3UA 1B16A 1T2DA 1UJMA 3BA1A 1B8UA 1C0KA 1JQBA 2Q45A 1LEHA 3JQFC 2AW5A 5ICSA 4U6QA 1A7AA 2QYTA 2PH3A 1DC3A 3GEDA 4GBJA 4R5HA 1JVSA 4PLGA 2UAGA 5FYDA 3UH1A 2I65A 3NUGA 5A1TA 3RUEA 4DMMA 4DQUA 4L76A 5DN9A 1HDXA 3ZNOA 2HRZA 3U0BA 1Z75A 1ZJYA 1Q7GA 4B79A 2LDXA 4M89A 3WS7A 4YJDA 5JO0A 2J5RA 3GVCA 3GY0A 4E5KA 4QFDA 1PJBA 3DB2A 4U5QA 5ICMA 3NDJA 2V6GA 1UP6A 1C1XB 2D5AA 2Q3EA 2O4CA 3F47A 4EUEA 3QLJA 3VVCA 1QLHA 3JQ8A 4E30A 2D1YA 3RFTA 2G17A 4PGFA 3WYBA 5TSDA 4J1SA 1E1MA 2O3UA 1FF9A 2ZB7A 3NV9A 3V8BA 5I7FA 1UUFA 4L75A 2NTVA 3D3WB 1NPTO 4XCVA 3FTNA 5BQFA 2HRBA 4N18A 5COBA 3OECA 3RFXA 4JJGA 4MVJD 3WQQA 1LUAA 2CDAA 1XKQA 1ADFA 1JTVA 2PD4A 4YQYA 3A06A 4LISA 1E3IA 1WNTA 1P1JA 2JL1A 2F1KA 1D4FA 4CPDA 4I9UA 1UXGA 2Y1DA 3PTZA 4IUYA 1IHYA 4EUFA 1GTMA 1LSJA 3O9ZA 1O89A 3SVTA 1VSUA 5CEEA 4A10A 4ROSA 5G4KA 3BMCB 4UEKA 1LRKA 2ZB8A 3RJ5A 3PQDA 1HZZA 2P9EA 4CM9A 1YWGO 4IZIA 4BO5A 1LLQA 3DR3A 3PZRA 3NKLA 1R4MB 2I3AA 3INTA 5ITWA 4MKXA 1P1KA 1PR9A 4BV8A 3G79A 2PD3A 3LDHA 3GPDG 5B4UA 4FJ1A 1GYQA 4BB6A 1EVYA 1PWXA 2QZZA 1TXGA 3GNQA 3EK2A 2RCYA 1XG5A 3TWOA 5AQ1A 1Z74A 5DDIP 3TL2A 2HDHA 1B14A 2HQ1A 1R66A 4MO2A 4DPMA 3WG9A 3G3EA 2IODA 4UAGA 4XDZA 4BNUA 2BFOA 2J3HA 3ZWMA 4DYVA 3KXDA 3WNQA 3A14A 4RPHA 4Z3KA 2X5OA 3H9QA 1RYDA 1LA2A 2VOJA 3NAQA 1D1SA 4PLPA 1ISJA 4G5HA 3SX2A 1PX0A 1JKIA 1Z45A 5BNIA 3D4PA 3OEYA 4OQYA 3R1IA 3TZ6A 2JD2A 2YJZA 4F45A 1X1EA 3PJEA 4GKBA 4HX5A 5A05A 1GY8A 3BMQA 1ISFA 4KDEA 3WMWA 3ZV4A 4O63O 4CL8A 4K6FA 4PN3A 2YQ5A 1SZJG 1ULSA 5LC1A 3WGZA 7ADHA 1GZ6A 1V3VA 2HJSA 4L74A 3RU7A 4CUKA 3F4LA
chains in the Genus database with same CATH superfamily
4WN3A 1Z4JA 3HA7A 4CQMB 5A4IS 1J00A 3ONVA 4UVEA 5DLDA 1M8JA 4IOJA 2RH4A 3A2LA 4DQXA 3I05A 2F1OA 3C4QA 1P8AA 1HE3A 4IDNA 4UULA 1X9IA 3GAAA 2IHKA 2YRWA 2OMKA 1TGYA 1C8KA 2GK3A 1W4CA 3AI1A 5HK9A 4ZI7F 3PFWO 5DNEA 3OEHD 3N53A 2FVYA 3R3JA 4M0DA 5I7OA 3BILA 2PKQP 3A1TA 1II9A 2JGJA 4ODIA 1OXVA 3CX3A 4A0GA 1D2GA 2JD1A 1T8UA 1SY7A 1EG7A 3H5WA 2NUTA 3BGSA 2BY4A 5EMJA 1RPJA 4HB4A 4BO7A 2FGKA 4EGSA 4HGZA 4R81A 2VNAA 4LSGA 1NVAA 5JPDA 2KS6A 1XDDA 1TK3A 2H1RA 4ENRA 5IHPA 1ZGZA 2NU7A 4JN6B 3G1TA 3Q3CA 4O3FA 4F4IA 2R79A 1EWTA 3QBVA 5HGJA 4I36A 2F3PA 4M98A 3T1QA 1XZEA 3H8SA 1A8QA 2VTBB 4MQEA 1PV4A 1RWQA 2ONYA 3S68A 2GBPA 1MORA 2IEGA 1GTJ1 5FQOA 5I47A 3DFKA 4J03A 4OJQA 3U4CA 1E1NA 2B98A 2Z57A 2REXB 3I2KA 4Z8XA 1DELA 1H1LA 4I9FA 4GMKA 4KPEC 3CKMA 1JDUA 4OSPA 3R5KA 3W2TA 1VOTA 3MTDA 4AS1A 4YBZA 2I2AA 1QIGA 3FTEA 1N1MA 4FE7A 3PR3A 1T8SA 3U19A 1CK4A 4MQUA 1GQRA 2H59A 1VE3A 3W1WA 3H9UA 4Y6SA 2Q9BA 3DBHA 4LJ6A 4Y1RA 2VT7A 1DAHA 