2PD4A

Crystal structure of the helicobacter pylori enoyl-acyl carrier protein reductase in complex with hydroxydiphenyl ether compounds, triclosan and diclosan
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
274
structure length
274
Chain Sequence
b'GFLKGKKGLIVGVANNKSIAYGIAQSCFNQGATLAFTYLNESLEKRVRPIAQELNSPYVYELDVSKEEHFKSLYNSVKKDLGSLDFIVHSVAFAPKEALEGSLLETSKSAFNTAMEISVYSLIELTNTLKPLLNNGASVLTLSYLGSTKYMAHYNVMGLAKAALESAVRYLAVDLGKHHIRVNALSAGPIRTLASSGIADFRMILKWNEINAPLRKNVSLEEVGNAGMYLLSSLSSGVSGEVHFVDAGYHVMGMGAVEEKDNKATLLWDLHKEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
publication title Crystal structure of the Helicobacter pylori enoyl-acyl carrier protein reductase in complex with hydroxydiphenyl ether compounds, triclosan and diclosan
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Oxidoreductase
total genus 91
structure length 274
sequence length 274
chains with identical sequence B, C, D
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2007-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2pd4A00
4IDGA 4W7HA 3ZHBA 4JK3A 2YV1A 3RUCA 2E49A 2YV2A 1YVEI 4Y6PA 4OQZA 4J4BA 3OF2A 1HRDA 1ZFNA 3BXXA 2VWQA 1Q0HA 1PS8A 4UEKA 3F5QA 2E4AA 3LT4A 3EVTA 2DLDA 1VM6A 4FDAA 5H81A 3ZDFA 3WGQA 4IMRA 3VZRA 2HAEA 4BV9A 3VTZA 3IS3A 4FR5A 5C7IO 3U3XA 2HO5A 1ISJA 1GQQA 2H5LA 2JAHA 4WJZA 1AN9A 4R1NA 1GDHA 3ZI0A 3D7LA 4PG8A 4NJMA 3O9ZA 3BMOA 2Z5LA 4FFLA 2XXJA 2QYSA 2POQX 2WD8A 4RCVA 2FOIA 3RBXA 4E31A 4D0SA 1P1HA 1W8DA 5B37A 3HNPA 3DZIA 1N1GA 3NJ4A 3OHSX 5BNIA 5IDWA 1Q0QA 3JQ7A 2D1YA 4YQZA 5FFFA 1W0CA 4O5OA 3IDSA 5TRTA 1H9BA 6ADHA 4HFNA 4B3JA 4R69A 2AQIA 1HDZA 5DNAA 3VDQA 3MOGA 2J3HA 3CMMA 3OECA 5KVVA 3WWYA 4YB8A 3JV7A 2IE0A 4JROA 5G4KA 3NYWA 3ZNPA 4D3SA 4PIVA 3WG9A 1CDOA 4AFNA 3A06A 1I24A 3NX4A 4GH5A 3S2GA 3UKOA 3BIOA 4CL8A 2YDYA 4KUHA 4TMFA 3GUYA 5U1PA 3TZCA 4FC6A 1PJCA 1Z82A 2O4UX 2Q49A 4HY3A 4MVJM 3WOHA 2DPGA 1ZW1A 4EI2A 2DFDA 3DFZA 4A03A 1ZK4A 3L6DA 3LC2O 4J0EA 3JQAB 4BNVA 5T64A 1B3BA 2FSSA 4NBTA 3OJFA 2VHVA 4I9UA 3EUWA 2XPCA 3ANNA 2VYND 4BO3A 1L7EA 1NFRA 1GUZA 1T4BA 3QLJA 1ISHA 1ENZA 1SB8A 3DMTC 4FIZA 3V1YA 4D41A 2EV9A 5J23A 3C8MA 4WASA 2Y05A 4J7UA 1UDCA 4PZCA 3ZWXA 1ZO8A 3GGOA 3JCZA 4BHTA 3ZN2A 1JVBA 2X58A 3K5PA 4XWYA 4JBIA 2NACA 1DIRA 3A28A 4I1IA 4RPHA 2PFGA 4LRTB 1YJ8A 1V9LA 2X7HA 3WXBA 1R37A 1DOHA 3JSAA 5G4LA 5A4DA 4AJEA 3VTFA 2ZCUA 3MJVA 3G3EA 1U4SA 1DPGA 3JQ6A 1PQPA 3AFNA 2VN8A 3IKVA 3MTJA 4ZQFA 2FHSA 4I9NA 3ZV6A 1O95A 4GKBA 5HM8A 1BW9A 5LC1A 4IJKA 2O3UA 1U5AA 2I99A 4UVHA 2NVUA 5JCJA 4CM8B 1CQJA 4OIMA 1Q1NA 1XDWA 2C5AA 4EJ0A 4L0QA 4W6ZA 3ST7A 3I9OA 4GMFA 1LXCA 4YJGA 3DBHA 1JKJA 4B8ZA 3TOZA 4CM7A 1TXGA 1RYEA 3ZHXA 4WCFB 1H0KA 4XDZA 1XSEA 1R4MB 1DIBA 4R01A 2P91A 3AI3A 5AQ1A 4A0SA 2NQ8A 1VE9A 2WYVA 3GQVA 3LF2A 4L8VA 3OH8A 3OJ0A 4O0LA 3RBVA 2JKVA 4UVEA 1XEAA 3GDOA 4CQLA 3ZHZA 5KWEA 3WGOA 1DLJA 1HYHA 3PDUA 2B4RO 5IG2A 1DFHA 1NM5A 1X7HA 5F21A 4HFJA 4OSPA 1P1RA 4BNUA 2FN7A 4XRGA 4CLOB 2IRWA 2OBNA 4X54A 3UICA 3S55A 4BKQA 4GGOA 1TT5B 2BI8A 4BNGA 4JCOA 2G76A 1SB9A 4BO8A 2CY0A 3VVBA 3AUTA 1E3WB 1KYQA 3WS7A 3GOHA 3WLFA 1C0KA 1PZGA 3TZKA 5C5IA 3GEDA 3SXPA 1Z7BA 1GYPA 2FZWA 5C7LO 3IP3A 2O3RA 1KC1A 4PGFA 2JCXA 4PLCA 4FBGA 1PJSA 1BTOA 2P68A 4D46A 1ONPA 4OH1A 3KYDB 2O3TA 5L45A 4IINA 3WSWA 4FJ2A 2IEDA 4DLLA 3Q9UA 1R16A 1J49A 2BF7A 1OZAA 2HRBA 4L4SA 1F14A 3A4VA 1HTBA 4DPMA 2CVOA 4BNFA 1GPJA 1GR0A 3V2HA 3KB6A 1XLTA 3I4FA 2FR1A 1X1TA 4M1QA 5K0ZA 3WBBA 1A7KA 3KHUA 4FFPA 4BL5A 1ZJYA 1QYVA 1NASA 3WNQA 1ZEMA 1SOVA 2EF1A 2JAPA 1H6BA 1F06A 2JFGA 4LCJA 2D3TA 3LVFO 4WLOA 3AY7A 2Y0CA 1Q2XA 3UXYA 1SBYA 1GY8A 2Q2VA 4R41A 1HEUA 5T57A 3B1JA 3D1LA 1I01A 3AOEA 3ZU3A 3ZHYA 2BI7A 2GGSA 3IIEA 2D5AA 1C1XA 1DDOA 1X0VA 4XQEA 1D3AA 4CM9A 5B1YA 4IXTA 3A14A 3GY0A 4I5EA 4II3A 3U0BA 2IYOA 1IY8A 3DFUA 3JQFA 1JDJA 1ARZA 7ADHA 5IFLA 4IIUA 2HSDA 1HDGO 5AXBA 1P1KA 2NTJA 2O3SA 1QR6A 3K2BA 1IUKA 1S7CA 2JHFA 3VH3A 5JAZA 4AJHA 1EDZA 2Y0EA 4J2HA 3UCXA 1Y6JA 3OFSA 1SAYA 4TVBA 3WFIA 3VZPA 5L9AA 3HDJA 3FBGA 3AI2A 1VKNA 4CLXA 1T2CA 2DT5A 3JD4A 3EK2A 1B26A 3PDJA 3H3FA 4KDEA 5L51A 4E30A 3JYNA 3ZZNA 4CMKA 3ETEA 5CEJA 4W9NC 3ONEA 1DJQA 3NUGA 5TGDA 3JQBA 4EZBA 2ZYGA 4DYVA 3KTDA 1U9JA 2CUKA 3IJPA 3K92A 1WAMA 4OSOA 3NDJA 5JSFA 4BNHA 1JKFA 1XR3A 5GZ3A 3AM3A 1YBAA 3CPSA 4RQUA 4WKGA 1KIFA 2YFQA 4JJIA 4OHUA 1D1TA 3RKRA 3U09A 4L74A 2C59A 2PLAA 4NQZA 5DF1A 3VZSA 1J4AA 1ZEJA 2HK7A 3GG9A 3EY4A 4RDIA 2PKRA 4YCAA 5DBGA 1WXDA 2DTDA 3PJGA 3W8EA 4DA9A 3VKUA 1XU9A 2H63A 1RKXA 1P0CA 1U8FO 1X14A 2EWMA 3RUIA 1I3MA 3CSDA 5JAMA 3W6ZA 2YZ7A 4IGFA 4NMHA 3LF1A 5F5NA 1PZEA 3G1UA 3I4CA 4CMBA 1VC2A 1TA4A 2JFHA 3CKYA 4OXYA 4N7RA 4FN4A 1PTJA 1QORA 1G0NA 4OO3A 3FNHA 4CLRB 3F1KA 4O1MA 2J8ZA 4GX2A 3OQ6A 4GMGA 4CUZA 5JBIA 3PHIA 3TZ6A 1N1EA 4UAGA 3JQAA 1NVGA 3RROA 2X4GA 3AOEC 2P5UA 3E48A 1ZH8A 4MIEA 1UP4A 1FDTA 1SC6A 4URFA 3Q11A 4NK5A 4AJ4A 3H65A 3DOJA 4J1TA 1EDOA 3L0DA 2X5KO 1GQ2A 2RCYA 4ZQBA 1FK8A 1QP8A 3VVCA 2FPGA 1KS9A 3JQDA 4ZRMA 1LLDA 4DQXA 5FI5A 4DLAA 4MPDA 4A7PA 1QYWA 3DTTA 1XA0A 3PWKA 2EERA 4IDCA 4HX5A 1N5DA 3TPCA 5L4SA 1HE3A 1T1RA 4NG5A 1LDNA 2FR0A 1DHRA 3D3WB 3H9GA 