2PD5A

Human aldose reductase mutant v47i complexed with zopolrestat
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
315
structure length
315
Chain Sequence
ASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHIYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Merging the binding sites of aldose and aldehyde reductase for detection of inhibitor selectivity-determining features.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Aldose reductase
total genus 106
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2007-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2pd5A00
2PDGA 4XK2A 1EXBA 4YU1A 1MZRA 3RX4A 4JQ3A 1IHIA 4QBXA 4LAUA 4DBWA 2F2KA 3EB3A 1US0A 3LZ5A 1EL3A 4PRTA 3G5EA 2HE5A 3O3RA 1MI3A 3ONCA 3WBWA 3WCZA 1QRQA 3LEPA 2IKIA 2VDGA 2PDLA 4YVXA 4L1XA 4RPQA 5JH2A 2DUZA 2ISFA 4FALA 2AGTA 1VP5A 4ASTA 3GHRA 2QXWA 4DBSA 1XJBA 3QKZA 3MC5A 3WBYA 1Q5MA 1AZ2A 4QR6A 1X98A 1ZGDA 2INZA 4DBUA 3CAVA 1LWIA 3ERPA 3UZZA 3V36A 4GCAA 4PUUA 4JTDA 2PDIA 3F7JA 4I5XA 1EKOA 1HQTA 3S3GA 2P5NA 3RX3A 2PDUA 4WDTA 4NKCA 2BGSA 2ACQA 4AUBA 2PZNA 2IQ0A 3WBXA 1A80A 4WGHA 4PRRA 1C9WA 1FRBA 4FAMA 2R9RA 2PDPA 4HBKA 2PD5A 4WDUA 4JQ4A 1T40A 4LBSA 4PUWA 1IEIA 1PYFA 4XVDA 4DZ5A 3Q65A 2C91A 3U2CA 3BCJA 4L1WA 5AZ0A 3UWEA 3CV6A 3M64A 2PFHA 1GVEA 1ZSXA 2DUXA 5LIXX 3EAUA 1Z3NA 2HDJA 4XZLX 5LIKX 1AZ1A 3M4HA 1PZ1A 1PZ0A 1EF3A 4HMNA 1X96A 3R8HA 2PDHA 5AZ1A 3UGRA 3RX2A 3G1RA 1LQAA 3N2TA 3M0IA 2IKJA 1RY8A 2PDFA 4JIHA 1ZQ5A 2A79A 3FX4A 3GHUA 1R38A 4OTKA 2NVCA 4WDXA 3V35A 3LQLA 3MB9A 3H7RA 4H7CA 3VXGA 2I16A 4GQ0A 2R24A 3LQGA 1S2CA 2BGQA 3Q67A 2PDYA 4XAPA 2PDJA 3GHTA 4LB4A 3CAQA 4PR4A 3LZ3A 4JTQA 4F40A 3N6QA 3CASA 3CMFA 1S1PA 3UZXA 1OG6A 4JQ1A 4GIEA 2PDNA 3LBOA 3EB4A 2IKHA 3KRBA 1VBJA 1S1RA 5HNUA 3DN5A 2BP1A 2ACUA 1YE4A 3BURA 2FVLA 4JTCA 1Q13A 1YNQA 3UYIA 4GACA 2FZBA 4LAZA 2PDCA 1AH3A 1XGDA 2PDMA 1ADSA 4WRHA 