1P19A 3CNLA 1L4KA 1MAAA 3GAFA 3AR2A 3CTMA 4RCZA 1B42A 3G5LA 5EG5A 2NSDA 3DVAB 3T7DA 5GADl 1ZGGA 3HHEA 4HDQB 3STVA 5CG1A 2R60A 1U6JA 3BQMB 1Z2NX 1PIWA 3OJWA 2WYIA 3IUSA 3RLIA 3AUYA 2JCXA 2ASVA 2JFZA 2J3EA 3BCRA 7AT1A 2FZ5A 2V7BA 1SIBE 3KLPX 3L41A 2M9MA 5CK4A 4DR7B 2WT9A 3C97A 3HADA 4FC6A 4XD2A 3TUJC 5JCPA 2P67A 1OI2A 2E87A 1L6IA 4IWXA 5CAEA 1CPYA 1K08A 3FYUC 5LB4A 4GWGA 4EA7A 4WUVA 2IV3A 4ED9A 2ENWA 2YS6A 3HDJA 4TM8A 2AOXA 1LJ8A 2NZXA 4XLTA 3FRJA 3RCBA 2CJYA 2Y4OA 3LRTA 3HMQA 2JA2A 4LSWA 3NCHA 2OM6A 1TM2A 4MWTA 3AXSA 4GOND 1H85A 3KT0A 4GLOA 5BOSA 3CT4A 2O7QA 4GYWA 4RHCA 1BS9A 4IICA 4LJSA 1CDOA 3TDKA 3VYWA 3IUYA 3BXXA 3DTNA 4HEQA 2XMPA 2RHCA 1KMHB 1L9XA 5E6UA 4DG9A 4X45A 3TIFA 2E21A 3BSFA 2I7VA 3K4QA 4JA2A 2Q1TA 2QX4A 4OGWA 2Y1LA 1NOIA 3PHIA 2YVUA 3IIJA 3ZHUA 5BW6B 3KJHA 1LRLA 1SUCA 3L9XA 2Z2JA 1RDFA 3G0OA 1SVUA 5IMBA 4BLQA 1XKLA 1Y34E 3HYTA 2EEPA 3FSJX 2B7LA 1JH9A 1D3AA 3H04A 4H1UA 3VZPA 4OL0A 2EGGA 2P9TA 3O0DA 1YTLA 2C9YA 4GKAA 1BA3A 1MVLA 4MQBA 2JGDB 1YB2A 2W2QA 2B8NA 3CG4A 3MELA 3Q11A 2ZT5A 2QN8A 3HM2A 1ULZA 3GRVA 3MSCA 4MW9A 4PRKA 4Z4EA 4HDAA 5C3MA 3MCAA 4UU8A 3JQAA 3UWSA 5BMVA 3OQNA 1V0JA 4DNPA 3JQDA 5DLQC 5DASA 4QVGA 3U37A 1NT2A 1RNLA 2C9BA 5EA2A 5TMBA 3WQSB 2YHAA 3LOUA 4RDHA 1IY8A 5BN3A 1DX9A 1MP0A 3NOOA 1HOTA 3U4QA 3THWB 3U4MA 3QV1A 4WCFB 2R5FA 4F2WA 3LOQA 5DCWA 1THMA 2WVAA 5JZSA 4EPRA 5E3HA 3ITNA 5CDGA 1XZFA 4H77A 4O4LA 1YR1A 2WABA 2UXDB 3GR6A 4M8NE 4AS3A 3QXJA 1HT1E 2Q1YA 2R11A 1T2EA 3UATA 4CCYB 1RQRA 5DNUA 3AQ4A 3L1UA 4PS1A 1IBMB 4DCUA 3P7MA 1H6AA 1MN6A 1T3GA 1Z83A 1V37A 2JCBA 2RJNA 2DH6A 1XLTA 3PFFA 2VJBA 4RZSA 8ATCA 4HEA6 3ELUA 3PZBA 4LXTA 1F8FA 3NEPX 4OGFA 2H2WA 4AIIA 4YREA 2IU4A 3AEXA 4WKNA 1L7DA 2FGJA 4GZ3A 2WJJA 2LR0A 4MVWA 5C7LO 2EWMA 1QC5B 1YNSA 1V41E 1ZSNA 2B21A 2J7PD 2PX3A 1E3JA 4FFVA 4M1WA 2GZAA 5CDFA 3RAPR 1FU4A 3VSEA 1R10A 3I0MA 5TX7A 2W2MA 2D06A 1N9GA 3FTQA 1O08A 2VHZA 4MWEA 4NSNA 4E31A 1QTRA 1RAFA 4A8PA 5HNKA 1QK4A 1Z4LA 3DLBA 4JUBA 1N4DA 4RNDB 1M73E 3OF3A 1UKBA 2YASA 3KDPA 4E5YA 1K7XB 1UFKA 2BEJA 4YAUA 2FY8A 1VLJA 1KEEB 2C84A 3ISVA 4MVJM 3WY9A 2GRJA 4Y9SA 4M9XA 5AVJA 4UBLA 3QG5A 1EVQA 2CYCA 4QPNA 1XELA 1WV0A 2GJSA 2ZUWA 1NF8A 3ODPA 3OQIA 4JVLA 4U3JA 3BAZA 3ZEAA 4BPBA 2YFQA 2ZG6A 4DB4A 1DRWA 1ULUA 1FSGA 2RK3A 3OLXA 4QU8A 1WXIA 4R8KA 4IMRA 5BYAA 4CKCB 5LMUB 2AEFA 2BKAA 3TLGB 1K88A 5E0KB 2HCRA 2X0IA 1MOPA 1KAQA 1W0CA 3K1AB 3GF4A 2NVUA 3QW4B 2JAXA 4GP6A 4FYIA 3FHLA 2QTLA 5KQGA 4U7WA 4C07A 2UYGA 3N3BC 3OOYA 3E5RA 4WI1A 3ZKAA 1SPXA 1FFHA 3CRRA 1RWBA 3F97A 3B6ZA 3KFXA 1W581 2WU0A 1YDMA 4HH1A 2X0EA 2H2DA 3FG9A 