4UVIA 3W8FA 2C7VA 3NGXA 1DSSG 4CMIB 1EZ4A 2WM3A 4BGUA 1PWZA 5FF9A 4FFOA 4XEHA 2EP7A 5KJFA 1JTVA 5ENDA 3ZWWA 3AOGA 1SO8A 3I5MA 4DGSA 1DRWA 5F1PA 4WLNA 4QUKA 4CM8A 5FI3A 3ZW9A 4R1UA 2ZYDA 2X9VA 4XGKA 2VTDA 4XDYA 3RWBA 3GAFA 4LGVA 4DIBA 1HDYA 1I3LA 3GGGA 3B1KA 1GADO 1A5ZA 3RFXA 3ZWPA 4JBHA 5B4TA 4CV0A 4KP7A 4Q3NA 2YHIB 4J4TA 1BG6A 4WCFA 4UVDA 2O7SA 1YJQA 3IOYA 1R4MA 4QTZA 4Y8VA 2BD0A 4MKZA 2ET6A 3OQ1A 1WW8A 1E7MA 2Q1UA 1D4FA 1GU7A 4RLHA 5TT0A 1A27A 2CFCA 2P5YA 4J4HA 1Z45A 2W2LD 3EW7A 4D42A 4J49A 3QW2A 1MV8A 1FJHA 4GKVA 1PEDA 2BGKA 3DAFA 3OQBA 3DZHA 1I32A 1MLDA 1PL8A 3JYPA 2Q2WA 4KWIA 1Y5MA 1EBFA 1YDEA 4NFYA 1FXSA 5DBFA 4CLOA 3QE3A 4XA8A 3LT1A 1GCUA 3U4HA 4PZEA 1TT5A 2J3KA 3TZHA 1B15A 1IYZA 1IHXA 3QWIA 5EN4A 3QA9A 1B2LA 4MOWA 1A4IA 1E1NA 4ESOA 4MKRA 4N5MA 2DPHA 9LDBA 1LRLA 1O89A 2UVDA 3M2PA 2UUPA 2W98A 3B70A 3C3XA 4I5FA 2O3JA 5G2OA 1G1AA 3GEMA 4MKXA 2OUIA 2EGHA 2NU7A 4FFRA 2J5QA 3GR6A 3WBFA 4OM8A 3BMQB 5TSDA 4C4OA 4IJUA 2O23A 3KYDA 1EFLA 2D8AA 4WPGA 4NR0A 5I9NA 4IUYA 3L77A 3Q2IA 3GA0A 2PZLA 2DU8A 3X2FA 1VKOA 4LVCA 1HLDA 1KETA 1V3VA 2I3GA 4TWRA 1GUFA 5JC8A 2D0IA 2F1KA 3OEWA 2WYWA 3I9MA 3JQ9A 4IPTA 3RUAA 1Q7CA 2GN6A 2Y67A 3CIFA 3HADA 4DMMA 2ZATA 4LMRA 2WMDA 2PGLA 3DC2A 4ZQHA 4YT8A 3IQDB 2NM0A 3E82A 1RWBA 5T67A 1E3SA 4G5HA 4BQPA 1OC2A 3VPFA 5JO0A 3TF5A 2PGJA 1UXKA 1LQTA 1JA9A 3DL2A 4R3NA 4XQ9A 5TQVA 4EUFA 4WOKA 2BRUA 2VWGA 1KVQA 4M49A 1K0UA 2PNFA 2FZEA 2O7QA 1L7DA 1MP0A 4OL9A 1N2SA 4DRYA 2GN8A 1JQBA 3NT4A 1AXEA 1IE3A 2YW9A 4D3DA 2NTVA 3DOOA 4UREA 5G0UA 3B1FA 1PU2A 2D59A 4JP3A 2Q4BA 4CM5A 4HXYA 4UEOA 4BKRA 1EBUA 4NNJA 3S1LA 4YXFA 3LSYA 2VZ0A 3DXFA 1UZLA 5KJCA 5JW6A 2FP4A 1H6DA 1UP6A 4PN3A 1IPFA 2X0RA 3MEQA 4FB5A 4ND2A 3PVZA 4UUOA 2ILTA 1MFPA 4KQXA 4ZRNA 3TRIA 4ZICA 2X0NA 1P31A 2Y1EA 3ZV3A 1B16A 4BGIA 4IJWA 4M55A 1PQUA 4WGGA 3IKTA 5IDXA 3LDHA 4CV3A 3WGHA 3C1OA 3WYEA 4BNNA 1V8BA 2Z1MA 4ID9A 2HK9A 3SX2A 3G79A 3GVIA 2DC1A 3TL2A 3U4IA 4Q39A 3W4IA 1T26A 2HMVA 3DZJA 3N74A 3C7CB 1T2AA 1HZZA 1PJTA 4ND4A 3DAGA 2HLPA 5JLAA 3UVEA 3RI3A 3NDRA 2Z95A 2OXIA 1DIHA 4QO7A 5I9MA 3RFTA 4TROA 1P0FA 1SZJG 3H5AA 3O8QB 1MXHA 3EMKA 1GPDG 4W4TA 3M1LA 4L76A 3Q1LA 2AQHA 3JQ9C 1LEHA 3ROMA 4J1QA 5CDYA 4BQRA 3KLMX 2DBQA 4AJJA 4N5NA 4E0BA 4IMPA 2BH9A 1IB6A 4KWHA 1LRJA 3NTRA 1JN0A 4B3IA 3SC6A 1PWXA 4PLZA 3EYWA 4XJTA 3I52A 5IZCA 3IL2A 4BO1A 3L9XA 5KJEA 4WE3A 3PHLA 4B4UA 1CRWG 4CLRA 4R54A 5DN9A 1UJMA 2B83A 3FNEA 1O9BA 4G81A 4L73A 3L6EA 4OOEA 5CEFA 4OAQA 1NTOA 1SPXA 3NAQA 5A04A 3VDRA 4XQGA 4QX6A 1DAPA 4FSHA 1ISIA 3C85A 4XIYA 3T4EA 4MO2A 1H93A 1UXGA 2GYYA 2X8LA 1PQWA 4EDFA 4H15A 3DMTA 1XG5A 3WR5A 4CMAA 4XYEA 3C7DB 4S1VA 2P4HX 3QVWA 1UZMA 1MX3A 1V35A 1F17A 1RM3A 2Y68A 5JFOA 1YQGA 2IZZA 3AK4A 4N18A 3JQEA 1RM0A 4ZVVA 1U7TA 1WVGA 3GT0A 1LNQA 1VLLA 2Y66A 4JBGA 5A9SB 2AW5A 3RIHA 2VCYA 3GFBA 4PG5A 3AU9A 1F0YA 3GC6A 4HV4A 5FYDA 3PIDA 4BNZA 1GCOA 3RJ5A 4DL9A 2QG4A 4NU5A 1Y9EA 3RAJA 4BMSA 4IBOA 4WLUA 1I0ZA 3RC7A 4YAIA 2RAFA 2ZJ1A 3D3WA 2PZKA 1QMGA 4R5MA 3WWZA 3LT2A 4IDAA 4RL6A 4CMIA 3BMCB 1E3JA 4W99A 5HA5A 3U5TA 3UHAA 4QQRA 1YB1A 2FWMX 1F12A 3JYQA 4L4RA 3ROPA 2FPPA 3H3JA 4NU6A 1M2WA 2Q45A 2PA3A 4HNGA 4HADA 3I6QA 2HUNA 3VH1A 4MIYA 5DULA 3PEFA 1WDMA 2LDXA 2W2KB 2H9IA 3M1AA 4RLSA 2EKQA 2O2SA 1NPTO 1XHLA 4PVCA 2V65A 4QFCA 3WGYA 3GK3A 3EVNA 4OOFA 2YHIA 2ZJ0A 3C24A 3PGXA 4UVGA 5CP8A 2AG5A 2H6EA 3RFVA 4J2OA 2IXAA 1DIGA 3ABIA 3JQCA 3ZWOA 4TZTA 5IZCC 1OC4A 4R68A 2OZPA 3F9IA 3GF4A 5GMOA 2X9NA 5DP2A 2XF8A 1QKIA 4YT5A 1ZSNA 3PGJA 1CWUA 2V6MA 2VTEA 3WGIA 4RVGA 4BO0A 1H94A 3O4RA 1QV6A 1XQ6A 2GN4A 4UEJA 4FC7A 1R0LA 3OM9A 4NK4A 3FR7A 4NBVA 1GZ6A 2UAGA 4YDRA 3TZQA 4M86A 3UCFA 1PZHA 2VYVD 4DTIA 4ND1A 3BTVA 1ADCA 3FN4A 4F46A 1DEHA 4GSKA 1JWAB 1DO8A 4JX8A 1JU9A 2GCGA 2BFMA 2DUUA 4B4WA 3LLSA 2AMFA 4PZDA 1SMKA 1PJBA 2A35A 4BO2A 4A10A 4CMJA 3RJ9A 4EEXA 3VKVA 5JY6A 1PJ2A 3BMQA 4K6CA 1VPDA 3PTZA 3HFGA 5IDQA 2IXBA 5ES3A 2NQTA 3W6UA 3MJEA 1LLUA 1U2DA 2IODA 1VRWA 3AI1A 3GPIA 3PQFA 4BS9A 1ZK2A 4QEDA 4PLHA 2ZTUA 4Z6KA 2B5WA 4FS3A 3VPHA 4R1SA 1K89A 2A9FA 1Z74A 5TJ9A 3VOSA 1OAAA 4XD2A 2WE8A 3WMXA 5L95A 4MDHA 3F6YA 1ISGA 4RPKA 3QWBA 1HDRA 1QXSA 4AJ1A 4MVJI 2O3QA 2J6IA 3IC5A 2R2GA 3Q0EA 1P44A 1I36A 3BMNB 3RC2A 4JN6B 2P2SA 3CZRA 1H9AA 4D79A 3G49A 2D2IA 4LISA 2I76A 4RPGA 5TT1A 1BHSA 1WLYA 5A02A 3KVOA 5C3MA 1C1DB 1O6ZA 2RIRA 3WDSA 1M66A 1C14A 3WQQA 1E3IA 2CDCA 3FBTA 4P22A 2EG9A 2SCUA 3PLNA 4OMUA 4BO9A 1HE2A 1Y1PA 4ALMA 3ZWNA 1LSOA 2NSDA 1CERA 1UDAA 3BHIA 5IN5A 2Y1DA 4GQAA 1Y5RA 1ZUD1 1NHWA 4DQVA 1ZIDA 4LMPA 2HMSA 3I3OA 2ZCVA 3MOIA 1R0KA 2GZ3A 3LQFA 5BNFA 4QT0A 3K9QO 5JYEA 1L1FA 4R4JA 4MIOA 3GLQA 4Z0HO 1BMDA 3KSZO 2ZTMA 2VQ3A 4M8SA 5EINA 1DFIA 2UDPA 4E5MA 2HJSA 5A5FA 3DQPA 4B8WA 2EW8A 1U3VA 4W9NA 4R3WA 2UYYA 1CQIA 5CDTA 1JAXA 4CLDA 2BHLA 3RC9A 1Y8QB 3PWZA 1LUAA 9LDTA 1O0SA 2H1SA 4JP2A 1PR9A 2X5OA 5EMHA 3WMWA 1H2BA 4RGBA 5IF3A 1PIWA 4EEZA 4XB2A 3AM4A 2EJVA 2EP5A 1WNTA 4D3FA 2W2LA 4J43A 4WNIA 4A73A 5CDSA 1VI2A 2WD7B 2AE1A 2QYTA 4NBUA 3O8QA 1IZ0A 1NYTA 3BTUA 4BNMA 2PTGA 4BVAA 2CF6A 1X15A 2C0CA 3DHEA 3H2SA 1A9ZA 2PR2A 3CMCO 1NAIA 3O03A 5ER9A 5EPOA 2J3JA 4F3YA 4Z9YA 4XRRA 3UAGA 4AJKA 