2PD5A

Human aldose reductase mutant v47i complexed with zopolrestat
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
315
structure length
315
Chain Sequence
ASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHIYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title Merging the binding sites of aldose and aldehyde reductase for detection of inhibitor selectivity-determining features.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 106
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2007-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2pd5A00
3DN5A 3LQGA 5KETA 1IEIA 4XO7A 1JEZA 1MRQA 4JQAA 2PDQA 3COTA 2IQDA 2WZTA 3KRBA 2FZBA 4PUUA 1UR3M 1RY8A 4PR4A 3CASA 5LIUX 4LB3A 1QRQA 4L1WA 4JTDA 1AH0A 2C91A 3V0SA 2IPWA 4LB4A 3C3UA 4WDWA 1YNPA 4DBSA 3M0IA 4ICCX 2FVLA 1LWIA 5DANA 4QX4A 1PZ1A 2PDWA 2ACQA 5LIKX 2WZMA 5HA7A 1PWMA 2INZA 3UZXA 1QWKA 4PUWA 2DUXA 2IKHA 3LZ3A 4HBKA 1US0A 1Z89A 3FX4A 3LEPA 4G5DA 3R94A 4R9OA 1S1RA 4IGSA 4DBUA 2PDJA 5LIWX 3BURA 3CV7A 1X96A 3UZYA 1RALA 4ASTA 1C9WA 3UG8A 2DV0A 4GCAA 1YE4A 2F38A 1ZGDA 4XVDA 4WRHA 3UZWA 2P5NA 1S2CA 4GQ0A 4LAUA 2BGSA 4HMNA 1GVEA 2PEVA 2NVDA 3G5EA 3CAQA 3WCZA 3ERPA 3N6QA 4XZHA 4JTAA 1VP5A 1PYFA 3UZZA 3NTYA 2ALRA 4PRRA 3H7RA 4JQ2A 3LENA 1S2AA 3UFYA 4LAZA 4JIIX 3CAVA 2R9RA 5M2FX 4I5XA 1HQTA 2PDPA 3N2TA 3R6IA 3BUVA 2PDXA 4LBSA 4GABA 4JQ4A 2PDHA 2AGTA 2PDKA 1YE6A 3DOPA 5JH2A 3R7MA 2PZNA 4IJRA 1IHIA 1XF0A 5HNTA 3WBWA 1FRBA 3Q67A 4XZIA 4JIRA 2PF8A 4GACA 1ZQ5A 2CLPA 1MI3A 1J96A 2PDLA 4WEVX 4WDXA 2R24A 4RPQA 2PDGA 3MB9A 2F2KA 4IJCA 3V35A 4XZNX 3P2VA 4YS1A 4MHBA 3LN3A 3LBOA 3ONBA 3EAUA 3R58A 2NVCA 1XJBA 5JH1A 3GHTA 4YVPA 1MZRA 4JTQA 2IPJA 4Q7BA 4XVEA 2HV5A 4FALA 4YVVA 4DBWA 3B3DA 3LNMA 3MC5A 3H7UA 4OTKA 2PDNA 3VXGA 2IQ0A 1ADSA 3EB4A 4L1XA 4PRTA 2FGBA 1PWLA 1K8CA 2BGQA 2HVNA 1M9HA 1EXBA 4XK2A 3R43A 1EKOA 4NKCA 1AH3A 1XGDA 3BV7A 4JIHA 3U2CA 1A80A 1Q13A 4H8NA 1OG6A 2IPGA 1ZSXA 4XAPA 2HEJA 1HW6A 3LQLA 3F7JA 2PDFA 2ISFA 4XZLX 1AFSA 1X97A 5AZ1A 2ACRA 4H7CA 1PZ0A 4GA8A 4XO6A 3WBXA 4QXIA 2A79A 2PD5A 4Q3MA 3LD5A 1Q5MA 2IKGA 2PDUA 3QKZA 3T42A 3M4HA 5HNUA 3GHRA 2PDBA 4LBRA 1Z8AA 2VDGA 2PFHA 3R8GA 3GHSA 1VBJA 2IPFA 3D3FA 3GHUA 2FZ9A 3UGRA 2FZDA 4JQ1A 4QR6A 2I16A 3ONCA 2PDYA 3UWEA 4AUBA 4EXBA 1S1PA 2ACSA 3O0KA 1RY0A 4GQGA 3RX4A 2INEA 1YNQA 4YU1A 2IKIA 4ZFCA 1T41A 2QXWA 3RX3A 2I17A 1LQAA 3FJNA 4PMJA 2PDCA 1AH4A 4JTCA 5AZ0A 4GIEA 2J8TA 2HVOA 4EXAA 3LUTA 2PD9A 5LIXX 3V36A 1T40A 1EF3A 4FAMA 2ACUA 5C7HA 3WG6A 2IKJA 4FA3A 3GUGA 3V0TA 2DUZA 4WDTA 4JTRA 3H4GA 4FZIA 5LIYX 3UYIA 1AZ2A 1Z9AA 4JQ3A 1AZ1A 2PDMA 3UP8A 3RX2A 1EL3A 4WGHA 2BP1A 2HE5A 3Q65A 4QBXA 3M64A 4F40A 4XZMX 2IS7A 3S3GA 4YVXA 2PDIA 1SM9A 4DZ5A 3WBYA 3V0UA 3CMFA 1R38A 2HDJA 3EB3A 3LZ5A 3CV6A 3R8HA 3G1RA 2FZ8A 4WDUA 3O3RA 3BCJA 1Z3NA 1X98A 2HE8A 1ZUAX
chains in the Genus database with same CATH superfamily
3S1VA 1QPOA 2QPSA 5GVJA 4L6OA 3BMXA 3BSMA 3I4EA 1O95A 4QDMA 1I75A 2YBTA 2OOGA 1GYNA 4NRRA 2VJXA 2OWCA 1TTPA 4L1WA 2NT0A 5IDZA 3QF0A 1DQWA 1MXGA 3TC3A 2UBPC 3TV8A 3LPOA 2VWTA 1UHVA 3W6YA 2DH2A 2BOEX 3MP4A 4A2SA 2ZWZA 4GXMA 4QX4A 3B9NA 3OODA 1RR2A 1ZJBA 2YCEA 3FVDA 1NEYA 2GOKA 4G7EB 2QF7A 5E9AA 4PUWA 4HA4A 4OZOA 3DBPA 3DYPA 1R9ZA 3HQNA 5I0DA 3B06A 2PLMA 3VCCA 4GLEA 3T08A 3AOFA 4G5DA 1M68A 4DI8A 3IANA 1XG3A 1IWAA 3L2LA 2RFGA 2X1IA 3TK7A 5T8GA 2EF9A 2QVNA 4Z08A 1TTIA 3RILA 1S2WA 1X8CA 2OQHA 3UZWA 1RCOB 1X6UA 2P5NA 3FIGA 1S2CA 2I14A 2X0YA 3AYTA 1D2KA 1R2RA 4M51A 2XN0A 3UZJA 2NVDA 3BAKA 1OBAA 4B4FA 3K5XA 3AJXA 2QAFA 3CH9A 1ICSA 1F8MA 2W6RA 2YDSA 4IJBA 1JZ2A 1VP5A 3FAXA 3N04A 4TV6A 1MVYA 2RKXA 1XD1A 1GOWA 3TQ0A 3NTYA 4UFMA 4G2DA 3S5ZA 2PLKA 4HB7A 1OFRA 3VFCA 3F4NA 3OO2A 3QV9A 3TWBA 3BW4A 4LEFA 1Q6LA 1HGWA 4HIBA 2VZVA 4Z2GA 4JFVA 1JCXA 2Z2BA 3V5OA 5TAOA 2Y7GA 4O13A 1DWFM 2VRQA 3GTNA 3E2QA 2PDPA 5TNVA 3P82A 1I1XA 4D1IA 1TV5A 3AJ7A 3KHJA 1XQLA 3W86A 4XAYA 1IHIA 5T9BG 3UJFA 4TTGA 3SFKA 3WBWA 3M0ZA 3SDOA 2P3EA 1E0XA 3PZQA 3AZRA 7REQA 3EOOA 4UZSA 1G69A 1VKFA 3T1GA 3AHYA 1DHKA 1QJWA 3RG6A 3GS6A 1KFLA 2NVAA 3P2VA 3V5FA 1K03A 3TR9A 3TFCA 5G4HC 2G4FA 4YCPA 3MV01 5CPMA 3TN4A 1UR8A 4MNLA 3QZ6A 4AQLA 4YHGA 2OZTA 5LA0A 4YTRA 2D2JA 4YVPA 4BR1A 1REQB 2A1YA 4QE1A 3EWUA 2GK1A 4X2PA 3PZTA 2VGBA 4WQ6A 1GW9A 5EYWA 3MC5A 4NJGA 2FMNA 2PP1A 2GGHA 4EP8C 3VNJA 4LUYA 3MHGA 3NDZA 4L1XA 3NOYA 2CLIA 4M29A 3E2SA 4JEQA 1L8PA 4L7ZA 3MI6A 3V1HA 5AB3A 2V30A 3ZO9A 1FP8A 4IG2A 1JAKA 1EKOA 1SW7A 1H51A 3WQOA 5KZEA 4N2YA 4ML4A 1QUMA 4Y8EA 4XAPA 1F5ZA 1UZHA 3O05A 3WY1A 4LY4A 2Z2UA 1I1WA 1M03A 1F6YA 3THUA 2DH3A 4EF8A 3G6MA 4RLIA 3EOUA 1P43A 3ATZA 2C8NA 3KL0A 3GDRA 3UWYA 1WX0A 3OG3A 4DVOA 3B9DA 4Z1YA 4PN2A 1OJXA 5HMFA 1NFBA 3BLPX 3MDWA 3ARUA 4UMBA 1H7RA 3UGRA 4HOZA 1BWVA 4IIGA 4M6VA 4ZQNA 3ZSTA 1YDOA 1S1PA 3G1SA 4HZ7A 3WQVA 1S39A 2IW0A 2VZOA 2PC8A 3AI0A 4LAKA 1X39A 1E3XA 3W02A 1UWUA 4JTGA 3W74A 4QM1A 4B2DA 2ZUMA 3BZGA 4RW5A 4UQCA 3HB9A 1TSIA 5AZ0A 3QV6A 3MKCA 3PVFA 3V75A 2VMFA 2JGQA 1ZJHA 3SJNA 4EXAA 1GZJA 2NLYA 2Z4GA 3W00A 1M5WA 5F1UA 4R9XA 2JKEA 3SSJA 4HNVA 4AWTA 2FPTA 1DE6A 4JFTA 