1XF0A 4ZFCA 2INEA 4JTAA 4JIRA 1T41A 4Q3MA 4YS1A 4XZNX 4IJCA 2J8TA 3R6IA 3T42A 4XZHA 4G5DA 2NVDA 3R94A 1SM9A 5LIWX 2FZ8A 5C7HA 4XZIA 5HA7A 4JQAA 3LUTA 2WZTA 4XO6A 1S2AA 3R58A 2IPGA 3P2VA 2FZDA 4YVPA 4XO7A 1MRQA 4H8NA 2PEVA 2HE8A 2ACRA 5LIUX 3R43A 5M2FX 2IPWA 4LB3A 2FZ9A 2HVNA 3LNMA 3UFYA 2PDBA 3FJNA 5HNTA 4R9OA 2WZMA 1RALA 2ALRA 3UP8A 4GA8A 1RY0A 3LENA 4Q7BA 2HV5A 3GHSA 3B3DA 4XZMX 3R7MA 4FZIA 1M9HA 2PD9A 2HVOA 5JH1A 1QWKA 1K8CA 1YE6A 1X97A 2PDKA 5DANA 1Z89A 3GUGA 4JTRA 2CLPA 3UG8A 2PDWA 3R8GA 4GQGA 4XVEA 3H7UA 1PWMA 4QXIA 2IS7A 3O0KA 4QX4A 3DOPA 1UR3M 2IKGA 2PDQA 5KETA 3ONBA 2PDXA 4WDWA 3CV7A 4EXAA 4PMJA 1YNPA 2IPJA 3NTYA 1ZUAX 3LD5A 2IQDA 4JIIX 1AH0A 1JEZA 3BUVA 4JQ2A 3WG6A 1Z8AA 2ACSA 3V0SA 2DV0A 4IGSA 1Z9AA 1AH4A 4YVVA 5LIYX 1J96A 1PWLA 3UZWA 3LN3A 4GABA 4IJRA 3C3UA 3COTA 4ICCX 2HEJA 3H4GA 4MHBA 2I17A 3V0TA 3V0UA 3UZYA 3BV7A 1AFSA 2F38A 4WEVX 2PF8A 4FA3A 1HW6A 2FGBA 4LBRA 4EXBA 3D3FA 2IPFA
chains in the Genus database with same CATH superfamily
2H9AB 4H6EA 4AMCA 4KIEA 2GVLA 1G1YA 4ZQRA 1OWQA 4CNNA 2P3EA 3SBFA 1HJVA 3UWZA 4RZ5A 5AYZA 3CQ0A 3CTTA 5JBEA 2G96A 1WYIA 2FLIA 4QLLA 3VK5A 4LJ3A 3WK1A 5DEZA 2ZZ5A 2CXEA 2V6AA 1CXFA 1UASA 3SURA 3TONA 2XH2A 2HE5A 3PWAA 4HB7A 1LWHA 4RDWA 4FLQA 3TAKA 4N4QA 2YGYA 3LM3A 1E9ZB 1V08A 1VLWA 3IJIA 3KTXA 2W9MA 3HGOA 2XN0A 5EYWA 2V2HA 4QNWA 2DIKA 1ONRA 4DBDA 1NF7A 2NQZA 3W26A 9XIMA 3VGEA 1EB3A 2W62A 2NX3A 3VTRA 3BOFA 1P0NA 2DZWA 4TVDA 4K8HA 1YKWA 1EQPA 4EX4A 3RPDA 3S1WA 3OVRA 3NPWA 1W1YA 4ILSA 4O1EA 5CG0A 2J9XA 4M19A 4GZIA 4GYKA 1I60A 3AICA 3E0WA 3TQVA 3LCFA 3VNMA 5IXEA 1N8WA 3THAA 4NZ3A 4GUJA 3I6RA 1NF0A 4LT9A 3B8WA 2HCVA 4P8UA 5G5IA 4U2ZA 3AXKA 3PZVA 3LPGA 3WX7A 3F2CA 4W86A 4HOWA 4FLOA 2YL9A 4DUXA 1EF2A 1TIMA 2YDQA 2OO6A 3M07A 3MKCA 3RRAA 1JCMP 5AZ0A 3VOFA 5F4SA 2Z1WA 3SGUA 1UR9A 1WOBA 1GVQA 1ZBKA 2DSVA 3AHVA 5BW6A 1E6QM 4FHAA 5CSUA 3LHTA 2DY3A 3HFYA 