4E12A 2YY7A 1MUUA 3SJ7A 3IMFA 1QLJA 3RBZA 4GGPA 1T25A 1BXZA 3QVTA 2B5VA 4ITUA 4Y6SA 3UN1A 1M6HA 3VH4A 5JAIA 2OBYA 1PS9A 1R66A 2C2YA 3KV3O 1LDGA 4IDFA 2Q4EA 3GRPA 3HG7A 1B3RA 4YJDA 1V3TA 4GBJA 4Y6RA 4DXHA 2PV7A 4KMSA 5BNTA 1FDVA 4FGSA 3DZFA 3GPDG 4I5DA 4R16A 2UUOA 5K9ZA 3G1TA 3GVXA 3R1IA 5COAA 1FDWA 2IZ0A 1A7AA 5DDIP 3MJSA 1C0PA 1J6UA 4O63O 4WECA 2NVBA 5U4QA 4BNJA 2ZB8A 5THQA 3F3SA 2CZCA 2NTNA 3QVSA 1G6KA 5KVQA 3LZ6A 4CV1A 5CDGA 1U3WA 4E4YA 1NXQA 3HDQA 3PYLA 5A9SA 1HDXA 3E1KA 4U0JA 1C3VA 3AM5A 1YH3A 2BMAA 4AJ2A 3MWDB 3TJRA 1A72A 2CNBA 1MG0A 3H5RA 3V2GA 5A5EA 1EUZA 5L3ZA 1DLIA 1ADGA 2GO1A 3HSKA 3H2ZA 4Z0TA 1V0JA 1D7OA 1HWYA 1GAEO 5GY7A 3ZH2A 5BSEA 1MXFA 4Q3CA 3DB2A 3BMCA 3I6IA 3UGKA 4B3HA 1GZ3A 3INGA 4WLEA 4YRBA 4J90A 3C7AA 1WP4A 2GRAA 1LX6A 2JD1A 5A05A 3NKLA 1U7HA 4E33A 3PLRA 2JD0A 4ALNA 4KQWA 2EHDA 2Y1GA 4IY1A 5B4UA 1U1IA 5G0SA 2NU8A 4MVJD 3H9QA 4TRNA 1UP7A 4O59O 1NFQA 2PWZA 3HN2A 2YV3A 4I08A 3K8ZA 4CLHA 2O50A 2W2KA 3ASUA 4ZHSA 2B37A 4PCVA 3RC1A 2PH5A 1KBZA 1EVIA 1K6XA 3FNFA 1ZBQA 3V8BA 4GWGA 4Q3BA 2J5KA 1XELA 1PGOA 1D1SA 1BXKA 2P9CA 1DB3A 2Q3EA 4BB6A 4BNKA 5LDGA 1NR1A 1LC0A 3TOXA 4PLGA 3HZZA 1AE1A 2YFHA 5DCWA 1DC3A 4CM6A 3P19A 1ZXBA 3FCOA 1IHYA 3ETGA 1MFZA 2CVZA 4K1LA 1QG6A 3S8MA 2JCYA 4R5HA 1N92A 4G65A 1ZKMA 3ZU2A 2V6BA 5ICMA 4PFJA 5I7EA 2I3AA 4IS3A 4RVUA 1UZNA 1HETA 1UH5A 4DPLA 5ILGA 4RQTA 1EEHA 1HKUA 2HJRA 1AHIA 4A2CA 5KVCA 1A9YA 1LLQA 4UULA 5BSHA 1E7RA 1I2ZA 1X7GA 4AL4A 2B4QA 3LK7A 3RASA 4GX0A 4JJFA 4HP8A 2VT3A 3PQEA 3KO8A 4RPLA 1U3TA 5I8ZA 2I65A 3ICPA 3QP9A 6LDHA 3W4KA 3ICCA 1PL7A 4Z9FA 2WEKA 1C0LA 4RF4A 1WWKA 4R51A 4YAJA 1E77A 1HSOA 2B35A 2CDAA 4II2A 4K9DA 3FWNA 1ORRA 4DUPA 2Q1TA 1M67A 1RM5A 4U6SA 1S6YA 5EL0A 1OFGA 3T7EA 4FFMA 5JYDA 4LN1A 1BVUA 1Z7EA 3DHYA 1V3UA 1ZK3A 1QSGA 3FWZA 3PZBA 4XX0A 3IJRA 4CMGA 3AJRA 1MA0A 4DPKA 4YWJA 4F6CA 3GH3A 1NBOA 3ORFA 2Y0DA 3MJTA 4RVDA 1P9LA 1YGYA 3IP1A 4ONEA 3QJ5A 1A4UA 4CMEA 2V7PA 2ZTLA 4W82A 1PJ3A 3BMNA 3H9UA 1LDBA 2X6TA 1ZXLA 3AUSA 4CM3A 3CZMA 4WK6A 4M54A 3F5SA 1E6UA 4YEDA 3ENNA 1LI4A 3SLKA 1QYDA 4RV9A 3ZWBA 3PFWO 5MDHA 1YBVA 2J5RA 2I67A 3O26A 5AOVA 4BMVA 3CUKA 4EJ6A 4H16A 4PLYA 3KBOA 1C1DA 2BFPA 2WTBA 3P7MA 4P38A 4CMHA 1I33A 3U49A 1WDLA 3D0OA 1PR3A 4M89A 1QLHA 1O94A 4TSKA 4AICA 4BNLA 2FMUA 4MINA 1I10A 3ROQA 2NUAA 1KEWA 1W73A 5U9CA 1H6CA 4HBGA 5F1OA 1R12A 3P2YA 4C7KA 5F1KA 5FWNA 1GUYA 3PP8A 1I2BA 3SJUA 4RVSA 3B6ZA 3S2FA 4RF2A 3WIEA 1TLTA 3R6DA 3TWOA 3ITDA 3HDYA 3HJAA 5BR7A 5BQFA 4BUCA 1IOLA 1KVRA 4QO8A 3JTMA 1E3WA 3FR8A 5KTKA 1WMBA 3QVXA 3V1UA 4OXNA 5ITVA 1GD1O 3F46A 1DXYA 1UR5A 2BFOA 3HFSA 2NU6A 1GTMA 4KDFA 2YQ4A 5COQA 2GNAA 1Y8QA 1ZSVA 2NWQA 4MP8A 4RZIA 3WX0A 3MTGA 1YQDA 5I8WA 2Q50A 1HDCA 1OMOA 2BGMA 2DM6A 4N5LA 4NDNE 5CPFA 3WGZA 4BNIA 2JD2A 3DWFA 2YJZA 1K5HA 3VZQA 5EJ2A 5JO9A 1BSVA 4RDHA 1ZMOA 2EKLA 1PGQA 5AXCA 1DAOA 1PZFA 4JNKA 5H83A 4BGEA 2G1UA 5KOIA 2WJPA 2Y1CA 2E82A 4TRJA 2GD1O 3WQRA 1Q7BA 2WD7A 2X5JO 3INTA 4GLOA 2NV6A 1SCUA 4E5KA 3M2TA 4NIMA 5IJZA 4BNXA 4DIFA 3NT5A 1WPQA 3BAZA 3FTPA 4WLVA 4J6FA 2AEFA 4DREA 2VZ9A 3GN1A 1J0XO 3WICA 1KEVA 1DC5A 3DBVO 2VYNA 5BT9A 4FW8A 4TVOA 4CMEC 1LU9A 1HYEA 4WEOA 4ALLA 2VYVA 2GERA 3JQ8B 3KLPX 4WUVA 4PLVA 3GAZA 1UXIA 4MVJE 4E32A 1DRUA 4E5NA 1E0DA 4YRAA 3RVDA 4NPCA 1X7DA 2CVQA 3PK0A 4P4NA 3PHHA 3COSA 2PZMA 4J7XA 2FRDA 3H4VA 4YYZA 1Z6ZA 5IAAA 4Y98A 2QW8A 4P4LA 5CDUA 3KEOA 4ROSA 4FFNA 1T2EA 3SLGA 4CL3A 1SEVA 5KCZA 3Q9NA 1DC6A 1XU7A 3E9NA 3WNVA 1DHTA 3E03A 2BGLA 3NTQA 4CPDA 8ADHA 5GZ6A 1ULSA 3JD1A 4PG7A 1CETA 1YL6A 3WJAA 4FGWA 5HRUA 3DBLB 3GNSA 1PGJA 2P4QA 1V6AA 1ZZEA 2AHRA 3HB4X 4D44A 5IXSA 3FF4A 3W8DA 5L40A 1LTHR 4YAKA 1N7GA 1O8CA 2OO5A 3OA0A 3PIIA 4BNTA 1R6DA 1EUCA 2I9PA 5JAQA 3DDNA 4KOAA 4R9SA 4RZHA 4B7UA 5CFZA 3D4OA 2DTEA 2X1HA 1E6EA 4GAEA 4Y67A 2YUTA 3RKUA 4WOJA 3VAZA 5CHEA 1VL0A 5T8KA 3EHEA 2EIHA 5JPIA 3ZNOA 2EGGA 4MP6A 2FPIA 3PQDA 1IL0A 4DC1A 5B4VA 3TFQA 3EGOA 1EVZA 3QVOA 4DC0A 3INRA 2W4QA 4O6VA 2HCTA 1PL6A 4Q3AA 4CR7A 3G17A 1ML3A 5JCXA 4GX5A 3GRKA 4U5QA 3W4JA 1ISMA 5DCUA 3V5NA 1XIVA 3AW9A 3QIVA 3KXDA 2GSDA 3ONDA 4BO6A 5G0TA 4E13A 1TB4A 3R3SA 1GL3A 2EW2A 3BHMA 5LCXA 5LDHA 3U9LA 1F8FA 1TI7A 5C7OO 3HE3A 1P77A 3GNQA 5K6AC 2W90A 4YAGA 3FRJA 3UF0A 1FMCA 1MGOA 3PJEA 1AGNA 2QQ5A 2GF2A 5KJ6A 3W1VA 3CTMA 2QZ9A 2C29D 2VHZA 2A94A 2XXBA 3VC7A 1PGPA 4WLFA 1EE9A 2AE2A 4IZHA 1QYCA 1VL6A 2PKQP 1YB5A 4KUGA 2E48A 4XYMA 3AFMA 2QHXA 4P4GA 5BSGA 2WYUA 5L7WA 4XYGA 1U3UA 1Z73A 1W6UA 4IXWA 1VJ0A 3S2IA 1YL5A 5CG1A 5THKA 1C0IA 2I66A 3BZUA 4RVFA 2AXQA 4RVHA 4EITA 3F4LA 2X0JA 4CUJA 3OMLA 4S3MA 3PZRA 3NRCA 2O48X 1BVRA 4CV2A 5KJ1A 1I3NA 4RPJA 1GYQA 1B8PA 1H2HA 2JCVA 4PLTA 1OOEA 4YA6A 3KYCB 2GR9A 5A9TA 5KKCA 1U8XX 2C5EA 3FPLA 1QRRA 1KEPA 2DUWA 4DWVA 1K2WA 1OBFO 3I23A 1KERA 2Q99A 3GVCA 5T6BA 1DIAA 4FOOA 2GUGA 3NT2A 1CF2O 1NAHA 4D7AA 5ILOA 4JXKA 3KM0A 5T8KC 3T4XA 1HLPA 2Q2QA 3ANLA 1YBMA 3WQSB 2Q1WA 2G17A 3K6JA 5L7YA 3S2EA 3NGLA 3ZNQA 2HMUA 1E5QA 2AA3A 3WFJA 1DFGA 5AVOA 3TL3A 3ZV5A 4B7CA 3HUDA 3QWAA 1YS4A 4FQ8A 1E92A 4P8RA 3ZU5A 5JY1A 3WSVA 4IM7A 3DZKA 1QV7A 1TEHA 2YHUA 3KSUA 4INAA 4FD3A 4EYEA 2GDZA 3PJDA 1NQOA 1GEEA 3MJ4A 3TFOA 