2JBMA 1G4PA 3KTCA 4QLJA 4D8LA 3G3MA 4QISA 1DTUA 3CUXA 5A6BD 5A5WA 1R3RA 1Q6GA 1XDLA 2W9MA 2WSPA 4I7VA 1FWAC 3WQGA 5ABFA 1UKQA 1XIFA 4XZMX 1BVNP 1IEQA 4IPNB 4U2YA 2ZRUA 2PDIA 2QCGA 3CMFA 3AISA 4DJED 1Z6KA 3VM7A 5K4ZA 3UG4A 3LZ5A 2GSJA 4PB4A 1YRRA 2OELA 2D0FA 1X98A 2J78A 2PCEA 2R91A 3BL3A 3DN5A 3CL8A 3CHDA 2ABBA 3CL7A 4WOZA 1QASA 4EF9A 2OYKA 2O7SA 2YBVA 3TYUA 5D30A 3GNOA 3GXNA 5K7JA 4C6KA 2VVSA 3W1RA 3EB2A 3BC9A 3NSMA 4BFAA 3KVLA 5I3JA 1CZ1A 4MTVA 4PEEA 3WZ0E 1CGXA 2X09A 3CO8A 3QHNA 4NAEA 2H3BA 3I65A 4J4KA 4UTLA 4IL0A 5DN1A 3MCOA 3M0IA 2FVLA 2QS8A 3NPWA 4ZO8A 3W2MA 2WJFA 3DDMA 2PWHA 4AD3A 1JDDA 3R10A 4PUMA 3HURA 4O8RA 2G3FA 4F48A 3N1AA 1FFRA 2OSXA 1TG7A 3LK6A 3NEVA 2I7GA 4YLWA 4GC4A 3HQPA 1JYXA 5M3WA 4C6PA 3LEPA 3KWXA 4AY7A 4LVBA 2CKSA 4QFUA 4BF5A 4XISA 2NQ5A 5KITA 1W5NA 2V38A 2WHLA 5JBEA 3VOIA 3WNKA 3W7NA 3VNYA 5CPNA 1UW9A 1SGJA 1NFGA 1GNXA 3AFBA 1MEWA 3CC1A 3L9CA 4YXGA 2DZVA 1V79A 4ALDA 1LG2A 3TSMA 4IQLA 1MSSA 1LRTA 5BCAA 2OFJA 4O16A 5D04C 3NXLA 1EFZA 3NQ7A 3KP0A 2FZMA 3ZSSA 4L65A 1UKSA 4XAZA 3W29A 5CJ5A 3U8GA 4CD8A 4MM1A 3WQEA 3KOYA 3S0CA 1FDZA 4DWSA 1XLDA 2TSYA 3M0HA 2GVEA 5U7SA 2AMXA 3HOJA 2ICSA 4BJHA 1C90A 3W1QA 3ARZA 3PPHA 5U4NA 1W9XA 4B5SA 2WNNA 1UIOA 1WXZA 2RJHA 2V2HA 1XIBA 5IBXC 1HG3A 1AJZA 7XIMA 3NQMA 2OMAA 3EA2A 1XSKA 4GABA 1J9YA 5JU6A 1FWWA 5HMSA 2VOTA 3N2CA 3CHFA 2XZ7A 2VEKA 2YW3A 5G1YA 3S6DA 1A3WA 4GNJA 1H4PA 3S46A 3WD4A 1IWPA 4HNNA 1G0CA 4JTIA 2B81A 1NF7A 5IRPA 2VM8A 2ZXAA 3M7WA 1KCXA 3KDOA 1VFMA 2JALA 1UD8A 3AXMA 1GWJA 3MMTA 3WDPP 4DPPA 3FHAA 3TYDA 3CIVA 4M80A 5BMXA 1VJIA 1TO3A 3AHTA 4RNJA 3IGUA 2ZUNA 3VAVA 3VGDA 3FNDA 3W2NA 3KL5A 5FOOA 1B3VA 2O7QA 3ECQA 2B7OA 4MLJA 4UFJA 4UTTC 3NVDA 4GI8A 4QGCA 3NQAA 1MQQA 4A35A 3RLHA 4KQNA 3VNIA 4Q8QA 1RK5A 2WCSA 3CPRA 3NG3A 4H3DA 3FK4A 3VABA 1QTWA 3FA3A 5HOSA 4UTIA 2GJXB 4K1WA 4WF7A 2RH9A 2E09A 2A5HA 3KZSA 4KRZA 1QNRA 1XGDA 5L9FA 1A80A 2EJ1A 1W1YA 3LHYA 1KKOA 1HW6A 4O0KA 3DC8A 1W9UA 3F7JA 3OVGA 5AHMA 3DECA 3VNZA 4XSMA 1RH9A 3ITVA 3KW3A 3PN8A 3PZUA 1W54A 4CN1A 3PM6A 2XUCA 3LTYA 1JFXA 4L6DA 1TV2A 1V08A 2ZZ2A 4QG6A 1I2NA 4J35A 5M5DA 4FS9A 2Y5EA 3PTQA 1E1FA 4O11A 3SCRA 3QMRA 3TFXA 3O6YX 4D9PA 1K9TA 3QW4B 4JQ1A 3PJWA 1DIOA 2CHOA 2ACSA 3O0KA 1RY0A 3RX4A 4LNYA 4YU1A 2BZNA 3KHDA 1HGYA 3CL6A 3SADA 1ZJAA 1VFHA 3RX3A 3TONA 1BKHA 3WBAA 4B5XA 4E4FA 3HGOA 5CG0A 3T9PA 1Q6DA 2WBGA 1QW7A 3GX9A 1MEHA 2LLEA 4FNPA 2OT1A 4D6DA 1NP0A 4CD7A 2CLFA 1GUVA 4C6IA 3IK2A 3KOFA 4Z1BA 2YFNA 2VEGA 2PBGA 4GIRA 3V0TA 1XH0A 1JDEA 1SPQA 4JTRA 3CV2A 4QRNA 2P76A 1HP4A 1YPIA 3T7VA 2Z00A 1PVNA 4Q8OA 4JQ3A 1OM0A 1GHSA 2Q3OA 1TUXA 2E25A 3WELA 1QHPA 3NQVA 2E9BA 2FHFA 2DZWA 1U22A 4OGZA 2BP1A 1XWYA 3GD6A 3ZT5A 4AEFA 5FJRA 1ZPTA 3SI9A 2CLMA 2XIBA 4DZ5A 1GPFA 4S3JA 5F2GA 2Z6JA 1FHVA 1JD9A 5BXSA 1TPH1 2GDVA 2FGZA 2Z7GA 2ZVRA 4HHLA 2CLHA 3QR1A 3BCJA 2X1TA 1X1ZA 6CGTA 3LCHA 2GQ9A 4L4OA 1KFEA 1F6PA 3VUPA 3QR0A 1PKNA 2W61A 3IIXA 5BOOA 2AMGA 3GWQA 3KRBA 5E0FA 1Q6FA 4CCCA 4A8RA 1Y5XA 4PGLA 1E0TA 3GC2A 3OQ8A 2I9UA 2CETA 4JTDA 2B7PA 2OG9A 4QJ3B 4RZBA 4IWWA 1UR0A 2IPWA 3TN5A 4DYEA 5XIAA 2G3NA 4ZOCA 1A5KC 4E2OA 3PC0A 4WK9A 2ZDRA 2Z1WA 4IFOA 3NVTA 4W9TA 1EJUC 4HA0A 3MKKA 3NZGA 1PYMA 3UF9A 4N0RA 3I7QA 1QWKA 4LANA 2PRLA 3I6TA 2Y6ZA 3MUXA 1GYLA 4PL2A 2B7NA 4QJ5B 4GXWA 4KS0A 3R94A 4DJDD 3PHAA 4NVTA 1R2TA 2X1SA 3R4IA 3DZ1A 4BQ4A 4DO4A 1XG4A 3PBVA 5KMYA 1KFCA 4LAMA 2QPUA 3VKJA 2YB1A 1LF1A 2DSKA 1XW8A 3E0LA 1O4UA 4NIRA 4UQEA 3LMZA 3PUEA 1P0DA 5I77A 1JG9A 4R7JA 5FJOA 4DXVA 4JTAA 4D1JA 4ZE4A 3CZEA 1V6YA 3F2DA 3C6CA 4H9MA 5G1TA 1FCQA 4F0SA 1QHOA 3VX1A 2DPEA 1PYFA 2ALRA 3FYPA 3NZPA 2V6AA 3BGJA 3G0XA 1KC7A 3TZFA 2YPIA 4ZEPA 1BTCA 3SAZA 3TYBA 1YDYA 3QPYA 4HPNA 2ZKMX 3KOWA 3LS9A 2AL1A 2VX5A 1LORA 3RLVA 1V0NA 3FN9A 3PP7A 1KGXA 5A6AA 2PF0A 3APGA 2YCIX 4NILA 2GVGA 1HQTA 4S23A 1H1ZA 5D37A 1DXIA 1M3UA 4ZE5A 3BUVA 1XYAA 1OF6A 1UZDA 4ZL1A 3LV6A 2J7CA 2GGIA 1KTCA 5JH2A 1IIGA 3R7MA 3TQKA 1UD2A 1HKKA 5C9RA 2OZ0A 1SFLA 1EXPA 2W91A 3WQ8A 4ILSA 3TKFA 3WD3A 4DX3A 4LC6A 4Z2HA 3VIHA 4IQDA 2UWFA 3LERA 1ZRQA 2PDGA 1WNOA 3WLOA 5J04A 3GE7A 2Q3RA 3HGSA 3B8UA 2VELA 1KTNA 1DTNA 1RLCL 3T0DA 1H0IA 1UROA 2HISA 3DGRA 3CQJA 3D47A 3H2MA 4WOQA 3B8TA 3ARTA 3NIYA 3OG2A 2FGLA 3WUGA 3KWSA 5ABGA 1YXYA 3WLNA 3VKAA 3CGTA 2ZDSA 2WZEA 1DWHM 1DOSA 2PPGA 3BSHA 4GNKB 4XD5A 3C2OA 2D73A 4PZVA 4ZQMA 3ORWA 1Z32X 2Z2AA 3W25A 3O6AA 1F61A 1AVAA 3IUIA 1BSLA 1VJZA 1E0WA 1VRDA 2XU2A 1Y0EA 4I9AA 1N2VA 2Y2WA 3N18A 1MUCA 1MZHA 4MPKA 3CHVA 1VENA 3USZA 3WFAA 4ACZB 4HJFA 1DJXA 4HN8A 5EBUA 3VFLA 4MSSA 2NUXA 4ATLA 1KXVA 3AUOA 4O52A 4KCWA 3QV7A 5IM51 3MCMA 3NO1A 3WN6A 1VGAA 3AXKA 1ECQA 2YL8A 3LQLA 5C2GA 1XLAA 4GXPA 1CPUA 3FYYA 4ENLA 2CXEA 1QW8A 5DX7A 3U7BA 1QBAA 2DZBA 2WWCA 1OGBA 4LTSA 1DJQA 2J24A 1N8FA 3VKDA 1IXQA 4ATWA 1KWKA 2H9AA 2WHKA 4UR9A 1O5QA 2E40A 2HPMA 3UJRA 1DJIA 2F6XA 2R1NA 3QC3A 4E2VA 1EB3A 3W38A 5G4WA 4B9YA 2Y5SA 3GHSA 1IXNA 1HJUA 2Z29A 2X30A 3EOEA 2OEJA 1PZ2A 1P48A 2JE8A 2PSNA 1LOQA 3PFRA 1P1MA 1O68A 1QU4A 2AQWA 1BYDA 4IH3A 1C9DA 5DMLA 4IZGA 3DFNA 4B4HA 1VIWA 4KEVA 1GOXA 1K7XA 2D20A 3PJXA 3QPEA 3S1XA 