4NYUA 1SGJA 1WKYA 1V3MA 4I5RA 1OFOA 1PZ0A 3EMCA 2QR6A 4W5ZA 4DJDD 4YIWA 1EUAA 3GH4A 3UJRA 3TN4A 3BSGA 3MMTA 4AVNA 4ZOCA 1Q66A 1A50A 2OEKA 2G4JA 1J93A 1N8IA 4S2CA 1I2RA 2E7FA 3CIWA 3CZLA 2TRSA 4MWAA 5EL1A 1XCWA 4BHYA 1CEOA 3M0YA 1R38A 3LA4A 4GZJA 1LLWA 1KXTA 4LBUA 2VCAA 5BXRA 2J79A 5D37A 4CNOA 3G24A 2I16A 2VRKA 1KRBC 2VWTA 1LP6A 4UNIA 3DH7A 1F8MA 5HDRA 1J01A 4MUZA 1R7AA 5BOEA 3FS2A 3VABA 2CETA 3WL1A 1FH7A 3ITVA 1SU5A 3S4TA 2DZBA 1SPQA 1MUWA 2ZX6A 3TQPA 4IQEA 3RLGA 5HNUA 4ADSA 4X60A 3S1UA 5FJTA 3S5NA 2PP1A 3N25A 4QITA 5DY3A 1IT7A 1V8EA 5HQLA 1TV2A 2CHRA 5CPLA 3VNDA 1Q8JA 1O66A 3V1PA 1UP3A 1TPH1 2XVKA 3WQ8A 2AMGA 3MS8A 3UYCA 2GWNA 1YLVA 3P0WA 2J13A 4LY8A 3T42A 3KCOA 1HGWA 4R7WA 1IZCA 1PVNA 3SUTA 4FMVA 2BVTA 5HA7A 3EWXA 5HBFA 3LPOA 4A21A 3AHYA 1LRNA 1XIDA 1XIMA 3UY8A 1KCZA 4Z1DA 4AIOA 2ZXAA 4WSKA 4YVPA 3U2EA 3LRLA 2X1TA 1HVXA 4LNCA 1I4NA 1HKMA 1KV5A 3W81A 4JKLA 4PEKA 3QM3A 3KDNA 1IEQA 4H8HA 4XAZA 3NQ6A 1OY0A 2OZ0A 4F0SA 3W7KA 3WFLA 2QGYA 2TMDA 2Y89A 4ZMGA 4JTEA 4PA8A 3PTKA 5I3KA 2X16A 4RXGA 3B3DA 3KOFA 2ODOA 3W82A 1KCLA 4GQBA 1EFZA 3VKAA 1H09A 4FZIA 1GQIA 1ITCA 3OLIA 2O4QA 3EZ4A 3G22A 4AW7A 3QPEA 3XIMA 4O1AA 4G7EB 3PBUA 4Q4KA 3M0VA 3QW4B 1FFQA 4Q8QA 2DQXA 3UCQA 3LGDA 4ADUA 1V3JA 3ICJA 3HJZA 2CLKA 1AL8A 2IS7A 3S1XA 3O0KA 1FHVA 4C6QA 3C56A 4CU8A 4H04A 2YXXA 2WC7A 1TUFA 2PB1A 3S2JA 5LHEA 7PTDA 3NPVA 2FDMA 4M0XA 1H3GA 1SFSA 1FTXA 3BUVA 1U1UA 4EWJA 4URIA 3ARXA 3FGCA 1JF6A 3T0TA 2QULA 1P4CA 4AHOA 1E1FA 4ZOEA 5EMUA 4IGSA 3LRKA 2WAGA 2W5FA 3V1HA 2YBTA 5CGMA 2XWEA 4TVCA 1GVRA 4H4IA 2AOSA 3LN3A 4MDPA 1MO0A 3E74A 1QNOA 3ZLHA 2QJMA 3PTQA 4C6CA 4D71A 4UZSA 4ATDA 2VD8A 2J24A 2FDSA 3QPYA 2NXHA 3AS0A 1PDYA 4NAEB 4LUSB 4WGXA 3V7PA 4FA3A 2PLMA 3WF1A 3SCOA 4DO4A 1BFNA 2VOTA 1RLCL 2WB5A 3K4WA 4UR7A 4S3KA 4L7ZA 4M6PA 1F07A 1US3A 2VDHA 4JQ3A 2D24A 1U33A 3OGRA 3I3EA 3VNIA 3PZUA 2BX7A 1EIBA 1WO2A 3C2EA 1GOKA 