2PD5A

Human aldose reductase mutant v47i complexed with zopolrestat
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
315
structure length
315
Chain Sequence
b'ASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHIYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Merging the binding sites of aldose and aldehyde reductase for detection of inhibitor selectivity-determining features.
pubmed doi rcsb
total genus 106
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2007-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2pd5A00
1HW6A 2BP1A 3RX2A 3UP8A 2IQDA 5HA7A 4YS1A 3U2CA 2AGTA 1Z3NA 3R6IA 4F40A 1RY8A 4QXIA 2FVLA 4ICCX 4OTKA 1FRBA 3LZ3A 1Q13A 2INEA 1X96A 1SM9A 1EF3A 3DN5A 3H7UA 4GA8A 4ZFCA 4QBXA 3BV7A 3UZXA 4JQ1A 5LIYX 3P2VA 4GABA 4JTQA 3H7RA 3F7JA 4QR6A 2PDKA 3LUTA 4WDTA 4GQ0A 3LENA 1YE6A 1IHIA 3B3DA 1T40A 3QKZA 3G1RA 2A79A 2ACSA 2INZA 4JIHA 3LBOA 2PDLA 4H8NA 4YVPA 3C3UA 1EXBA 2IKHA 2IKGA 3GHRA 4QX4A 4PRTA 3LQGA 2PDYA 4L1XA 1MZRA 1MI3A 2ISFA 4JQAA 5HNTA 3MC5A 2FZBA 4DBWA 4L1WA 1AH3A 3ERPA 3LNMA 4HBKA 1X98A 2PD5A 3UZYA 1T41A 2R9RA 2DV0A 1ADSA 2HE8A 3Q65A 3N6QA 1X97A 4Q3MA 1GVEA 2PEVA 4GACA 4WDWA 3CMFA 2WZMA 3GHTA 4FZIA 1Z8AA 2PD9A 3O3RA 2PDJA 3V36A 1PWLA 3H4GA 1ZQ5A 2PDXA 3UFYA 5JH1A 3FJNA 4XK2A 3V0SA 1LWIA 3CV7A 3EB4A 4R9OA 4WGHA 3O0KA 2IPGA 1YNPA 2I17A 3S3GA 4PUUA 2ALRA 3EAUA 2IQ0A 1AH4A 2FGBA 4JTAA 1OG6A 3WCZA 4G5DA 2NVCA 2HDJA 2HVNA 3BURA 3R58A 3V0UA 2HVOA 5LIUX 2IPFA 4WRHA 4XZLX 3T42A 2FZ9A 3UZWA 4LBRA 5AZ1A 4DZ5A 2PDCA 4WEVX 1LQAA 3WBXA 4WDXA 1QWKA 3FX4A 4PUWA 2PFHA 4FALA 3WBYA 3N2TA 4HMNA 4IJRA 2PDWA 4JQ2A 1JEZA 3NTYA 1M9HA 1K8CA 1EL3A 1XF0A 2IPJA 3CV6A 4PR4A 3WG6A 2DUXA 3VXGA 1ZUAX 3D3FA 3M4HA 3RX4A 4EXBA 4NKCA 3GHUA 4JQ4A 5JH2A 1ZGDA 3R8HA 2IKIA 2J8TA 1PZ0A 1AFSA 1EKOA 3M64A 4RPQA 4IJCA 1US0A 3R7MA 5HNUA 4XVEA 4LBSA 1A80A 1VP5A 5LIKX 4PMJA 4GIEA 3R43A 3R8GA 3UWEA 4AUBA 3CAQA 4YVVA 1S1RA 3LQLA 2ACRA 2NVDA 4JTDA 1Z9AA 4LAZA 3LZ5A 1XJBA 3ONCA 3GUGA 2VDGA 2PDNA 4XAPA 2HEJA 1VBJA 5C7HA 4XZHA 2I16A 3UGRA 4JTCA 3UYIA 1YNQA 2HE5A 1C9WA 2BGQA 1PYFA 2IS7A 1MRQA 1XGDA 2PF8A 3EB3A 1RY0A 4JIRA 2PDBA 4LB4A 3UG8A 3BUVA 3LN3A 2ACQA 4DBSA 2R24A 4YVXA 3DOPA 3KRBA 4XO7A 4PRRA 4WDUA 2HV5A 1AZ2A 3CAVA 1Z89A 5LIWX 1R38A 1S2AA 4YU1A 5AZ0A 1UR3M 4XZIA 3LEPA 4JQ3A 4I5XA 4GCAA 2PDHA 1J96A 4JIIX 2CLPA 3RX3A 1PWMA 3MB9A 4IGSA 4DBUA 3V0TA 2F38A 4XZNX 5M2FX 4ASTA 4LAUA 4LB3A 3CASA 3G5EA 1AZ1A 4JTRA 3ONBA 2IPWA 5KETA 2PDGA 2PDPA 2PDIA 1ZSXA 4Q7BA 1S1PA 1IEIA 2PDFA 2FZDA 4MHBA 4GQGA 2IKJA 3R94A 4XVDA 2PDMA 2F2KA 4FA3A 1HQTA 2DUZA 4EXAA 2C91A 2PDQA 5DANA 2BGSA 4FAMA 4XO6A 2PDUA 3M0IA 5LIXX 2FZ8A 2WZTA 3WBWA 1RALA 1YE4A 1Q5MA 2QXWA 4H7CA 3UZZA 3V35A 2ACUA 3COTA 3BCJA 2PZNA 2P5NA 4XZMX 3GHSA 1S2CA 3LD5A 3Q67A 1PZ1A 1QRQA 1AH0A
chains in the Genus database with same CATH superfamily
3KXQA 5JVLA 3RX2A 4GO8A 1W54A 2V5BA 1KV8A 4NX0A 2NQLA 4Z0SA 4BF9A 4FLRA 1R3TA 2QT3A 5I6SA 2IUZA 1CT5A 3MUIA 1IR1A 4L4OA 5LXEA 4GHRA 4H1ZA 3CQKA 3EGJA 1Y65A 5TAOA 1MW2A 4U3AA 4GQRA 5IHRA 5LIYX 4GABA 4L64A 1C92A 3AZTA 1ZJBA 3QY8A 2AL1A 3INPA 4PMDA 3H70A 3B9EA 4JGDA 4Z2JA 1UHVA 3CZEA 2VZUA 4HCHA 4NY2A 1XRTA 4LCQA 2ODOA 2WK2A 4F9JA 1XGZA 4BA0A 4C6EA 1QASA 3MCNA 1UYQA 2G4JA 5FEZA 1O66A 1Q6FA 3CHDA 3SCNA 4NZ1A 3TDFA 2BLEA 2YXGA 1ISZA 3LBOA 1CXEA 4GD0A 4EAMA 2IKHA 3ARWA 3L66A 4GGHA 1O12A 2RGLA 1LUCB 4FNRA 3L5LA 4F0LA 3IIVA 2GK1B 3STCA 1Y7VA 1FP8A 1ZBCA 5D33A 4Q4MA 2PWUA 4QQUA 4HN8A 4AIUA 1XLBA 3CB8A 4K36A 1FWBC 5D32A 1O5RA 3FHAA 4IFKA 4MKSA 5EMMA 1JDAA 1BYBA 1F8MA 3VGFA 2BY2A 5JBDA 1D3GA 4M24A 4S1FA 1CECA 1PIGA 2DSVA 4C6CA 3DC8A 2A6NA 4C6MA 3B40A 2HXUA 3SCQA 3LXBA 2DFAA 1QXLA 4H7VA 4HJFA 1SPQA 5C2CA 3W6MA 2A1YA 5GJPA 4DWSC 3O15A 3EB4A 4R9OA 3K8LA 4YTSA 1L8PA 5A3HA 4BI7A 2BXVA 2QDEA 4IPJA 3Q2DA 4MWAC 3LX9A 1O5KA 2X7VA 1KRCC 3PJTA 3NGFA 4DUOA 3KWSA 5T9CE 1UG6A 5BOFA 4F8XA 2DZUA 1UP0A 1IF2A 1GJPA 1E6SM 3T0CA 4J35A 4ZXOA 2PRHA 2E9MA 4MYAA 4OJYA 3N17A 3VD7A 1GZ1A 5LNUA 4N9DA 5BROA 1NAL1 2WSRA 1HXJA 1TPDA 3KBMA 4ZEPA 1KW1A 6A3HA 4GIRA 1XIBA 5KZDA 2HRWA 1SSGA 3GG0A 2YZRA 2BOFX 4RE3A 1HFBA 2YL5A 1GONA 4I9JA 1A0EA 3FX4A 2Z1SA 4MM1A 4B9YA 3N6HA 3TCSA 1EGZA 2WLYA 1XRSA 3VNZA 3VCCA 2G95A 3A9BA 3DFYA 1CW2A 3MKKA 2BS9A 2EG8A 3WG6A 5EFDA 5FL1A 3DECA 4NJGA 3S5NA 1AK5A 3GVGA 4K37A 1FA2A 1U2YA 4BQ2A 1G1YA 4CLMA 2V5CA 2CHOA 1Z6KA 3L0NA 3CWOX 3ISIX 1OD8A 5E9XA 3RCYA 2DZTA 3PG9A 4UR9A 4J2MA 2BBFA 1WUFA 3R11A 3OIXA 1VB9A 1FUYA 3SR7A 4O52A 3NDZA 2OWWA 1ZJAA 4XTIA 3AIEA 3F4VA 3R8GA 2RHGA 2YFNA 5D02A 2V5LA 1OFDA 4KCWA 4J3TA 4JHMA 5CC3A 3ONCA 1L8NA 5D8ZA 1KFWA 3GXPA 1VHCA 2OVLA 3TAKA 1P6WA 5AKQA 3TC7A 4PSPA 1DJGA 4UTWA 2OLSA 4CQBA 3PZOA 1V02E 4YN5A 5HANA 3LYEA 5MKGA 3T7VA 1B3OA 3PZQA 3QTPA 1SQ7A 1UQYA 1C90A 1V08A 4O16A 3POCA 4WOZA 2DY3A 3N6JA 4FI4A 4KETA 1MUCA 3HPXA 3L4ZA 3WEZA 3CNYA 3CL6A 4WOQA 4ZGYA 1HX0A 5K4ZA 3P82A 4AQLA 1R2RA 3F2BA 2YXXA 2RGMA 2XVKA 3W7GA 2DVXA 4OIFA 1YRRA 3FNDA 3ARTA 2HPMA 2VGGA 4IPPA 2EXOA 3T08A 3WQPA 3I6RA 3TE9A 1OADA 2GVJA 4GVIA 3WK0A 3EMQA 1ISYA 1ZCCA 2VZVA 3S8HA 3BLLA 