4GC9A 3OZFA 1Z25A 2FSPA 4L50A 3T8YA 5AM3A 1CUWA 4KXXA 1PVOA 2G9ZA 1VIAA 2H07A 2GPSA 1F2DA 5JEEA 3D2CA 2IYQA 2I2FA 2FR8A 1SR8A 2FFJA 2EU8A 1JXQA 1NXQA 1WULS 1VE1A 3JWHA 4K9LA 4X1OA 4DTIA 4TYNA 5K8UA 4X66B 1UPFA 3HEBA 4JC8A 1ETHA 4KITB 2R66A 1Y6FA 4FFOA 1ZWKA 5KX5A 1MV8A 1N9ZA 3D7NA 1HURA 3OOJA 3JZFA 3R8FA 2Q8QA 4MB6A 1N1EA 5G0UA 5A1JA 3G7NA 1EX7A 2XMQA 3P2KA 3RBVA 3IAXA 3PXEA 2I8CA 2P79A 1L7NA 2BSAA 3DHYA 4JLBA 1F38A 3ASVA 4RJ2A 5KUTA 1N7HA 5FLEX 1TQ8A 3DVRX 3HA2A 2GS9A 5TS2A 1MHTA 3RS9A 1PVDA 3TLBA 2QUAA 3CEAA 3IQEA 5H5JA 4QBHA 4H4EA 2GZHA 3DDSA 1NOKA 2AQKA 2JGFA 1GT6A 1RRGA 4MNTA 3PKIA 3AOEC 4LAFA 4RUKA 1UPAA 2EKZA 4KPFC 4YT5A 1PLLA 4FEAA 1Q44A 2RKOA 3SXUA 3IJRA 3U5ZB 1J9EA 1V5WA 1QF9A 2CKDA 3GGJA 1DG1G 2WZDA 5GV8A 1A9XB 5F7OA 4H2DA 3ZG6A 2OVFA 4O0MA 5EPOA 1DP4A 3OE7D 5EERA 5FOVA 1RXVA 4TOIA 1JDVA 3IAHA 4NCAA 2QP3A 3DEJA 2IPMA 4WZ6A 3LPAA 5AYVA 5JVDB 3FOEC 2YXDA 3VGJA 3H97A 5CVEA 1E66A 1MOQA 4ZU1X 4BE4A 1LF5A 4GRIA 1B3RA 2HMVA 3OHSX 1FU7A 1Z62A 1FDWA 3QX7A 3FUVA 4N5MA 3ST7A 1X0VA 2XECA 3LUPA 2WM8A 3REOA 3SXJA 4M54A 1UEIA 3HQ4O 4IJUA 3RDPA 3VDQA 2FOIA 1JHUA 1NBIA 4DQDA 4FS8A 4BMXA 4ITRC 1PEAA 3SJAA 1VJGA 3AUJB 3C7KA 1FQKA 4J2HA 1BXRA 3EFOA 1ZUD1 3GLGA 1XIVA 4TKUB 2KJQA 4IXMA 3NTQA 1IN1A 1XL1A 1AO3A 3OUTA 4IRUB 1E1CB 4OP1A 5EUBA 1IJFA 2DUJA 2QR3A 3I9JA 3Q41A 4MLCA 4EG4A 4TZ0A 1YH3A 2PGOA 4QELA 3N9IA 1V5GA 1PZFA 4TV9B 2YFYA 4AUNA 5E38A 3FOZA 5C35A 2QVXX 4TWAA 3R5SA 4N5IX 5BT8A 1W88B 2X2PA 4H59A 2HI0A 3E6AA 1I4WA 3KFVA 5FPYA 3K92A 1VBMA 1L7AA 3P1JA 4D96A 3I5YA 3AEUA 1UKCA 2DFNA 5DYNA 4DEXA 1ZC3A 2J07A 2GN2A 1MPXA 2WDPA 2XZTA 4FXPA 4CGYA 3DD1A 3AT1A 3Q3VA 4S05A 3WGGA 1JIQA 2XE8A 4FQ8A 4INOA 2JKVA 4R1SA 3BXPA 2V65A 4RKWA 4B3FX 5L3VA 2W6PA 4XQ9A 3TK1A 2ZTSA 4HQ0A 4TYYA 1LBQA 2GLTA 1ST3A 1Q0RA 2G83A 3TQFA 5JH7B 1V9CA 2FEXA 3BXFA 8LDHA 1GG2A 3M6IA 4LDPA 1JA9A 3KZOA 4J4TA 1NT4A 4MAAA 4QBKA 3IH5A 5JAUA 1X39A 3A1FA 2F67A 2PS1A 4G1VA 1XRRA 5JECA 3FRIA 3O8QA 2RBKA 1J06A 1T2CA 4J1TC 3I9V1 4EPTA 4J0DA 1P61B 4K3UA 3RK1A 2FX5A 4D44A 2R00C 1CRQA 1QDUA 3X44A 3WGHA 5JRDS 3ZHOA 3KCNA 4JXKA 2QLTA 3JD1A 1Q84A 2ARKA 4TL9A 4UDOA 4UE6A 3BF8A 1EA5A 1DKLA 1SZPA 4NBVA 2BKUA 1BC5A 1FYEA 2EARA 5FBLB 2VJKA 3TZLA 1SXJD 1R8JA 2EF0A 2J08A 1E5QA 2XVYA 3GLFE 1RHKA 4Z99A 5H02A 1QQ6A 4N65A 3PTLA 4J0HA 1N2JA 2I71A 3GA7A 2YVKA 2YJ4A 3AY0A 4QTTB 1K98A 1C4KA 3WL4A 3E0XA 4EB3A 1UL1X 2ZRJA 5D7NA 1HNXB 1F17A 1LDYA 1AUXA 4EG8A 3WMXA 3KKMA 4LYJA 4OATA 2A84A 4RY8A 3FXAA 3U0VA 1HDIA 2ADMA 1X7WA 3KM0A 3ZVLA 3ET4A 2C3MA 1I2CA 3KJFA 3RE1A 4YRZA 1ZN7A 2FW6A 5DHTA 4MO9A 4Q4AA 3R8XA 