3I83A 3C1TA 4IDEA 1DJNA 2DTXA 1MG5A 3FD8A 1ZJZA 1N7HA 3WGTA 3PI7A 4HWKA 4RF5A 1HSZA 2X23A 4DYDA 2C7GA 4KTTE 2VHXA 2WDZA 4XJSA 1ZK0A 1JVSA 4GWKA 1NQTA 1Z75A 3BTSA 3OICA 4I5GA 3WB9A 1LC3A 2OFPA 3M6IA 1MC4A 1LBEA 3TQHA 3EC7A 3F47A 2TMDA 3GZ4A 1PJ4A 1P1JA 2DQ4A 1CIVA 1EFKA 2IEBA 2NLOA 2GLXA 2VHYA 2X9GA 1Y7TA 4MVJA 3GEGA 4CODB 2C54A 5KKAA 4NBRA 2QRLA 1Y8RB 2V6FA 5TC4A 2I5PO 3DBRB 2CD9A 3B20A 1LLCA 3K96A 4NFSA 4WCDA 3RUEA 3RQSA 3HDHA 3ITKA 2X0IA 4TZKA 3DAPA 1EK6A 2B36A 3E9QA 4FJ0A 4NFHA 3OIGA 1RYDA 3WGGA 4HUJA 4BMNA 4GVXA 3E9MA 4XGNA 4ILKA 3PFFA 4Q9NA 1E1MA 1GYRA 1NQAO 1O5IA 2P9GA 4IDBA 1X13A 1LSJA 1CJCA 1EUDA 5CPBA 1JAYA 5T5QA 1E7SA 1DBVO 3H6KA 3DZGA 3Q6IA 4H3VA 2VOJA 2WE7A 5A03A 4TKLA 2GPTA 4QFDA 4WNCA 2VRCD 1M76A 1NX6A 3SBOA 1I3KA 3NEPX 2NNLD 1N8KA 4YACA 1YQXA 3L6OO 1KEUA 5L4LA 3MZ0A 3P5SA 2JHGA 3DR3A 5TX7A 2D4AA 3TN7A 7MDHA 1CEQA 4Z9XA 3JQGB 3EZYA 4B7XA 3PRJA 2PD4A 2PH3A 5ENVA 4A5OA 4D45A 1R0SA 5I7FA 3GVHA 3LU1A 4FCCA 1HDOA 4IIVA 2J3IA 1UUFA 2VUTA 3JQ8A 3V1TC 4U6QA 3RSHA 4TRRA 4CUKA 1E7YA 1LQUA 2DVMA 4CQMD 5HS4A 1GQYA 5I7VA 3OETA 5DOZA 3WYCA 4OGWA 1KC3A 2Q46A 4KTVE 1BXGB 1XWFA 2B0JA 3E6AA 3E5MA 3E5RA 4BNWA 2RH8A 5EESA 3KYBA 1LDYA 1U5CA 2VUUA 1Q7GA 5AYVA 2OL4A 5HWSA 1B7GO 1R15A 1GV0A 5L4NA 3SEFA 1E5LA 1NPYA 5ADHA 4J1NA 2IZ1A 5A3JA 1RM4A 2OORA 5GZ1A 1VSVA 4IQ0A 4EUHA 4J0FA 3U4DA 3JYOA 3HHPA 4N54A 1IPEA 1PSDA 2VNAA 3T7CA 3OEYA 5F3RA 3UFXA 3ZU4A 4BO4A 4IQ8A 1ZSYA 2O2YA 3DBLA 3GZNB 4MVJF 3D5TA 3ZGYA 1OI7A 1PX0A 3OSUA 4ZQEA 1T1SA 1G0OA 3K31A 3F4BA 2QZZA 2YQ5A 3KEQA 3CINA 5JMWA 3N7UA 4IS2A 4E21A 3BYZA 3WTBA 1NPDA 4BB5A 4EW6A 2C07A 4F45A 1NWHA 5G0WA 5HS6A 4A27A 4CM1A 4Z3KA 5HTOA 3D3EA 1NQ5A 2R6JA 3ANMA 3ON5A 4NJOA 5JXWA 4FPXA 2BLLA 1KOLA 3ZWYA 4HKTA 2X22A 4AJPA 1B8VA 1P1FA 1E7QA 1PJLA 1K6JA 4BOYA 1ENYA 3NDIA 3RU7A 2GN9A 2W8ZA 2PZJA 2B69A 3GNTA 1JKIA 1ADFA 1HXHA 2BELA 5KVSA 4JIGA 3GG2A 3K30A 4BKUA 3CH6A 2IYPA 4PRLA 1BRMA 1FF9A 5DOVA 2G0TA 2Y1FA 1UAYA 1N9GB 1PS0A 1LSSA 4E2ZA 1KVTA 1RPNA 2RBEA 3PXXA 5CG2A 5JE8A 4YBZA 3UH1A 3KRTA 4OXKA 4JJGA 5DZSA 4LSMA 3VPGA 1ZVMA 4GLLA 1T24A 4XIJA 2WSBA 4E2WA 3D64A 3L4BA 4QSMA 4G2NA 2RHRA 4J9UE 3ULKA 4PLWA 2FR8A 1HZJA 2XOXA 3FPCA 4L4XA 4DMLA 5A1TA 4CM4B 1ADBA 3EZLA 2OP1A 2VZ8A 3VPXA 1WDKA 3F1LA 4BNYA 4R9RA 4RJTA 3U4CA 4PG4A 2C2XA 3NTOA 4GX1A 5G0VA 3TSCA 1LDMA 4B4VA 3FSRA 1NR7A 1BDBA 4XYBA 3AY3A 1LRKA 3GVPA 4DVJA 4JGBA 3MCVA 3EDMA 3WTCA 1UAGA 3H9EO 1I2CA 3KYCA 8LDHA 3WJ7A 3NV9A 4CQMB 1ISFA 1K6IA 5DT9A 5JS6A 1LDEA 1AHHA 2G5CA 3GDGA 4ZU3A 5TS3A 4CLEA 3I9KA 3KOUA 4M87A 5JMPA 5IXYA 3KETA 2WWRA 1P74A 4HFMA 4IQGA 3QWHA 5CAEA 1IZ9A 2PD3A 4NBWA 4B4OA 1TVEA 2HDHA 2HKIA 2C20A 3D4PA 1GEGA 2ZB4A 1R4NB 3BHJA 3D4NA 3U62A 1MC5A 5ER6A 4ZA2A 4QECA 3O38A 4U0KA 2OHXA 1NVMB 1PGNA 2JL1A 4MVJG 4XQCA 2HU2A 4J91A 4H7PA 3ENKA 3WLEA 4B79A 5AXDA 3ZWCA 3OBBA 1JLLA 1TT7A 3UCEA 5MGBA 1YKFA 3UW3A 1J5PA 2HK8A 2NU9A 3AU8A 4XCVA 3D5QA 5KNLA 1VJTA 1E3LA 4UUPA 2ZB3A 3JYLA 2NVWA 1B8UA 4W7IA 1UXHA 2VRBA 3OJEA 1T2DA 4ZQGA 5JDIA 4DIOA 1UDBA 4MP3A 3TNLA 3I1JA 4MJLA 4PVDA 2B4TO 2DBRA 3UOGA 4BO7A 1I8TA 4ZD6A 1KVUA 3IUPA 4WEQA 2AEJA 4XR4A 4XKJA 3L4BC 4NHEA 1B0AA 1HE4A 3DMYA 1ENOA 2VHWA 4J7CA 3MJCA 4AJLA 3ROKA 4GSLA 3DTYA 3LLVA 3RU9A 4YJHB 4OKIA 1ULUA 1H5QA 3Q3CA 3GN2A 4ZN6A 2YDXA 1Y8RA 3ASVA 2ZYAA 3DBRA 4J3FA 4K6FA 4OYRA 2Y93A 4OKNA 1YXMA 4YJFB 5C37A 1EVJA 1YOVB 3AUAA 1YE3A 4FOSA 5IDYA 4KUEA 1E3EA 4ZGWA 3QQPA 4ZJUA 4UUNA 5A06A 2ZK7A 4BKPA 1W4ZA 3JD0A 2EEZA 5JCJD 3H9JA 3PWSA 1DC4A 4AJNA 1ONNA 1WZIA 3ADPA 4GVLA 3JQFC 3VH2A 3E18A 2GASA 1IULA 4TRMA 3PYMA 4YQYA 4L75A 2QIOA 3CXRA 3DEYX 3AUUA 3HN7A 4DLBA 1ID1A 3ZW8A 3A9WA 5JNLA 5BSFA 1P33A 2P9EA 2JFFA 3JQGA 2VOEA 4OJNA 3OIFA 2UV8A 2O4CA 4BV8A 4AJIA 3EAGA 1I5RA 1NWCA 3L9WA 3PYXA 5EERA 4L9RA 1PJQA 4ALKA 4LCEA 4YRDA 4MVJH 1EE2A 3WIDA 5EQDA 1XKQA 2LDBA 2ZQZA 3OJOA 5JDCA 3ZWAA 2BKAA 1JW9B 3CE6A 3ZNNA 3JQBC 3RUHA 5JC1A 5CEEA 4NJMB 1BXGA 4AVYA 1HF3A 4HNHA 3SVTA 3BMOB 3N58A 3E8XA 3RCBA 1YONA 2AQ8A 2JJYA 4NZ9A 4Y9DA 2YYYA 4YTEA 1E6WA 4CR6A 4PG6A 4Q3EA 2RHCA 3VPSA 3JQ7B 3V2UA 5ICSA 2ZIZA 3IAHA 4CR8A 3HQ4O 1NNUA 1YRLA 2HMWA 3PJFA 4RF3A 5A3VA 3OJLA 5JDIC 4EJMA 4LVUA 4XZ3A 1E7WA 5A9RA 5IN4A 3BA1A 5EQFA 2V6GA 4BKOA 3LC7O 4DBZA 5G4KB 3ADOA 1LA2A 3GMDA 4IDDA 4Z0PA 3P2OA 2PKQO 3H8VA 1HYGA 3GZNA 2DBZA 5TNXA 5I7SA 2C82A 4U8GA 1A71A 4GI2A 1FDSA 2VT2A 3PHJA 3I9LA 4CJXA 3DO5A 1SEPA 4D0RA 5I9LA 1NP3A 3ZCXA 1CYDA 1B14A 1U28A 3X2EA 4E5PA 2VNSA 2XAAA 1KVSA 4TQGA 3FNGA 5ITWA 3Q2KA 4IJVA 4J1SA 3AWDA 4DQUA 1M75A 1SNYA 1DRVA 1BWSA 3I9NA 3GHYA 2PK3A 3QSGA 5AXAA 4ND5A 4MVJP 2I6TA 4KZPA 4TKMA 1HT0A 1ZCJA 3PHGA 4IGEA 5EIOA 1P3DA 2A92A 3TDKA 4YAEA 4YPOA 3I9JA 2NADA 2QRKA 4YT4A 2DAPA 4XYLA 5TJHA 2F00A 3STHA 2ZKLA 2QRJA 3R3JA 5B12A 4J9VA 2OOSA 3ZWVA 2TMGA 4DBVO 3GHHA 1T4DA 3HWRA 1KY4A 1ZNQO 2G82A 1YDWA 4CM9D 2ZTVA 2CSUA 4XB1A 4RORA 4F6LA 3GGPA 1N9GA 2R00A 5K6AA 5TIIA 4LSWA 3RUFA 5IZ4A 3K73O 3DONA 4CMCA 2PGDA 1GZ4A 3JD2A 2VUSA 2HQ1A 1WMAA 5JDCC 1X0XA 2FSVA 1ZK1A 3JD3A 4D43A 1XYGA 1BDMA 1U2GA 2IDZA 3OA2A 4E2XA 5DP1A 1NFFA 2OGUA 1BW9B 5TF4A 2E6UX 3QWFA 1E1LA 1GV1A 2EKPA 5DBIA 1EVYA 2EXXA 4NI5A 1YL7A 2CMDA 