2ZRZA 3FHAA 2P88A 1EL3A 1FWFC 1CGYA 3DIPA 4PTDA 3T09A 4A05A 3GTXA 3G5EA 4P7NA 2QCGA 4WXYA 3WBWA 5G2IA 2FHFA 4GNVA 4NAFB 2ZX8A 1FWDC 1E9YB 3BTNA 3LEPA 5ECUA 1UD3A 2ON3A 1I0DA 5JH2A 4TO8A 3FSUA 2QUUA 3BO9A 4JHMA 4IIGA 4IP7A 4BR1A 4DUOA 1I2PA 3GBEA 3LV5A 4D6EA 3F2BA 3VNYA 3QV8A 3VGHA 1WA3A 2OLAA 4QR6A 1BRLB 5F2GA 3BMVA 5D02A 4Q6JA 3LTYA 3EA3A 5C70A 1XV8A 4IM4A 4O0ZA 1OZMA 4ZQNA 4EPKA 1CGWA 2VI0A 4UOZA 4I7VA 4ZSTA 4U5IA 4CNSA 1VBUA 1QI5A 4AVFA 5I00A 2VURA 4GYJA 3SUVA 1Q4WA 3OIHA 2ZZ3A 3VFCA 1CGUA 3GW3A 3A4AA 2GGGA 1TJRA 1KRAC 1XISA 5HUOA 2RDWA 5XIMA 1G69A 2PZ0A 4J35A 3LCXA 3GX9A 4PUWA 1DJNA 2XH4A 2VC9A 4GFSA 4C91A 4WCJA 2NQJA 5I6SA 3EB2A 3AC0A 4GD0A 1OEPA 3GXTA 2P8BA 1LJYA 2DUXA 1S5MA 3M43A 1KR0A 1YTKA 1Z3NA 4KCUA 3USBA 4E0CA 2VGBA 3S9YA 2I1OA 2RHGA 1UPMB 3B04A 3STPA 3KLLA 2RAGA 4Y7EA 3IRSA 3W76A 4WUIA 3LYEA 6XIAA 5CXPA 2EG8A 3GXFA 3LSBA 2OQLA 2I5GA 4CN4A 3SQMA 1WOAA 3VMPA 3QR1A 3P80A 4PBGA 3O2LA 3TN6A 4ORMA 4O0QA 4AY7A 2ZRVA 3I6TA 4FOUA 1K1DA 4J40A 1XLKA 3W71A 1DQUA 4RNJA 1ZLPA 1XSJA 7REQA 3WO8A 3GIQA 1JPKA 1WB0A 3AYTA 3FJ6A 5D03A 2NX1A 1M6JA 3UZJA 4YN5A 1MW3A 4R85A 5I7GA 3D46A 3MA8A 4JIEA 4AFYA 3M9YA 4ZZ9A 1EX1A 3VOIA 3MDUA 4ZB5A 1PS9A 3G2GA 3T07A 2WHJA 1YPXA 1RP8A 1KM4A 1WDQA 1UWIA 1DJYA 1KM1A 1ISXA 2V5KA 3HURA 4IPLA 1VBRA 1OFAA 1EJWC 4JKMA 5D9MA 4UTTA 5FF7A 3CXOA 5LA2A 1S1RA 3PZGA 3HV9A 3QQ1A 4DB7A 2HNEA 6ALDA 2BGNE 4EAMA 2D2JA 2WPGA 1E9IA 3HM7A 4A22A 3V5FA 3APGA 1J0YA 3IWPA 5IDZA 1V6TA 4XBSA 2XH0A 5D30A 3NEVA 3M41A 2VX6A 4D6IA 1A5UA 1V7AA 3L4UA 4U31A 5HNNA 4HNVA 4YYFA 3WYZA 1K9FA 3R6IA 1V3LA 1HFBA 1C9DA 1YADA 3IJ7A 1TZ9A 4RX0A 1EC9A 5LA0A 3LSCA 3R8RA 4JICA 1THFD 2WZTA 4HKPA 1GTHA 3QR3A 2ZADA 4WY0A 2CBJA 3VCNA 4C90A 5I02A 1XPGA 1EHNA 2DJXA 2HE8A 2HJPA 4ONVA 1XIFA 3TH6A 3ITGA 4ROQA 2Z4GA 1VFHA 1L6FA 1A0DA 3VZYA 4X0NA 4XIMA 3SY8A 2ALRA 1G94A 3PULA 2JFEX 3P81A 1MDRA 4UTJA 4XZMX 4JY8A 