3HPFA 2A7PA 1XLIA 4JNZA 5CJNA 3TXZA 2Z0IA 3DHPA 4RV8A 3THCA 1CXIA 1B3WA 2DJLA 2DZAA 4A05A 1ZBKA 3BWWA 5MKGB 1LQ2A 1J12A 3SIMA 3UBPC 3DFQA 1GKRA 1A5LC 1GEQA 3AMCA 4AZ6A 1POKA 5LNSA 2F6KA 4LGXA 4E8DA 2XWEA 1UP3A 2RJGA 3MVIA 5FAGA 3UYIA 4RK8A 1SR0A 4UZUA 2BGNE 4MG4A 3KS6A 2YCKX 1W9PA 1V3KA 4RJEA 3ZLGA 2QCHA 5EMMA 2FTYA 3NL3A 1QW9A 4QEEA 1ZS2A 4FXFA 3TH6A 2HE5A 3WL0A 4PCPA 1Q65A 3CYJA 3AHZA 4QAWA 1JZ3A 3E2VA 1I2QA 3KS5A 1RLDA 4JZ5A 3P80A 4LYRA 3CJPA 1ISZA 3CV6A 1UC5A 4B5WA 2PGEA 4CNSA 2QDEA 3H23A 5DQPA 2TAAA 3EX1A 2YL6A 3PZVA 4TU1A 5D03A 2WMIA 4XO7A 4C6NA 4JQAA 4Q4QA 3NA8A 3IAQA 3M0LA 2YBUA 4TXEA 5KZMA 3GVGA 3LLXA 5DXXA 3KRSA 5A6TC 1KFBA 3GVRA 4O0ZA 1OINA 1EUNA 4PTDA 1K77A 2YXOA 2FFCA 2OB3A 4CGTA 1OFEA 5HANA 2G3JA 5FF2A 3ZR5A 2YJQA 4X3ZA 1QOQA 3UQNA 1V77A 2DT1A 1CLVA 3EA1A 3OBKA 1ZCOA 5CZSA 1ZNNA 4P7NA 3HJEA 1EC9A 3BPWA 2PUZA 3IVSA 3WLTA 3N19B 1TVLA 4BF7A 4QROA 1XINA 3CQIA 3MW7A 5HA7A 1XYZA 5D2XA 4BWLA 1KQYA 2XVNA 1KGUA 2ZYFA 4O1DA 2BY3A 1F4HA 4TMCA 1E9ZB 4L1GA 1ZALA 3INPA 4GBDA 1P0EA 4Z1DA 4NHVA 4K8HA 3NUKA 1TELA 2JF7A 5LNUA 1HTIA 2E6DA 4NASA 5C6MA 1Q66A 3KX6A 5H91A 1PIFA 4RW3A 1J0YA 5CGTA 4CNUA 4NUWA 4PUJA 5BMWA 1OG0A 4IMEA 2BGSA 4GFIA 1C8YA 4NX0A 3WMLA 1EO5A 1XUZA 5D9NA 2Z1BA 1Q2SA 3QVQA 1LRNA 3KZPA 4IGNA 2XFYA 3HTWA 3P3BA 4AWUA 5DY3A 1CX9A 1KRCC 3CB8A 4JBRA 3EOSA 4IXHA 4ZVJA 1W3TA 1S5MA 3T0CA 1KRAC 4HT3A 4XIMA 1TVPA 4PSPA 3AC0A 3UG5A 2E4TA 2PRHA 1OT2A 1YLVA 3QOKA 3B9EA 3FY1A 4IGMA 1L9WA 4DZIA 2GGJA 4PMQA 4C6BA 1EJSC 3WH8A 4DWSC 3W76A 1TPB1 1ZHAA 2V3EA 2WWDA 5FF7A 1XIIA 1CWYA 1YKWA 2QIIA 3P74A 2PDXA 4LSBA 3EPOA 2WMKA 4HGXA 4JQ4A 3VGGA 3MUZ1 3TLQA 1WA3A 1CIUA 4AFYA 1FVPA 5CAHA 4GVHA 1OCJA 5FF3A 3AUJA 3R8RA 4GNVA 2XH0A 5BXRA 3IIZA 1A3XA 1OC6A 4PFMA 2PF8A 4GQRA 2BXZA 4JX4A 1LROA 1OB0A 3QEZA 4KCUA 4TV5A 3ZXWA 2QHAA 1MFUA 5BNKA 3PZOA 4X60A 4LU0A 1EZWA 2VX7A 4AHQA 3PF3A 2POTA 3GH7A 3IVUA 5CLTA 3W88A 2B0MA 1WDPA 1NWRA 3FEMA 1YXDA 3BJTA 1BYAA 2X0SA 3TUUA 1JRCA 4E6MA 2PLCA 1XDMA 4FLRA 4HU3A 2J7DA 2OGJA 1J5SA 3KLLA 3HN3A 4F0RA 4H9VA 4LH8A 1MWOA 3F1QA 1WKEA 5FJJA 4XD3A 1DEDA 3W2JA 3PTDA 4P7RA 5D33A 4AZCB 1UR9A 2WBKA 1S2UA 3PZMA 1YADA 1S46A 3WMCA 4JIHA 1KM5A 2DVXA 4ORIA 4XBKA 3TTYA 1S3HA 2D22A 2XISA 4ZOBA 2NV1A 1OD8A 1X6NA 5TD4A 3BLOA 1F3EA 2ZOXA 2UY2A 3LXBA 3RR4A 1JJKA 1E6ZA 3BE7A 2OWXA 4NI3A 3TYCA 4NX5A 4QXIA 1J11A 1WBJA 3NL2A 3M16A 1QT1A 1WPCA 4HP5A 1VLIA 3ARWA 4HSOA 2WSYA 2PDUA 3AIEA 3SR7A 3N25A 2WNWA 1TPDA 3T42A 3B03A 3L4YA 2CHRA 4TIMA 1NWTA 2QJGA 5DLCA 3GW3A 2EPHA 2NZLA 4C6EA 2PP0A 3GHUA 3F4WA 3F2CA 2FZDA 3DC0A 4IPPA 2JK2A 5AYIA 3ONCA 2MNRA 1RQEA 2PDYA 3UWEA 4Q8MA 1D8CA 5BWAA 4JHMA 2BY0A 2XWDA 4LS2A 4GY0A 1JZ4A 1ZENA 3MDUA 1F4AA 1B4KA 3TC6A 2E6FA 2QXWA 2EAWA 5A8QA 1AD4A 3HPZA 4JKKA 1Q6OA 2OX1A 1MFVA 3W7CA 1JGIA 4OOUA 1ZAHA 3W1UA 4PMJA 4KFPA 5I7GA 4GG9A 1EA9C 4XKYB 2ZX5A 2PDCA 3LLFA 1NH6A 1F6KA 5AYXA 1A5MC 3VOGA 1NQKA 2OLSA 4N4PA 3VD3A 2WK2A 3CPGA 4UQAA 4MY1A 4EANA 1TB3A 3EGJA 4ZQRA 1LG1A 2Y4SA 3V36A 1FHUA 1R0MA 2VDIA 3OYXA 1WV2A 3VD7A 4NQ1A 1K4GA 4FA3A 4K1GA 3SGUA 3T55A 1OEPA 4AXNA 2BOFX 4KT2A 3B0PA 4P8XA 1QBBA 3OYZA 1L6SA 1J79A 1PZ3A 1WOBA 4HNLA 1E6PA 1GONA 4AC1X 4YPJA 6TAAA 3VDBA 1WDRA 1XL9A 3MP3A 1KA9F 1DJWA 4LS1A 3W73A 3K1GA 1QDSA 4CKQA 1EOMA 2CKRA 3SIZA 3IJ7A 3DYOA 1LBLA 4KIEA 4A3YA 2ZRYA 3KAOA 3TJLA 4CN4A 3U57A 2GPTA 3OIHA 1QOPA 2NX3A 3AIQA 4BF9A 4B3ZA 4GVIA 4TO8A 5FJUA 4N9BA 1RVKA 3NQCA 1T6MA 1XRFA 1K8XA 2BY2A 2EHHA 2Y7EA 2CESA 3LQGA 2C14A 2ANUA 1IEIA 3R0UA 4RDVA 3S6OA 1DYSA 2DZXA 3WDIA 1ESWA 1VC4A 1KBLA 4IPLA 4E2BA 1RPKA 4YTQA 3PSWA 1Q4NX 3FKRA 3ABQA 5IXEA 3PR2A 3UNDA 2P8BA 3S2JA 4X61A 2VR2A 2J66A 4AD1A 1IYXA 2V5LA 2CITA 1J10A 4Z0JA 3VMPA 2OO0A 2BG5A 1OCQA 4TX9A 4LB4A 2RDUA 3S1UA 3P81A 1E51A 2A0NA 2XGBA 2PI6A 3S83A 3C86A 1F3TA 1C3FA 1FA2A 4RDWA 4PFHA 4ICCX 3RM9A 3W1PA 1CB2A 4W86A 3MUY1 1EEPA 2GQAA 3KRUA 4IX2A 2HK1A 4YTTA 4MAVA 1AQFA 2INZA 3W53A 4HJWA 1V0KA 2EPMX 3SCVA 1IV8A 4CVUA 4M1BA 1XLMA 1PKMA 4F2BA 4CD6A 1YTEA 3HPAA 3OZPA 3M5XA 1US0A 1PL9A 5BYWA 3IGHX 1MUMA 2ZZ6A 4H01A 3ZIZA 5AVNA 3L0NA 4Q4PA 1JZ7A 2CZ5A 3GYCA 4EK7A 1UUMA 3S9ZA 3N4EA 5CXPA 4M6PA 3DKJA 1YE4A 2PLJA 1OFPA 1GKQA 1PO9A 2RAGA 4JKLA 2Q71A 1J0IA 3VIOA 2IXUA 2FB3A 3IRDA 5I00A 4L9YA 4LAUA 1QWGA 1P4CA 1OX6A 1NARA 3IV8A 4IT1A 3W9ZA 3MO4A 3VOCA 4JEJA 1EBHA 2W4XA 4FX8A 3UJEA 4MYAA 1RBLA 1FHDA 1EX1A 1XFBA 4H7VA 1K6WA 1TPUA 3CQKA 2F8QA 4I3GA 4O8AA 3IVTA 4Q8NA 3LXAA 1MW0A 3WNMA 4PCTA 2EQDA 2BTMA 3TC7A 4W4QA 3LHZA 5HPOA 5C0QA 1VQTA 1DJGA 3V7PA 1EJWC 3F4CA 1UKPA 2AGTA 3U5UA 4S39A 2GSEA 4H9TA 1Q85A 4YWSA 4IM4A 1LLWA 2VZSA 4J9JA 1XF0A 1A0DA 1RUSA 3LGGA 4XZIA 3T2PA 1TWIA 3D3AA 5DCDA 1XD0A 3M43A 3SN0A 3N6JA 1A0CA 3WQ5A 3B8WA 3P0WA 4IUOA 4WDXA 4YCOA 3U2OA 1KNWA 4CQAA 4HZMA 4F3HA 2F2KA 3VI2A 2H90A 3DG6A 3T07A 1SJBA 3BAYA 4RZ5A 3N9KA 1SZFA 4UOZA 4CNPA 3R58A 3CIWA 4ZOAA 2F61A 3AIBA 4NZ4A 5JH1A 1KRMA 2FJUB 4MVAA 4IP5A 1YNYA 1P0NA 4J3WA 2NXHA 4KEMA 4K39A 5ABTA 1E4MM 3R5EA 1H1YA 3VOFA 5AC4A 3MYPA 2C79A 4U5KA 3SO7A 3PSVA 1G67A 2PDNA 4P5UA 2E1DA 3MPGA 4Q4RA 3RPMA 2QLYA 4BI7A 2J75A 4WKFA 2OT0A 