1C8QA 2C8NA 3JRKA 3JR2A 3O6CA 4XD5A 3FDGA 3DYMA 3E02A 2X2GA 1XLIA 4IGSA 3FCPA 2X7WA 3TFCA 5B80A 5AY7A 2VFFA 1DWJM 4LNCA 3WQCA 4OZOA 3S2CA 1HT6A 3LB0A 4H9YA 1UZHA 2E0PA 4ADSA 1XXXA 2PDFA 2ZX8A 4CCZA 4N9BA 4CNOA 4K8EA 2DUAA 1RP9A 1YKWA 2VENA 3NEVA 4GUHA 1EUAA 4QIUA 5B7ZA 5D30A 2V2HA 3MS8A 3H21A 3MP4A 3OQ8A 5HMDA 3REQB 1TV4A 1M41A 3W01A 1UZ4A 5CGQA 4AEFA 2PP3A 2G5WA 2ANUA 3P62A 1GOKA 2XPKA 1DJIA 4KGLA 3TROA 4GG9A 3EWWA 3IJ6A 3W29A 4B5VA 2AQWA 3C2VA 4ERIA 1JDCA 2OFJA 3OBAA 1XD1A 4XZMX 3TYUA 4PL2A 4XISA 4ML4A 4ZSTA 3V5FA 3EMCA 4WXYA 1F73A 1YTEA 2ZUUA 1XLKA 4AYSA 3L67A 4HYRA 4KF1A 4QAIA 4KFPA 1X96A 3I7RA 1SM9A 2YCLA 3DN5A 3GYCA 4MFDA 5A8OA 4HHMA 1P1MA 3HURA 3MW7A 3TTOA 1GG0A 2POTA 1SR9A 4JYDA 4NG3A 2W61A 4YTTA 3GH7A 3W7CA 3W71A 1SZRA 1N7KA 3WQWA 1HP4A 1YE6A 4B9ZA 4AZHA 4ZB2A 3QKZA 3QGKC 4XAZA 5TQLA 3CUIA 3AWOA 3H4XA 4HHLA 2GJPA 3ARQA 5K4XA 3ITLA 3QPYA 2BZNA 4JFWA 4K8GA 1JPDX 4L1XA 1I9CB 3RMJA 1ITXA 1V03A 4NAEB 4D6IA 5FEWA 1FKWA 2C7FA 4MPKA 2J9YA 3L2MA 2D73A 3NYZA 2VZTA 3VNMA 3QMSA 3LNMA 4UTUA 4M6QA 4HBKA 1QCWA 3VCRA 4QNWA 3MHGA 1VRXA 3I3DA 3GW3A 2YB1A 3O06A 3WY1A 4A4AA 5T8GA 3CYJA 3GKAA 4DQWA 5A6BA 4N42A 4NJKA 5HUOA 3WF0A 1Q4WA 4RUBA 4HPXA 1O60A 1NY1A 5CPOA 1R85A 1M7OA 3PTDA 1P0NA 3PBVA 4GJ1A 2FH8A 5I7GA 3SDOA 1XYLA 5FEXA 3EX3A 3SBFA 1TQXA 1A4LA 2X09A 2GWNA 4XTDA 4ZOEA 2A3BA 4GK8A 3FHQA 1PYMA 3D3AA 1PDZA 2G3NA 3PBMA 3IK4A 4UR8A 2PTWA 4HT3A 1U5JA 4WR3A 3W2LA 1B57A 1W9VA 4A8RA 2WQDA 2HZGA 1I1WA 5EPDA 1MEWA 3MWAA 1VPQA 4V28A 3VNLA 3AHXA 4MLJA 2A3HA 5CZKA 3K4DA 4DZIA 4PA8A 1DJHA 1R3QA 2RJGA 3SY1A 3ITGA 1AMYA 3CMJA 3VFLA 4XZLX 1XLJA 4UTJA 4GUJA 3WQOA 2PBGA 3CB3A 5AZ1A 3JUGA 4E0CA 5KEZA 1JDDA 1LQAA 5KZMA 1CEOA 2CKSA 2QCLA 3FSUA 3KTXA 1NSJA 3P0WA 1UZ1A 3NTYA 1QT1A 3NL3A 3B0XA 2IPJA 3LCHA 1S3HA 9XIMA 1KCLA 2EKCA 3PTKA 4PR4A 1KCZA 2Y7FA 4PCNA 5HINA 2DEPA 4H9ZA 4PUDA 1Z69A 1E4IA 4JQ4A 5JH2A 4MAVA 4ACYA 2AL2B 3GLCA 1E1EA 4QJ5B 2E5BA 1XBYA 1LRQA 3E5BA 2EPHA 2VC7A 4HCDA 2FFIA 1UWIA 3VKAA 3VIPA 4XVEA 2V69A 5CPTA 3MSRA 2EHHA 1A80A 4CN6A 1TCMA 3MU7A 1THFD 4I8DA 3VIFA 3KTCA 3QVQA 2WWDA 2NWRA 2QMJA 1GOMA 4QGCA 5REQA 3A4XA 4QFUA 2Y7DA 1KWKA 4MLRA 3W7EA 5BXSA 1E0XA 4NZ3A 3RK8A 1YXYA 2GPTA 1DJXA 1J6PA 1FCVA 1XD0A 1QWGA 1XUUA 1A5LC 4J7RA 1G5AA 4MB1A 2DIKA 2J7DA 1DJZA 4WJXA 3S42A 3UCDA 5A95A 1GVIA 1V4YA 1HN1A 3VGBA 1MRQA 2ZRZA 3AS2A 4ZQMA 3S9IA 1CENA 3S1GA 3LCIA 1B54A 4OE7A 1CXKA 3P5YA 5KZEA 1GWJA 3EOSA 1C8XA 2ACQA 1RCOB 2GJXA 2YCKX 3HU7A 4H83A 1KB3A 3QFWA 3G1YA 3B06A 2ZZ2A 4UTMA 3IS4A 1TPVA 2E7FA 3AYTA 3VKKA 1E6NA 4WLCA 8CGTA 3W7NA 4TX6A 4C7FA 3ITTA 1E43A 5K9XA 1YDOA 2G3IA 3V4BA 3CUZA 2CLPA 4QROA 3MB9A 2GSEA 1OCJA 3WUGA 1E6PA 4RJEA 3AWNA 1N8FA 1UC4A 4B4HA 3STPA 3B0PA 5C9UA 3VDBA 2ZUVA 1U5VA 3QQWA 5CG0A 3ID7A 1FWEC 1TPC1 1I6NA 3W26A 1J4EA 3PN8A 3GDLA 1EJTC 3R2GA 2IPWA 1DJNA 4LC6A 5ABGA 3S5OA 5LYRA 1NFPA 4IL2A 3RMEA 1EFZA 3W02A 3GFXA 4DYJA 3TOPA 2OEMA 2FGLA 1HKWA 4H00A 4PUMA 4IPNB 1VBUA 4W7VA 1NWUA 1RQEA 3B9AA 4FEZA 3C0QA 1U33A 1NDYA 3P3BA 3TUUA 3GFYA 4HA4A 3E49A 1BSIA 4XB3A 3UJRA 3QSRA 3UG3A 5HPOA 4DWSB 2XGZA 1G01A 3EKGA 8TIMA 1Q6RA 3NZ1A 3CHVA 3SCSA 4X3ZA 3H2CA 2OKTA 3IGUA 5DLCA 3HMCA 1AL8A 5DEZA 3RRAA 1Z3NA 4OECA 1E1CA 1W32A 1BD0A 2XIOA 3MTWA 1WDDA 1E71M 2EGZA 3M1ZA 3DESA 4XD4A 3BAIA 2VC5A 3CUHA 4MKVA 1X1NA 1XW8A 4JTTA 3SADA 4X9YA 1UOKA 1OX6A 3RILA 3VIIA 1S5WA 4NT0A 4UMCA 4YIWA 3LXAA 1EYEA 5G1TA 3UWYA 2QUVA 2XWEA 3VZZA 3KBSA 4WHBA 4QR6A 2WCSA 1EGMA 4CNPA 5TD4A 6ENLA 5FSEC 4IG2A 3R79A 4RZ4A 2UY4A 3T07A 2YA1A 1ZALA 1A50A 1JPHA 3TTSA 2ACSA 2CC0A 2XG9A 4UWMA 4DXXA 1A0CA 4M0XA 3U5UA 2OELA 2R1KA 2X41A 1WZKA 1JD9A 4ZO7A 5HQMA 5BU6A 5DY3A 5AYIA 3QQ0A 2ZVRA 3LPFA 3S47A 1VRDA 3VD5A 4DBWA 3A3WA 3HV9A 3C86A 4NI8A 1XQKA 1E73M 1VS1A 2WOQA 1UPPA 2GGEA 4MDOA 1IZCA 5FJPA 2PBOA 3UVAA 3UWQA 3LCLA 2OG9A 1T41A 1HJVA 2VWTA 4NNBA 4RV3A 5G4HC 6XIMA 2Q8ZA 4REQA 4EACA 1X97A 3QPEA 4L61A 4TX9A 1T7LA 5A8NA 3PULA 4Y9OA 2UBPC 1QMLA 2TMDA 3MMTA 1MFVA 3GHTA 2PD9A 4G9PA 4AB4A 4J28A 4UFIA 5I06A 3PHAA 2HBVA 4Q4PA 4RDYA 2WCAA 1LG2A 3QH2A 4CU6A 1EQPA 1E4LA 2B31A 2AGKA 4ZXLA 1HNYA 3ES7A 5AN7A 1EEXA 4U10A 2GDUA 1TJ0A 1SUXA 4NXSA 4HSOA 3BG9A 3USZA 1KFBA 1BYCA 2PWEA 3QHNA 7TIMA 2F61A 2WMHA 2V8ZA 1PX4A 4GBDA 2R94A 1KGWA 3WL0A 1XLHA 5GNXA 4U28A 1XGEA 1E9LA 4O10A 3B8UA 4FK9A 3TJXA 2HDJA 1JCTA 1YX1A 3BURA 3V0UA 1W37A 1BG9A 5DX7A 7ODCA 1G0CA 3NPUA 5AFDA 4MNMA 1VCFA 4PEEA 3QN3A 1DEDA 4A3YA 3EWUA 1DTUA 2Y2WA 2W67A 4QLKA 1WZMA 1KCKA 4D6HA 1GUVA 2L5HA 3QFEA 3EMZA 1H7XA 1NIUA 3AO0A 1XIIA 1KBLA 3ARXA 1GOWA 1LORA 2AL2A 3GDTA 4IJRA 4CQAA 3WLOA 3KEHA 4TVDA 3WD4A 1GOXA 1S2TA 4H9VA 1PDYA 5EBAA 5LGXA 4DUXA 4MSSA 4IGMA 2XIIA 2XIJA 4UNLA 5CCZA 2YBVA 3GHUA 2XIQA 3DKJA 3WLRA 4AEOA 1MDRA 3KVLA 1L6GA 3UU0A 3IUHA 4I6KA 4XKMA 4XZ9A 4LF2A 4AIBA 4LT9A 2PTDA 4IJCA 3AIVA 1O1HA 3FV9A 1GOQA 5HNUA 1CXLA 1E1CB 2ZX5A 3CGTA 4MY1A 4HOWA 4IHCA 3LLXA 4Q7NA 3AIQA 2C18A 5DCDA 3IAQA 1QK0A 3ZMRA 4GJJA 3MZ2A 4NF7A 3LZ5A 3I7QA 3LLDA 2GQ8A 1HJXA 3MDUA 3DGRA 3QRHA 1KBBA 1A0DA 3CUJA 3BZJA 4RZ6A 4P7NA 4YL2A 4NJJA 2W6RA 2YDAA 3ZO9A 4DJFA 1XBZA 