3W7QA 1JCNA 1R9YA 1UH4A 1LL7A 3FA4A 1OFEA 3KHDA 3L4ZA 3N3MA 1E43A 3GDTA 1QI0A 3WENA 1WDRA 3L5LA 4A8LA 1K8CA 3T4CA 4DO6A 1M65A 2Y63A 5FSDC 1I2NA 1NDWA 3LBMA 4H9XA 3CUJA 5DANA 4R88A 5AHLA 2ZUSA 4GNKB 1D3HA 3UG5A 1FY6A 4F9JA 3CTLA 4B5SA 4PMNA 5A6SA 5A6LA 3N2BA 3ZJ7A 4QXIA 3H2MA 1GOOA 3GC4A 1SZNA 2G4FA 2CZFA 3SRKA 4W7UA 2BDQA 1XFBA 4DEFA 3HQNA 4EXAA 2I5QA 4PUMA 1HZYA 1ISYA 3DC8A 1JR1A 2VEMA 4K7YA 3TA6A 2GFTA 4DJEC 3HG5A 3B8UA 3MQTA 2POZA 2X1UA 2GK1B 4JCLA 2YB4A 2CIPA 3DUGA 2VZOA 4QM1A 4WY0B 1SO4A 3QHMA 4AEOA 3IJDA 4FO4A 2VL4A 2E0PA 4JGDA 2H8ZA 2G8ZA 3TIMA 3UZWA 1JL8A 4IJRA 2ZUUA 2HPIA 1SJCA 4E4FA 5LGZA 4JTJA 1ONWA 1TB3A 2HEJA 2QS8A 2DORA 1KTBA 1GQJA 3MY9A 2CWNA 3B8TA 2Q8ZA 3FEQA 4WEVX 3VCCA 2XVLA 3GK0A 1EWEA 2PP0A 2YSWA 1EGZA 3UR2A 1RXOB 3W2KA 2IPFA 2A3HA 4UWMA 4FXJA 2QCHA 5FKYA 1QBBA 5DN1A 1FXPA 5KSWA 1CGXA 2QJNA 2P0IA 1E9LA 2V38A 1XG3A 3ABXA 2YCJA 1F6PA 1LRQA 1R2SA 4MMWA 3GG8A 4TTGA 1QUMA 1JYNA 2AAAA 3TYUA 5BWAA 3RJYA 1L2UA 3TVAA 1YX1A 3UCDA 4YVXA 4YHEA 4NP7A 1OX5A 4L4LA 3IVUA 4L4PA 1WZAA 4RUBA 1W37A 1H5VA 2EPMX 2PTXA 1OK4A 4LS2A 2VX5A 2C16A 1W0MA 7REQB 5K4ZA 2YPIA 2NX9A 5CZJA 1OC5A 2KX9A 4QLJA 5A6JA 4LUIA 2ALDA 3PBMA 3GW0A 3G3DA 4B2DD 5KMYA 4N02A 2VNCA 1RD5A 4L6OA 4JTDA 4DJDC 2OT0A 5I3DA 1R7OA 4O57A 9XIAA 2DIJA 2W6RA 4UFMA 2XGBA 3L2LA 1BPLB 5A8PA 1MXDA 1DV7A 2YCEA 3UWWA 4C7FA 5BXTA 4Z17A 2J4GA 1DQXA 1CB2A 2XSXA 3O63A 1DJXA 3BJTA 3EXSA 1I1XA 2BVYA 3BW4A 3K1GA 4UMCA 2ISWA 1TTIA 2Z6IA 5D32A 4UTUA 4QEEA 2XM1A 2CFFA 3QV9A 3ZT7A 1X8CA 4FNQA 1XDJA 2I56A 3W1QA 3CIVA 3K30A 2O55A 4IFOA 4UFLA 4IQLA 1C8VA 3TKFA 4QDWA 4OVXA 1JXKA 5FAJA 3AYVA 2W0UA 3NZ1A 3C8NA 3ENLA 6TIMA 2D2GA 1XX1A 3VIPA 3N6HA 1JCTA 1LQAA 4K39A 3VINA 1W32A 1TTJA 3OO2A 5E5CA 4ZEPA 3TTEA 4R33A 1WZKA 3RR4A 3HZ3A 1UQYA 4L1GA 1IQ8A 4K36A 3JUGA 1G67A 1ECEA 4WDXA 2PMQA 3LQLA 3BW3A 1C7SA 1EOMA 4NF7A 3ABRA 1XBVA 3ZLFA 5K4XA 1OGBA 3RJXA 