2GZ2A 4E5YA 4RO0A 1VSUA 2NVUB 5KIAA 2ZB7A 4AG3A 2FY8A 4I8XA 4LRSB 1YO6A 2D5CA 2PY6A 3DOCA 3VHRA 4CM4A 1K3TA 1KY5A 2AEMA 1ONOA 2VRCA 2A4KA 4XGIA 5DCYA 3ZWMA 5HBRA 5L7TA 1ENPA 3LYLA 3WYBA 4YJGB 3DBHB 1H6AA 2CF5A 1QYXA 5COBA 4Z3DA 1Y9AA 4AJOA 1F8GA 2VWPA 1LSUA 2QX7A 1E1KA 4K26A 1X1EA 1LJ8A 3KSDO 3C1AA 4YT2A 3DHNA 1Q0LA 4WCFC 4ALJA 4BGVA 1U4OA 4EGFA 1T2FA 4LW8A 1VL8A 3CEAA 2DFVA 5H82A 1M6WA 3FTNA 1YWGO 4IZIA 4CQLB 4CQMA 1HL3A 4QXMA 1BGVA 4ND3A 1GFSA 3R0IA 4EBFA 1EMDA 3SC4A 4PLFA 3RUDA 2HMTA 2PD6A 3FI9A 3QRWA 3G0OA 1UXJA 4NH4A 4FJ1A 3KUXA 3QV1A 2OMEA 3AY6A 4E3ZA 1MB4A 4R1TA 1AUPA 1Y81A 3H5NA 1HE5A 5TLSA 1R4NA 4XR9A 3NJ8A 4PRKA 2Q1SA 4YR9A 5L53A 3QHAA 4LK3A 3LT0A 3DZBA 1NHGA 4EUEA 4J16A 2OP0A 2RH4A 4BO5A 2Y1OA 4GL4A 4E2YA 3JQAD 1RJWA 1JWBB 3HB5X 2DBVO 3ONFA 4K28A 4PLPA 4Q3DA 1XGKA 3GUCA 4BIIA 4ALIA 2GZ1A 4JQCA 4UUMA 1ZMTA 3H7AA 3MWEB 4A26A 1EQUA 4OQYA 4YVFA 2E37A 1VJ1A 2EJWA 2R00C 3QY9A 1YB4A 1P45A 2VWHA 1NVTA 3GMSA 1P1IA 1FDUA 4I9HA 2HRZA 4GPD1 3BTOA 1XCBA 3L4SO 1EK5A 2ZQYA 2Y99A 3PPIA 3LC1O 2CDBA 2AG8A 3KZVA 4C7JA 3IUSA 4U7WA 4E6PA 1AXGA 5FEUA 3ZV4A 3ETDA 3A1NA 3L07A 2AQKA 4YJHA 3UUWA 1D8AA 3FHLA 1XQ1A 1SOWA 2X86A 2Z1NA 4YJFA 3GDFA 1YOVA 4JLWA 1WZEA 3OP4A 1C1XB 2DKNA 1I30A 2BFAA 3K2EA 3OIDA 3RD5A 4HFRA 1EQ2A 5F5LA 3GFGA
chains in the Genus database with same CATH superfamily
1A2OA 4IDGA 3PQ4A 4W7HA 2XITA 4IHJF 3QF4A 3VPAA 3VOTA 4EMUA 2Q3BA 2FEWB 3O75A 3LQ1A 5ALEA 3ZHBA 3EH2A 2CXNA 3RPEA 4LQ4A 4TS1A 2YV1A 5SZJA 2YN2A 2YV2A 3BCHA 3KX2A 4Y6PA 4X44A 4IJ5A 4KBYA 2Y0BA 3TTYA 4OFXA 2Z8ZA 4I4IA 3ZWQA 4CT0A 3OLQA 2SHKA 3B6IA 4MS4A 1GFZA 1JSLA 3K0BA 1K98A 1TM4E 4Y2JA 1RKUA 3PGKA 3PPYA 3N2LA 3S27A 1C4WA 3EVTA 3KWLA 4YRSA 2IKQA 1JIJA 4DIMA 3RT7A 3Q7IA 4XM2A 2G09A 1FFGA 1N5KA 1CNEA 3G89A 3VZRA 4Q66C 1A5AB 5I7WA 1C3LA 1KO5A 3INNA 4DUYB 4O2BB 4YRLA 2H5LA 2JAHA 1J0EA 4WJZA 5DX0A 3GGDA 5HF5A 5IEBA 5J59A 1YRYE 1P3JA 3L1JA 4BMZA 4ER7A 2MU1A 3EULA 3D7LA 3TZBA 4PG8A 1OWLA 4NJMA 4EKYA 1ID8A 2C31A 3ADBA 3O9ZA 4U8HA 4JP8A 1IOZA 2XXJA 3O21A 4LRQA 2FPUA 2Y1XA 2ZJOA 2OD9A 2WD8A 1X7ZB 2FOIA 1Y8CA 3R76A 1P1HA 1UPTA 1PLLA 4KH1A 1R8SA 4KWCA 3DZIA 3NJ4A 3OHSX 3ZGNA 1QE3A 4C2BA 4EGCB 4EX6A 1N9ZA 3JQ7A 4O2AF 3NYQA 1P2BA 3OEHD 4YQZA 2GUWA 3B6MA 3AVUA 4LY6A 1RJ9B 1Y34E 2R8PA 4O5OA 3A6GA 3EAFA 4V0OA 4ZCSA 4B43A 5ALUA 3LYAA 1K63A 2J3HA 3CNEA 4B4DA 2W2XA 3TH5A 5KVVA 2A9VA 2JEZA 1VMIA 6YASA 1V5FA 2IE0A 3R20A 5M29A 1ZL2A 3AQIA 4KX3A 5G4KA 3NYWA 3SZLA 2H1WA 3RKSA 1AM4D 3AVTA 3NMUF 3WG9A 4JB3A 1M9NA 3GLGE 3F7OA 4DF3A 5CB4F 3FGNA 1IBKB 2JS7A 3NKFA 1KQNA 4FC6A 4LHYA 1Z82A 2Q49A 4MVJM 3OBIA 5KTRA 4MARA 1VHQA 8GPBA 4QUIA 1U90A 3DFZA 1CDDA 1SOMA 3MLAA 3L6DA 1A77A 2Q5JA 1MQSA 3DVRX 3QJGA 1B3BA 2FSSA 3AKYA 1V39A 1XZAA 2VHVA 3BN3A 3BX1A 3R9IA 4I9UA 4EB6B 1KI8A 1EWQA 2PVSA 4UM5A 3H84A 4Y3UA 1Y5LA 5LMUB 1D6NA 3WQHA 2YZ2A 2ZVDA 3M70A 3USCS 3RODA 2FWNA 2IGBA 3SD7A 3WLIA 4JZKA 1T4BA 2UZ1B 4EG5A 1ENZA 1KZ1A 1SB8A 3DMTC 3EQ6A 2GRUA 2P4UA 1XCMA 5F7ZA 4BN4A 4PU0A 1KI3A 2O05A 4J7UA 3CTPA 3GT7A 3TQFA 3ZTWA 5TVKA 2FLKA 3EAQA 3HTXA 1N78A 1IHDA 1AMUA 5TDHA 4N8EA 4EX7A 3R0ZA 5KWSA 4PYQA 5KYYB 2O7RA 4MV8A 4F2GA 3A6EA 3MCTA 4L16A 3A28A 3Q3GE 4R81A 5JFGA 5D3ZA 3KDAA 1AB6A 1G3QA 1OX4B 2DT8A 2HLDD 3HXKA 2JLSA 3LD9A 4RPHA 3IVGA 1YJ8A 4UC0A 1ZOOA 2MINA 1DOHA 4PS0A 3WXBA 1NYLA 1SUFA 2MWMA 3BK2A 3UYLA 4V38A 2B30A 5A4DA 3W5DA 3QE9Y 3HUUA 4EQZA 3DYBA 3G3EA 1U4SA 2AT1A 2I4OA 4GR5A 2HJHA 3JQ6A 4BMDA 3B3FA 3AFNA 4DDUA 2ENWA 4OAPA 5AM5A 1F2TB 1KPIA 4GKBA 2Z6UA 3QYPA 1V8OA 2W2VA 4I1OA 4D0NA 1QIIA 4JLPA 4UPVA 3EG9B 4W5JA 4ECEA 2L69A 4RMHA 1E4YA 1SBZA 2NVUA 1JIUA 1GFIA 1TECE 4QGHA 4Z4IA 4W6QA 3ZK9A 2VEDA 2E89A 5GQSA 3KQQA 1TX4B 4HO1X 2PX0A 2CHGA 4L0QA 4W6ZA 2Q3MA 3CX7A 3CZ4A 3I9OA 1NV8A 4GMFA 3BVPA 5BSRA 1LXCA 4BJ5A 4FYPA 3A9RA 2NUTB 1UZAA 3V46A 1E2NA 2V3WA 4J3NA 4DRXB 1JQEA 1EWYA 1RVDA 4NZMA 4C6HA 4CM7A 5AM4A 1RYEA 4KG7A 3ZHXA 4PRZA 5CK5A 3C15C 3IILA 5IX8A 1JHVA 1CUZA 3E1SA 3VMFA 5JRDS 2P3LA 2Z5FA 4S1OA 4A0SA 3BCRA 3CF6R 1ZL0A 2HPAA 2WYVA 3GQVA 3HCDA 1GSHA 3LF2A 2AI1A 4L8VA 4LXIA 2FEAA 3OH8A 1Z7GA 3CONA 4O0LA 2AR9A 3RSFA 4MRNA 1YQ9A 2JKVA 3P5BA 4UVEA 1XEAA 3GDOA 4RKQA 1PZMA 1FDRA 4WAUA 1DLJA 1HYHA 1OF1A 2R751 3PDUA 2X1LA 4RD1A 1Z0DA 2OCIA 5A5GA 1NBEA 4DOMA 1LVGA 3T06B 5HKKD 3HRKA 4S2EA 1P1RA 4TLCA 4MDYA 1KO8A 4PZLA 3RRMA 1KQOA 4PPFA 4N6NA 1YOBA 4JCOA 2G76A 2GRJA 4IL5A 2NT4A 3BE8A 2CY0A 3EQ9A 3HPQA 3PUHA 1E3WB 3LA6A 1JYSA 3NO4A 2ECQA 1EHCA 2P6PA 3II6X 2D54A 3Q15C 3BORA 1UC5B 3HP4A 1C0KA 3WLFA 5C5IA 4JR0A 2LE0A 1SKUA 2F90A 2FRVA 2ZR9A 3OURA 4KL8S 4FWBA 2PTHA 4W1SA 3CSUA 3FPJA 3LL4A 3RM3A 4C0HA 2CL7X 3CLKA 3KVYA 4DG5A 4HDAA 4GPEA 2BVNA 5C34B 2CYCA 5IANA 2O3TA 3GIWA 4MXDA 4PSDA 4Q16A 2GN2A 1LB1B 4G4JA 5IH7A 4AK9A 3Q9UA 1KJNA 2J6CA 4ND8B 1R16A 1J49A 5BN3B 3SJAA 1KGDA 4HDRA 4HRYA 2YOFA 1F14A 1X1DA 2H29A 5JRJA 3WISA 2QMUA 2FAXA 3G9ZA 3K1AA 4Y9RA 4CT4B 5AKJA 1Y9ZA 2HRQA 2X3UA 2CVOA 4FYXA 5AFSA 2ORYA 4TZ6A 3CB2A 2QLBA 1DAHA 2R85A 4TWAA 2O20A 3KB6A 1XLTA 4ENPA 1FRVA 2YCBA 3EMBA 1C9EA 1T8TA 2HLHA 5ECYA 5K0ZA 3L8YA 3AHIA 3MG9A 4UDNA 3PUJA 3MIZA 4KSBA 3WK6A 1CU1A 4BL5A 1ZJYA 3RO7A 1JEDA 