4ILSA 2NUXA 3BAWA 1VHNA 1T0OA 2WKGA 2Q3RA 5CC7A 4H9XA 4NNAA 1HO4A 1LQ0A 2JK2A 3VGDA 2VRQA 3VUSA 5I3JA 1R87A 2CZDA 5HWNA 4BY3A 3DI1A 1VLWA 5J5RA 1H63A 1WV2A 2NZLA 2C1HA 3MI6A 2ZRVA 2JGYA 2PP1A 3ZOAA 3B0YA 3O2LA 4U5IA 4EE9A 1R3RA 3TLLA 3NXLA 2ZZ6A 4GX8A 1CB7B 3Q58A 5CZ0A 4PN2A 3L21A 3W9ZA 1WBJA 4EWJA 3GWQA 4ZQOA 3BO9A 4I9MA 4FPSA 3WH6A 1FXQA 3ABXA 2F38A 4LCSA 4UCGA 1XIMA 2Q8XA 3LSBA 4ASTA 2VZSA 5A6MA 1KQZA 3DHPA 4IM4A 1J9YA 3R12A 3KTSA 1BAGA 2VTFA 4FNPA 3WLIA 2G50A 4D8AA 1WAWA 1V0MA 4U2YA 3KOYA 4DLFA 1DQWA 1DIKA 1E15A 5DF0A 2VRKA 5E0KA 4D6GA 3D5HA 3ZFHA 1W56A 5A1AA 2C19A 3W83A 4AC1X 5HNRA 2PDQA 1TPB1 1K6AA 1YBQB 4GY0A 3EWYA 2QMKA 3PZ9A 1MSSA 2A3AA 2WNQA 1HG3A 3OBEA 4HNTA 2JGQA 3VC5A 3IVTA 3BCJA 4YLWA 4XSMA 1A5SA 2ZUNA 2W27A 1JNDA 3VK5A 3GHSA 5GPRA 3FK4A 4QLJA 1GJUA 1XYAA 1ZPTA 1XLLA 2R1MA 5HJYA 3G1FA 4C6QA 4AY7A 4DBDA 2E6AA 1NARA 3SIMA 5EMUA 1OM0A 5E6YA 4Z2HA 3W27A 5D2TA 4WKHA 1TQJA 4QXIA 1V6TA 1CPUA 3APYA 4IIGA 3GBEA 1OX4B 3GZ3A 1J0JA 2EKGA 4AZ5A 1ZJHA 4GUGA 5I78A 1ONWA 4MNJA 4QAWA 3HOJA 3OGSA 4D72A 1IIHA 2H3DA 1B3XA 3VI2A 3JZEA 1A5KC 1V3MA 4HNVA 3M6DA 5C70A 5CBBA 3WFLA 3N4AA 4NRRA 2PDKA 2DW6A 4DNHA 2CXEA 1VC4A 3RLGA 1TPUA 3G1RA 1TCDA 1QK2A 1XSIA 2FHCA 1J5SA 3PVFA 2A79A 2Z6JA 2E6YA 4IJBA 2ZA1A 5IFPA 3BW3A 4N4PA 4NYUA 3GG8A 1X38A 3ABRA 4JFUA 4UFJA 4BZYA 1NP0A 3A4JA 4TMCA 2PDYA 5EA9A 4MPQA 1J2BA 3URNA 3LOTA 2ISFA 1J12A 5M3WA 1Q4NX 4Y8EA 4E3VA 3KZPA 1PAMA 3WJYA 1YXCA 4XWUA 1QJWA 3THQA 1OFRA 2YLLA 5HMSA 3THDA 1YDYA 3G0SA 3IIXA 1FDZA 1W5PA 4IIBA 4GYJA 3HQ1A 2DV0A 2ZOXA 1L9WA 3W1AA 5CLWA 3G0UA 4YNGA 1LL4A 1QNSA 1Q6OA 5XINA 5DQPA 3BSGA 4MWAA 3STFA 5FOOA 4WDWA 2HROA 2NVAA 2J7CA 4O8AA 2XSBA 2DT1A 3CPGA 5CBIA 4S3GA 2XFYA 5C9ZA 5F2IA 4O1FA 4UFHA 3W82A 4ZOAA 4NL1A 4EXQA 1TTQA 2WSKA 5AHEA 1R6WA 1M68A 2YR1A 2C0AA 4CD8A 4HP5A 3V0SA 3TJ4A 4K8HA 1RCXB 4HIBA 1IEWA 1YDNA 3DFOA 2GFTA 3L0GA 4GUFA 1Q6QA 1Y8BA 4JOMA 3CU2A 4EPEC 1GKQA 3QOKA 4JS3A 4PBFA 1OG6A 3DG6A 1XLDA 2XM2A 1J2WA 3UPBA 1ITCA 1W3TA 2C1IA 4G5DA 1E4MM 3KW3A 4LRSA 1I60A 3F2DA 4J9JA 4D9PA 1UP3A 3UWVA 4TO8A 1UC5A 4DJDC 3L4VA 1J93A 1A5AA 4HSNA 3UGVA 3EBVA 3WFAA 3WBXA 3U9IA 1XKJA 1O5QA 3VM5A 2D2OA 4E8CA 3M7WA 2WB5A 4JYFA 3SM0A 3VOFA 2Y8VA 1RD6A 4ZFMA 3IVSA 3MO4A 1QI4A 1TELA 3UYCA 3NQ6A 1ZUAX 3CS2A 1GVRA 4IMGA 3OYZA 3MY9A 3W2MA 1IWPA 4O53A 1AW2A 4LAKA 3OJGA 4MUPA 2ZZ5A 3LY0A 1T5AA 4O4WA 4C65A 4O0ZA 5BU9A 4GQQA 1XICA 3L68A 4B3LA 2BX7A 1CBGA 2ZBTA 3TEVA 2BHUA 4HGXA 2VEKA 3EWDA 2WANA 3JS3A 2FFCA 1XC6A 3QGAC 2JKPA 2P88A 4ATLA 4OBSA 4GQBA 4PBGA 3NDOA 5IFTA 1XIGA 2W3ZA 3NNTA 3TWBA 2FHBA 4LS1A 4XSLA 4J1OA 4NAFB 4KRZA 1T6MA 2VX5A 2ZRWA 3SGZA 3FLUA 1K03A 2O92A 4FXRA 4HMEA 1W2VA 3DERA 3TMLA 3AXXA 1EWDA 4K39A 3AALA 2Z1KA 2E5DA 4TUFA 4WIWA 4Y6GA 1SYTA 1IT7A 3C3NA 1YBQA 4DI8A 2VYOA 2I16A 3ME3A 3PM6A 1XKYA 1EBGA 2FQIA 1PYFA 4POCA 4DNMA 4A05A 3TCEA 3B8SA 4HU8A 2F8QA 3QXBA 4N9EA 3VUPA 3RIKA 3S0CA 3PB0A 2YXOA 1NOUA 3NZGA 3KOXA 4FXFA 1PZ3A 4KQNA 4HOXA 4AZ6A 1VEPA 3DKLA 1PE1A 4UQBA 1UIOA 2QQ6A 4S3DA 1H7WA 2GOUA 4UTHA 3T55A 4E6MA 2OU4A 3PJUA 1H61A 2CIPA 4AX6A 1UR9A 3PG8A 2INFA 1NVMA 4DPQA 1VFLA 4H01A 1E6RA 5LIWX 4GLEA 1NQ6A 3AJXA 3MV11 3TX9A 1TB3A 4R53A 4GZJA 1M65A 4NQ1A 1XX1A 3LS9A 4EPBC 3B0VC 3UWZA 1PIFA 1VIWA 1PCKA 2VVNA 2J7GA 1J0HA 1F9CA 3NIYA 4UTTA 1RLCL 4DF1A 2R1PA 1WZAA 3N15A 3M16A 3PPFA 3TQKA 2OLAA 5AC5A 4YMZA 1UR1A 1F7BA 1SO6A 3N4EA 1S5VA 4W8LA 4HA3A 3E0IA 5KETA 2PDIA 4Q7BA 1EDTA 1FWRA 2CWNA 3A24A 1VFOA 1W1TA 4F79A 1BXCA 3P6LA 3A21A 3FXYA 4L1GA 4DPPA 4MNKA 1CCWB 1LT7A 2ZX9A 2C91A 2QAFA 3SN0A 2VUNA 3FVMA 4W84A 5HMEA 3S6TA 3KHDA 2PTXA 3P5ZA 1XLCA 3NSXA 2PODA 2YW4A 3UZZA 3IJIA 4D2JA 2WPGA 3COTA 3KBNA 2Z00A 3WDIA 5IOBA 4L6DA 1OF8A 3EOOA 2YCIX 3EDEA 2Z2UA 4R3UA 3IWPA 4LY4A 1HGWA 3TN4A 5F4XA 3U48A 1HKIA 3MSGA 2NW0A 1F3WA 4PB4A 1YHTA 3MKVA 4MJ2A 4HYWA 2O7SA 1FRBA 2ISVA 1OZMA 4RCXA 3GH5A 2J7BA 2WCGA 2PI6A 3IEBA 4DZAA 2DW7A 1YW1A 5IDIA 4AHQA 5CZSA 3ZYZA 3CZLA 5I3IA 4WJEA 2OWXA 3DDMA 2D3NA 1Q66A 2P3ZA 1EJXC 5JIPA 1P48A 3MWCA 3WDPP 4FR1A 4ZENA 1ONEA 4KRTA 3RM9A 2CLHA 3TR9A 2ZADA 5LXXA 1ZFJA 2WHLA 2TSYA 4Z2LA 3OA3A 4S2BA 3HG3A 1QHOA 3USBA 2HK0A 2TYSA 6REQA 3GHRA 4QP0A 4YTQA 1NWSA 4KEUA 4PRTA 4NNCA 2OOFA 1JPMA 4XD3A 1TPEA 3W81A 4DWDA 1CDGA 4NVTA 4GO9A 2LLEA 3H22A 3NPXA 4GFIA 1P6BA 1XR2A 4FHAA 2Q02A 3GBDA 3S1WA 4IIFA 3W37A 4EX4A 1KC7A 4O28A 1MWOA 3RLUA 1FWAC 3Q65A 2WZEA 1OC7A 1I0DA 2EQDA 4I7WA 1G69A 1SGJA 2BMBA 4JBRA 2G41A 2WZMA 1CGWA 1P0BA 2J66A 3J7HA 1KNWA 3WENA 4TX8A 3CTLA 3V36A 4UC5A 4PMZA 1J0ZA 1W5OA 4TU1A 3UFYA 3ZQ9A 3MI3A 4RNJA 3UERA 1WQ5A 3U4AA 3HGOA 1ZL1A 2NSXA 2Q3OA 2C3ZA 4NJHA 2XVGA 3C61A 3GM8A 3GDKA 3SCOA 3A4WA 4CU8A 3TJIA 1K8XA 3KVJA 4YYCA 1K70A 3BZGA 3WD2A 1NF0A 4DJDD 4RZ5A 1EUNA 2DP3A 3BMVA 4W5UA 1OYCA 4JTAA 2EG6A 2QF7A 3POHA 1WDPA 3BLDA 1VEMA 3UXKA 4H41A 4NAFA 2GK1A 3F4DA 3UZJA 5LIUX 4AX7A 1JZ7A 2CLLA 3HO8A 1C93A 3TYBA 3T1GA 5BCAA 4GYPA 3II1A 4NILA 2P50A 3W00A 3O07A 1EZ2A 3T78A 4X0NA 4B5WA 3E0WA 3QC3A 3SB0A 5F2LA 3W7IA 4RNFA 4ZB0A 4MOZA 1EO7A 1KBKA 5FKYA 2WVVB 2Z1BA 1PXGA 2D2JA 2CESA 1VJSA 2ZUMA 4G2DA 