3QA9A 1MXFA 1ORWA 4AMYA 3B2EA 2ZUCA 4ZQIA 5K5EA 2WWFA 1IZ9A 3O95A 2PS3A 2W6ZA 3PLRA 3SF8B 4A0HA 4Z9YA 2WM3A 3K71B 3QELB 3OIVA 3CVWA 3ROKA 5K8LA 3I01A 3CRQA 4N54A 4MS4B 1U2SA 2IDJA 2IZ7A 4J3FA 2Z6QA 4ZT7A 4TQGA 2ZIUB 2HZ7A 4EYOA 4FSXA 2AA3A 2EQ5A 2EP5A 3L6DA 1SVLA 2NADA 1YGYA 2PIAA 2PKWA 3KQWA 2CNWD 4NZOA 4YROA 1QOQB 5TGTA 3U3OA 3ICQB 2GCOA 1FVXA 4UQLA 4UBMA 3BREA 4ZAFA 2XF8A 5B1YA 1XYVA 3EF0A 4WVFA 4ZQFA 1II8B 5F33A 4PRYA 2NX2A 3VV3A 3THYA 4FIDA 3HUEA 4NU5A 2BMVA 2W2LD 4WK2B 1WWKA 5IAJA 4I19A 2NPFA 1VRWA 1ZW1A 1Z7GA 2UUCB 5IH3A 4HB3A 5CH3A 1HG1A 2OSVA 4JD5A 3HDVA 5C4GB 1E18A 5FR1A 1JHDA 3UW1A 5CG2A 1ZJ6A 3DE0X 3GARA 1Z06A 1QZUA 4RK7A 5CA1B 3FX2A 1GQFA 4JBGA 2EBHX 4K9SA 4E5SA 4F84A 2LDBA 1T5DX 1FX1A 1MIOA 2JZCA 3GT0A 4IFEA 4X8LA 5AJYA 1AS0A 5A5FA 2XZLA 1AJEA 2IE0A 4X6XA 4AMVA 1NJ2A 1EH5A 1JHYA 1C81A 2V7VA 3OA0A 3P97A 1GZUA 4HAUA 3X1YA 4DC1A 3E9QA 4D43A 1JDZA 5KTKA 1IN6A 1DL5A 5FPPA 1Z7WA 2RE8A 4HMOA 2PV0A 4WE3A 4HX9A 1PHPA 1MAVA 2HX1A 2I78A 1VJ0A 4I7EA 1IBLB 1WCIA 4FFRA 4ENWA 3DR5A 4X8MA 3CIOA 1IIBA 2OFFA 2GYWA 3IEMA 1O0CA 2PRYA 3NJ8A 4DCJA 2PN1A 2CWDA 5IBRA 4MJ3A 3NIDB 4WDQA 4GDMA 2OV1A 1M66A 1HLPA 1JXOA 3OZRA 3O3CA 2HQOA 3GAZA 1H2HA 1H94A 5E4FA 4EYGA 3KOOA 1XWWA 2E6KA 2QW8A 5ER6A 3TKYA 5LXTF 1QXSA 4IV5A 1EGHA 1LB1B 1XCJA 1XLVA 1YR9A 2OSBA 1XZPA 2GF0A 3P20A 5J4YA 1XJ0A 2JGAA 2D74A 4EH1A 4FKZA 2C7VA 1STOA 3VHLB 5KNDD 2X4GA 4BV2A 2FN8A 3OIGA 4CQMA 3K0AB 3SVLA 1RYFA 4QQKA 2AVNA 2G8LA 3NONA 2R6HA 4LWQA 1JEOA 1QCCA 2BKXA 2PGNA 2WF7A 4KNWA 3W8DA 1QHIA 3ROZA 3EZYA 4AYXA 1S9DA 4F46A 2H2AA 1YK1A 4YRGA 2V3CC 3UAXA 4E15A 4AMUA 4F4FA 2PRJA 1IHPA 4KNYA 1ZGBA 5EHGA 5AM4A 1C41A 1PR5A 2AN1A 4RTSA 2NZJA 4WZAB 1P7VA 1RPTA 1N6PA 4C78A 2YZNA 4N1AA 4F86A 3W77A 2QP4A 1MC8A 1Z4OA 3LY8A 4M87A 4DADA 2A14A 4D3XA 1NUUA 3H3JA 4DLWA 3JATB 1WBBA 1SCBA 4HEHA 4Y1GA 3ZJTA 3HRHA 1CJTC 3ETDA 2VRWA 4RFSB 4J07A 3QHQA 1O94A 2QA5A 2VH2A 1KBZA 1Z6GA 1CF4A 5B30A 2VTBA 3ZWWA 4PO1A 4NY1A 5BQXA 3RVKA 2ZZMA 3NHBA 2R8EA 4GSLA 2H5EA 1UCFA 1BFKA 1ZK2A 4JBXA 5CXUA 1C30B 1QP8A 4MW1A 1XZCA 5CA0A 1ADBA 2WU4A 2C2YA 1E7RA 5EE3A 2GASA 5LYYA 3VH1A 1YQXA 3VHRA 5I3CA 5M04A 3TG8A 4CL0A 3WRWA 1IN5A 5T67A 4KYIB 4ND1A 3WKBA 4QZVA 1IUKA 5IT9A 1OOEA 3UMBA 4D9GA 1XZGA 4ZYVA 1ISHA 1VZ2A 2PZMA 1NXOA 4MWBA 5J5AA 1E89A 2DQZA 3CKYA 2FRDC 2A9RA 4NF2A 5GTDA 2QW0X 2AQ8A 4N8SA 2J30A 4DJEC 4YNBA 4F0JA 3L0BA 5EXSA 1ENZA 1ZEMA 3KKNA 1UMKA 2GH1A 4UNQA 3UC9A 3VTFA 1UOOA 1VE6A 5BXQC 4G5YA 1SCUB 2UZ1B 4X3CA 1PJ8A 1ZU4A 4FFLA 5ALRA 1YRQA 2QJRA 1C4XA 3VR6H 1CSEE 4GOJA 4QPPA 2C7RA 3WXMA 1P4AA 4GZ6A 4QHTA 