3VIGA 1R3QA 1EXBA 3IEBA 4I8YA 1X7FA 4LS0A 4QNWA 3WDQA 1EYWA 2NQLA 3TCEA 2YA0A 1KQZA 1TR9A 1FHLA 3O1NA 2EPOA 5F4XA 3RM8A 4RE0A 1LUCB 3J7HA 3GTFA 3B8VA 2BOGX 2CBIA 3EA3A 1KTBA 4FMVA 3A6OA 1V93A 2ZA2A 1DQXA 5E6YA 1XRSA 4PMXA 3M07A 3JZUA 1G7VA 3JS3A 1RCXB 1XISA 3CAKA 2W63A 1ZP4A 3S2CA 2BFGA 4A21A 2J77A 2NLIA 4DNMA 1GEHA 3QKZA 2X7WA 3GHRA 4H8UA 1ZB5A 3E49A 3D3FA 4OIFA 2E5CA 4X9SA 4W88A 3QHMA 1QFEA 3M1ZA 3MSGA 1XIEA 3LTPA 2NSOA 3H4WA 7REQB 4A8IA 1D9EA 3REQB 3FEQA 4CCZA 3UXLA 4HMDA 2PZ0A 2ATMA 3AHVA 4FIQA 4R7OA 2ZXQA 4CU7A 3MZNA 5F2IA 4IPJA 3WJWA 4H2HA 1AH4A 2DVTA 4TMBA 3O8AA 1NOUA 2H8XA 1K1DA 3LGDA 1Q7MA 1ME8A 1Q2RA 4KRTA 4FAMA 2WZHA 2ZUTA 1BG9A 1BXBA 2HVMA 3WDHA 3FJ4A 1RZMA 3TAKA 1LLOA 3V4BA 5JIWA 1OSEA 1JUKA 3I4KA 1AZ2A 3MKVA 4Q8TA 1K4HA 4JTFA 3R2GA 3N29A 1V6VA 2EG7A 1OVDA 3M0YA 3URBA 8A3HA 1J2WA 3C0QA 3PTKA 1OX4A 1ZAJA 3WX7A 1WKFA 3QTPA 4LUSA 4IG2B 3LPFA 3WDJA 1GQKA 3SQLA 2J8FA 3V16A 4PMUA 4AX7A 3P0XA 3T44A 2NX9A 1GOIA 1J0JA 1ME9A 5A2BA 4IISA 4WHBA 3G1XA 3N3TA 3W1TA 5EB8A 3LCXA 4F0KA 4XZ9A 3MHUA 3DBNA 2QJJA 3RN6A 4CEXC 1DIDA 4V33A 3GFZA 2R1KA 3LSCA 3TU9A 2GJNA 5EL1A 4L61A 2VDHA 2HPIA 3ABXA 1UH4A 2QJMA 2QJNA 1MQRA 3N14A 1E6NA 3TW7A 4A2RA 3FLUA 5BRPA 1DQUA 3ABZA 3T09A 4XV0A 5J5RA 1EIXA 4RDYA 4MJ4A 2ZX6A 4QE4A 2F9RA 4H7ZA 4AU0A 1E43A 3G18A 1VEOA 1SO3A 1G4SA 4J3UA 2HWGA 2V69A 1THFD 4LX4A 1WDWA 3ZWSA 2QW5A 1A3HA 1PZ1A 5GNZA 4LBUA 4ES4A 2ACQA 3GH5A 1B3XA 5ECVA 4OWGA 4NZ1A 3WQ4A 4Y7EA 9RUBA 1O60A 1ODUA 4NAFB 2E1WA 3UT0A 3W3OA 5CAKA 4Q6JA 2OODA 4GMEA 4ERAA 4DYKA 2XH7A 3TVAA 1LYXA 1POJA 4HBKA 4GYPA 1KCLA 1XSIA 4RX0A 4BWLC 3TW6A 4LNCA 3IUDA 3U4AA 3G1FA 2XHYA 3KFTA 1FWEC 2WMHA 3RITA 3JZEA 3WEMA 4F2UA 3ZJKA 4CLMA 4GPNA 4DHGA 1RALA 1AQ0A 4GCAA 3O07A 1I6NA 5BXPA 3EDJA 3N12A 4BEQA 3CHEA 1UUOA 3LB0A 3ZFHA 4AEOA 3C2EA 3VD9A 1HXJA 3FS2A 4WJ8A 3CUGA 1AQMA 3CAQA 1GPWA 3VNKA 4M7TA 5ABFB 3CZJA 1IR1A 4BEUA 3MUIA 3LCFA 1T8QA 3LMYA 2Z1SA 5E0CA 1CNVA 4OV9A 3VO0A 5CQ1A 3WLLA 1E6RA 1EF2A 1H50A 4UFLA 1ZY9A 3CK5A 2PP3A 3VVGA 5E70A 1EH9A 1KCZA 4AVFA 4H00A 4A6GA 1W8SA 1TPC1 1R87A 1H49A 4WXZA 1MUWA 1BG4A 4POCA 4DY1A 3ITXA 4BZYA 2YX0A 3WF0A 4C90A 3VIPA 4R27A 4RNIA 3WD1A 1RA5A 1UD5A 3S8HA 3C5QA 4B3LA 3I3DA 3ZZ1A 5GJMA 3M47A 3RPTA 1O94A 3E38A 5BRBA 4JIRA 4A22A 4QG9A 4GACA 1ZQ5A 1ZBCA 4FI4A 3GTIA 1BTMA 1W5MA 3WNLA 2VD8A 3H2FA 3UY7A 5CPTA 3W7OA 1PHQA 2JIEA 3GIQA 3R79A 3V35A 3A9BA 2QCDA 4M8UA 4XZNX 1E73M 4J3TA 2Z27A 3LBOA 3PZ9A 3EX4A 1VFTA 4PTNA 3GU1A 5GJPA 4JD4A 1XJBA 3GHTA 1WAWA 4FXSA 3B04A 3RF9A 4AG0A 1LJYA 1VB9A 4EKJA 4UR8A 4UIOA 3G0SA 1TPFA 3F5KA 1WDDA 3QSRA 1E72M 3BLKA 1IEVA 5C9UA 2VZTA 2V5JA 3VIKA 2Y62A 2Y8KA 4CCEA 2FVKA 2YCJA 3BW2A 5F1VA 1Q6RA 4MUPA 1TVNA 1HJWA 3FGCB 3TW9A 5FEWA 2XIQA 4ZOEA 1HNYA 4PMNA 5AHEA 3R12A 3RMEA 1YQ2A 5I78A 4UTKA 5CC3A 2HVNA 1PAMA 1M9HA 1E0VA 1HO4A 1UIPA 3EDKA 3DESA 3H21A 2QCEA 5CZKA 5HNNA 5C9XA 3DH7A 1W3LA 3URQA 1X6LA 3LG3A 3P67A 4PBGA 3DFOA 3GG0A 1TV4A 2V3DA 4OUIA 1U83A 5H1WA 3DFPA 3WJZA 3HA1A 4XZLX 1H7NA 3SUUA 2PURA 4MB1A 4S3DA 3NOEA 4PTWA 4W85A 3SUWA 4O1BA 2C71A 1TREA 1VFLA 1U33A 1EYEA 3S1GA 3UWZA 3TWAA 5DF0A 1A5OC 3IIOA 5C55A 1RP8A 3P84A 3RLGA 4OE7A 3E0FA 2IPFA 4XIAA 4N6EA 1SJDA 2VFGA 1TA3A 2ABAA 2OVLA 4ZXOA 3PB0A 1A49A 1V51A 3E5PA 4IIBA 5HNRA 1PS9A 4UCGA 1UD6A 1OGGA 3RM4A 4GOAA 2ZTJA 2WKLA 4GUIA 1YX1A 3JR2A 1H7OA 1HKJA 3MI3A 4HOWA 2VC7A 4NI8A 1XLLA 4GZEA 3F5JA 2VKZG 4Z42C 2WCAA 1JPIA 2YFOA 3W87A 4X9YA 1OCNA 1GQIA 4MWAE 3M5ZA 4UTMA 1EJ7L 3VIJA 2FHCA 4FZIA 1TPVA 3EWDA 2OWWA 5GPRA 5HJYA 3PWAA 1AZ1A 4JICA 4H83A 1W9BM 4G1KA 4U5IA 4GZ7A 3HPSA 5CGQA 2FFIA 4WGHA 3KTXA 2D0HA 4A4AA 3KOXA 1B9BA 2WSKA 2QULA 3PUGA 1E4IA 2TODA 1RVGA 2WW5A 2NV2A 4C1NA 2P10A 1WO2A 2J4GA 2DSWA 4MJ2A 4QSFA 3E9AA 2DUAA 1FWBC 1V3JA 3G8EA 1MEIA 3O3RA 2PTDA 5DFAA 5FI8A 5HINA 4AMCA 3DFTA 1VJSA 5TBOA 1CGUA 2ESCA 1T7LA 2WZIA 4FB7A 1HFBA 1MRQA 3SCUA 1JL8A 3FVMA 1WAUA 4O0QA 1K70A 1J6PA 4XQ6A 5FF0A 5CJMA 1VCVA 1YTKA 3CYVA 2G96A 4LF1A 3EWCA 3GYEA 5I3HA 1DBTA 4D8AA 4J3XA 5HR7A 2Y85A 3NSNA 4F8XA 3CHCA 2DQWA 4FLQA 4HHHA 1JF6A 1NDZA 1AMKA 4TVUA 1LBMA 2WCGA 3V18A 4FX6M 4QE5A 2ZC1A 4D6GA 4BS0A 1UZ1A 2J7FA 1JIBA 1L8NA 4BQ2A 4P7QA 5BROA 1S5WA 1TWZA 4YJ5A 2GDQA 1I2PA 1CCWB 1V3LA 3EX2A 3KVJA 3LZ3A 2GVLA 4GYFA 3H53A 3R0DA 1GG1A 2ZX8A 4KGJA 1J6OA 3WF4A 5C7VA 5K4XA 4DBUA 1E40A 2PDJA 3MUCA 1FXPA 4MUZA 1KFKA 3W7DA 1J93A 2DW6A 3D0CA 1H11A 4ASTA 2F38A 1VCFA 3MI2A 3GR7A 4V2XA 4LY8A 3QZAA 4DJFD 3H2EA 1YW1A 4UFKA 4XAGA 1A47A 4Z17A 4UMCA 3H26A 1P6WA 2Y24A 3TDFA 1YPFA 4MWAC 1GVEA 3CMJA 1V0LA 4A3RA 2J74A 3RNDA 4DI9A 1E5NA 2ZC8A 1J4EA 2ONEA 3CZKA 3M41A 1YEYA 5IOBA 1PTDA 2CHNA 1A5SA 2Z1VA 1NDWA 2CBUA 4S3FA 4UMAA 3BH4A 3BOLA 2WSRA 3WQCA 5I3DA 2HNEA 4JY8A 1TMLA 4KCVA 1BVZA 4WZHA 4QAIA 3IACA 3OLDA 1FWGC 5BU6A 4JIIX 3KXQA 3DI0A 3EDEA 4GIYA 1HT6A 2WLZA 2Y7FA 1UR1A 3CWHA 2FHBA 1M53A 1Y65A 1DIKA 5A8PA 5EA9A 1RAKA 3VKBA 3V1PA 3QC0A 3OPSA 4P7LA 3BCFA 4A3QA 3F2BA 1GVFA 4MKNA 1AD1A 2NT1A 3E6EA 4ZBCA 2DIEA 1O12A 2UY3A 4BY3A 2VNCA 3FJ6A 1KCKA 1UKOA 3AYRA 1TJRA 3RU8X 1QR7A 2QAPA 4JFSA 3AU6A 2G95A 5L6UA 2GWNA 1ITQA 