3MP5A 1KM2A 1J8VA 2DU2A 3C4UA 4X61A 1GW1A 4K68A 3TYCA 1AMKA 2AMGA 3K13A 3VOGA 4G6CA 4F0SA 3B4YA 3NM3A 1BQGA 4W8AA 3WUFA 4EAYA 3Q45A 5DRIA 3CL7A 3UXIA 5I3DA 2FKPA 4C1NB 5KSWA 5CXPA 3KOZA 3FS2A 4PZVA 1WA3A 1JQXA 1RUSA 2E77A 4UQEA 3OIHA 2GLKA 1KLZA 1KTNA 5JBFA 3VGGA 2ZC8A 4XIAA 2OLHA 2IXVA 3FSTA 1F8IA 1OQFA 1BKHA 1VBHA 2V67A 3GAKA 2CZ5A 3TNOA 2PURA 5FJUA 1ZHAA 4Y2WA 2QPSA 5DT5A 1TIMA 1VBJA 1VIZA 4EK7A 3QV9A 1VCGA 3HJZA 1S2VA 7PTDA 1Q2SA 1UWAA 2J74A 3ECQA 3L7RA 2YOCA 3ZJ8A 3LMZA 1S5NA 4FX7A 3UG8A 3PZUA 2I7GA 3FYPA 1CGYA 1D3CA 3WF1A 1FCUA 4LJ3A 3KDNA 3BGAA 3M07A 2DZVA 1GQIA 4S2CA 5A6SA 3S2NA 2POZA 4YHGA 3UPMA 5E0CA 3DZ1A 3GC5A 1O7AA 5DBTA 4CQ8A 4KWSA 4UOZA 3CAVA 1KKRA 1NEYA 4GH1A 4BHYA 3QF0A 4F2TA 2J8GA 3TK7A 2CNCA 4G56A 3NPWA 2D0HA 3PSWA 3JW7A 2XU2A 1GYLA 3SY8A 2VFEA 1QPRA 5A8GA 1MRAA 2QCHA 3OVPA 5G2HA 1HF6A 2CWXA 2FGZA 2VGIA 4WSJA 3FXGA 4JTRA 3DAQA 4MYXA 3F1QA 3ARZA 1Q7QA 3UBPC 2J25A 2PDGA 2PS2A 3DU0A 2FZDA 2QPUA 3R94A 1UWTA 1XV8A 3QBUA 3VIHA 2DSWA 3T81A 3GU9A 2FZNA 3UQNA 5H8MA 3TXVA 5RUBA 1QO2A 4ZZ9A 4FXJA 5EY5A 2A3EA 1RZMA 2PF0A 4M56A 3V1HA 3QYQA 2QNEA 1DWFM 1D8CA 4PUNA 1L2UA 4E2DA 1QW7A 3C52A 5C71A 3LD5A 2OZ0A 1F07A 1WX0A 2YW3A 5D9MA 1UP2A 3CLWA 1DPMA 1R46A 1K77A 1UD2A 4AIOA 2E40A 4A22A 1OFQA 3DH7A 1GW9A 1TWDA 2ON3A 4YWIA 3PJXA 1V0LA 3HTWA 1MEHA 1W9PA 5LGZA 5MF5A 4GI4A 4QISA 1WXZA 3WNNA 4Y8FA 1CZ1A 3BSHA 1V3IA 4PODA 1TV2A 5DMNA 4UUIA 2WZIA 1M04A 1OC5A 6REQB 2QAPA 3AICA 1XI3A 4ZODA 2JALA 4ZCWA 2Y63A 5JQ9A 4RLIA 2YA2A 4G8TA 3M41A 1CGVA 4WDTA 3NCOA 3EOEA 4XKYA 3O63A 3B3DA 3LXCA 4DI9A 2V3DA 1GEQA 1UR2A 3IGHX 4GH3A 2GSHA 1VPXA 4Q8UA 3L5MA 3VDHA 4DO6A 3LHWA 1M3UA 3ABOA 1OT2A 1YTKA 5E5CA 1GOIA 1PKNA 1MZRA 1SJBA 2XINA 4A8IA 3MC5A 3UA3A 3HGJA 3M0VA 4C1LA 2A7NA 3KS5A 2OZ3A 3ERPA 1W9DM 4RZBA 1TWIA 4DX3A 2PD5A 1PV8A 4DBEA 1B9ZA 3VIJA 2R91A 1FCBA 1JVNA 3CAWA 1NFGA 2J88A 5J04A 3N6QA 1FHUA 1J11A 3WQ4A 4FB7A 3VOIA 2X30A 3CT7A 1SSDA 1OYAA 3LSCA 2Y5EA 4PYSA 1F61A 2WSPA 1N8WA 1Z8AA 4ZTXA 2ZTJA 3NL6A 1E5NA 5CPLA 1BPLB 3NVTA 3ZWSA 4QE1A 5CJMA 3GXNA 1ME7A 4M19A 5E9AA 4U33A 4JTSA 1IGSA 1OGBA 2CLIA 3CV7A 5I07A 1E51A 3QQ1A 1WPCA 4Q8WA 2OWCA 4HN4A 3S83A 1H7OA 1S46A 1EWEA 4A3QA 4P7QA 3G1DA 3NO3A 5FCZA 3VU2A 2PTYA 5DT7A 1GKPA 2ALRA 3WD3A 4V27A 2O55A 2NXGA 4JHOA 3NQGA 1TA3A 1WNOA 3GRIA 1FWGC 3H54A 1BVNP 2NVCA 4AVNA 3RDKA 2PWGA 4LS0A 3TTQA 5LNSA 4DZHA 2HVNA 4V2XA 3N2CA 1MO0A 1C9DA 1JPIA 3VX0A 3A5FA 1W17A 4KCUA 3SN1A 1KKOA 4J2PA 2XH7A 1LROA 1PJ9A 4GINA 4WDXA 2PGWA 3PAJA 1V6WA 4UXDA 1UWSA 3ZZ1A 4BEUA 3WBYA 2ZICA 4LS2A 4LANA 3WF4A 2XISA 1JEZA 1K4HA 3LI0A 3C2FA 3STEA 1F74A 3KL0A 3THUA 3H2MA 3MYOA 1YNYA 4AF0B 1TTJA 1JDEA 3GTHA 4GISA 3WMSA 3CV6A 5HQLA 1WKFA 1W9BM 3GNOA 3A6OA 1U22A 1GQLA 4GNJA 2DZXA 4E4PA 1QO5A 3NQBA 3BG3A 2ALDA 4ROPA 2NV1A 1TO3A 1KQYA 3MQTA 3GDMA 3GH4A 2OO0A 4KS0A 1PZ0A 5EU9A 1XYFA 3CIXA 3W07A 3IK2A 3EXTA 3SJNA 3O9NA 2WMIA 1VH7A 4LBSA 1W9UA 3S2MA 1JIBA 1QNRA 1OC6A 9CGTA 3E3HA 5AC8A 4GI9A 1R2TA 3PBUA 1VJIA 3EOUA 4YVVA 1UBSA 3TXZA 1NP2A 4XG1A 4DJDA 3WK2A 1Z9AA 3NGJA 4HPJA 3O7UA 5CG7A 2VDGA 3GXMA 2CLEA 4OFCA 1UH4A 4UTTC 3CH0A 1E0TA 5KINA 3AYVA 1CWYA 1PKLA 1ZY9A 1A5BA 1KFCA 1TREA 4F48A 4ZE5A 1Q45A 3I3BA 3VD9A 2QV5A 3SCPA 4YCOA 2PGFA 5A5WA 4E2BA 2EJ1A 1E3ZA 1VFFA 1X1ZA 1GQNA 3M5ZA 2VGBA 1VFSA 3EDKA 3ARVA 4KEZA 1G4SA 5A2BA 1OYBA 4PRRA 5LNWA 3OYXA 3W70A 2F2HA 3IRDA 3WH8A 2VFIA 2F6UA 2X0SA 2FMOA 3BJTA 3A5VA 2TAAA 4C1KA 1XIFA 1W6TA 5BOEA 3RR4A 2OJPA 3QV6A 1I2NA 2R14A 2QUNA 1EZWA 4DBUA 5FF4A 1WOAA 2JKEA 3VE7A 3HM7A 5IXEA 2BB0A 4C91A 3PTQA 2QCDB 2VD9A 5E1QA 1O5XA 4TMBA 2V68A 3P93A 2J7HA 3VD3A 1HKVA 2DZBA 2WW5A 4IOTA 2OCZA 4W7WA 4DWSA 3B97A 4QRNA 5BXTA 1NOFA 3UXDA 5BYWA 4DWSD 1UWRA 2WZHA 1F3EA 4UFLA 1WE5A 3W7LA 2DJLA 1TE6A 4JCLA 4XX6A 5FA5A 2V63A 4NXKA 4ACZA 4YJ5A 3KFTA 4GVHA 4DELA 1GK8A 3IJQA 2I9EA 4AFYA 4AEEA 1SW3A 2CW6A 2QXWA 4M80A 1OVDA 4FIRA 4AXKA 3BQ5A 4QG8A 1NDWA 1TR1A 2I57A 3LU2A 1RA0A 3Q67A 3MZNA 5D8WA 2VOMA 1AH0A 2AAAA 5DELA 3V5OA 1R7OA 3WLKX 1H49A 5HA7A 1JF6A 1FTXA 1ZU8A 4MAZA 3QYSA 4C5ZA 3PFRA 5AHNA 1A3WA 1RBLA 4AD0A 3WDRA 1NJJA 2I56A 4FNQA 4PTVA 3M44A 2YDQA 3URQA 3WYZA 3KS6A 3OVQA 5HR7A 1EF3A 4JX4A 4IISA 2A6LA 3G1AA 5AB3A 1E0WA 2QJHA 4Q8PA 1VYSX 4DJFC 1X6LA 4KT2A 3RO8A 3NSNA 2YA0A 3FIGA 3BVJA 1OCNA 3I65A 3BDKA 1LL6A 5FF7A 3NL5A 1DJQA 2XN0A 2V2DA 1MXGA 1UWUA 3AOFA 4PMOA 1ICPA 1L6FA 3OOQA 1CNVA 4JDBA 2Z4GA 3SUSA 4DXVA 3VZYA 2GUBA 5HAOA 1DJWA 4H6QA 2HMCA 3OW1A 1OGSA 3L9CA 1PS9A 3D47A 1Z41A 5A6BD 4F9DA 2YBTA 3V18A 4C6NA 2BOGX 1JULA 4NSBA 1E9IA 1R7AA 1TSIA 3A47A 1UKSA 3QMRA 4MADA 4Y9AA 2HNHA 4JAWA 1IZJA 4C6FA 2QDDA 1XCXA 4DHGA 3AAMA 3UJEA 1LF1A 1ZBVA 3CIVA 3WQ5A 4MGGA 1BEUA 2JEQA 2O9TA 4KPLA 2PEVA 3T2QA 2G97A 5H2ZA 1TE1A 4FX8A 4GUIA 4BR1A 5I3HA 3LV6A 3A4AA 4LQ1A 2W0UA 3NURA 1KFLA 2WVVA 2ISDA 1QOXA 3CHCA 1OFPA 3P7YA 2RDTA 4JFVA 4LPCA 3S2LA 3MUAA 2YYTA 1BVZA 2XGBA 2AQVA 1EEPA 2PRMA 2XVLA 1QPQA 2EF9A 4PCSA 4ZVJA 1OFOA 2BODX 3UZ5A 2ZA3A 3P8IA 3W53A 1D9EA 1HZYA 3I68A 3FA3A 3RGTA 3WJZA 3BC9A 1B4KA 1ITQA 4Q8TA 1XYMA 3N18A 1O1ZA 3L4XA 2VGFA 4UQAA 4S3FA 3WLNA 