1A5KC 4Q7IA 2XN2A 1DWFM 1ZP3A 4Q6XA 4GBDA 4IPPA 2GSHA 4TIMA 2EBNA 4HNTA 4L6DA 4UCFA 3DI1A 2HS6A 2KZHA 1VZWA 1OCQA 3FA3A 3M5XA 4MYXA 4YXGA 4PRWA 5CPNA 1M7XA 4ZR8A 4F40A 1V02E 1VEPA 1BKHA 2AL2A 1ITUA 1VS1A 2LLEA 3CUIA 1EYEA 3O9NA 2O7QA 1RSCA 3PM6A 5BROA 2ZE3A 1WDPA 3E02A 4WKAA 4K1GA 2WNQA 5CZTA 4JFVA 3S6DA 3T2QA 4DJFC 1E6ZA 1B2YA 4PUKA 1Q3NA 2J62A 3RR1A 2INEA 1XIEA 2V67A 4NVTA 2XU2A 1E0TA 3S2MA 1XBYA 4JKKA 4DY1A 3G1XA 3DGRA 3RU6A 3TA9A 1TE6A 2J8TA 1PTAA 1KGXA 4GG9A 4H83A 1ITQA 3R5EA 3HOJA 3QQWA 2E4TA 1EGVA 3RGTA 4XZIA 2VEKA 1CXEA 1WAWA 3QSRA 2VCCA 2G41A 2DSWA 1GQKA 3VNKA 1VB9A 4XO7A 1UD4A 3AMCA 4XUYA 4W84A 4DF0A 4KFNA 2XSAA 4ZO8A 3S1VA 2BG5A 3PZTA 1Q6OA 4DYEA 2ZC1A 4MAVA 3MYPA 1C7TA 3QV7A 3TCSA 2B7NA 4GJIA 5BYWA 4WLCA 2D1ZA 4AD3A 2QYGA 2ZE0A 1E71M 3ITTA 1E0UA 1R86A 4UTMA 3W25A 2QMJA 5LXXA 1HGYA 1YBQA 1ICSA 3ITCA 5CH9A 3RMEA 4L5ZA 1K9EA 2WJZA 3NL6A 1QXLA 2D3NA 5U4NA 1M53A 1XD0A 5TNVA 2R91A 5BMWA 3WDPP 1KQZA 2WMIB 2PDKA 3A6OA 4PUDA 3W28A 1UWUA 3WMCA 3R8GA 4GQGA 1XH0A 2BXVA 1TX2A 2YFNA 1XUZA 4POCA 1UKOA 4NASA 1A0EA 3BMWA 1ZAJA 3M1ZA 1XG4A 5DQPA 4GXMA 2Y7DA 3WNMA 1Y5XA 3W1XA 4Q8PA 3CV7A 1QWGA 4RKAA 3EKGA 4CQBA 5IBXC 2OZTA 3D0CA 1R6WA 1V6YA 3GR7A 4UZUA 2X1SA 4KPLA 4FI4A 1JAKA 4XBKA 1BGGA 4AD1A 1HKKA 3CEUA 2G97A 1RA5A 1HO1A 3TW7A 3B0VC 3UG4A 4NIRA 3POHA 2PLCA 4NZ1A 1V6VA 1JAEA 4QE4A 1SO6A 1QASA 1VYRA 8TIMA 5ABHA 3CUHA 4Z2LA 4V28A 1O5XA 2QHAA 1W3NA 1KM5A 3FHQA 4CN6A 3O6DA 2PRLA 4CQ8A 5G1YA 1MNSA 4H2HA 2A3LA 3MO4A 2PDGA 3ZYZA 4XK2A 2C79A 1JQXA 2WCGA 3HF3A 1OCJA 4QAWA 3T05A 2I14A 3OZYA 3LHYA 2Y6ZA 3TTOA 3BXWA 3E2QA 3Q4DA 4G1KA 3VGFA 4Y90A 1UKPA 3AYRA 4KT2A 1HJQA 3QTPA 4CCZA 3VX1A 3KL3A 3NQBA 3VDCA 1NDVA 4PRTA 4Z2JA 4JZ5A 3P82A 3A47A 1W6TA 4DYJA 4KEVA 4I9TA 4RZ6A 1U5JA 3HGSA 2ZUMA 1A5OC 4K8EA 4M1BA 2JBMA 3W7CA 4S3AA 3W2UA 4A3QA 2R1NA 3IV3A 2A21A 3BK0A 1E3XA 2NWRA 3UERA 3NQMA 3LX9A 5JVLA 2OLHA 