4PANA 5I45A 1S4QA 2QRLA 1G5QA 3MOSA 4QGFA 4R69A 3ENWA 1G7RA 5D3QA 1AUVA 5CYOA 3M6WA 2EIXA 4MDFA 3RS0A 1YCGA 4R8MA 3P9ZA 1HDZA 5FWXB 3G8BA 4J9VA 4JB0A 4PO3X 1R7RA 4J49A 2WVGA 4IGFA 4BO6A 5JJBA 1UQTA 2OGUA 2IW3A 4A92A 1NJ5A 2P4QA 2KB0A 4B44A 2GNPA 3ICOA 2BFBB 5CH5A 2FEMA 3KU1A 2ZVPX 2K87A 3THOA 4E1BA 3EUWA 2FZLA 1ODIA 2HF9A 1U0SY 3LBNA 3RRMA 3T15A 1DOZA 1T5LA 1N2EA 1AY0A 2EATA 3LXRA 1K2VN 1RE0A 3IR6A 2B4AA 3BMOA 3VTZA 3BEOA 1U3TA 4H17A 3DV2A 4RIIA 1K6IA 4B8YA 1I80A 3DDOA 1O77A 4GSYA 1DWOA 2ESRA 4B46A 2ZWPA 1YZLA 2MJLA 3RYCB 1D2NA 4JT4A 2WNIA 1UWCA 1R6TA 2Y2VA 1XZLA 3N2NA 3PQFA 1ZL2A 2VHYA 3T7RA 1IZ0A 1FDRA 1XVTA 3CXUA 3G7SA 4EAAA 1JLSA 4XIIA 3BE4A 4C7MA 2ZR0A 4I8IA 1SKAA 4TZ6A 1KO8A 3H2BA 3JYLA 5EY5B 1OMOA 3S5UA 1KDZA 4AM8A 3VI4B 3NBFA 4DT1B 4YCDA 4BU0A 3RAEC 3ZJVA 3EMBA 3EGDA 4IIHA 2ZJ1A 1GQQA 4YP6A 3TM5A 3DSRA 2G9UA 4AZSA 2QMYA 4NH0A 3BQNB 3WQHA 2I33A 3RROA 1Q7RA 1JVBA 1GADO 1ONSA 3T9CA 4C6RA 4R0MA 2BDUA 3ES9A 4NG4A 2NYUA 1I7QB 3SFVA 2BUCA 2AI2A 2ERYA 4P4SB 5IKXA 4AO8A 3DJYA 5HDQA 3BULA 3ZQKA 3B1YA 4MRNA 4OFZA 1H42A 4BTLA 1IQUA 2IUUA 5C81A 1S3FA 3V2GA 4CCYA 4P9NA 5LD2C 1UK6A 2HK7A 3HUUA 3O1IC 4WSOA 4QGAA 3R7NA 4KACA 3T5CA 4IXDA 1S2OA 4KB5A 1R16A 1LRJA 4WLFA 1SHJA 4D4LA 3GMDA 1JHQA 3USES 3DTVA 1DKQA 4OCZA 5AOVA 1WKVA 2WK1A 4Y2QA 5FQNA 3MIZA 1MO4A 3QXSA 2N75A 1V1JA 1FP1D 1GAJA 3HCFA 4DHEA 4YJ2A 1L7BA 1KVUA 1QC5A 4KQHA 4ZTUB 3G9XA 5EAIA 3P0JA 4NOJA 1G5PA 2C5EA 4N03A 2OG1A 3K6JA 4ZCIA 5IBPA 3CNEA 3MGAA 3FIJA 2ZR9A 3O9MA 1ULTA 1HEIA 1PW7A 3DBOB 3IT0A 4HYYA 3AVPA 5GY7A 4BV3A 3R6GA 4TWRA 3TTYA 1R6BX 3LBIA 1BH6A 2D0OB 4D3YA 4EZIA 2Y68A 3CMMA 1Z0FA 5T57A 2NT3A 3QKSA 4D9FA 3CS3A 1FNSA 3LP5A 3O74A 2VAMA 2JFYA 3OFND 4CW7A 1KEEA 5I7HA 1GPUA 1GU7A 2F3UA 4LCEA 3FCYA 3KAJA 3CVJA 5EXDA 2DGDA 1IHOA 4B6PA 4QTUB 4RYDA 2AKAB 4CKCA 1NLMA 1UF9A 3EWAA 4GXRA 2QROA 2X0DA 1QRUA 4TZKA 1Q3KA 2VH1A 3TLGA 3F6CA 1P7CA 3I39X 3M70A 5ILQA 5JZMA 5TT0A 4G86A 2IK8A 4D0RA 3H6KA 4HN2A 2YJ6A 3OLWA 2GB4A 3Q98A 5LQMA 2PBZA 2QN3A 4D8XA 3ZDCA 3I4LA 4LZZA 2C57A 3H9GA 4DN6A 1VMKA 4F11A 5IARA 3AVXA 3H5NA 1N0WA 2ZREA 3M3DA 4B6RA 5LZ2A 2H1CA 3BKXA 4JT9A 3AO0B 3OZUA 3A4MA 1YOVB 2ZJFA 1ISRA 1EESA 1UBRS 4WW0A 2Z5VA 1RJEA 3I5XA 3D6HA 4YJHB 4J7UA 2XD9A 4C08A 4BFLA 2W6MA 1SXJC 2IIVA 2Q4OA 4TTJA 1FTYA 1A8HA 4G41A 1M7HA 2H54A 1HLGA 3JVUA 4DDKA 1FVFA 3WLMA 3ZCVA 1GUZA 1P7ZA 4IFIA 2VNJA 1GTL1 2X19A 4PLYA 2K2QB 3AERB 1NV8A 1K7EB 5T3YA 3WX0A 3I83A 1OHHD 3IOMA 4PCAA 4DLNA 1TT5B 2CHGA 2N9UA 3GRCA 1J8DA 1LSUA 2VXYA 1S3IA 3MMZA 3CF4A 5BVGB 3EPJA 1EK1A 1PJ4A 1WIWA 2A0FA 3REGA 4ENQA 5BPHA 4KQIA 