1N7KA 3PWIA 1TRDA 5I3KA 4GI6A 3DKLA 2R1MA 4YS1A 4MHBA 3T8QA 1VAHA 2UY4A 4YTSA 1Q8AA 3OTRA 1W5QA 2QIWA 1V5XA 2WVUA 1ZJIA 2FPYA 3VDAA 4L4PA 2WYSA 3TNBA 4GUJA 1VFOA 1TR1A 3TTQA 4W5ZA 1OFAA 1PCWA 3SCSA 1SU5A 3KBSA 4DXKA 2VVNA 3CLMA 1F07A 2V5CA 1XYCA 4QIUA 4MNMA 1XC6A 2E6YA 3WQWA 5C71A 4DO7A 3NPVA 2VEPA 4UTFA 2X16A 1UD3A 2GJXA 3KCJA 5A8GA 4C6FA 1ME7A 1Z42A 3W71A 1S2TA 2GLKA 1W3KA 2WSQA 4AZIA 4WSKA 8CGTA 1KM3A 2O9OA 4CU8A 3CLWA 4QCFA 4PSRA 4HYVA 1L6WA 1B31A 1OG6A 4PUEA 1QNQA 1PCKA 1GG0A 4I6VA 3KLKA 3M6DA 1YMYA 2WM0A 4NL1A 2O92A 3CAWA 3B4YA 2D2OA 3FFSA 3SW6A 4HOXA 3OP2A 4UTHA 3SCNA 2PE4A 4Q7NA 4PCFA 4NNCA 1UBSA 4MADA 2JKPA 4DJFA 4XO6A 4QS6A 3W7GA 3LD5A 2ZE3A 1N8IA 4KEZA 1CGYA 4FOUA 2YKKA 1P7TB 3H54A 3BAIA 4O4WA 2OXNA 1E6XM 3FW6A 3UXKA 4DZAA 1M7PA 1Q45A 4HCLA 2VDGA 1TYGA 4Y96A 4UBPC 5D4YA 3W75A 1AL8A 2I16A 3KVMA 3NYZA 3T40A 1CECA 1L2UA 3MQTA 1HJXA 2W3ZA 3GU2A 3HG2A 4GWEA 3USBA 1J0KA 4ZFCA 2ZX9A 3CTLA 5E5CA 3N4AA 1TQJA 2GZXA 3LLDA 3QZEA 2YB4A 2E5BA 2NXIA 3HQ1A 1UH3A 2WQDA 2C7FA 3BVJA 1TJPA 1GCYA 1Z41A 1QI2A 3VILA 4J3ZA 1KKRA 3WG6A 3BJSA 3PZNA 5EU9A 1BVWA 3AXHA 3STEA 4HK7A 3WK0A 4Y2WA 1PBGA 1TMQA 3NO5A 3THAA 2P0IA 4QHRA 3VD5A 3JW7A 3SUSA 5HMDA 3PAOA 3VINA 3MCNA 1DJNA 3WLQA 3QSTA 2XPKA 4JTUA 5EPDA 4HZ8A 2YA2A 1JPDX 4LVFA 2BWGA 1OYAA 5C5YA 3EMQA 1YDVA 3ES7A 1E4LA 4HPHA 2QMJA 4M81A 4IL2A 4JOMA 3SCWA 2BHYA 3SRKA 1XCXA 2VXNA 4YVXA 2CEQA 4F4RA 3EB3A 1PUDA 3A4JA 2ZADA 4ERGA 1SSDA 3BQ5A 3EWBX 4KFOA 3NGFA 5GQBA 1G94A 1JEZA 1BRLA 6REQA 1R9XA 4B2DD 3AU2A 3BZJA 3WFZA 3BW3A 2FZBA 4JN7A 5CPQA 5B80A 1QXLA 4AW7A 2E6AA 1XV8A 2NSXA 1V03A 1Q7ZA 3H2AA 6XIMA 4O1AA 3S42A 3ZVHB 2OEMA 2FMOA 3TCSA 1B1YA 3GW0A 1KBJA 2CLLA 4YL2A 5LNRA 4K37A 5TIMA 5I09A 1ZZMA 3HV9A 4LFYA 3EMCA 4UTUA 1GOOA 1UUQA 5CGMA 4MYXA 2P3ZA 1LOLA 1US2A 2VEIA 4D72A 1S5VA 3CPUA 4JTLA 4MB3A 4O4VA 3UR8A 2BVDA 3ZJ7A 1DXFA 2WJEA 1RD6A 2C3ZA 3SN1A 3TAOA 2XN1A 4S3CA 2Z28A 4OHQA 5D9MA 1X96A 4HHMA 3S5NA 2GDUA 1I60A 2OYMA 5E93A 2JEQA 4GYPC 1XBXA 1SQ7A 1GGOA 1EJTC 3LRLA 3OJGA 5DO8A 5K9DA 2YW4A 1B5TA 3DFHA 1DJYA 1QI3A 1QI5A 2FDSA 2RHGA 3A5FA 4P7OA 5D05A 4X22A 4JYFA 1PJ9A 2YSWA 1ALDA 2ZZ1A 3UXAA 3ERPA 2V68A 4NRSA 2GUBA 3VC5A 3ZT7A 1TZ9A 1M7JA 4Y6GA 1AMYA 3GG1A 2OZ8A 2QCLA 3WUFA 2Q8XA 3UETA 2CLEA 3ZS4A 5CSUA 3QR3A 3ARPA 4D6IA 4M6UA 4K6AA 3GVVA 3FXYA 1AJ2A 5DBTA 2J7GA 5HDRA 3MY9A 2Q09A 1OIMA 3N3MA 4JNMA 4CQCA 3RR1A 1W9VA 1TIWA 3UR2A 5CPSA 3BLIA 3A23A 3IWPA 3GDTA 4Z2IA 3WLMA 4MKVA 3HMJG 5REQA 2DZPA 3GLCA 1HZYA 1NFPA 4LW7A 4HNUA 3WSUA 5CG7A 3W7KA 3VGEA 2Q8ZA 4H8VA 4AEEA 4IICA 3QMSA 2VEFA 4DQWA 1UD4A 3VCNA 2DIJA 4IMGA 3QHOA 3L0KA 2BDQA 4OECA 4MZ1A 2VX6A 1EC7A 2HZGA 4ICMA 4EE9A 3EX6A 3E3HA 1WUFA 3AIWA 2YXXA 2EPKX 1LL6A 3KCOA 3EXTA 4X0VA 4AX6A 3G2GA 3VM5A 1XBZA 3ITLA 1JCJA 4NJKA 1DWAM 2REQB 4XAFA 2R8WA 2X40A 4XB3A 3MU7A 2XVPA 4JAWA 2V5DA 4WVXA 2XM2A 1DV7A 3ANYA 3B9AA 1KWGA 4R5EA 4Z2JA 4JTQA 1PX8A 1E55A 1XDJA 3APYA 1HKWA 3OLGA 4DBWA 4INFA 5I79A 2ZZ7A 2BODX 4AWSA 2BX7A 4DWSD 4I9JA 2VD9A 3WH9A 4NG3A 3ABSA 2WVVA 4NNBA 2OOFA 2Y1HA 1XYFA 2IQ0A 5H8PA 4AVNA 1NAL1 3STFA 4M24A 3SM0A 3QQ1A 3GTHA 3QLLA 3FSUA 4ACZA 1FKWA 4AH7A 3WBEA 3FOKA 3ZOAA 3VIFA 3WF2A 4DF2A 4YIWA 2EG8A 2VENA 1WDQA 1EBGA 4BK9A 3K4DA 1Q13A 4ZTXA 2QKFA 3VK5A 3N9SA 2ISFA 1V6UA 1GJWA 2BHZA 2DIKA 3E2RA 1JFHA 2BXVA 2A3EA 1A5UA 3GU9A 2C1IA 2HMCA 4UQDA 4HN4A 1Q5MA 2IKGA 3W7LA 1TE1A 4RE2A 4Y9AA 3SEPA 2CERA 5ABHA 2FH8A 3HBLA 4LBRA 5A2AA 3UVIA 3VNMA 3P5ZA 4QEHA 5K2ZA 4B91A 3QYQA 1VBJA 3H22A 2QJHA 3CBWA 1GZ1A 2WC4A 2VUYA 3MZ2A 1NM9A 3AALA 4QR6A 4M7SA 1FWJC 4O10A 3WQDA 1Q7QA 4Z2LA 1E1CB 3PK7A 2HXTA 3MJYA 4TOQA 4GQGA 4W5UA 1UJPA 4D71A 5I23A 5I3FA 3N4FA 4NZ5A 4I9MA 5LKYA 1T41A 1VPQA 1XKYA 1IT0A 4I9TA 1Y5VA 1VH7A 4NJHA 2VFEA 1JGMA 1XBYA 3N73A 1PDZA 3EDDA 3M9YA 3DI1A 2OPJA 5AECA 3KP1A 4X63A 5GNXA 1R3SA 1A0EA 1LZOA 3LNPA 2HVOA 1BFNA 2C6QA 3B40A 2WC7A 3L5AA 4RXFA 4DRSA 2ACUA 2DT2A 3VNDA 3GR4A 4WY0A 5F2MA 4I5UA 2J9ZA 5AVHA 1FWHC 3NNTA 3B4UA 3G0UA 2OLHA 4WX2A 3FSTA 2YGYA 4HSNA 1QK0A 1U5JA 3S5YA 1I9CB 1W91A 4MGGA 2DQXA 3L12A 3L5MA 3SY8A 3POHA 2RUSA 3MS8A 3UP8A 4B5TA 4K7YA 3RX2A 3NXFA 4MJMA 2D24A 1M7XA 5CZJA 1PIGA 5DELA 4L5ZA 1LTDA 3S3GA 3L5LA 1BGGA 4HVXA 4X0NA 3WBYA 4XBSA 1SZRA 3V0UA 5T26A 1WUEA 1BQGA 4XWUA 4E4PA 3HFTA 3BV4A 3QGVA 2ZUUA 3SBFA 1ICQA 4OV4A 2Y8VA 5H8MA 3UPWA 3VE7A 2X42A 5KETA 1WZKA 1PSCA 5FA5A 3QLDA 3URAA 3A22A 1VR6A 4Y9PA 2OO6A 2PDQA 3AYSA 1LL7A 1SYTA 2IQDA 4IFKB 4MDPA 4PUUA 2NQ9A 3S2NA 2BVTA 1E9IA 4D6CA 3F4VA 4LVAA 2YZRA 1A5NC 2WJDA 4ZSUA 2J27A 4N7QA 1OK6A 3WMSA 2J7BA 4A29A 1QPKA 2HSAA 3E96A 4KGLA 2ZE0A 1Q8JA 3C2RA 1IWBA 2JGYA 3A21A 3KM8A 1M04A 4UOJA 2FLIA 4AC7C 2PGWA 2NQZA 1PB0A 4GQBA 1EDGA 3IJDA 1ML1A 4MY8A 5LIKX 5G5IA 3K2GA 3NQ8A 5HQLA 1KXQA 5E0KA 1PWMA 3MMWA 3SCOA 3TSBA 3A13A 1VYRA 2RDTA 3T4CA 3VZYA 2DUXA 3ZJ6A 1VHNA 1RBAA 3UG3A 3NSXA 3CZ8A 2ODOA 4MLRA 3PBUA 1BKSA 4ZO9A 1B3YA 1B90A 3LCIA 3UERA 5AKQA 1S5NA 4OUEA 2ZX7A 2BHUA 3LYEA 3FYOA 3UZYA 4MIMA 3DFSA 4XVDA 3BMVA 4I6KA 1U1JA 3UA4A 1B57A 1KR0A 1UP2A 3BGAA 3FCPA 4KPLA 2G97A 3QOMA 4AZ5A 2VR4A 3A64A 2FPVA 5DMMA 3AS0A 