4ACZB 4O8AA 2JE8A 1AZ2A 3GDLA 4NZ4A 2I57A 4Z1AA 5CBBA 3ZT6A 3KL5A 4Q8UA 2INZA 1V0KA 4JYDA 2P0OA 3ERPA 1ESWA 2DT2A 3T4WA 3DFYA 3G6LA 1RHCA 4MADA 6REQB 3RO8A 3L5AA 2X09A 3RHGA 2QW5A 4A3HA 1VFSA 1UR4A 1X1ZA 4PBFA 5HANA 3N2CA 3UW6A 4D8LA 5JQ9A 1ECQA 1A47A 4FAMA 3WNPA 1ZJBA 2AKMA 3GVWA 4WDUA 7ODCA 5F1UA 1HKVA 1KFLA 2X2YA 3WQGA 1EQCA 3H6OA 1VQTA 5HK4A 1B4KA 4LGXA 2C91A 4DF2A 1UA7A 2Z2BA 4BI5A 1F3TA 3KRZA 2A3BA 4ZFMA 3CL7A 3KOZA 4H6KA 5FEZA 4YNGA 4WKFA 5A6AA 5TD4A 1XRSA 4WF7A 2PURA 1VBHA 4KBXA 1GKRA 3HPZA 4P5UA 4UFJA 3PUOA 3CM4A 3E0IA 3GKAA 4UOJA 2ZDRA 3R11A 2OKTA 1PB0A 1GEHA 3INPA 3WDJA 3BLOA 2VWSA 3L2MA 1TR9A 2XJ7A 3APYA 3UNTA 1UH2A 1WUEA 3OVGA 4H9VA 1US2A 2ZRUA 1HXJA 3ITOA 2ZA1A 4E4UA 4IHCA 3UVIA 3DYPA 3ZJKA 3LV6A 4IIDA 1GOQA 1YDYA 2VTFA 4H8UA 2DH2A 3BOLA 1AL7A 2ESCA 4RW5A 2ZUVA 5C2XA 4PL2A 2ZRWA 4TMBA 2QCDB 1C8YA 4C5ZA 4D1JA 1VFMA 1JYVA 3AUOA 3E6EA 4IPJA 2BV9A 3EDFA 3KE0A 3OW1A 3WF0A 1QI3A 3CGTA 4DHGA 1FCBA 2OXNA 2J7GA 4KF1A 2VR4A 3SB0A 1OJXA 5E0KA 1MUMA 5C0QA 4Y2WA 3WJZA 2BP1A 1S38A 2BXYA 5G4WA 1VJZA 3SGZA 1YNQA 1IGSA 2ADAA 1ZFJA 2VFEA 2VZVA 1TZ7A 5FA5A 5I07A 3AFBA 5DFAA 2QIWA 2H9AA 1A4LA 2JKEA 3E38A 1AH3A 2AL2B 4LOCA 1PSCA 2DZUA 4X0VA 4WSHA 1RUSA 3WK2A 2ZFAA 3GXIA 3GXDA 1MNZA 3M0JA 4JN7A 1HT6A 3LTSA 4UR8A 3TW9A 2XIIA 1LDCA 3BCFA 4JCMA 1NM9A 5C54A 3ELFA 3P3BA 1U5VA 1WNOA 1BYCA 3MUIA 3UEQA 3ZXWA 3HMCA 4WY0F 3OB8A 1UWAA 4C1LA 4XZBA 4YYCA 3PSVA 4AZ5A 2C18A 3JRKA 5JU6A 1Y0EA 2WZHA 2JK2A 1TIWA 4EE9A 1HUVA 1R2TA 3GO2A 3QMTA 2V9DA 2QT3A 1IIHA 3A9BA 3HGJA 1BXBA 7TAAA 3GTIA 4C6IA 5LXEA 1VF8A 1ZBWA 5F2LA 5EA9A 5EB8A 3T0DA 1HF6A 2OSWA 1OC7A 1PO9A 4F48A 3TXVA 1LUCB 3S1GA 4CD5A 2HVOA 4BF9A 2D0FA 3BG5A 3CWOX 1YE6A 3UJEA 4O16A 2G3JA 2YOCA 1ME9A 2EO7A 1NJJA 5EBAA 3KP0A 2DEPA 4JTRA 1KM0A 3KOXA 1F76A 3TMLA 1W9DM 4V2XA 4J3XA 1EUNA 2TODA 1MXSA 5CZKA 4HSOA 1WX0A 1EJVC 4J28A 4A6GA 1Z7AA 3RDKA 2D0GA 4NX5A 