1KCXA 2O0TA 1H7PA 3KRSA 2CFFA 2G3MA 4AH7A 4ZO6A 1KXHA 4US5A 1SW0A 3W74A 2Z25A 4ZQNA 2OZTA 3AS0A 4O19A 4PFHA 4UFMA 5ABFB 4KCVA 4W88A 4KWUA 1IYXA 2ASHA 4ZMGA 3N2TA 1WKYA 1OFBA 3E2RA 4CNNA 3NZPA 3WMBA 3WJSA 1LLZA 2FLIA 3QZEA 4AYGA 3CHEA 4XBSA 3BAYA 3MUCA 2RDUA 4GVFA 3M0MA 2DUXA 1W1YA 3VXGA 5BRBA 2PMQA 3RX4A 3C0JA 2GJNA 4LUSB 2X0HA 3CBWA 1BF2A 3DHUA 4JL1A 2D0FA 1GHSA 4QG9A 4HK5A 3U6WA 4LVBA 3QY7A 3W1LA 3GG7A 2PLMA 1RLDA 2DSKA 1V6UA 2D2GA 3S1XA 4P8UA 1WXJA 4UNIA 4Y90A 3OZMA 2Y8UA 2Y89A 2QZRA 3H24A 1UD3A 3S9ZA 4PCPA 4AMCA 2OYKA 1HVXA 3WNLA 4D6FA 1FXPA 3SFKA 1HP5A 1R5YA 1XH1A 3ENLA 2HEJA 3PY2A 4HD5A 2YCJA 1NF7A 4K6AA 5CQ1A 3UGRA 4Q4QA 4C6KA 3UYIA 2HE5A 3O1NA 5AECA 3EDFA 5G1YA 3G0XA 1XLFA 3BLIA 4J4KA 1ISWA 1JCMP 3UWWA 1SJAA 3ZIZA 1SW7A 2PF8A 5GJMA 3LRKA 4LB4A 1CB2A 2V5DA 3GXFA 4PRWA 3OHMB 4CEXC 2X8RA 4ADUA 4V15A 3W4RA 1JNEA 3OA5A 3W2KA 4CN4A 4DAIA 3B4UA 1KRBC 4GC3A 4O13A 4IP4A 3PZVA 3RCMA 2XIMA 3W1QA 2NX3A 1PSCA 1MW0A 1QTWA 1E9ZB 2PLCA 4JIPA 3VDCA 1PHQA 3RX3A 1NU5A 2QPXA 4CQ9A 3DIPA 4DF2A 3M0HA 2PCQA 3BGJA 3WUBA 1AJZA 2VJXA 1OD0A 4QJ3B 3LPGA 3WK3A 1EHAA 5K9DA 2J75A 4KFNA 1J0IA 2O9OA 2VCBA 3SEPA 1H2JA 4ACZB 4IMAA 4NAEA 4Y9NA 1F6PA 4UNKA 1ZP4A 2PDMA 2XH0A 4M29A 1J18A 1V7AA 3IJ9A 3NOEA 4S3CA 3OEXA 4QSHA 1P1XA 1FX6A 4N7QA 4DYEA 4DRSA 1BSLA 4FAMA 1CTNA 3AMDA 1GZGA 2VEGA 3AIUA 3ZXWA 1KR1A 3W28A 2NSOA 2ACUA 4NRSA 4AF0A 2E5CA 1H0IA 4C90A 2V3FA 4Q4SA 1JF5A 4TV6A 2VURA 3ZWTA 1B4EA 3ZJ6A 4PSRA 3NM1A 3R6IA 3SRFA 4BKNA 3LTYA 4RV8A 3F4NA 1RH9A 3WH7A 5F4WA 2FVLA 2VM8A 2X42A 3V75A 4NIRA 3W1NA 1DE6A 3DEQA 2R82A 4Z08A 4RKAA 3FY1A 1EJRC 2Z26A 3L12A 3NQFA 4KKXA 1T8XA 4ZFCA 3DCPA 3UZXA 2NXIA 2QCGA 5U4NA 3O8AA 1DBTA 2WMIB 2WXDM 1UKQA 1BHGA 3NPVA 4C6OA 2W66A 4C6LA 3VNDA 3P0XA 5CPQA 1XHGA 5T9BG 1I1XA 3LUTA 3LENA 3UR5A 3H2FA 1T40A 3ABSA 3CK5A 5CPNA 1JZ8A 3JZUA 4N6FA 3G1SA 2IQTA 4H19A 1ZNNA 2NUYA 3A22A 1Q8JA 3QGVA 3EWZA 3EPOA 3NL2A 2FPVA 3GDBA 4IPIA 4OBRA 5DCBA 5D05A 3ZS4A 4I7UA 3ABZA 5CGMA 3DYOA 4Z1YA 5K3VA 5D2WA 3QLLA 1DHPA 4JKLA 1Z44A 4IT1A 1K8YA 5D09A 2QUUA 1R9YA 1XIDA 4ZL1A 1WKDA 5L6UA 1AJ0A 4Z42C 4AZCB 3AHTA 2NX9A 3VD4A 1DV7A 2OKOA 1YQ2A 2GDQA 1F2JA 1SU5A 1UROA 4A3UA 4Q3MA 4G7EA 3GVVA 4PMRA 5AC4A 1DE5A 1H41A 3S4TA 4UTKA 3CMFA 3OQEA 3S5YA 2J77A 4QDPA 1QDSA 2XVPA 4M6VA 5BXPA 3WDJA 1ZQ5A 4QE4A 3GB6A 2E67A 3G22A 2G3FA 1W3LA 5FIPA 3FJNA 4F2UA 1M53A 3AROA 2NX1A 4AZBA 4KBXA 4C6DA 3ITOA 2Z1VA 3SUWA 1WB0A 1VJZA 3N4FA 1FFQA 3VA8A 5HJLA 4QJ4B 1JCYA 2XFRA 4AAJA 3CL8A 1TUFA 4LFYA 4INFA 3L0KA 4HK6A 2VNCA 3HBLA 2QULA 4C6PA 4OKDA 3G1HA 3MP3A 3W7QA 4UB9A 2ZRYA 5KZ6A 4EF9A 3IJ8A 4FR6A 3QMTA 5I03A 1MW1A 2DIJA 2HS6A 2IPFA 1V3JA 3HFYA 2VR2A 1TJ2A 4N02A 4PMQA 4IIEA 4D71A 2FJUB 3GU2A 3WO8A 4JPGA 1K1DA 4DZ5A 3KRZA 2BY1A 4R7OA 4YTRA 3EB2A 1BGGA 2ZRUA 1SMDA 2V9DA 3SJ3A 3R13A 4TIMA 3VNKA 1WBHA 5IM51 2D23A 3RXZA 4D8ZA 1R86A 1R3SA 3R0KA 1HKJA 2PRLA 3GE7A 1VLIA 1ZENA 1EA9C 4QG6A 4XIMA 1FDYA 4U5KA 2PC4A 5D37A 5DN1A 3RAOA 2QGYA 3IGSA 4US5D 4UZUA 2W4XA 1TJRA 4LVGA 1ZGDA 1DXFA 2CHRA 3R8HA 3LCXA 3ZLFA 3M64A 1PX8A 1B30A 4RPQA 3C56A 1V0NA 2RJHA 4HHHA 3SQMA 3AZSA 2VELA 3IJ7A 1E6QM 1HJWA 4IP5A 1MMFA 4EF8A 5LIKX 2X1IA 3MUZ1 4K38A 1I0BA 1K9FA 3K4AA 1JFHA 4CNTA 1FP9A 3MHFA 2ZXAA 2HISA 1PB0A 4GXMA 3DFPA 2D24A 1REQB 4LVFA 1JCLA 4Q4RA 1P43A 3AHYA 4ZE4A 2BY0A 2PZ0A 1N55A 1A3HA 5JBEA 4ZQPA 2BNJA 3W6LA 3AIWA 2PWFA 3BUVA 1V0KA 1HTIA 3LN3A 2OEKA 1N82A 3H2OA 5J8LA 4MY8A 1H4PA 4NI3A 4B3KA 1MVYA 1B3ZA 3W7JA 4DO4A 1OX4A 2OOGA 5D2YA 3P80A 1NDVA 4IWWA 1GVYA 4AZ7A 3GUWA 5LA2A 3R0DA 4Q8OA 4J40A 1Z89A 3CZKA 1EOKA 3EYPA 5I23A 1R38A 2V6AA 5E70A 4JHZA 3HG4A 4ZBCA 4AWSA 3VIKA 3LEPA 1EJSC 1Q7MA 4M1BA 3T9PA 2H8ZA 2NQHA 4IIDA 3TW9A 4HZMA 2EPOA 1VYRA 3EA1A 4CD5A 2CERA 3N13A 4LEQA 4E3TA 2HPIA 1W91A 1ZSXA 3EXRA 4I6VA 3PBYA 4FNTA 5H8UA 4CCEA 3IAPA 1IEIA 4US6A 1GYNA 1GPWA 3A3XA 4GWEA 2P53A 4O0KA 1PZ2A 1CX9A 1UA7A 1NQKA 5AHLA 3JU2A 3MSDA 1SO5A 2ZCGA 3N2OA 5FESA 1QR7A 3EX4A 5C9XA 5EYWA 4PB5A 1P6CA 3TW7A 2YL9A 2A3LA 3VMOA 2Y85A 1T99A 1W3NA 1J01A 5C2GA 1CXFA 1DWGM 2PZNA 4ENLA 3N14A 3TJLA 1EJ7L 3CWNA 1MW3A 1LG1A 4ECLA 5C5YA 1G94A 3ORWA 3KVKA 4LU0A 3LTSA 3UP8A 1JI1A 3KAOA 3BTNA 3GNRA 1BWLA 1FWDC 3PTMA 1Q3NA 4IZGA 1F6YA 3JVAA 4QE5A 1QNVA 3P8JA 4MMWA 2W91A 6PTDA 1OB0A 2BFGA 2FMNA 1ALDA 3LNPA 4O50A 3TONA 2H90A 3DG3A 5D03A 5HPCA 1DIOA 5AVHA 5G1MA 3EPNA 1ZS2A 3P60A 2WHKA 3UF9A 4GA8A 3R25A 1LWHA 2WJDA 1VAHA 2GGGA 2C0HA 5CZTA 3RPMA 1C8YA 4GMEA 3TZFA 4IUGA 3H7RA 3GTIA 4LXFA 3M0LA 4GQ0A 2WLZA 4FOKA 4UOJA 3ZSSA 3NG3A 3WLLA 3VAVA 3AMKA 1EIXA 3BARA 3W88A 2DQXA 2CEQA 3C2OA 4BWLC 3VINA 2Z2BA 4N0RA 4L9YA 4ZA0A 4H8NA 1XDJA 4MWAB 3GVWA 2X1TA 2Y6ZA 4QX4A 2E1WA 4K2SA 4XZWA 2OYMA 4PB3A 1EXPA 2CBIA 4OT7A 1X1OA 1QUMA 2CBJA 4UOQA 4F0KA 2GVEA 4B91A 3TVAA 3TV8A 5I3FA 3FKKA 5M5DA 4PMXA 5EFFA 1TPFA 3I4EA 1WDWA 5I79A 2ZXBA 1E9YB 1ESWA 1BTCA 2UZ9A 1UUQA 2XH4A 1EOMA 1V3HA 2QCFA 1V5XA 1A4MA 1FWHC 2OO6A 7REQB 1VF8A 1LT8A 1EC9A 1IV8A 2PWVA 3ZM8A 1Q6EA 2PDXA 3KDOA 1GTEA 4TV5A 1BYAA 1RAKA 1PTGA 3RPDA 2HVMA 1JYNA 7REQA 2YDSA 2WYSA 1R3WA 3W25A 4Q22A 3NSMA 2Z6IA 3VKJA 