3M7SA 4ZA0A 4NYUA 1YBQA 1JYVA 1FUYA 4UFHA 2A6NA 2I5IA 4XX6A 4PMRA 1A4MA 1WDSA 3T78A 4H2CA 3NQ2A 3LENA 3UFYA 1R9YA 3IJQA 5FD0A 2E28A 4EAYA 4AD5A 4PODA 1ISYA 3U9IA 3L7RA 2BB0A 4AIOA 3IJ9A 1J0ZA 3ZMRA 4O18A 5TQLA 3SCPA 1TPEA 1VRXA 2D3NA 4CNOA 1M01A 4U3AA 1NELA 2NUWA 1WYIA 5HJLA 1UMLA 3CUIA 3MTWA 2A7NA 1JPHA 4HTYA 3CTTA 3EKGA 3RJYA 2EXOA 3TP4A 4PE8A 1EZ2A 1MI3A 2WQPA 3UVAA 2ISVA 3L2IA 3RFAA 3AMKA 2ADAA 5A6SA 4FXRA 5PTDA 2BASA 3BLFA 3ID7A 3GVWA 1J2BA 3GNNA 3W7MA 4US5A 1IGWA 1C8XA 1F05A 2NQJA 3SQSA 3QN3A 3E0VA 2OJPA 4HYWA 2I5GA 2VUNA 1XGEA 4LCQA 3TE9A 3OGRA 3LHTA 1MZRA 2ISWA 3N9RA 3KUMA 3AHXA 4B15A 4W84A 3O6DA 1OGSA 4QTGA 3T6CA 2ISSA 3HV8A 3NWRA 3NJ3A 1EA0A 2ZUWA 5HQMA 3NL6A 4YYFA 3KE0A 3UR5A 3W81A 2VFDA 3U7VA 7TIMA 1NOFA 4GX9A 4QQUA 3IIVA 3RUBL 3C3NA 3S5OA 1CXLA 2HQAA 1W3IA 3ARQA 4AZCA 1K8CA 1OYCA 2NXGA 3GNXA 3HMCA 3RAOA 5FJPA 1F9CA 2YYTA 2VOMA 1LCOA 2OSYA 1HKVA 2I56A 3DHUA 3C56A 2Q02A 3LRKA 3PJTA 5EBAA 5H2ZA 2GJLA 4D6JA 1BXCA 3P93A 3IK4A 4CCDA 3PULA 1SW3A 2OKOA 4HHPA 1XR2A 3TSDA 5CEWA 1UWRA 4LCSA 3WBXA 3GFXA 1BF2A 2YLAA 3WLKX 3OHMB 3GZ3A 3ZVIA 4KETA 4DJFC 1XRTA 4Q8VA 2CFFA 5EMJA 5HUOA 1GOQA 3N34A 3D6NA 4V28A 3R25A 1R7AA 1KM1A 4EXQA 2Y89A 2ZWYA 3NM3A 3WDRA 4PMVA 2WNQA 5ENLA 1RJRA 1G9HA 5AYYA 3ARRA 3HM7A 3Q4DA 1EEXA 2ZVIA 1FWDC 4AD0A 2A3LA 4DUVA 4OBSA 5KZ6A 3PPCA 4XKYA 1Q6CA 3WLSA 3VKKA 3GBEA 3GK0A 4KWWA 4GCXA 2GQ8A 3ITCA 4H9XA 8TIMA 3U0HA 2XTKA 2UY5A 4AF0B 1XI3A 3W6MA 3W27A 1IT7A 2VC5A 1K7FA 3CT2A 1NIUA 3W7QA 1J8VA 4PH6A 1N55A 1IT8A 4PC8A 5CLWA 1VEPA 3K1DA 3SN4A 1XCWA 1Z9AA 2QF8A 2X2YA 1CT5A 4GY7A 3GR8A 1KGWA 3VD4A 3E02A 2QVHA 1JNDA 1S2VA 5LXXA 1GVSA 2VWSA 3ES8A 3Q65A 4P8UA 2RGMA 2QDHA 1YYAA 4U28A 3NEHA 1P0KA 3LPPA 2VL4A 1R38A 4B90A 4M19A 2HNHA 2DZSA 1JRBA 3KTSA 1EGMA 2XGZA 5LHEA 4LRTA 1SO5A 4PYSA 3SCQA 3W7IA 4JIPA 3COTA 3VYLA 5I03A 1UR3M 3C61A 1JCMP 3K30A 4RE4A 1OWQA 1AH0A 3CQ0A 1B54A 4TQTA 3V0SA 1RBOB 3NAVA 4Q4OA 3W22A 5D8ZA 5A6LA 1KFJA 1G6CA 1GZGA 1FH7A 4C6QA 3BLLA 3T2OA 4M0XA 2XSXA 3TTOA 5FCZA 4Q4KA 3G77A 4N9EA 3NZRA 3A3XA 2XGIA 5IFTA 2QZRA 2PWVA 3M0KA 1W9DM 1E0UA 1TX2A 3LCWA 4HQVA 2X0HA 1CYGA 2B31A 3I68A 3OBEA 2D1ZA 4YHEA 4ADSA 3QXBA 1O5RA 3VX0A 3VDCA 2QUUA 3BAXA 2VFHA 4WLCA 3W7HA 2OGYA 2I57A 1TWSA 1JPKA 1R30A 1TJ2A 4WRHA 8XIMA 4JDBA 3NQ6A 1R5YA 4GQ0A 4Q22A 4AZHA 3DERA 1PE1A 3PBYA 2EG6A 2PEVA 2XVGA 1D3GA 2B4GA 1OX4B 4XZHA 5T91A 4AZGA 4DAFA 4IIHA 4F9DA 4V1XA 2CLKA 1RQHA 1W1ZA 1W1B1 1WQ5A 2ZZ4A 2ZZ3A 3WF1A 5HWNA 4QDWA 4DBEA 4MZ8A 1HL2A 2R1PA 4H6KA 3PAJA 5C9ZA 3W82A 3MHFA 4QJ4B 1V6TA 1ADDA 1SMAA 2A4AA 5H8UA 7ODCA 5LGZA 1CGTA 1V3MA 2WB5A 3AMGA 5M2FX 1GW1A 5E1QA 4BI5A 5A95A 3M0MA 2E8ZA 2XN2A 4PA8A 4E3VA 4QG8A 3GZAA 3VDGA 3BGGA 2PGFA 3C0LA 3BSGA 2PDKA 3G6LA 5M1TA 3DOPA 3SRFA 3LA4A 4HSHA 3WLJA 2C0AA 3E12A 3KBVA 3AS2A 3NM1A 1TV3A 2A3AA 5AFDA 2CLPA 1UWAA 1J96A 4F0LA 2V67A 1HKMA 4OQVA 4KERA 3H7VA 4WEVX 1XYMA 1CDGA 1J01A 4E4UA 5A2CA 4QP0A 4E2DA 1AW5A 4K8GA 1JCYA 5HWMA 3TEVA 1AW1A 4ICNA 3TJIA 3CV1A 3ENLA 2WKJA 3ATYA 1K8ZA 3TLLA 4E0CA 5K9XA 1C8QA 1E6QM 3WIJA 2PTYA 3A24A 4ZR8A 3BICA 1RP9A 4G9PA 5HPCA 2VRJA 2G41A 2P1FA 3B3DA 4REQB 1W3HA 2C1GA 4K36A 1NF0A 3N2MA 4O50A 2ZBTA 1G01A 1VBRA 5D2VA 1SZNA 5EFDA 1UWQA 4HPGA 2R14A 3OB8A 4NJIA 3B0UX 5I2UA 1W1IE 4HK6A 4D8ZA 4UNKA 2BS9A 2V0TA 1LUCA 1ZSXA 2BMBA 4HZ6A 4UR7A 3DEQA 5HJXA 2VT0A 2QV4A 3GTXA 3CB3A 4OOZA 2FYMA 2FKPA 1FX6A 1O5XA 3HF3A 4NZFA 1JXKA 2E3ZA 3CNYA 4NZJA 4C60A 4NF7A 4Q7IA 3UJ2A 3I6EA 1W5OA 1PKYA 4LUTA 4MB4A 1W2PA 3DAQA 1HKIA 1GVQA 3CWOX 4EX4A 2V5BA 4D2JA 1U1HA 4AHPA 1VBUA 2OSWA 4UC5A 4QITA 1D7KA 4RE3A 3PWGA 1W32A 2XG9A 5D9PA 4KMQA 4Y8FA 3REQA 5E09A 4PTXA 1KLYA 6PTDA 5G1MA 3CEUA 3UGVA 2QCDB 4IHCA 3EWXA 3STPA 3NQBA 3FJNA 4N6FA 1LQ0A 2Z6IA 2Q01A 1BEUA 1SJAA 2W62A 2X41A 2J8TA 1R3YA 4GISA 1JUBA 2VR5A 3OBAA 1BHGA 5FEXA 2WPBA 1F2JA 3B0XA 3L4TA 2EO7A 3AWOA 2VHLA 3QQ0A 4NT0A 4LPCA 3AMLA 5DMNA 4I7WA 3M0XA 3GC5A 1ECEA 4H04A 2MANA 1FQ0A 3BG3A 3PUOA 1QAPA 3XISA 1E9YB 4P8WA 4GD0A 2PDMA 3EX3A 3A3HA 1ZBWA 1MDRA 3WH7A 1KM4A 3TR2A 1IE7C 3VIMA 3NR0A 3WQFA 3GG8A 5XIMA 1HL8A 2PWFA 5B7ZA 1JCTA 1IXPA 4DPQA 5LYRA 1P5BA 3L4UA 3LGEA 1HJQA 4JX5A 2P50A 1KBIA 1OY0A 3ZJ8A 5LXEA 3EKZA 4WKHA 4CNNA 3UWQA 1Z3NA 2HE8A 2Z26A 3PB2A 1A5BA 3IARA 4RNHA 3S9IA 2J6VA 1W3JA 2J79A 3G1YA 4M5PA 4RDZA 4ZODA 1XYBA 2VCCA 2XM1A 1U1UA 4GKLA 4W87A 1QOXA 3WH6A 2XIOA 4Q33A 3CZGA 4GK8A 1QNVA 2ZFAA 2WZTA 1LOSA 1QNSA 5ECUA 1RY8A 3RO6A 4LRSA 3G22A 2NQHA 5LIUX 3PUDA 4LB3A 4AD4A 2AAAA 1QRQA 2XZ9A 4YWIA 2J7EA 5CCZA 4XUYA 2YL5A 3QTGA 1TA3B 2J9XA 1TE6A 3ABOA 4QCEA 3OEXA 2W67A 3C3UA 4WDWA 4GBUA 4NZCA 3K8KA 2J6XA 2WO5A 2VYOA 3S2MA 3AWNA 4RR4A 2NWRA 1DORA 3K13A 4PBEA 5CZTA 4L56A 2J7HA 5LZLA 5D2WA 4HNTA 4MFEA 2C18A 4LYPA 4NAFA 2ZUSA 4QS5A 4LV4A 2V3FA 4FNSA 2AL2A 1GHRA 1SVDA 1I8JA 4JFUA 5KZDA 2G4JA 1TZ7A 1Z89A 3U6WA 1S1RA 4D6EA 1XBVA 4ECLA 1BD0A 2RGLA 3UG8A 2DV0A 3G1DA 5J8LA 3XIMA 1XFCA 3GBDA 1EDQA 3FHQA 1GQJA 2XFFA 1XLKA 1C7TA 5G2WA 1JDCA 2J88A 1O6IA 3KBNA 3GQYA 3MSDA 4WR3A 3KRZA 4EWJA 4HMNA 1RXOB 1FWIC 1KM0A 2YCLA 3L68A 3TYAA 1DXEA 4LF2A 1ONRA 4LV9A 4GUGA 3DU0A 