3QVGA 4ZVNA 5KQPA 3DPSA 3KPVA 1JJFA 4NJEB 3HCNA 3UWSA 4BVKA 4GZ5A 1NF8A 2X9QA 4LCJA 4R1PA 5LU9A 3AY7A 3QFSA 2Y0CA 4IRMA 1Q2XA 2HFKA 3F96A 1SBYA 3UXYA 4DCOA 4ZYVA 1HEUA 2HBZA 3B1JA 2BFWA 2IJGX 1MEOA 1VMKA 3MINA 3ZHYA 2BI7A 1XZIA 2VJOA 3AJ8A 4E14A 3OOEA 4PZUA 3FKSA 1X0VA 1QYIA 1M2OA 4EUNA 1VCNA 4PPQA 1RPAA 2DERA 3GY0A 4I5EA 3U0BA 3LWZA 4A0QA 3J7TA 5ALPA 1NLMA 3K4QA 3NFRA 4MRPA 5EXTA 1QQ6A 2HNKA 5JROA 1DGQA 3W9BA 5AI9A 1GTVA 5DRTA 1MENA 1OAOA 1AQLA 3HC7A 1ATIA 5JS1A 5FI0B 2JHFA 3VH3A 3GJYA 2WU3A 2JKYA 4J2HA 4GE0A 3MT8A 1NM5C 1Y6JA 4RZ2A 3WFIA 5FOQA 4KR2A 1RTKA 1PT8A 4AI6A 3HDJA 1Q95A 4HWSA 4H0FA 2C5SA 3AI2A 1CRLA 3QUAA 4RFLA 1CF9A 5JISA 2JK1A 1T2CA 2DT5A 2V9PA 1FRQA 1Q1BA 1B26A 4NS1A 3H3FA 4Q7LA 5L51A 3UKJA 4HEQA 2X2PA 3JYNA 2QSJA 3BE4A 4HGNA 4KN5A 3AW8A 1AMOA 5L3SB 2GPNA 2OO7A 5IBRA 2BZGA 5HCIA 4W9NC 2VPIA 4YA6A 5EE5B 3NUGA 5IH3A 1KFBB 4O2BA 5FPYA 4RXUA 5E1DA 5TGDA 4LXXA 4G84A 2QL5A 4DYVA 3TI9A 2CUKA 4IO0A 2H1RA 3K92A 4OSOA 1T36B 3VYSB 2QD5A 3EC2A 5JXJA 2HA6A 1C80A 1XR3A 4BLUA 4UMVA 3AM3A 5DGCA 5J3JA 4KDRA 3CPSA 3AM1A 4WK0B 1CY8A 2HGSA 3LXUX 1KIFA 1X7ZA 2HSGA 1WXQA 4JJIA 1QM5A 4RENA 1D1TA 2QDXA 4A2PA 2AXPA 2C59A 2PLAA 2WU0A 2PMWB 1EFCA 1UOOA 2VP3A 1CY2A 1JQLB 2A88A 2FSPA 2ZSKA 1DBPA 2PKRA 1PVDA 3COWA 3GG9A 3PC7A 4KQJA 4U6NA 4YCAA 1NXOA 3EFOB 4PCLA 1RJ9A 1NSYA 1XDGA 4ZCLA 2H63A 3RU7A 4UNRA 1A4RA 3UFBA 4YJ3B 5JAMA 3IUYA 1WF3A 4UNNA 3W6ZA 1SBHA 1URPA 4NMHA 4EATA 4MWSA 4LG1A 3QEJA 5E3JA 4PICA 4NP6A 3LPMA 5IC4A 1PKXA 1QK3A 2JFHA 4JT8A 2ZYWX 4P80A 4WDRA 2WIDA 2YWJA 5IK2D 1PTJA 3VR5A 1G0NA 2P0AA 3OCVA 1XTJA 1NYQA 4CLRB 2PBLA 3F1KA 2COKA 1EVQA 3FDJA 3AJAA 2JIZD 1NJ2A 2IHUA 2ZANA 1MVOA 1S4QA 3EIFA 3UWPA 3TZ6A 1N1EA 5E1MA 5AVKA 1NOKA 3RIGA 1RRGA 4K9KA 4MW9A 1IEXA 2ZT6A 4S1TA 3E48A 1OFVA 5CA0F 1IM2A 2G71A 4YRQA 4EB6A 4RTLA 1UP4A 2GETA 3ICWA 1WB6A 2R6HA 1V2GA 3Q11A 4NK5A 3A1SA 521PA 5IEJA 4AWAA 3CJQA 2JPDA 1Z2NX 3LFTA 3L0DA 2UZ1A 2PUVA 5FI1B 3FETA 4OV6B 1IHUA 3DKRA 1QP8A 4EG4A 4XTCS 3JQDA 1Z15A 1FW6A 3E27A 3HUFA 5C1DA 4HEJA 5J4LA 2R86A 4MPDA 3LL7A 1SUSA 1EFAA 2WT8A 1MB9A 3N2YA 3OESA 4JC0A 4B84A 4XFJA 2EERA 5KYYA 2NXEA 1W5EA 4IDCA 1YSCA 3R7BA 1WXEA 3KYJB 2WR8A 1RE0A 2OHVA 4HLDA 3CT6A 1EG7A 3WLMA 1JHOA 4JWTA 3FPHA 3RNOA 1OX4A 4R2MA 3V9PA 1DL5A 2FR0A 5J2TB 2AX4A 3EPJA 3DLAA 1DSSG 1YKSA 4DILA 2ZBPA 1OYVA 4YAUA 1VP3A 1PWZA 3PF8A 4LYJA 5FF9A 4MTCA 3WXMA 1FP6A 3IPYA 4X20B 1F2TA 1Z2EA 2D13A 2QTAA 4HC4A 4F72A 3MCZA 1FBNA 4ZVOA 5MF6A 2I9KA 3IEIA 3I5MA 1FU7A 4DSUA 1DRWA 3EG9A 4LMAA 4DSTA 2A5GA 1ESMA 1WU7A 4WLNA 2Q8PA 2GEDA 2Z30A 1EK1A 1BCSB 2YY5A 1AQIA 4FEAA 3QYAA 5AP9A 4MUEA 1WKCA 5EHIA 1DS6A 4GOKA 3V4OA 5CNMA 1DV2A 3BRQA 4M3NA 3K0FB 2X9VA 4FHCA 4M53A 4XGKA 3UQYS 1R6BX 3FYHA 4LCBA 1B1AA 4X6XA 4KQHA 2NUTA 4DA7A 4BEWA 5AW4A 3CEHA 5GGXA 1NXWA 4DRXA 2Z56A 4CV0A 3MLBA 4Q3NA 1QK4A 2NSHA 2VXCA 4J4TA 4K1XA 4GMDA 3TM4A 1JPJA 2VDVE 4EH1A 4Q4CA 2Q6KA 3AP2A 3M4NA 4BB0A 4QTZA 4Y8VA 1J20A 2KI5A 3T9CA 1IY0A 2OXEA 2Q1UA 3L05A 4RD6A 4ER0A 4ZEOA 4RAOA 1V16B 3IDFA 5EKXA 1UZUA 1Y3CE 2P2YA 3DAFA 4HNVA 1VE5A 3HM9A 4ED9A 1AY0A 1I32A 2WYHA 1PL8A 3NANA 1Y5MA 1YDEA 1HKHA 3I0ZA 1CEXA 3UUFA 5DBFA 4E15A 1PR5A 2ANBA 1SC3A 4XA8A 1QLWA 4DWOA 1R9GA 4X92A 5C4IA 5JEDA 2C8KA 2JAUA 4IH1A 3R3HA 4P54A 4EHKA 4B45A 3CVWA 1TMGE 3H4TA 1XRNA 3LX4A 3ECSA 3QWIA 3SJCA 3UGQA 5DYNA 1B2LA 2HXSA 2AN5A 1E1NA 4YP5A 5BWNA 1GG5A 2G9RA 1N57A 2XTMA 1SG0A 4MKRA 1I4EB 1J39A 1GPWB 2NGRA 2QX8A 3PR1A 4JJ7A 4LJ8A 3B70A 4PZPA 4IOLA 1OBOA 3ORRA 1GPKA 2QQEA 2YVUA 4TYNA 1J33A 1KTVA 4HYQA 3ZY6A 4DY6A 1HYBA 3GT3A 3GPCA 4MRSA 3UZUA 3WBFA 3H0EA 5BV0A 2QJOA 2B94A 1F4PA 1NBMD 4IJUA 3DDUA 5JNRA 4ZOAA 5A0FA 2P2ZA 2VYFA 1YZQA 4NR0A 4RADA 3I58A 3MWLA 4FDUA 2VR1A 5I9NA 4ND8A 2PZLA 5BN3A 4M1WA 3X2FA 4F3KA 3VM6A 4OTZA 1FS6A 5F12A 4YDHB 4NCIA 1KETA 5FD8A 2VJNA 5JC8A 1ZMXA 3RS7A 4JC8A 1QPGA 4JT2A 3I9MA 4IPTA 3MWFA 3RUAA 3I76A 1QX3A 3AB7A 3PKIA 5BRJA 3VYTB 2WQ6A 1FFXB 1XAHA 1RP1A 1XDZA 2WMDA 2I4RA 3JQRA 3T7AA 2AJDA 1YZVA 4WZAB 5KQMA 2Q6VA 1XAGA 2ZRKA 5P21A 3V00A 5H1YA 3N1UA 2J7KA 2HCJB 3ESBA 1T3LA 1AKUA 4YRKA 2PIAA 3CKLA 4TTAA 5EZSA 4NJEA 1UXKA 4F2PA 2RAPA 3GJQA 4EUFA 4MW0A 5E4YA 1Y4SA 4Q15A 1GRCA 4M49A 4MK4A 1SU6A 4M8IA 1XALA 1MP0A 1MBZA 1M1YB 1WCYA 2PMKA 5TQJA 4AMYA 1YMQA 1GA4A 5JZ9A 4RWZA 2V6JA 4EHJA 4A92A 1AXEA 1IE3A 2F3TA 4HQFA 1F1BA 1EX9A 1XJQA 2W2QA 2ZRLA 3A36A 4TTRA 1GAWA 3WL5A 5IYZB 4B71A 2PWAA 3OLWA 1XEFA 3B1FA 2C98A 3OQJA 3VGPA 4KPEC 3K71B 3N8DA 4DLYA 1SK8A 1Q6ZA 3OE7A 4CKBB 4CM5A 2GBLC 5JJCA 5HP4A 4HXYA 1EBUA 4KE9A 1VZ2A 3Q8KA 2I2AA 3EWNA 3S1LA 4YXFA 2VZ0A 1B6TA 1C4XA 3DXFA 4ZZIA 1V1MB 1XAJA 4PSKA 3U13A 5I9SA 2RHOA 5A4AA 1G291 2CCKA 3TRKA 4YCMA 3EVZA 5BWMA 4RY0A 3UV3A 3O3OB 1HQKA 3EDQA 4ND2A 3FPFA 3PVZA 1UIRA 1ZPDA 4GYKA 3STUA 4TYQA 2PUFA 3C3WA 3JU3A 1MFPA 1XUOA 4MDEA 4OI0A 2FX2A 7REQB 3FLMA 1KYIA 3NBQA 4Q4AB 4NYMQ 1SQFA 2HIAA 5EHXA 1VJ5A 5C4MA 5IBCA 3B12A 3V1NA 5KVAA 5E0KB 2O8CB 2RC6A 1YK0A 3ZY5A 4E22A 1CQIB 1P2DA 3RSGA 2IYQA 4EG3A 3I8XA 5L3SA 2YVAA 2RDMA 3COVA 4ID9A 2HK9A 5D5QA 4BNNA 3GVIA 2NX2A 3A1FA 1Y7IA 3TL2A 1G5IA 4YDSA 3VJRA 3U4IA 3ZQJA 3GH1A 1T36A 1R0WA 3DZJA 4DZTA 