3XINA 1RCQA 3AIRA 3ZLHA 2ZDSA 4KWWA 1TJ1A 2EPKX 3KLLA 1KGXA 5LHEA 3FKRA 1YEYA 5HBFA 1K6WA 3C6CA 1SR0A 3WSUA 1W8GA 2DZWA 4V1YA 4N2YA 4P7LA 1UW9A 1ODZA 2OGYA 3UA4A 2CBUA 1L0PA 3HQOA 1B3WA 3F4WA 3SCTA 4KESA 4CN1A 1KRAC 1TYGA 3NQ2A 1SO3A 3H8AA 3EKZA 3CM4A 3VIGA 3PUGA 3CPUA 1JCJA 1XUZA 1I45A 2YPIA 2X1SA 2VXNA 2X05A 1U30A 1GQJA 3NQ8A 4U31A 3M0ZA 5CEWA 1MUWA 5ECUA 2EAWA 2GYIA 1P5BA 2B0MA 1K8ZA 5LNVA 2WBKA 1POKA 4LH8A 1RBOB 3FYOA 5DY2A 3FJ4A 1QOPA 3L5AA 4H04A 3UESA 4IL0A 4HOZA 1LRNA 2OQLA 4HHPA 4BFAA 2I1OA 4NKCA 2YL8A 4O1AA 4O0QA 2Q6ZA 4Q33A 1AVAA 2C13A 2IKIA 4C6BA 2C1GA 2CLKA 2WMKA 5FJIA 2WSYA 3ZLGA 5TNVA 1B3YA 1PTDA 3QLDA 2ZZ1A 1U1JA 1LDCA 3WDHA 4LTSA 1H1ZA 1K02A 4LF1A 3TU9A 3UR7A 2OZ8A 4LAZA 3N9KA 2PAJA 3L4UA 1LOQA 5ABHA 4C60A 3W2JA 3IARA 4EVZA 4LAMA 1O94A 1EJWC 3BXWA 3W73A 3T4CA 4YCPA 3L2IA 4L4PA 2XVNA 4GYKA 5C7HA 4XZHA 1YTDA 3M9YA 4BF5A 2AOSA 3A9IA 4GRSA 1T8QA 3ZSTA 2I5QA 3NQDA 1TUXA 4RNIA 3UT0A 4BQ3A 2YB4A 1DQUA 3M46A 2I9UA 3VOCA 1K4GA 2CKRA 1L6SA 3TSBA 2QLYA 2R6OA 3QV7A 1M7PA 1RXOB 4S3AA 2X1RA 3G1VA 2HV5A 4CNUA 3WFZA 1TJPA 5ABTA 1F6KA 1US2A 1LBMA 4HU0A 4QCEA 2D69A 1DTNA 2NV2A 3AUOA 1JUKA 5D38A 1H51A 4OHQA 1JZ6A 3DFSA 3E0FA 3BMWA 1IEVA 3R0UA 3CC1A 1PWMA 2Y5JA 4DF0A 3MHUA 3IGXA 4CEUC 1FHLA 3OZPA 3W7HA 3PP7A 4OUEA 1YPFA 4LUSA 5CSYA 4JEQA 4ZO8A 3W84A 3UCCA 4GQGA 3GNXA 4DYKA 3MMUA 5A94A 5F2MA 3T8LA 5CBJA 4M1RA 3MMDA 4JZ5A 1DP0A 2B4GA 2E09A 1UQZA 2YL6A 3C8NA 4Q8VA 2ZXQA 4S23A 1W5NA 1VYPX 5ABFA 2BGSA 4FIQA 4PTDA 4XO6A 1Q63A 4WY0A 4QDMA 3ARYA 4IFRA 3RRXA 3DX5A 4JTUA 1W0MA 3AFBA 1K7EA 2ZA2A 1TWZA 1WZLA 4KGJA 3RHGA 3TN6A 2VI0A 3N04A 4DO7A 3AI0A 3IANA 1ZRQA 4IFKB 4F0HA 5FSDC 3MA8A 1I2RA 1AQMA 4FSAA 3P81A 1AJ2A 3W85A 1NTHA 3A3HA 4K3ZA 1BXNA 3FOKA 5HWJA 2INEA 1UIPA 3YPIA 4Q4OA 4YYFA 2GSJA 3LHZA 5BRPA 1JFXA 3HPZA 1QHZA 3MYPA 1RSCA 1NH6A 4JQ1A 3CV2A 1KTBA 4J3XA 3OHIA 3W7MA 4PEKA 4AD5A 4J3ZA 1TPH1 5HATA 2O4QA 3CQIA 4D6CA 2QR6A 4ZSUA 3SIZA 2Z7KA 3N19B 5MHBA 1C8VA 3GFZA 3GSMA 2TPSA 3GTXA 3TZNA 1MZHA 2QHAA 2BASA 5EGRA 4JIHA 2V3EA 2W63A 3NR0A 1VBGA 4WQ6A 1RJRA 1ZAJA 3OG2A 3UXLA 2IKGA 2WKJA 5AYYA 1MI3A 4B90A 4W89A 2ZUSA 4L7ZA 2E9LA 3VILA 3W1RA 1AW5A 4H8HA 5AYZA 1AH3A 1RP8A 4I9TA 5J5DA 2G3JA 3FJLA 3NOYA 3CO8A 2V3GA 1U1HA 3IV3A 5C7VA 1QI2A 1KLYA 4BQ4A 1JZ3A 5CPMA 4X2PA 2XUCA 5M03A 1GVFA 2XDFA 4RE2A 1ADSA 4MB4A 4MWAD 4L4LA 3G24A 5HOSA 3W3OA 2Q71A 4DM1A 4QITA 3FAWA 3WQEA 5T26A 1XLEA 4XAGA 2J4GA 4AZCA 2RDXA 2CZFA 1L2QA 3IJLA 3AS1A 2Z7GA 4TVCA 4Q8NA 3RO6A 4UTWC 2GVYA 4FF7A 4KERA 1CGTA 3P84A 5JXQA 3OLIA 4HQVA 4QDWA 5HJXA 2X16A 4JNZA 1H09A 5G5IA 2GQ3A 3BW2A 4J5NA 1EP3A 1OT1A 5D4YA 3K8KA 2ABAA 5DMLA 1S3TC 5I02A 3NJ3A 3K8MA 3NFUA 2PA6A 1A5CA 3GY1A 2I5GA 3O0FA 3WCZA 4X9SA 4QNEA 2RH9A 3FEMA 1MXDA 1SJCA 2W92A 4L6HA 3WIJA 4HNUA 2DDXA 2C16A 3CIWA 3BLEA 3S2JA 2VC9A 3WNMA 3HMJG 1B3VA 4A2SA 4RL3A 1TPWA 3RPTA 3W7OA 2XN1A 4B5UA 2WNZA 2DJXA 2PDCA 4QLLA 1W3HA 3UW6A 5BWFA 3CMGA 1E6XM 4HTYA 4FALA 1Z7AA 3HZ3A 1ADOA 1UUOA 1A49A 4XD6A 3DFQA 4AD1A 3EZ4A 3W86A 5LKYA 4JD4A 4GKLA 1TV3A 2QUTA 2PU1A 3LMYA 1B90A 2REQA 1FH9A 2BSLA 1OX5A 1Q6CA 2B81A 2V82A 2YDRA 1UD5A 2XFWA 4R88A 4PGLA 4B2DA 3G8RA 1LBFA 3SGUA 5G4EA 1MUMA 1EHNA 2FJKA 1VEOA 3TN5A 1US0A 3R7MA 1C29A 1T96A 5AHIA 1VR6A 1QI3A 2PC8A 3TTEA 2CYGA 3NQAA 3IIZA 4KMQA 4GIEA 2NV9A 5G4WA 3SSZA 3LG3A 4AUBA 3NVDA 5I00A 3DUGA 1KBIA 3MMWA 5A6AA 2NVDA 3IUDA 2TRSA 2FTWA 5G2WA 1EO5A 3M0XA 1XBXA 1LOSA 1CYGA 1V51A 1JCNA 1TVNA 4FX6M 1EDQA 4GIAA 4D1IA 4Y7EA 5HULA 4E8GA 3SZ8A 1OEPA 1JPKA 2WC7A 1BQCA 3U2EA 4L9XA 3U7VA 1QBAA 2J62A 4LYKA 3AXHA 1KD0A 3OLGA 4N9CA 1RY0A 4D6JA 2C6QA 4M8UA 1XRVA 4W93A 4Z1AA 2WNWA 1ML1A 3O05A 3N1AA 4IQLA 4GYFA 3LGGA 1S38A 2VO5A 3HPFA 2QJIA 4WDUA 5BOOA 3RCNA 2BGNE 5HXMA 3MBDA 5TBOA 1QOQA 4P61A 3KX6A 5FF3A 2OR2A 3B8WA 1EQCA 3LRMA 3SI9A 3SCWA 1K9EA 1GZJA 3EA3A 1RBAA 1FFRA 4Q7IA 4XZIA 4LNYA 3F5KA 3BLPX 3R4IA 4GCAA 4PH6A 3V7PA 3ICJA 1FWFC 2VFDA 3BG5A 3SUVA 2O9PA 4BK9A 2WQPA 5HK4A 5CSRA 2ZZ7A 2GUYA 3WEOA 1HO1A 4LB3A 2FVMA 4RNHA 1OWQA 3WKZA 4GNVA 1AZ1A 3N11A 1EC7A 4KCTA 4BJHA 3L23A 1BGAA 3HF3A 3KVMA 2ISSA 3TAOA 1AG1O 3TFXA 1VZWA 4YPJA 1S1PA 1Q6DA 3NQCA 3TN3A 4ORMA 3AZRA 2BHYA 2F2KA 4AHPA 4GI6A 3GNPA 4WXZA 3VABA 3RN6A 4LYQA 1YDVA 1Y0EA 3AQUA 3LHVA 3V16A 3CAKA 3OBKA 2EBNA 3DFTA 3EA2A 3Q94A 3WBWA 4M6UA 2VD8A 4P8WA 3V35A 4JTFA 4IGNA 1FKXA 4O11A 2WVUA 4AXNA 4MZ1A 4R9XA 1AD1A 2V38A 3W23A 2P5NA 3KP0A 3DGBA 3MV01 1S2CA 2G4FA 1HW6A 1UJPA 3URBA 4JFTA 1IEXA 4GY7A 3PZIA 4B3ZA 1GVSA 1E3XA 3ZVHB 2HSAA 3UETA 2OEJA 4MWAE 3OVGA 1DXIA 4JFSA 1PTAA 1TV5A 3GX9A 4RW5A 3H2NA 4UIOA 5D9OA 4AC7C 2PB1A 3ITVA 1B5TA 1M7JA 3P2VA 3EWBX 3VIMA 1SMAA 2C79A 2QJGA 1TWSA 3FVDA 4Y9PA 1LZOA 3W6YA 4EWND 3WL1A 3BMXA 2VHLA 3ATZA 4H6EA 3H26A 4XKYB 5CJ5A 4PUKA 7ENLA 1IXOA 1V6VA 1M1BA 2PSNA 1AQHA 2CHNA 2ZWZA 1TZZA 2GGJA 3TA9A 1DWIM 4NZJA 3WMCA 4YVPA 3C3UA 4Q8QA 2GGHA 1TMQA 4F2BA 4E4FA 5SWUA 3EPMA 3QTGA 5DMYA 1KR0A 3KCOA 1QPKA 4R85A 3VE9A 3UY8A 3WD1A 1J0YA 4AWUA 1EJUC 1F3XA 1P7TA 3CQ0A 3F5JA 1F4HA 3G6LA 3U2ZA 7A3HA 1H0GA 1UR0A 3CHFA 3R5EA 1F5ZA 2WMGA 2P0OA 1FH7A 4MG4A 4AISA 