4C1NB 1Q6EA 4JCLA 4OT7A 5K3VA 3LSBA 3TA9A 4E5TA 5AOUA 3NURA 3MWAA 4LYKA 1G5AA 3NQEA 5HXMA 4JGDA 5FEZA 1XICA 3O7UA 4LAZA 1BYCA 5I06A 5C54A 4HA1A 4AIUA 3BTNA 4FPSA 1TWWA 4GZJA 2Y0FA 1XP3A 2G50A 3G1AA 1NDYA 3GIPA 1H7WA 3N2TA 3QW3A 3FA5A 3ZYZA 4LBSA 3WEOA 3WK1A 3WEZA 5JBFA 4URIA 1WCGA 3WK3A 3Q67A 4MNJA 4UNLA 3GKAA 2WNZA 2XDFA 1IQ8A 5T9CE 4CEUC 1XXXA 4MWAD 1B3ZA 3ZT6A 2R24A 4JN6A 2I9EA 3FA4A 4WCJA 1I0DA 5DY2A 4YYCA 3NPUA 1WZLA 2A7RA 1SW0A 4W7VA 3CO4A 2DT3A 4C6LA 4H41A 5FAJA 1TKKA 2X8RA 1NWSA 5DRCA 5LA1A 5I07A 3W72A 2QGYA 1BXNA 4Y9MA 2IPJA 2CBVA 3LV5A 5A94A 4LUJA 1UOZA 4HU4A 3L4ZA 3T0AA 4KRUA 1R85A 3ZLFA 3II1A 8XIAA 3KL3A 4DIAA 3RYSA 3AS1A 3H7UA 3DFYA 3FGCA 2G5WA 1V4YA 4FO4A 1NU5A 1T0OA 4K8EA 3UEQA 3PBWA 1XLFA 2ZXDA 2ASHA 1PWLA 3W28A 2G3IA 1A5CA 3IRSA 4C5ZA 1VBGA 4XK2A 1MQPA 4G56A 3PZGA 3BV7A 3N2BA 1TZZA 2DT0A 2ZA3A 3S47A 2D69A 1OFQA 2CPUA 3TROA 3WLRA 1IXOA 4U33A 3AMDA 2PTWA 3H8AA 5SWUA 4DXXA 1Z69A 3LXCA 3VZZA 5A6BA 1GTHA 5AZ1A 2EGZA 3UJSA 5FIPA 2PS2A 4NP7A 2XSAA 3TYEA 2A79A 1TUFA 9XIAA 2PWDA 1ISVA 3EYPA 1DWJM 5HNUA 2HBXA 2PDBA 3H2NA 3CEPA 4DO6A 5JIPA 2O9RA 4ZFMA 5F2LA 2FTPA 4FNTA 3UU0A 2FZ9A 4DJEA 3GVQA 1OFDA 1XHGA 4RL3A 4UNIA 1EP1A 3UCCA 3BDKA 1T8XA 4U3CA 3MO7A 4MFDA 1UZ4A 1LRQA 3C0SA 1FWRA 1PTGA 5AC7A 3FAWA 5LSMA 5EY5A 2FQIA 2YZ5A 4AIBA 4JPGA 1QMLA 4GJJA 4R34A 1W37A 2QCCA 1L6GA 1LBFA 5IHRA 3WO8A 1DHPA 2OU4A 1UA3A 2CZVA 2PU1A 1FTXA 2PD9A 3L4WA 2DSUA 3W7PA 4IF2A 1OCBA 4JR5A 3BO9A 6A3HA 3BAJA 3DX5A 1VF8A 5C2XA 1OADA 2IKJA 4W8AA 4Z0SA 3KBJA 5D2YA 3SUTA 3EZ4A 2ZRXA 1WBHA 3W1NA 1IR2A 5AY7A 2VFFA 3RK8A 3MBDA 2AQVA 4IFRA 3R13A 2WC3A 1EOKA 1E1EA 4ZGYA 4MWAA 3OZOA 3PTMA 4JHOA 1H3GA 1DJHA 4KW2A 1DWIM 3HG3A 4C5YA 3WQ6A 4AB4A 2C19A 2IMRA 4FR6A 1X7IA 1BLIA 3GKFA 4AWEA 1MNSA 3M64A 3VA8A 1TIMA 3TTEA 4JCMA 4L4MA 3SRDA 2D3LA 4EVZA 4PB5A 4EOUA 1JPMA 3W2KA 1XM3A 3UY8A 4HPJA 4S38A 4LVGA 4J3SA 3UWWA 3BLEA 3HO8A 3UA3A 1ZU8A 2R82A 5GJNA 3UR7A 1BGAA 4C6DA 1EO7A 3M6YA 2G8ZA 1MW1A 1DKWA 1I4NA 4WJXA 5JBDA 3OU8A 3T81A 1ENUA 4KWSA 4PR4A 4GH1A 5FKYA 4AHOA 1A4LA 1SFSA 3P5YA 1JZ6A 1XCFA 1V8EA 1B0IA 2WOQA 4JTTA 3C8NA 2ZRVA 2Q8LA 3DHDA 3B8SA 3OW1A 4AXKA 4JN8A 4NXSA 2VC6A 3LCGA 4ZQCA 4H4IA 2YDQA 1SFTA 4R33A 4V27A 4MPQA 4R53A 3ARSA 1EC8A 2GSHA 3NYDA 3UZXA 2HXUA 1E9LA 2ALDA 1H62A 1H63A 3QGAC 4WSHA 3ANUA 3W85A 3NO3A 3S9YA 4MAZA 4IUGA 3GAYA 2CCRA 3L2MA 4AY1A 3WF3A 5K9CA 4UOQA 1VS1A 2H8ZA 3BURA 4GZIA 2VEMA 3KEHA 4EPDC 3B05A 3QH2A 1L2QA 3AYVA 1ZGDA 4Q8UA 1V02A 2HTMA 1W0MA 4IMCA 1IZKA 3MT1A 4U31A 4RNFA 2QUNA 4CD4A 5E9XA 3VOHA 1QO2A 4L4LA 2PWGA 1E56A 1Z44A 5G4EA 4AMAA 4L6HA 5BZAA 2YDRA 5DBUA 3VPLA 3G5EA 5LGXA 1TPWA 1BF6A 5EMUA 1EPXA 1QNOA 1C93A 3HGRA 2FTWA 4S2CA 3W37A 4DF0A 3PANA 3SECA 2DP3A 3NDOA 1CI1A 3U2ZA 3UESA 3VE9A 1Q4WA 1PTAA 3PBGA 3QFWA 4W7UA 1R46A 3PS7A 1XIGA 1FBAA 3I7SA 3OOQA 3PZIA 1E15A 4E3TA 1OF8A 1BRLB 1UBPC 3NQDA 6REQB 4I5XA 1F3WA 2ZRZA 3W7EA 3CU2A 3UNTA 3CM4A 2WLYA 4BQ5A 3S1WA 1FDYA 1ZCCA 4ONVA 4CU6A 2RDWA 3KDNA 4ZMGA 1GQLA 2OQLA 4ZZ9A 3A9IA 1YE6A 4HTBA 2Y7DA 1M41A 2PZNA 3LTSA 1WB0A 5I3GA 2QT3A 3F4DA 1RPXA 2P0OA 4O19A 1A50A 2OR2A 1TJ1A 3TA6A 2PCQA 4F0HA 3LBMA 5HR6A 4PULA 4RPQA 3MB9A 1C92A 2PA6A 3P8IA 5FL1A 4U2ZA 2J13A 4DZHA 1M6JA 2P53A 2CYGA 1OX5A 4JTKA 4F2TA 1NWUA 4S3BA 3NGJA 4DM2A 3IJ6A 4LAOA 2NVCA 4J7RA 1GYMA 4XUGA 4MKSA 2GWGA 2Z25A 3O06A 4HMEA 4KCTA 1CGVA 4LT9A 2GK1B 4JKMA 2VX4A 3QY8A 3IS4A 1ONEA 2CBJA 4ADTA 4ZXLA 2PTZA 3LM7A 1D8WA 3ITTA 4WIWA 3WNNA 3NZ1A 4NJJA 2EPNA 2X1RA 1ZTVA 2C16A 3L21A 1XC4A 3R43A 4R85A 9CGTA 2W66A 3W1LA 4OBRA 4KWOA 1IZJA 4PTVA 4O14A 4PMOA 2WMFA 3OA5A 2PDFA 1PXGA 3SFWA 2A3BA 4QNEA 2POZA 3RHGA 3BCDA 1H2JA 4IMDA 2D2HA 5CPLA 2GUYA 1XS2A 4BHYA 3GXMA 4F9JA 4O57A 3VMOA 1E6SM 2FH6A 3UWUA 1UWIA 1P7TA 1ZP3A 5CPOA 4AD2A 3G24A 4QJ1A 5REQB 5BOFA 4DF1A 1X38A 3JU2A 4Y9NA 1C91A 4B9ZA 4RKAA 2E68A 4A8NA 4C91A 1XLCA 1WKDA 4ZQPA 5F4WA 2WJZA 3GNDA 3SQMA 2QGHA 4GO8A 4HD5A 5MHBA 3RDKA 1HP5A 4R3UA 2ISDA 1TV8A 3LHWA 2Y88A 2I17A 5BOEA 5BU9A 2E9LA 3OVPA 2EBNA 3TX9A 4G7EA 1IEXA 4NNAA 3RIKA 4Q32A 4RZ4A 2YIHA 2ON3A 5M17A 3VC6A 1UASA 3HG4A 4P2VA 3W6LA 2CIPA 3RRXA 1N82A 1QHZA 1YIXA 1AQHA 3LBCA 3SB0A 4FF5A 1RA0A 4DYJA 5HATA 4WDTA 4J5NA 4QSHA 2WVVB 2AGKA 3MV11 3Q45A 4FLOA 3QRHA 1YPXA 3CUFA 3P60A 1LLZA 1TCMA 1W1PA 1VLWA 1XYLA 2DORA 3SZ8A 3MYOA 3WJYA 2X2GA 1W3NA 3TTSA 3WH5A 1FWNA 4UWMA 4HU0A 1O5KA 1EL3A 1KLZA 4PBFA 2R6OA 4AISA 4PRWA 1JI2A 2CWNA 1FKXA 5JVLA 4DJDA 1LWJA 2C0HA 4KBXA 3JUGA 5HMEA 2OEKA 2HDJA 3HQOA 1FCBA 2FDMA 3HG5A 2TPSA 1SZGA 3D46A 4Q4MA 1L6YA 2AAMA 1VFSA 1H7XA 4RUBA 4XG1A 4IMAA 4M6QA 2NV9A 4IX0A 3CT7A 4DLFA 5AC6A 2R94A 4X2RA 3QPZA 4OFCA 1ICPA 1GKPA 4KF1A 1R7OA 1JQXA 3TJXA 3TN6A 4CNTA 3WUEA 2DDXA 4C6CA 1MDLA 3GNRA 1R47A 4JTEA 3P14A 3ZVHA 3LI0A 4P8VA 1ONWA 3O6CA 4GUFA 5GNYA 5J5DA 2D2GA 4NAEB 4PUDA 1UP0A 4I7UA 2OX4A 2GJRA 3LX9A 4C7GA 3VGBA 1OK4A 3U3HA 1RD5A 1VD6A 1FY6A 1LT8A 2ZCGA 5HQEA 2PDWA 3DYMA 3GXPA 2CW6A 3ELFA 1MNZA 4PCSA 1IIHA 3QGKC 1XUUA 3QV8A 1JI1A 1ODZA 1G4TA 2IKHA 3FXGA 5ABEA 2QNEA 1K3UA 4XTIA 1KRBC 4O17A 2C13A 3FX4A 4N9CA 3GXFA 3ZM8A 5LIWX 4HMCA 