1OV6A 3C15C 4P80A 3FYSA 4ZCLA 1JR4A 2Q8PA 4ZGWA 1X7HA 4GX2A 1MGPA 1E6MA 2R4UA 4KH0A 2JEZA 4PWYA 2C61A 1E7QA 4N0EA 2BIFA 3DHVA 4ZAYA 3W2FA 5IC4A 4CM6A 2GETA 4KE6A 2VEOA 5HIJA 1GDDA 5KJFA 4HUTA 3AY3A 3ED5A 4ZPXA 3C8DA 4PG5A 2CFIA 2EZUA 2C3OA 5DJ5A 5K3DA 3IVXA 3WGUA 4N82A 5LQRA 4JDUA 1JGTA 4JQYA 3TW8B 5FO0A 2XNCA 5BN5B 3DNMA 5C7OO 1F2UB 4PAMA 4QDUA 2J0UA 2IYOA 2XOEA 2HMSA 2H7VA 1J90A 3WL7A 2RBEA 5CFZA 3NGLA 1EIZA 2FXVA 1A9XA 4KRXA 1Q3TA 5L3SB 2PO7A 4ZQCB 2NV6A 2JB9A 5LM3A 1ZRMA 4GLBA 4TS9A 4XOIA 3DUFA 2GKGA 3SR0A 3VA7A 3DF7A 5JVDA 5DHQA 3R9WA 4QBTA 5KWEA 3LDUA 2AW3A 2TECE 1T9DA 5GZ1A 2QVGA 1AMUA 4ENUA 1YKSA 1I3CA 3NOQA 2ZXEA 4JQSA 4XRRA 3ZWDA 1GIAA 5HVNA 1U7DA 3WK8A 3ZZ1A 3OIWA 2WYUA 5JEDA 1SC4A 1WQ4A 3ESXA 3A4NA 4FHGA 3PC8C 5LNK1 2GEBA 1IQ0A 1SH7A 3ECAA 3O4GA 4W1RA 3FPEA 5CPBA 4H7HA 4TRRA 5AKKA 3RC2A 4KPUB 4LC9A 3VAZA 1A5ZA 4M0LA 1IQPA 2IHBA 4YAJA 3L8HA 4ZIRB 1HE1C 5ITZB 1TDJA 2DXIA 1NX6A 2R87A 3E3LA 2P68A 1E1CA 4FYYA 3NGMA 1R6DA 4IDPA 5GP1A 3UUEA 2CVFA 4QC2A 4BX9A 4TV9A 4EO7A 4LOHA 4L0DA 4Q16A 4AX8A 3GVHA 1QG2A 1W88A 4ZEOA 1WM1A 4BVAA 2HWKA 1MO5A 2FHSA 3ANLA 3BE8A 4KWIA 1FDTA 2WVHA 3IOCA 4FGWA 3W8NA 3W9UA 1O95D 4HNVA 3RKRA 2XBUA 4IV0A 4K88A 5SV2A 3V8MA 5KHAA 1KRXA 5EUCA 1ACJA 2QRPA 1EK0A 3G5AA 4KEAA 4MRVA 1SULA 1A4UA 2I1VB 3EODA 4ILEA 3ZJ5A 3HE3A 4RULA 3TOSA 4E5DA 4QAQA 3ZZ0A 2OECA 4RXUA 5IBCA 1JQJC 3GCGA 1MOSA 1VA4A 3V9AA 4AP9A 2Z5LA 3O8NA 1P0QA 4ZV7A 1G59A 4JUIA 2B7BA 4FBMA 4KO8A 1Y1PA 1QIEA 3D8RA 1BG6A 2LW7A 4FIZA 3UHPA 1XWIA 3E81A 1YZYA 2H5JA 2VP6A 3E7FA 1CVIA 3PL5A 4B3MB 3WGYA 4MIOA 4KW7A 3V1UA 3W34A 4BNIA 3TNDA 3W5VA 4FMBB 4NQRA 1B15A 4KMRA 1FEZA 2R751 4PYNA 2I4RA 4YRRA 1B8NA 4N9QA 3EDYA 4UHDA 4QPJC 3HNRA 3AW8A 5T7BA 4Z0HO 5CITA 1C3LA 4YMWA 2W98A 5A7GA 4YFYA 3UTDA 4HP8A 4FT2A 5HW0A 2JLCA 1X87A 1HMYA 2H5LA 2L69A 4PSVA 4ZYZA 3H1FA 2JA1A 1EP9A 1DX6A 1ABEA 2JFQA 4FE4A 3ZVNA 3FOBA 2P6NA 5FBRB 2FSVA 1ZIPA 1CY0A 2FN4A 4GVLA 3DOFA 4JMLA 4OQZA 2RSLA 1QH1A 3OQJA 3LNCA 5JW6A 3RHFA 2P9CA 4ZAGA 1MV5A 1ODTC 4OA5A 3Q40A 1VP3A 2GN8A 3KJGA 1UBNA 3E7DA 4U7PB 2I3BA 2OBXA 5C53B 4HDSB 4U00A 1DO2A 1TMYA 2ECOA 1YL7A 2ZSHA 3IDFA 4ZQEA 2DPXA 2CV1A 3ILYA 5IT0A 1U5BB 4HGOA 1Z4IA 4ZI2A 3SF8A 2V55B 4JOCA 2WSSD 5D84A 3FVWA 5HQJA 3QELA 2UXCB 1CU1A 1ESZA 4WZBB 1KOLA 1V3UA 3HVJA 2VZ0A 2J85A 4PCVA 5GINE 2X4IA 2CXPA 4MS4A 2ZXFA 4F9TA 4MTCA 1USKA 3KKPA 4U0JA 3OY7A 3DFIA 5BV1A 1FSFA 2F7SA 2VDPB 1Z7EA 3A6KA 1EQ2A 3LE8A 4BNGA 4CM7A 3E82A 3W8FA 3SKXA 4J29A 4YALA 1RAGA 1RLOA 2AFRA 3JTEA 2E82A 3NM5A 4MGYR 3AKCA 4F5DA 4URVR 4B33A 2C97A 3LX5A 1NQVA 3VDMA 1M72A 2ZRIA 