3C2RA 2E6DA 3QC0A 4DLMA 3AJ7A 1A47A 2G37A 3O3RA 4DJEC 1PWLA 1JAKA 3O16A 3MUY1 2YJQA 4HU4A 3IV8A 1BYDA 3B9OA 1RPKA 2A5HA 1HIZA 3O0KA 3M0YA 2XYLA 1JQVA 1GCYA 1GTHA 4B5TA 1YNPA 3THAA 3HJEA 1XPGA 1BWKA 3CZGA 1REQA 2G8ZA 3QR3A 1TV8A 2IQ0A 4B5SA 3SAZA 1AH4A 2FGBA 1ICQA 1NM9A 3RG6A 1OHLA 2RFGA 1JZ2A 1U83A 1E70M 3B8VA 3PBGA 1YIXA 3VPLA 1E0VA 2Q01A 3N2BA 5CH9A 4A2RA 3TC6A 4U2ZA 3IIOA 5M17A 3T42A 4DB7A 1QPOA 2FZ9A 2J27A 4P8VA 3P67A 4O8RA 5FJTA 3VDGA 2R1LA 3UG4A 5C9RA 4GE8A 4PUWA 2ZX7A 3LDVA 3BOFA 3NO5A 3CT2A 3T2PA 4FS9A 1DQXA 1JRBA 4D6DA 4BI5A 3GO2A 3T0BA 3B04A 1Q65A 3R1ZA 3PS7A 5GQBA 1R2SA 2VCAA 3A64A 2DSUA 1SFSA 4EXBA 3ZJ7A 2W62A 4HZ6A 3WQ8A 3KHJA 5EMLA 1Y5VA 3SUUA 1FVPA 1IR2A 1I2PA 1OINA 1OJXA 1AW1A 4O17A 2JFEX 4XQ6A 1ZBKA 4DJEA 1DL3A 4H2HA 4FO4A 3T0TA 1VP5A 4W9TA 1KBJA 1TKKA 3HG5A 3GYEA 4ZR8A 3BICA 2VEPA 3U5YA 3P14A 4C5YA 3MT1A 2OMAA 3D46A 3TSDA 2NLIA 1LOLA 3CYVA 2O4MA 3K2GA 3U4FA 1ADDA 3GUGA 1ELSA 3C0SA 1UUMA 1V3KA 1FHVA 2IMRA 4NX5A 1FH8A 3HIJA 2FZMA 2FB2A 5EMJA 4JTCA 4D6EA 3SRHA 2J6VA 2H6RA 2CZEA 4UTLA 5I24A 4NASA 1S39A 3PK7A 4MZYA 3T05A 3W1MA 5M1TA 2Z29A 3H7VA 3HA1A 2VCCA 5D2XA 2VVSA 4KEVA 4QJ1A 3NO1A 1JI2A 4Z17A 3Q37A 3PUEA 1H7NA 3N9SA 2UV8G 6TIMA 3EDJA 1Q6LA 2HS8A 3C0LA 4BWLA 1W3KA 4H9MA 3VZXA 1OF6A 3UWUA 4MY9A 3N2XA 8XIMA 5LSMA 1AZ2A 4JXCA 5AVNA 2GJRA 3T2OA 1GHRA 1IXPA 4UR7A 3M0JA 1RR2A 1ZAHA 2Z1XA 4LCRA 3RM4A 2GQAA 1J96A 2PDHA 4JL2A 3WK1A 4GZ7A 2NQZA 2PCEA 4TTGA 1XYZA 1KXTA 4GCXA 1NOWA 1XWYA 3EX1A 3G5EA 2J47A 3KL5A 4HZ7A 3LM7A 4GIYA 3GG1A 4PTMA 5IBXA 5C2XA 3QY6A 3KBJA 1LJYA 1EPVA 3BWWA 4XVDA 1FDJA 3DYPA 1XIJA 4FA3A 4IXHA 2A7PA 1EIBA 1EDGA 4GI8A 3VGEA 1ISVA 4HA1A 4RE4A 3S9YA 2VL4A 3OVRA 3SCVA 3GDRA 4LAOA 1TMLA 3SRKA 2NT0A 2OX1A 1G4TA 1H5YA 3CUXA 3WQ6A 3O6DA 1OG0A 2A21A 2HCVA 1H11A 1QRQA 2DPEA 1D7FA 4DUVA 2WMJA 4IMEA 1RK6A 2B7QA 2E8YA 3GAYA 1GKRA 3HG2A 4F40A 2FH6A 1QNOA 1RY8A 3VKBA 3I6EA 2WO5A 3T44A 3WBAA 4AW7A 5ECVA 4UQCA 3I3EA 3AISA 4DM2A 1OIMA 4KWVA 4A29A 1DKWA 3QEZA 3N3MA 3WLPA 5CGTA 1PO9A 3T40A 3PR2A 2HJPA 1XFCA 4IICA 3B8TA 3O6AA 3TR2A 4CUCA 1W1VA 1IHIA 1Y5XA 2P1FA 3GK0A 1P4CA 1XPYA 3AMLA 4JN6A 2OSXA 2VMFA 4OGZA 1DIDA 4PTNA 4H6KA 2P8CA 1IWBA 2GVLA 2IXUA 3V3WA 4X2RA 2GZXA 4O1BA 3QKEA 4P5UA 4L4MA 4IUOA 4R5EA 1KFEA 1NELA 2E4TA 2HQAA 2EEXA 3RLVA 5XIMA 2J13A 1B2YA 3TOYA 4HMCA 4TTUA 1X98A 3UEQA 4GXWA 3UZYA 1TX2A 4UMBA 3WJWA 2HE8A 1W9XA 2I5IA 3F4CA 2ZFAA 1GVEA 4F0MA 2QIWA 3WQFA 7TAAA 3AS3A 4LYRA 2WVTA 4JTLA 2FPYA 8RUCA 4EIVA 5CPSA 3WJXA 1K9DA 1W8SA 3U8GA 5JH1A 2HTMA 1D8WA 1VFMA 2VDHA 3DXIA 1GG1A 1OBAA 2G96A 3KBVA 4KH2A 4AD4A 1JYXA 3N34A 4KEMA 3IUIA 1QI5A 2RKXA 2VEFA 3APTA 2FDSA 1J0KA 1UMLA 1EC8A 2XZ9A 4O4VA 3N29A 3EAUA 2NT1A 1JZ4A 1IGWA 2WJFA 4MVAA 2ZVIA 4O1EA 4C6IA 5CAHA 4C7DA 5C54A 4PL1A 4JKKA 2YKKA 1QBBA 3T09A 1XISA 2UY5A 1FBAA 2Y1HA 2F7FA 1O95A 3EKLA 4QEEA 4JIQA 2XJ7A 1CGXA 5EB8A 4WRHA 3LK6A 3BGGA 3W7PA 3A12A 1QPNA 4CNSA 1NDZA 4WSHA 2XN2A 5DRCA 1TWWA 4W8BA 2PFHA 4YXGA 3KUMA 1TMHA 1S5TA 4DVOA 4FOJA 2OYLA 5F1UA 2QKFA 1M7XA 3PWGA 1XF0A 1QNQA 5I3KA 4HNOA 4X22A 3D3FA 1QVBA 1XG3A 3ALGA 1XBVA 1JRCA 2QW5A 2J8TA 2DH3A 4MJ4A 1EPXA 2V30A 1A5OC 1DOSA 3MCOA 4ERAA 1XH2A 5I2UA 4J3SA 1IWAA 3KP1A 2GVGA 1U1UA 4JR5A 2RAGA 3GQYA 5A8MA 3WBEA 3THCA 4REQB 2D2HA 4RX0A 5AYXA 3AUJA 3R43A 3UWEA 3HV8A 1Q8AA 5HR6A 1UZDA 2NUWA 3ELFA 1A5NC 1FOBA 1KO0A 1BKSA 1JYVA 2HXTA 3LBCA 3A23A 3C8FA 5D9NA 2DSZA 5CC6A 2VZOA 2D0GA 1ZJIA 3CLMA 5FJOA 2REQB 2BGQA 4IXXA 3GIPA 4BI6A 3VNIA 3LCWA 4ERGA 1D3HA 3OP2A 4IFOA 4OWGA 2OODA 2QCMA 2YIHA 3QM3A 3EWXA 1KTCA 2YZ5A 4JIRA 8A3HA 3TC3A 5E6ZA 1XS2A 1A5MC 6CGTA 2EPNA 4IP7A 4JNMA 2H9AB 5K7JA 4DBSA 2WAGA 4IF2A 3WN6A 2VX4A 5E93A 1W2PA 2B7OA 2F6KA 1AODA 2WHJA 1I75A 4UZSA 2OQHA 2V5JA 1GPFA 3PSVA 4EANA 3QZAA 1A3XA 4JNYA 5JMUA 3W72A 4PE8A 2CCRA 1MYRA 2XH2A 3GVQA 4YU1A 2CBVA 1UR3M 1EB3A 3QZ6A 5AOUA 2VEIA 3CV1A 1E0UA 4ZOCA 3GTNA 1BTMA 4JIIX 3UNTA 5AC7A 2PE4A 1XL9A 5M2FX 2AQOA 1ZLPA 2PGEA 3GS6A 2Y4SA 3VNYA 4DJED 3NWRA 4ZB5A 2WM1A 1RK5A 1GNXA 4CD4A 3RJXA 3ZVIA 2F84A 1JUBA 2RDWA 4GJIA 3I4KA 4O15A 2IKJA 3ARRA 1US3A 4GPNA 4C1NA 1XC4A 1QW8A 1RPXA 2A0NA 1V3LA 3M5XA 1HQTA 3N2MA 4F66A 4LC8A 1L6WA 4H8VA 2OB3A 3GD6A 4JKMA 4FF5A 1QFEA 2BXZA 3VMPA 4IMCA 4UQ9A 2CLOA 3P74A 3M0IA 2KX9A 1OFEA 1WUEA 3WLQA 3MO7A 5KTLA 5I0DA 1B0IA 1AL7A 4Z1BA 1BRLA 1HL9A 2E1DA 1Z42A 2J78A 4CVUA 3LHTA 3EDDA 4G1KA 1FHDA 2WM0A 1QU4A 5F2GA 5K9CA 3PANA 1I2OA 3TH6A 1XH0A 4RK8A 1RJQA 2PP0A 3W2NA 4ICCX 1TA3B 5A6TC 3VNJA 4NHVA 3PAOA 4LW7A 3KBWA 1JGMA 5EBUA 5HMFA 1Y5WA 1KXVA 4MB5A 1SZFA 3TQPA 3VO0A 3H7UA 3ARUA 2JE8A 3T0AA 4OOUA 3BV7A 3W22A 1IXQA 4O14A 3DG7A 3CZJA 4Q32A 4Z0JA 3LV5A 1UD8A 3NQEA 2DH2A 3PB2A 4JTQA 2NWSA 2E25A 5I09A 4MUZA 2ZZ3A 2WPBA 1V79A 4F3HA 1OZQA 1LLOA 3HPSA 1LBLA 3UJFA 2J6XA 5CC5A 2O56A 2OGJA 1H50A 2XGIA 1MQQA 1J6OA 1YMYA 4JTHA 4N4QA 3SY5A 2DGAA 3LM3A 3TYEA 3NZRA 1JXJA 1SZNA 5HNTA 1XRFA 4AD3A 4LBUA 1P0KA 1MEIA 2ZE0A 1V93A 1FWTA 3CQJA 2R1NA 2QEZA 5IHSA 1H60A 3ARPA 3W76A 1R3YA 2BHZA 4GNKB 3G18A 5FF0A 5REQB 3NQVA 3KZSA 1E56A 1WDRA 1LLWA 1I8JA 3C2YA 2J9ZA 3ANYA 1ONXA 4GBUA 