2B34A 4GOOD 2IHTA 5H4HA 4EG0A 1T2AA 3O7MA 2FEOA 4UU8A 1TEXA 5F3DA 3COPA 2WVAA 2HEIA 2HLPA 2Q7XA 2WIAA 2YCLA 2Z95A 2V98A 3EXAA 1DIHA 1GZUA 1S2DA 1VYHA 3BREA 3RTCA 5C8YB 4I55F 5JECA 3L3BA 2XXAA 2WJYA 5KPJA 1P7YA 1X6VA 3EMKA 1GPDG 3JR7A 2ZSHA 3A26A 3FYUC 3EFOA 4RK1A 4ZZ2A 4D4LA 5B57C 1I94B 1N34B 2IFTA 1LEHA 1TRKA 2D2XA 4YJ3A 4E03A 2TYSB 1W76A 3KLMX 1XXHB 5AHXA 2Q9UA 2PQ6A 5AKIA 3WWEA 4EEKA 3KL2A 2PL1A 3NDBB 1LRJA 4JH0A 4K9LA 4MB0A 3T9AA 3KDSE 2G9NA 4PLZA 3FUCA 4XJTA 3I52A 4LSGA 4ZYLA 1DTWB 2JW5A 4LDNA 4WE3A 2B8NA 2I2WA 1Z5VA 2YRXA 2YWEA 1CRWG 3PHLA 4YGYA 3UMSA 4R54A 3OIVA 4CLRA 3MYRA 2PBFA 3B3GA 1NW8A 1Z4QA 3FNEA 4R40A 1O9BA 1T3GA 4FYHA 4NV1A 5DN9A 5E38A 1E20A 3FWPA 2HT6A 1KJZA 1NTOA 3NAQA 4OAQA 1P6XA 2F1HA 1ONBA 3VDRA 5IM4A 4B40A 3F49S 3RVOA 1NOIA 4QX6A 4UU0A 3KAKA 3M6LA 2QMZA 1DAPA 4FSHA 2EBUA 1W4BA 1GG9A 2O2DA 2E55A 4M1SA 2X8LA 2PMCA 5ECWA 3M3DA 1C8LA 4QYSA 1JAIA 4ZAXA 1E32A 3OT4A 2RHGB 1K7EB 2AX3A 4LJAA 4CMAA 4XYEA 2B61A 4HDSB 2L42A 1FYFA 1MX3A 2FG7C 3IQFA 1RM3A 4JXJA 2Y68A 3FE2A 5BQOA 1V71A 2JLQA 1RXEA 3K15A 4N18A 5CVCA 3JQEA 4JJ4A 3WMGA 4EW2A 1WZ2A 4H1WA 1NV9A 2ID9A 3A2LA 1TO6A 1EVLA 2HJGA 4GO1A 5DEOA 3GELA 2OZVA 3MRTA 1VLLA 3UXMA 2Y66A 1CP2A 5CDFA 3FGOA 4GUAA 3CRVA 3VPBA 3W3AH 1DX6A 1E96A 1L4YA 4JYPA 1ZD1A 3AU9A 3CVJA 1IIRA 1XCLA 4LDQA 5FYDA 4BNZA 5LA6F 3GW8A 1TKBA 2FW9A 1H66A 1KQPA 2KBFA 3PFBA 4RVOA 3RAJA 4AULA 3RYCB 1XDBA 3RC7A 3UHPA 1RXVA 3S2SA 3O0TA 5I7OA 5J2TA 2PZKA 3ESZA 2OO5C 3PCXA 1RWWA 4R5MA 4RBNA 4ZHQB 5EXEA 3LT2A 4IDAA 3G8YA 1E3JA 3M9WA 4ZVRA 2RGGA 3QMPA 1FBTA 1JPNA 3L7NA 3PQ6A 4U9UA 5BYJA 2J48A 4NCJA 4LRYA 2WPDD 3FKQA 1YB1A 2VA8A 3JAKB 4X20A 4FKBA 3IE1A 2REBA 1TC2A 3JYQA 4FMPA 4DIUA 4I81A 5HQJA 1JDZA 2NU8B 1S8NA 4E6EA 1HZZC 2PA3A 2BBWA 4NF2A 4HADA 3I6QA 1BCSA 3VH1A 4MIYA 3AV3A 4BX3A 5ICGA 5LXTF 4YRZA 1W4LA 1U98A 2LDXA 2W2KB 2Z9BA 1G6OA 3M1AA 1UOPA 2AD5A 1UJBA 1Z06A 1AUQA 2XDQB 4BVLA 3K0FA 3OJWA 4RHCA 4E1BA 3M82A 1S3GA 2FWIA 2YWRA 3JZMA 4HGZA 4MYRA 4PVCA 5EQJB 3EJ6A 1T5LA 3ZLBA 2CEKA 4OOFA 5KPDA 4N01A 4YYEA 1ZZGA 1RRVA 3IVAA 4D3YA 4OQ4A 2AG5A 3ZE2B 5CLHA 2H6EA 1TZMA 5F76A 4BFYA 4C14A 1VE3A 4PZ9A 3HJUA 1DCMA 1DINA 1JHYA 4O08A 3THOA 4JLJA 2C0QA 2I6UA 4W5RA 2FUG6 1YR7A 1DIGA 3K9FC 1N77A 2ZRBA 2RCNA 5KHLB 1OC4A 4R68A 5REQB 3L46A 4BWYA 1V16A 4LJ4A 5EA2A 1NQXA 4IDPA 8ABPA 2DHQA 5CYFA 2X9NA 3LUDA 2XF8A 4P6VF 4G2TA 4R9NA 4YT5A 3U3JA 3GCWA 3HBMA 1TJ5A 1MT3A 2VTEA 4HLNA 3WGIA 4RVGA 5DGXA 3TLXA 3KKEA 2VRWA 1K97A 4OG2A 5ETJA 4HB4A 2ZYSA 4FC7A 4RXMA 4EUSA 2EQAA 4PIPA 1U5BB 2IU6A 3V8VA 4WTOA 4B35A 1GZ6A 1K75A 2OFFA 4YDRA 1X1RA 2QP9X 3EDRA 2FDCA 1R1DA 1N3YA 3FN4A 3U3OA 4F5YA 4MV6A 2BFMA 2PS0A 5EYPB 3E5HA 2F55A 5FTNA 4EJ2A 2O59A 4FVTA 4XB6B 4Y9UA 3FF1A 1SMKA 3SYLA 4NICA 2A35A 5K7SA 3GRVA 4CMJA 2C7OA 2ZB2A 1DIOB 3I42A 1PJ2A 2VLIA 1V4NA 4XXHA 1SA0A 1DXHA 2AD1A 4K6CA 3ZGOA 1VPDA 2OILA 2VA9A 4K9MA 3F97A 4G8DA 3ZDBA 2J0QA 2J3DA 2IXBA 4O8CA 3REGA 3ZTYA 3MJEA 3AI1A 1E79D 3DCNA 4FK8A 4UFNA 4V3BA 4TQ9A 3R5JA 2B8WA 2LPMA 5KSWB 5EIXA 2ZBUA 4PLHA 3KQTA 4Z6KA 4FS3A 1VB3A 1EFHA 4CIDA 4KGDA 1ZD3A 5LD2B 1FPMA 3HN6A 5LWHA 3MFQA 1P80A 2A9FA 3OX1A 4O8ZA 5TJ9A 3TR0A 3VKFA 4LXQA 5TPZA 1VMAA 4BX8A 4MEAA 5FTJA 5AVUA 1JTEA 3AXTA 3F6YA 4TTVA 4Q9KA 1FFXA 1ZRHA 2Y92A 3VYWA 2D1FA 3H5LA 3TTTA 3QLUC 4BVGA 4WZAA 4B6PA 1LPBB 3MXOA 1D2GA 2HDNB 1KI6B 5E95A 3TVTA 2OFWA 2DE0X 2R2GA 1WUYA 2MHCA 1T1GA 3IDQA 4KEAA 5AJYA 1NC1A 5C1OA 2AFVA 4E70A 1PG2A 4LY3A 4D79A 3G49A 3CR8A 1Z25A 4L57A 3RNLA 2C00A 3KJXA 2I76A 2G80A 2I6SA 5EJIA 4F5ZA 1BHSA 1VJRA 1UEIA 1XYVA 1JALA 1M1YA 4UE2A 4YP7A 3VJKA 1RFGE 1ODCA 2LUOA 2PRYA 2R8YA 2RIRA 3C6ZA 1RXWA 1M66A 2UYQA 5FX2A 5FTLA 1P2SA 1C14A 3WQQA 5IYZA 5JNVA 5ERGB 3FBTA 5JLJA 3KKNA 1BKDR 1T9HA 2I29A 1ZM9A 1WCV1 4N0PA 5IP5A 4KFRA 2FETA 5KTYA 1ZISA 3N75A 1DNPA 4CKBA 4ALMA 3ZWNA 3IAXA 4Z49A 4GXNA 3TL6A 4CU2A 4PFSA 4DS3A 3H1BA 1UDAA 4MAMA 4PZZA 4YV2A 5F9HA 2Y1DA 5FNZA 5B30A 1V1MA 4D6YA 1P7ZA 2HMSA 3I3OA 2ZCVA 2ZT8A 3TRFA 4ZOLF 4QLOA 3UBTA 3LQFA 5JYEA 1L1FA 1MV5A 2I1VB 1H1TA 5FUWA 4F1KA 3AL0C 1QHGA 1HX7A 4ICIA 1NU8A 2WM9B 1ZVKA 2X8BA 1BMDA 1TF7A 2GCOB 7REQA 3KSZO 3QPBA 5K0LA 4BP8A 1WCWA 1OTYA 3N3BC 2G72A 1OD6A 1G2PA 4B8WA 4GP6A 2WTUA 4RCZA 5CYOA 5FBVB 2EW8A 1U3VA 2C1ZA 2O8CA 3QUCA 2GTPA 4R3WA 1YI1A 1CQIA 1JAXA 4G5QA 1SKYB 3RC9A 3TSWA 5JTTA 1JLSA 4UHHA 2H1SA 1V1JA 3U6KA 3V7NA 1CUYA 4FGUA 3T3GA 2ORED 2XGMA 1B6GA 5EGSA 4W5QA 3G2NA 5TV2A 1FIUA 2OM2A 1RS0A 1EZ1A 2ACVA 1W34A 3QU7A 1DKUA 3GPLA 5AM3A 4XB2A 3AM4A 3NXSA 3AUKA 4L5JA 2I2XB 3OPXA 2W2LA 2G6BA 2KW5A 1LH0A 5J2UB 4MA0A 5C8YA 3U1BA 1XNJA 1PNTA 4NBUA 1CS4C 1U63A 3SDZA 1NYTA 1YHZA 1IEVA 4EY5A 3RJTA 3RABA 2CHVA 1JXMA 2O0JA 1IY2A 2VK8A 1XXHA 2GHQA 2WQZA 3DHEA 3H2SA 2TECE 3QG5A 2ETVA 4JJAA 1BMFA 3CMCO 1HQYE 2ODEA 3EUFA 3O03A 5ER9A 5EPOA 1NKTA 3CA8A 3CRZA 1DBSA 2FXIA 3BCSA 4E12A 3OFJA 9GPBA 2HA4A 3SJ7A 4IIJB 1NJSA 4AU1A 1DTWA 1G19A 2Z6AA 4GGPA 1A2KC 2AR0A 3EXIB 3Q7QA 1T6BY 3C7KA 2QEQA 3EBPA 4IQFA 3TVYA 1M6HA 3IPCA 3VH4A 5JAIA 1RT9A 1HG1A 2C2YA 1JDTA 2XEXA 1LDGA 4IDFA 1UQRA 1K5GA 2BDTA 3Q9SA 1KH3A 3FOFC 1B3RA 4L9SA 1E1RA 2EJTA 2W5UA 1EFPB 1N2EA 2CLIB 1SBIA 1XDSA 