4WY0B 3GDBA 4PUNA 2GVYA 4FNRA 1BWKA 4LXFA 1REQA 2WAGA 3VOJA 2DVUA 1OD0A 1CBGA 2VQTA 4EPKA 4TTUA 4UTWA 3AQUA 3VUSA 1CB7B 3IUHA 4IGHA 1DIEA 1KFWA 2OYLA 4H19A 3GSMA 1AA1B 3IIPA 1JVNA 4FR1A 3OZYA 1VPYA 1PDYA 4YN5A 1CLKA 4FXJA 1KV8A 5C70A 1W1VA 3SUVA 2WMJA 1SO4A 3MJMA 4DWSB 4DN1A 2XSBA 3L4XA 1ZBVA 3CUJA 3GC4A 1LDCA 1US3A 3SY1A 4DM1A 4KESA 1XIMA 5I3IA 3A3WA 3V5CA 2O55A 4GJ1A 1W31A 3RRAA 1B2YA 1FH9A 1E5JA 3W01A 4ZSTA 4Q6XA 3IV3A 2X05A 3B0YA 1FRBA 2SFPA 4LVDA 3VIIA 3PNZA 2XVLA 1JAEA 1S5TA 1HVQA 5I02A 1F8IA 3SY5A 3KBMA 5KEZA 1TTJA 1DE5A 1R6WA 2P88A 1SZEA 1H7PA 1H5VA 4FNUA 2REQA 1QCWA 1PHWA 1RHCA 3FV9A 1IGSA 1XPGA 4HCHA 1MXDA 1Q3NA 3ONBA 5D32A 1OIFA 3ITYA 1JR1A 1VHCA 3GDMA 2MUCA 3B97A 2E0PA 3T2QA 4TVCA 4MZYA 1NQ6A 4S1FA 3BG9A 4XVEA 4A3HA 2A3HA 5HWJA 4YVVA 4FP1A 2XINA 4MJZA 5MF5A 4IXXA 2OQYA 2PTXA 2DY3A 3RU6A 4OTKA 3VKCA 5C2CA 5I6SA 1ADSA 2C15A 3EBVA 3RJXA 1I2OA 1U5HA 2FGBA 1SUXA 4JS3A 2PODA 5CC6A 3WYZA 3VGHA 1FCVA 3KOZA 1HX0A 1YBQB 4ERIA 2F84A 4G6CA 1GT8A 4F66A 5DRIA 3IGSA 3LY0A 7A3HA 3OVRA 4C7FA 3CS2A 1S3TC 4Z1AA 1KV5A 4K38A 2BBFA 1K9DA 3GXIA 3EWWA 2IPGA 3ZR6A 3P7YA 5CBJA 3MMUA 3EWZA 3W26A 2ACRA 4GJIA 3VU2A 4CVWA 2G0WA 4ZCWA 2VCAA 1IEWA 4GA8A 1RJPA 4W89A 4LOCA 3TYZA 3AO0A 1QPQA 3SGGA 1EQCA 2DEPA 2E5DA 3WD2A 3HZ3A 1Z8AA 4KWUA 2PFHA 3PG9A 4FEZA 4XBJA 1E1CA 3I7RA 4XD6A 1JZ5A 1OQFA 1GVIA 1OZQA 2VO5A 4W93A 1CW2A 1N8WA 3QKEA 3G8RA 3Q94A 5A6JA 4G7FA 3LCLA 1FP9A 1Z7AA 4DJEC 2HK0A 5EMLA 1PEZA 2YA1A 1PV8A 1SO6A 4UFIA 5D8WA 4IIEA 3PPGA 1AK5A 3LM3A 2R1LA 5D09A 4M82A 1XGZA 3ITOA 1R86A 4H6EA 4AY8A 4JTCA 3DXIA 3EWYA 4KH2A 2W92A 4GIEA 3WJSA 2DSVA 1UG6A 3W0KA 1T40A 1UWSA 1QPNA 3ARVA 3JRKA 2V9DA 1CXFA 4B16A 5AYZA 3WENA 1EDTA 2VRKA 2VFIA 3STGA 3T4WA 2DUZA 1V02E 1ITXA 4QLKA 4ACYA 3HGJA 4DWDA 1HIZA 1CXKA 3W7RA 5HK4A 4I5RA 1HN1A 2HRWA 2QMKA 1NDVA 2QUTA 4LYQA 4H8HA 4FSAA 2YL9A 3BARA 3TZNA 3VZXA 4IOTA 1FWSA 4CQ9A 2WM1A 2ZIDA 5BXTA 2IS7A 2QDGA 5D2TA 1VEMA 1UQYA 4GIAA 3DUGA 3WNPA 2QUMA 4W8BA 3N15A 3R8HA 4D6FA 3THQA 2FZ8A 2XIMA 1K7EA 5LA2A 1ZUAX 3FDGA 5JUVA 1BWLA 4DAIA 1DJZA 5G2IA 1L6FA 1F76A 3TOPA 1I45A 5DMYA 4WUIA 2WHMA 2GVJA 4JYEA 2BSLA 4IFKA 4H9ZA 3LDVA 4U4MA 2XFWA 1QI0A 3PPFA 1ZLPA 1XLEA 3CUZA 3AZSA 3LU2A 1KR1A 3TXVA 4AAJA 2FVMA 2VTFA 1EPVA 3UPBA 5LNVA 3V3WA 4IIFA 4GC3A 3OQEA 1YNPA 1P0BA 2GFTA 5BRQA 4LEQA 4GVFA 3ALFA 4GHRA 2E67A 1GVOA 1HF6A 2W79A 3WK2A 1EUAA 5DT5A 2WHJA 2Y63A 3I3BA 4PCNA 2OZ3A 4O1EA 3AAMA 5HULA 4E38A 3VMNA 4S3AA 5F7UA 3TIMA 1C8VA 5H6HA 4ADUA 1F74A 4I90A 3HIJA 4B3KA 1M7OA 3VNLA 1T96A 7PTDA 3WLHA 3IAPA 1B9ZA 1O66A 3AROA 3QYSA 3UYCA 2QJIA 1FOBA 1I0BA 1OFBA 4B92A 4JY9A 1RV8A 1KM2A 2PMQA 1EWEA 1UPPA 3EPMA 4DB7A 2JEPA 3BMWA 3AICA 2EPLX 5JQ9A 4FX7A 4ZENA 6ENLA 1HJSA 1W5PA 4S3EA 3RPDA 1UOKA 1BPLB 2PRMA 1CTNA 1V6XA 3U4FA 3TQVA 4KKXA 2DW7A 4JQ2A 1NY1A 4E8GA 2Y5JA 2DZTA 4NYYA 4FOKA 5CBIA 2KZHA 2Z1XA 2IXVA 2PGRA 4O1FA 3H6OA 2C1HA 1J0HA 2VGFA 5A8NA 5FSEC 2V2CA 4UB9A 4B5NA 1ZFJA 3L67A 4RZ6A 1KBBA 3OGSA 4JFWA 2RDXA 3R6IA 2CZFA 3RCYA 4EPEC 3UPMA 3H55A 1R8LA 1D3CA 4NY2A 7ENLA 4K68A 4LUIA 1U5VA 4K3ZA 3WL1A 3L66A 3C0JA 4OVXA 1HUVA 2V2DA 3UD6A 1A5AA 1ONXA 4M3PA 5CSRA 5AYBA 3DG3A 3M46A 4DEFA 4AYGA 5LHFA 3EDFA 2DU2A 2PDLA 3QJAA 4LWWA 2ZRWA 3N2XA 3A4WA 1EJXC 1JCLA 4CQDA 3H12A 2V8ZA 3U48A 2B7QA 4J2PA 1MXSA 3PY2A 2VCBA 2AQOA 2VURA 2YYUA 4CN6A 1I2RA 1KXTA 4UTJA 2CZDA 1JZ8A 1TCDA 2Q6ZA 4GFSA 4JNYA 2XJ7A 1YTDA 3RXZA 2E8YA 1FCUA 4GGBA 1M1BA 3L23A 5HBFA 9XIMA 2W5FA 2BNJA 4N42A 3ZWTA 3LNMA 2IQTA 3H2OA 2FB2A 2Z1KA 3OGVA 2I5QA 1FXQA 3BG5A 5XINA 3UCQA 4S3KA 2X7VA 1PX4A 3A47A 3HPXA 4JTSA 4J40A 2QEZA 2CC0A 3KBWA 1H5YA 2QR6A 1KBKA 5CSSA 3W84A 2DGAA 2VQUA 4ORMA 3GO2A 2D0GA 4Z2KA 3O15A 3D5HA 1EJRC 1TWDA 2HEJA 4RCXA 2V3GA 1P6CA 1XH1A 5CKSA 3MMDA 4S2BA 1JDAA 4GRSA 2GUUA 3OHIA 1E71M 1PZ0A 2XH4A 2EKGA 4GH3A 2OTDA 3OVQA 1DVJA 1EP3A 2PD5A 4Q3MA 4UXDA 1EWDA 1TFVA 3SCTA 2H9AB 3UZ5A 2A3CA 4R7WA 3H2CA 3RO8A 3M0JA 3DG7A 1AODA 2GJPA 1WP6A 3B9OA 2GQ3A 3NPXA 2XFRA 4J1OA 3N13A 3DCPA 3ABRA 1Q63A 2ZQ0A 3ITGA 3THDA 3G3DA 5DCBA 2A6LA 3O0FA 3ARXA 2FZNA 4UCFA 4GE8A 1QK2A 2KAUC 2F6UA 3GG7A 4AF0A 1JYWA 1VYSX 2H6RA 5LIXX 3T8LA 1EF3A 1VYPX 3NFUA 3STCA 4CD5A 1SJCA 1EHAA 2O56A 2XIJA 1UR4A 4JHZA 4GKTA 3GUGA 1G7UA 1UQZA 4LCRA 2O4QA 2QCNA 1UR2A 3ME3A 3KVKA 5EFFA 5A8MA 4LALA 2TRSA 4H9YA 3AIVA 4IPIA 5CH9A 3S6TA 3W23A 3ZR4A 2HROA 3QMTA 4HYRA 4EACA 4IIDA 1IF2A 3O16A 4AYSA 3WNOA 3EMZA 4GUHA 2CNCA 5TF0A 2AKMA 2A21A 1VIZA 1X8FA 3T0BA 1Y5WA 4ROQA 1G1YA 1Y8BA 3GAKA 4K7VA 1Q6QA 4WY0F 4OU1A 4DJDC 4DUWA 3SJ3A 4XZWA 4S3GA 3P61A 3AXIA 2CU0A 4C6JA 3QQWA 3WLPA 1WZMA 1AL7A 3NCOA 1CEOA 5A6KA 2QPXA 3QY6A 2WMIB 2J25A 2E9MA 2V63A 4LUTB 4NZ3A 2GYIA 3W1MA 2ZZ5A 1ELSA 3ZQ9A 1GOMA 5RUBA 1TV7A 4BCEA 1R3WA 3BXWA 3H4XA 4TUFA 3IPWA 4KWVA 2UZ9A 3CASA 4O15A 1RJQA 2OKTA 3N6HA 5I5RA 4PUKA 2C91A 1WOAA 1GJPA 1FWCC 3R1ZA 3HJZA 3C4UA 3Q2DA 2NW0A 2XYLA 1BAGA 4UUIA 5FF4A 4ZTYA 4DBSA 4H6QA 2V5KA 5HUPA 4OJYA 1EGVA 1XSJA 2ZXBA 1TJ0A 1LWHA 3CXOA 2VC9A 5DCEA 4KEUA 1VZWA 5JMUA 2QYGA 3OLIA 1GK8A 3R89A 1PX3A 1PIIA 2CLOA 4IGSA 5D9OA 2BV9A 1TTQA 2A85A 3CV7A 1RK6A