3E2QA 9XIAA 5F4SA 4NZFA 6TAAA 2YLAA 2OPJA 4NU7A 3FGCB 4IX2A 4ROQA 1H5VA 4WK9A 3MVIA 1C91A 1ZB5A 4HK7A 5CLTA 3UR2A 4JTKA 1Q2RA 4X0VA 1PVNA 5BNKA 3C5QA 3GVRA 3GU1A 3RM8A 3LPPA 1EH9A 4WGHA 3BAKA 3ZR5A 1ODUA 1R3VA 4WZHA 3WLHA 1N8IA 3FA5A 2OXNA 4FNSA 4J3VA 4AVFA 4PMVA 2I17A 3PZMA 5GNZA 3LRLA 4RDZA 1MQRA 3BCFA 3IIPA 1B1YA 2Z1WA 1W5QA 1XM3A 3UJSA 3PNZA 3RYSA 3RU6A 2NQ5A 2CXGA 2Z0IA 1HL2A 2VR4A 1JL8A 4XZBA 4HNLA 3R58A 3UR8A 4ZTYA 3SURA 3SUTA 3PUOA 4R34A 3B03A 4FLOA 1BFNA 1ZBWA 5C8BB 4WEVX 4JTGA 3OLEA 1BG4A 1XQLA 1UH2A 2IW0A 1C7SA 1P0EA 3U3HA 1K8CA 3W7DA 5C0QA 1ZCOA 1O6IA 3PPHA 3F2CA 4HPNA 1O4UA 4A3RA 4DJFD 1DVJA 4HTBA 4W7UA 2E9BA 3S1VA 1KV5A 3CZ8A 3VOHA 1R9XA 4HZ8A 4I7VA 4L6OA 1LP6A 1XLAA 4RDVA 1R8LA 2J24A 5A6KA 3MVTA 3ITCA 3VC6A 2FHFA 3BK0A 3BSMA 1FWCC 5IRPA 3NDYA 5F7UA 4AVOA 1X39A 3MKCA 3GTFA 2J9XA 1VCVA 4WY0F 2OTDA 4PCTA 3G77A 4IQDA 4PMNA 1EYWA 6ALDA 4PMJA 5BXRA 1LUCA 4YWSA 3CAQA 4QM1A 3WEMA 4JTDA 5EMYA 1E72M 3B8IA 3O6YX 1XJBA 4H7ZA 4O1CA 4L9ZA 3P61A 4PTWA 1F3TA 1S5MA 3VCNA 4CD7A 1X6UA 2YCEA 5A8QA 4IQJA 2JQXA 5I3GA 1OGGA 4RW3A 3WLJA 3B05A 4HYVA 1V6XA 2A85A 3EEZA 2IS7A 1G7VA 4LGXA 4ICMA 1M6JA 2ABBA 1TV7A 2PDBA 1L6YA 2X2YA 4DN1A 3BLOA 2QVNA 2Y88A 1QHPA 1QATA 4S3KA 1ITUA 5FL0A 4XO7A 5AHMA 3VDAA 1LCOA 4A8LA 3PPGA 4OOZA 1C7TA 2PPGA 4ATDA 3WF2A 6XIAA 1IIGA 4Q4KA 4OBTA 1R47A 3R8RA 1S2AA 2ONEA 1XSKA 3EOLA 2Y7EA 2ESCA 1PPIA 1VBRA 3SGGA 4I5XA 3KE0A 1X7IA 1ONRA 3AC0A 3NQ7A 4LV4A 2JKAA 1IEQA 1EP2A 4WF7A 4MTVA 1C3FA 1HJSA 4UTIA 3QHMA 1V77A 4X60A 3BE7A 4MIMA 1R9ZA 4MFEA 1ME8A 3GNDA 2VFGA 3TNBA 2XHYA 3PWAA 3FYYA 2XM1A 1DHKA 1EGVA 1EF2A 3QOMA 3SN4A 2EJAA 2PLKA 2ATMA 3L4TA 3M7SA 5EL1A 5D04C 3K1DA 2QUMA 4AY1A 2PWHA 2E68A 4Y9MA 4K7VA 2DVTA 4Q6XA 1GGOA 2VQUA 3SECA 1K7FA 2QDGA 5DMMA 2FZ8A 2WZTA 1XG4A 2P76A 4LVAA 4GXPA 1RALA 1YE4A 4B5XA 1KM4A 3KOWA 1IZKA 3LCGA 2WBGA 3HN3A 2DT2A 4I5RA 2FIQA 1RA5A 5BRQA 4R7WA 2BVYA 1KWGA 3LLFA 4OVXA 1E40A 4B92A 4JIEA 4YS1A 4CCDA 4RXGA 1LQ2A 2BDQA 2PU0A 5TIMA 3AXIA 3LGEA 4OUIA 3RJYA 3LERA 3XIMA 3G1XA 2ZZ4A 2ZX6A 3PBWA 4ICNA 2DVUA 2ZKMX 3LZ3A 3ZR4A 1TZ7A 1I2QA 4PUJA 1H7RA 1KXQA 4Z2IA 2CETA 2X1UA 4JYEA 1TTIA 2XZ7A 4JICA 4XUGA 4CU7A 1W1PA 4UCFA 4QBXA 1BLIA 4R27A 1UJQA 1G7UA 3TLQA 3KL3A 1UPMB 3CTTA 2QGHA 1JXKA 3IPWA 2ZIDA 4W87A 3G2GA 1UR4A 4LOCA 4M51A 1JYWA 3V5CA 3ALFA 1RV8A 2BVDA 1LYXA 4HPGA 2QDHA 4AWEA 4O1DA 5I77A 1E5JA 1ENUA 2YBUA 5KITA 3PWIA 5H91A 2QJNA 5F1VA 1FY6A 5ENLA 3WNOA 2WV8A 4O54A 5U7SA 3H2EA 1EX5A 3BANA 2XSXA 2D22A 5G2IA 1LTDA 1F05A 5CSSA 3M5VA 1OK4A 1W1A1 4O18A 1UR8A 4JTIA 2B7NA 2EO7A 3K5XA 5LA0A 1HGYA 3E0LA 4AZGA 4B16A 1S2UA 2GWGA 1HL8A 2Z27A 4URIA 2ZE3A 1JD7A 3FAXA 2V81A 1YYAA 2GL5A 4Q8MA 3ES8A 4J27A 1UH3A 4ZQRA 1ZP3A 4HVXA 4FZIA 3W38A 3GXIA 4FOUA 2ZQ0A 3S6DA 1GOOA 7CGTA 3NZQA 2P8BA 5BWAA 1XSJA 4P2VA 4XAYA 4M6PA 3URAA 2YGYA 5FAJA 5GNYA 1B9BA 2D1ZA 4LVDA 1UWQA 3LHYA 2Z2AA 3CEPA 1YXDA 4RE0A 1LWIA 1H3GA 4I9AA 1FCQA 2PTZA 9RUBA 4I8YA 2UWFA 2QF8A 3WLSA 4AWTA 4S3EA 3S3GA 1EX1A 4PUUA 1G9HA 5TF0A 3HPAA 1CI1A 3WUEA 4DEFA 4PCFA 2WNNA 4MDPA 4WD0A 2OQYA 5PTDA 3U2OA 1W1ZA 2WVSA 3VTRA 2D20A 3H6OA 1VQTA 3PPCA 1MDLA 3T0DA 3R89A 3UG5A 3VGHA 3PNUA 1N2VA 3GR7A 2FB3A 2HVOA 4NZ4A 3K1GA 2FTPA 4HCLA 5DO8A 3AYSA 2PWDA 2D3LA 1KFKA 1RHCA 3UZWA 3H4WA 5H6HA 2R8WA 2VKZG 4OV9A 4NYYA 3UNDA 5CKSA 5C6MA 2VDIA 2GGIA 4J3WA 4H9UA 2GJXB 1JAEA 1KM5A 4WCJA 4LYPA 3WMLA 3CQHA 2RUSA 3G3DA 2VP8A 2W9MA 5FI8A 1EL3A 4EP8C 3OG3A 3D6NA 1PEZA 4WUIA 2WC3A 3WQDA 3AXKA 3PZGA 4S39A 3DHFA 1TVPA 3LA4A 3TWAA 1E6ZA 4JDYA 3BJSA 1CLVA 4AMAA 2VC6A 1TZ9A 3BLFA 4GYPC 3OB8A 3GR4A 2QCNA 2WMFA 2ZRXA 3LPOA 3V1PA 4XV0A 3MJYA 1JR1A 1G4PA 1XIHA 5DXXA 2P3EA 2QCCA 4YHEA 4AHOA 2JF6A 4Z2GA 3RLHA 5E0FA 3GNNA 3L65A 2XWDA 2VX7A 3CPRA 3MUXA 4C6JA 2I14A 5JIWA 4AIEA 2BXYA 1X8CA 3M43A 3RNDA 1P7TB 4PULA 4QEHA 3DFNA 2WJZA 3NXFA 4ZOBA 4S3BA 2XTKA 3WELA 1V7YA 1VENA 3LHUA 4LWWA 1NFBA 1UB3A 4AY8A 3AU6A 1YNQA 1XP3A 2HNEA 5AYBA 1POJA 2VEMA 2AMXA 4WJ8A 3QSTA 5A6JA 4JN7A 1OIFA 1OY0A 4IPLA 3B0UX 1XINA 1RJPA 5D9PA 3K4WA 2YX0A 3W2UA 2O9RA 2BY3A 4JY8A 2EPLX 4QSFA 1CGUA 1MNSA 4I3GA 4LUJA 1JGIA 4JTEA 4KIRA 2DQWA 2EG7A 1R30A 3TSMA 4TR9A 3H55A 3DBPA 3PJWA 3ZVHA 5DCEA 2DIEA 1TX0A 1AA1B 3QV8A 4LAUA 1P0DA 1HKMA 2Y0FA 3E5PA 3A13A 2CU0A 4HSHA 3E9AA 2MNRA 5LHFA 4KW2A 3ZJKA 1OK6A 1VFHA 4LUTA 4JCMA 4M81A 3N73A 3N12A 3APGA 4LUYA 2DUZA 3N25A 1CIUA 4BEQA 5A2AA 4NZ5A 2KAUC 1B31A 3VKCA 3N9RA 1XCWA 1DORA 3GR8A 2J8FA 4HA0A 3E2VA 5FD0A 3UJ2A 3GIYA 3PF3A 1A5UA 4WGXA 4E5TA 2UY3A 1CXIA 1F4AA 1M5WA 4HKPA 4CCCA 5HUPA 1XDLA 1UCWA 1PZ1A 2GQ9A 1GVQA 1RQHA 2BP1A 4MJZA 4V1XA 4U3CA 3TYZA 4GY1A 3TQVA 4PUEA 2BVWA 1TTPA 1IT0A 4NUWA 3OODA 4E2OA 2AGTA 2V0TA 4L5ZA 1GYMA 4PMYA 2C14A 1FWSA 2Y70A 3FEQA 4Q6JA 4IMFA 2EPMX 4AD2A 3OO2A 1Q13A 3UY7A 3RFAA 3TA6A 3BQ6A 4M7SA 2PLJA 1AQ0A 1A53A 3HB9A 5HDRA 3M0KA 1MFUA 3H53A 3AU2A 3SRDA 3LI1A 3NUKA 4JX6A 3NAVA 3FW6A 4JEJA 2P0IA 4DAFA 3CEUA 3VYLA 2QJMA 3WH5A 2PGRA 1PKMA 1IQ8A 1KM3A 2INZA 1SZGA 1V02A 1J10A 1WAUA 4G7EB 2C71A 1PX3A 4QQ3A 5EKYA 2Y8KA 3DHDA 2H8XA 4A8NA 3K30A 2YYUA 4WX2A 4NJIA 3U7BA 1UD4A 5DXYA