1X7WB 2PV7A 4MWGA 5K8CA 5KYNA 1MJ5A 5KB3A 4JR2A 1P39A 3QELB 4V24A 5DSZA 2RGRA 4K8OA 2YZNA 4X71A 3NEJA 1PD1A 3A3OA 1M7HA 2E87A 2O2CA 1VCOA 3G1TA 2F7SA 1QZZA 2PGOA 4HDSA 1ZITA 3IE2A 2HU5A 3RIYA 3MJSA 4GRDA 2PHZA 1MEEA 1UC8A 2Q5IA 4CGZA 4LYAA 3BIFA 2JFXA 3FCAA 4QTYA 5KQRA 3DYIA 3F3SA 1XYYA 1J0BA 1AK1A 1XZFA 2G1JA 2NTNA 3KC2A 4ZAWA 2H1OA 1G6KA 1XJ5A 2WP8J 3LZ6A 3IX7A 2ZDGA 3ICOA 4X93A 4POOA 1HDXA 3ZK8A 3AM5A 4JYCA 1UPFA 4JUIA 1G8YA 3OFKA 4AJ2A 3MWDB 4AQYB 3TJRA 1A72A 3IV6A 3V2GA 3RYCA 3H5RA 4O4IF 3T3EA 4P0PB 1MU0A 1T9GR 3C4VA 4JOCA 2XE4A 1Z22A 4LDRA 3TLBA 1JA0A 1E3DA 1GAEO 3V34A 4UHJA 4ZHQA 1Q19A 1HOXA 3ZH2A 2RBKA 3DB2A 3I6IA 4LDPA 4JVNA 2YVQA 2FZGA 3TBKA 3TXAA 2QVCA 3DAYA 1DAEA 3BWDD 2C5FA 3WL3A 4B3HA 1WP4A 2JD1A 4S24A 3LP5A 1J00A 3JAKA 4CDRA 2PVCA 1SHUX 4ALNA 1E2BA 5KNBA 2Y9MB 1JILA 4CL2A 2NU8A 1L4KA 2AMYA 5C7IO 5DK6A 2V7UA 2QP3A 4O59O 2XTAA 2XCIA 3L5OA 3F7TA 3LBHA 2W2KA 3KR9A 6PFKA 2CV1A 4WKOA 4B6SA 1EVIA 1T8WA 1X80B 2CL0X 3H5WA 3LBFA 2YVKA 4H6PA 2J5KA 2VIIA 3BWVA 1OVMA 4LTNA 3ABQB 1D1SA 4OMFG 4TN1A 3VXKA 3LUAA 1FL9A 2VP5A 2VP0A 3F2VA 2EBWA 3C5CA 2WHYA 1LC0A 1YZFA 1P4AA 3TOXA 3GLHB 2BPOA 3QENA 4PLGA 2IYUA 2ZUFA 5DCWA 1DC3A 3FCXA 3FSJX 4X7RA 3BIJA 4LZZA 3QNUA 5DBEX 5KDDA 2WF6A 5KOHB 1ZXBA 3IRUA 5JRZA 3ETGA 1MFZA 2P67A 3C8DA 4K1LA 4NULA 2C4UA 5IARA 3ITNA 5REQA 2DKOA 2XNJA 4RVUA 4FQ5A 1YB7A 2FF7A 1CQZA 2CZQA 3FROA 1MVNA 5SZKB 1TKCA 1IUOA 4DY4A 1DOZA 5HIAA 2R8OA 3OZ7A 3EISA 3GCXA 5KVCA 1OY1A 4AY3A 4JHXA 2GVZC 4L02A 2EU8A 2FMKA 2G9VA 1LLQA 4YLEA 5DHPA 5BSHA 3E3LA 5E2IA 1FTNA 1U5BA 3AF2A 4GX0A 4AMGA 4HP8A 2CJPA 5AI5A 1K86A 1TM3E 1OBCA 1TM7E 4LXTA 3C0KA 4DUGA 4HLUC 4L7QA 2FR8C 1PFQA 2COUA 1M33A 3KELA 2XVAA 4LPKA 3RAGA 4N8SA 4FMCF 3W5IA 4CIAA 5EYPA 1WWKA 5K99A 2R68A 1JZQA 2FMFA 4DUZB 2B35A 3L5KA 4II2A 1PR1A 3FWNA 3A6PC 2VPTA 4EA7A 1O77A 1G98A 2V7EA 4DUPA 4HTFB 3GJRA 5G3ZA 1P6UA 2ORWA 1M67A 2QN3A 3ZVLA 1BE1A 1JR3D 4MR7B 2Q8QA 1VDZA 2XZPA 3AEZA 3OTIA 4LN1A 4EHDA 4LJYA 3FPBA 3CEPB 1KK3A 5F9FA 4OQDA 4F56A 4G0OA 4U02A 3WE7A 1E9CA 3CN9A 4QOIA 1E1QA 3ND8A 1IZYA 3UAZA 3FWZA 3VSDA 1JQJC 2OVFA 4G9BA 5B3JA 4OI2A 4CMGA 5AVRA 3H2BA 4DCSA 2H4JA 5CIWA 3PPWA 4KWEA 5I9IA 3ORFA 3IIIA 3GIDA 3SJBA 2IPLA 1BC5A 1P9LA 2HCBA 1H65A 5LP6C 3QJ5A 3TG2A 4N7MA 1A4UA 3T5TA 4NCAA 3G0HA 1KI6A 1TFRA 2DHEA 2IDMA 2P79A 2P65A 2ICAA 4ZAYA 1LDBA 1YZLA 1QMPA 2X6TA 2C58A 1XI2A 4Z8YA 3G0GA 3ZUGA 3IBTA 1UOQA 1ORDA 4BFSA 4PAOA 3SLKA 2WVHA 4PX9A 3HI4A 3AEUB 2XMPA 3OCZA 4CCAA 4TL9A 3T94A 2J5RA 1LK7A 1BHQ1 2NVOA 5AOVA 4U7GA 2A57A 3CUKA 1IOWA 1KS2A 1U0GA 4YGXB 4BMVA 2V7WA 4P38A 1CR1A 4UD2A 1I33A 5A2QA 5B58T 3UAWA 1WDLA 5K1ZA 1PR3A 2N46A 4KACA 1QG2A 2IH5A 3ENQA 1UBEA 4BNLA 2FMUA 1NVKA 2ZYIA 5AVWA 4BE9A 4PNEA 4JUDX 5I4CA 3FMFA 4M7PA 5HMLA 4IIHA 2LZ0A 5HMMA 1CUSA 1R12A 2VDOB 3K9BA 1QONA 2JGNA 2YR0A 3L8MA 4H3KB 1NXXA 3K9LA 3AF4A 4WJKB 4V2IA 4IWNA 5EE0A 5TS2A 3K0KA 2X0FA 4ZI3A 3PL5A 2D0DA 2ZUSA 2HRRA 2HSEA 1QVZA 3CSSA 1M6EX 1SXHA 4RF2A 2HQBA 2HWKA 2H4YA 2C9YA 2ZIWB 4TKZA 1IVYA 3FJ1A 2YWCA 4MO9A 3VR3A 5BQFA 1HNNA 1DKQA 1OV4A 2BAGA 2WUVA 3CFYA 2KSQA 1PJRA 1AN0A 3HJTA 1WPRA 4KYUA 1WMBA 3QVXA 2QM3A 2BFFB 1NXTA 5EJFA 3WRXC 2NO6A 3D6TB 1N25A 5ALOA 1SCBA 2QNBA 4MR9B 5K51A 1X74A 5CFNA 1GD1O 2RGWA 1DCFA 3DDSA 9ATCA 4AS1A 2KHZA 1GTMA 1JEOA 2G1KA 4KDFA 1T4GA 2GNAA 1ZSVA 4XIFA 2VS1A 3AHDA 4RZIA 3MTGA 2BJVA 4D82A 1Z4LA 2CK3A 2GWHA 2Q50A 4K6MA 4BNIA 4ENRA 4ZV4A 3VA7A 1TYZA 1UINA 4AY5A 4NC9A 4BBPA 3EVBA 2QTWB 1AKYA 1QHSA 7YASA 1OFTA 1ZMOA 5DWDA 5KAMA 1U7ZA 1DAOA 3DMHA 5JD4A 2GKSA 2ZR0A 4QDZA 3PJRA 3TTUA 2WFLB 5IJAA 3RVNA 5J2UA 4FGJA 4TRJA 4FGKA 1IEWA 4K40A 3WQRA 1Q7BA 2NV6A 5AJHA 3M2TA 2QQGA 3RRFA 2Q21A 4BNXA 2E6KA 1SQ0A 2N1BA 3FTPA 4RHUA 1EX6A 2Z3ZA 1EEXB 1WSWA 1E2GA 4GT1A 5ICEA 1GNQA 1JP7A 4DDWA 1Q20A 4HDNB 4FXPA 1ZOLA 5TARA 4ALLA 4BQSA 3ZIDA 2I55A 4PYJA 3RK1A 4IIJA 4N9WA 3VSCA 4NVRA 3CLRD 5GJBA 5ECDA 3O83A 5I5GA 3EXIA 1Y1RA 3R6WA 4E32A 2Q28A 1E94E 3AKEA 1O2DA 3ED5A 1GGJA 1E0DA 1P3Y1 1HURA 3L1IA 4NPCA 4MCAA 4WOBA 4RD4A 1PBTA 4IVPA 3RVDA 5C52B 4FM9A 3COSA 3EASA 4J7XA 1Z9BA 1NUUA 4FCWA 4LRXA 1KDYA 4AS3A 4M1OA 1EFPA 4Y98A 4IIGA 4P4LA 1X7WA 1Q84A 2ZRFA 3U19A 1Q0ZA 3QELA 2DJ5A 1JDBB 3UB2A 3DV9A 1OI2A 5KCZA 2I87A 2XRYA 4L3WA 3Q9NA 1NXVA 1UM8A 2R84A 2R5NA 3BF7A 3G8CA 4I6GA 3SI7A 4KIFA 5HJ2A 3S5JA 4A15A 1IJBA 1EI9A 2XYRA 3WNVA 3E03A 4CPDA 3N28A 2BTQB 4LYHA 3G7UA 3QZUA 8ADHA 1UBNA 4LOIA 1NNLA 1VDMA 3BCUA 2X2FA 3J81k 3UFXB 5L3VA 5I9BA 2DH5A 1B0UA 3THYB 2FNAA 1BKYA 4IJQA 2G3YA 4RW0A 1VPLA 3GNSA 4MQ5A 2WY2D 1PGJA 2ZITA 2P4QA 2QF7A 3QKSB 2AHRA 4S0ZA 4ARCA 4D44A 2ODTX 4F8EA 3AC0A 3FF4A 3W8DA 4FKZA 1LJLA 2XCSB 1CUEA 1LTHR 3IVRA 3MWDA 3DOEA 1N7GA 4MI6A 3TRJA 2PL9A 1S1CA 1CKEA 2BEUB 2GBFA 4KOAA 4R9SA 5AOBA 1KARA 2XB2A 1FP7A 2DTEA 2X1HA 3NNDA 4P34A 3E81A 4GAEA 4Y67A 4B82A 1Z6TA 1AKNA 4OFWA 3VR4A 3B7GA 2PS1A 3AFIA 4EY6A 1M8KA 2DOKA 3AHHA 3QKWA 2H8KA 1I9GA 1GTG1 1L1EA 3HBLA 4MP6A 3WB1A 1RQNA 1ODJA 3H04A 4WA7A 4NE2A 5F2OA 5B4VA 1EVZA 3QVOA 1FFSA 1M2FA 2CXSA 2DFPA 3H2JA 4P32A 4GXTA 1FFDA 3N2IA 2HCTA 5HILA 1R6XA 1PL6A 3NETA 2VDQB 3DZ8A 3KPUA 4QBHA 2FJUA 2QRHA 4M0KA 4D8XA 5EZ6B 1A0OA