1GXSB 2CFCA 4DY4A 4E14A 3O93A 4H3VA 2E4WA 4XM1A 3ZZNA 1SC1A 3NH6A 3Q0EA 2GRUA 3T3OA 2QYHA 3V8NA 2YN0A 1II8A 1SKYE 3A3OA 4ITUA 3HB5X 5J43A 2OHIA 3KL4A 4UM7A 1II0A 4FWIB 4H3HB 3SSAA 3I62A 3ML1A 4D9HA 5JFTA 1J1ZA 3GLRA 4B76A 1LS1A 4OBEA 1PFQA 3SQMA 3WYCA 3ZI0A 5CA1A 1NOJA 3IBGA 3R3HA 1PZNA 4ND8B 2XKBA 3BBPA 1KMIY 1RAEA 2SHKA 1Y1LA 5TQ2B 5KJCA 1ZESA 4A1FA 4CM8B 5IDVA 4B2IA 1SXGA 2W8ZA 5IZCA 2C7BA 2FX3A 2W42A 3OEHA 4MP3A 3UMGA 1SEPA 4C5AA 1PR6A 3MCVA 3RSLA 2JARA 5C51B 3F49S 5EQDA 1ZC4A 1JEQB 4P3OA 4ZZ2A 1XSEA 1DKRA 3S55A 1THZA 5E4YA 5CW2A 1FNNA 5AVWA 2Z30A 2Q9UA 2IP1A 4BO9A 4D0SA 4F6CA 1B74A 2WHEA 3HABA 4PAGA 3B9PA 3VDRA 2IYVA 3KQLA 1V48A 1L7MA 3GQBB 1SCDA 1TU4A 3A8TA 3KLMX 1ES9A 2B1QA 4RHUA 4CE6A 4H60A 3WTCA 5AJUA 5FA8A 4QTYA 3FGZA 2G36A 3V2HA 3VYUB 1FFEA 3L8YA 4E22A 1TVCA 1G8YA 1QVZA 3EJ6A 4C22A 4S1WA 1YDEA 4D82A 4F4JA 5TC4A 2Q3JA 4I5GA 3TXXA 4IQFA 5G1PA 2HSDA 4P08A 2EJUA 3LBYA 2C94A 4Q01A 3NXKA 4FN5A 1KC1A 3SZUA 3ZHQA 4D02A 4YMUA 2P6RA 4EHKA 5DWQA 2YV4A 2Z8YA 4HAOA 3TLMA 1EFPB 4CQNA 1D2HA 4MP6A 4ZK6A 1V71A 3K0AA 4B6FA 1LWOA 1WVIA 5REQB 3FFBA 1CZNA 4KQEA 5CB0A 3W6PA 1R0LA 4FD3A 4EF4A 4F3KA 4AJEA 1XD9A 1CB0A 2P4SA 1Y8RB 5A9SB 3PL1A 1H2AS 4JI2B 1Y1RA 1X13A 2OBLA 3PFIA 1RWMA 2QM7A 4IIUA 1JDSA 1TYDE 2PWPA 2CVZA 1A95A 2X6QA 3NIWA 2QW1A 2W2OA 1M74A 3QY0A 4CLHA 5TJHA 5JSZB 2BHSA 3OZTA 3GA0A 1TL7C 4HBGA 5ES3A 1XMXA 3L4KA 4WH0A 2Y71A 1JA0A 1Y4ZA 2O48X 4HNRA 4MRPA 4N18A 4Z0TA 3MS7A 3RSGA 3T3PB 4C0HA 4C0SA 4B74A 3FSRA 5LZ4A 3DFZA 4PSAA 3A0RB 3MWDB 5ELLA 5BYJA 4YCNA 3IRUA 4J16A 1I7SB 3FSGD 3KKQA 3NWOA 1GA1A 1QGUB 3EXHC 1HOXA 3OPXA 3L46A 4OD0A 1PNTA 5AM0A 2HU2A 1FP6A 1NXWA 3Q5EA 4FMCB 1ZNYA 5DOVA 4AN0A 4LMAA 4RFSA 4BZXA 3CUSA 1CUDA 5JAHA 4J3NA 5JJCA 1EAMA 4HLDA 3VOAA 1NG9A 4TRNA 1QYRA 2GI4A 3AVOA 4KGVA 3OIDA 1AKWA 1NHWA 3QMWA 3UT5B 4NMMA 1IK6A 2XCOA 2A33A 2OOKA 1N8SA 1P74A 3AJAA 4HCJA 4KRYA 1C30A 2HOQA 4W8OA 1LI4A 3T9BA 4UJ3A 3ETGA 3PS9A 3K73O 3ZTTA 3K9FC 3EOBI 2DPHA 2RB5A 4NK5A 1FSZA 1XZ8A 2J9XB 3LQFA 4PICA 3OT5A 2Y93A 3W78A 1CR6A 1SXJE 2WWWA 3FJ1A 3TI7A 4DNOA 3TLJA 4C2AA 1PD0A 5AKLA 1UZAA 1Q20A 3KVVA 3U3RA 4B7ZA 4E2FA 4EKDA 3B13B 4CCAA 3SEZA 3NDBB 2OL4A 1WX1A 2CMFA 2AV6A 3GCZA 4B81A 2NZWA 1L1FA 3ZXYA 5FOTA 1TI7A 3G9QA 4UFPA 3B6JA 3F5MA 4CEJB 5PGMA 1QX3A 4E5MA 2P2DA 3NTOA 4B2LA 1SCUA 2OO5C 2OFXA 1S8OA 3H2KA 1Y81A 2VHEA 4NK4A 4D74A 1R5BA 3JQFA 5C8XA 4MDEA 4IF6A 5EHXA 5KJ6A 1G5FA 3M49A 4Q1EA 4NCHA 1GRNA 2RH5A 4ALJA 1Z9BA 3R09A 4F21A 1QS0B 5CRIA 2SICE 5B1DA 2OKGA 4E2XA 4HDMB 4GQIA 3ZDFA 1GPWB 1KDPA 1OZAA 3UCFA 1W4BA 2Z2YA 3R5XA 5FWXA 1CRZA 3BRSA 4OIFA 3W3ZB 1JPVA 1PJRA 2XB8A 4KQ6A 4MMYB 1A96A 3IXMA 3Q5DA 4NE2A 4A91A 4WBNB 5JFOA 1QTQA 1MLDA 3GVIA 1GPDG 1XNRB 1A5TA 2FNAA 4CODB 3S2IA 1RQNA 1M2WA 1FFAA 3ENVA 1MZVA 1P5FA 4RPIA 3UG6A 3HP7A 5G4LA 2R4TA 3W5SA 4MA0A 3CW9A 1XDUA 2PKQO 3T3IA 4G0OA 3QPDA 3U13A 2YJ3A 1PVVA 1QP0A 2ZCVA 2RDMA 3LPDA 3OFVA 4G9EA 4OF4A 3CX4A 3N8DA 2BTEA 4E1AA 1BCRB 4KNVA 3QYAA 3A6PC 2OP1A 1VTKA 3AIOA 2G70A 4BO1A 5JV5A 1OV4A 1YR3A 1G5HA 3CQ9A 2K6GA 5KYKA 4Q3LA 2YBEA 5CK5A 4XPZA 3FOAA 1IN7A 3DQQA 4BMVA 4V38A 1FUIA 1CR2A 1P62B 4IHJB 5KTOA 1FFSA 4ZVVA 3BTUA 4AY6A 2GAOA 4EB6B 2FWNA 3P5BA 2NVWA 3RVNA 3L1VA 5ALEA 4B35A 2O52A 4NMHA 1GGJA 1QRTA 5JE8A 3GRFA 3M1YA 1QAMA 3T0FA 2C04A 5DNVA 3VR0A 2FHPA 3DPUA 3GRUA 4RF5A 1DSSG 1EHCA 1VE5A 1VHDA 4E5NA 4EBBA 2VLIA 3S0JA 2GN9A 3QOXA 4FFSA 3TRJA 3STYA 5IG2A 2CNNA 4XIFA 3PXCX 4PSUA 3I45A 4YCJA 3IQXA 5KTRA 3FOFC 5LL6P 2W6JD 2F4VB 2DB3A 3T4XA 2PUJA 3A37A 2X2FA 3L7DA 3NATA 5KYWB 3FDZB 3CO5A 4P4SA 2ZJOA 4Y6LA 3ZBTA 1RVV1 3HCAA 4JQCA 2VJLA 2VUSA 3N39C 2ZT8A 3LRPA 1NY5A 3AHEA 2HK6A 4RMIA 4JIGA 2AZXA 1NSFA 5AVOA 4RKYA 4BFSA 1SK8A 1S8AA 2FCRA 2JCGA 4GNKA 2ATEA 4MV8A 5GONB 3VKVA 4DCMA 4ETMA 1P2UA 3QLUC 4OHMA 5KREA 3H13A 1UFVA 1YR2A 1AKQA 1NBOA 4L72A 5T64A 2WOJA 1X7GA 4MV7A 3RUFA 1JR3A 2KHZA 4OQDA 3BA6A 4XI9A 1WPRA 4BE9A 2I91A 2WJIA 3OQHA 4OQNA 2MINB 3LRXA 1ORTA 1SK9A 13PKA 2FFQA 3BWBA 2FU5C 3O2SB 1N4AA 1ZAYA 3DDUA 3PUXA 3KJZA 4MK4A 1AHNA 2IPXA 3F4KA 3O8RA 4AMZA 1U7XA 3SYTA 2E2WA 3EHDA 2VCYA 1SKBA 3KVYA 2AZDA 1O95C 1FX0B 3LUDA 1TYCA 3UJ7A 5FWDA 1YRBA 5LQCA 1JFTA 2E4UA 2IUYA 2IITA 3NR2A 1G7TA 2FUG1 3AR5A 3PXXA 4S3MA 5JCJD 1UIRA 2RGBA 3GGCA 3KXPA 3HR4A 3U3XA 1YA8A 2ZSEA 2LZ0A 4AJ4A 1FRZA 1I3OA 3M6XA 4N49A 3PQ2A 9ATCA 6ABPA 4LSZA 2G09A 2NT4A 2DTEA 4W1PA 1NBHA 3AYZB 4MUNA 1FUYB 1H22A 2Z3WA 3JY6A 4UXIA 3PGA1 1FDVA 3G89A 2W11A 3OG9A 1NMXA 4TROA 2XUIA 4N5NA 3HWWA 3BCSA 4MJ7A 2BOVA 3S28A 5JQGB 3C7TA 2NV2B 3UV3A 2HLHA 3GXOA 1T1EA 2QE7A 1HR0B 1A0OA 1X1AA 3AIIA 2JFHA 4K0KB 3ASUA 1P1CA 3VPBA 1Z22A 3OTQA 3T54A 1M2GA 2CC2A 1GYPA 2PJUA 4RDIA 1CNEA 4E03A 3IOBA 4J6FA 4GR4A 2CNDA 1LD3A 1C2TA 1U8FO 1YOVA 2GZ2A 4LVCA 3AUTA 3SM3A 2Y0DA 1P7WA 1TKCA 1WCXA 4YJHA 5BWBA 1DBWA 3FPCA 3HJTA 4O2RA 5H16A 4Y0NA 3WYDA 1LBEA 3TBFA 5GOZA 3IIMA 1BYUA 4Y2YA 4G5GA 2PNFA 3NYQA 4MUIA 5JI3E 3DLHA 1PD1A 2O54A 2X86A 2FDXA 1PE0A 4UCQA 3UJBA 5F98A 3ND6A 2XXAA 3BGIA 2GA9A 4BNHA 4KGZA 4L51A 4EYKA 1JG6A 5IAOA 4LZNA 1IVYA 5DLYA 2ZQZA 4FHFA 5JH7A 1UFQA 1UAGA 2VR1A 5BVGA 1BS2A 1O9BA 1T43A 4LNUB 2C2MA 4L5IA 1A8IA 2DU8A 3WYEA 5M29A 3JQGA 1PJAA 4YAWA 4JSTA 4KJXA 2X0RA 4BJ1A 1PLJA 2ILVA