4I8DA 1M1BA 3CZGA 3BLKA 1I8JA 4KEZA 4TV5A 1KO0A 4GJJA 3LD5A 3DFOA 2GUUA 3CAWA 3P5ZA 5BXPA 2AAMA 5J5RA 3KXQA 3DHUA 2E40A 4QG8A 2REQA 3NYDA 5H8UA 3HMJG 5LHFA 3VYLA 3EDKA 3P8IA 1RP9A 3NOYA 5I3FA 3D47A 1S2UA 5FAGA 2V69A 4YCPA 1FVPA 4A29A 3LXBA 2J7DA 3COTA 3L0NA 3ZSSA 2VDIA 2G5WA 2WCSA 2PWVA 2QIIA 3G1FA 1EP2A 1XRVA 4IG2A 5FL0A 4YL2A 2WK2A 2Y8UA 4F0MA 1GG1A 2FGBA 4JTHA 3D3FA 2VC7A 5ABTA 2DJLA 2J47A 4N0RA 4HU8A 4F2TA 2ATSA 2H90A 2MUCA 2V2CA 6REQA 3EX4A 3M44A 3EMZA 4N4PA 4WD0A 4U10A 4CNTA 3CZEA 4WOQA 2PI6A 2CZ5A 3VI2A 1NDYA 2VC6A 2RDXA 3GG0A 1JZ5A 1VPXA 4LXFA 1E3ZA 4W7WA 2BODX 5IRPA 3TYEA 2OQYA 2W61A 1O12A 2VQUA 3WLHA 3F5JA 2CLLA 4IUGA 5D04C 2WVUA 3BC9A 3CLWA 5DRCA 1A5BA 4W88A 2FHBA 3MMUA 2ZKMX 6PTDA 1VP5A 5KEZA 2VVNA 4HSHA 1RBOB 3JS3A 4O10A 3UJSA 4V15A 3H55A 1S3TC 3A3XA 1N7KA 3AOFA 3NO5A 5KZDA 4O8RA 3ZMRA 2WZIA 3PFMA 4DBUA 3WFAA 4BKNA 4AD4A 4QS6A 2ZZ4A 1UC5A 2DT0A 4NZJA 1ZL1A 2D73A 2FHCA 3B8DA 1EJRC 2PDIA 1OIMA 4WKHA 2BOFX 2VD9A 4LS1A 1TVPA 3G0UA 1UBPC 3GU1A 1PEZA 7CGTA 2UY3A 3HFTA 3BAWA 3O0FA 4PTXA 3DECA 1P6CA 2BVWA 5CJMA 3W7GA 2R9RA 4AF0B 5ABFA 4MJZA 3NWRA 3S5SA 1IXPA 1OSEA 4PGLA 3IACA 4UNLA 3Q65A 3WLNA 1XCXA 1GJWA 2DUAA 3L7RA 4KETA 4GIYA 3TR9A 3B40A 2A6LA 4GY1A 4AIBA 2CLFA 4AH7A 1OC6A 1GVEA 4MWAB 1GVFA 3ITLA 3UVAA 2DW6A 2QUMA 1YDNA 5G1MA 5ABFB 3QYQA 1A5LC 1ZJHA 3VIFA 3RAOA 4RE0A 3RU8X 2JGQA 1B9ZA 1AQFA 2VCBA 1XFCA 1ADDA 4LRSA 1FXQA 3CL8A 1QVBA 2D22A 2ZOXA 3IUHA 3QF0A 3W2NA 4IIEA 4UFIA 1M01A 1MWOA 3LGGA 4NU7A 3PVFA 5FSEC 3L4YA 3CUZA 2PWUA 3MI6A 3W6LA 4QQUA 3S8HA 5GVJA 3GVRA 2F8QA 4OE7A 4CCCA 1UR2A 1NVMA 3KS6A 3NURA 4DJFA 3ARRA 4DBEA 4GINA 4B9ZA 1W9BM 2AL1A 1JDCA 1GOMA 4GWEA 2R1PA 1QO2A 1XIHA 4G8TA 1NWUA 3NR0A 4NJKA 2OX1A 1NWTA 3UZ5A 1BHGA 4GH1A 3LI1A 1GUVA 1SZRA 2J8FA 1P5BA 3GNRA 3AZTA 1AJZA 2QNEA 4HU0A 4IGMA 3FW6A 1IT8A 1RVGA 5TF0A 5BWFA 4JTTA 3S9IA 4TQTA 1EGMA 3UZXA 4REQB 3W7OA 5L6UA 4C7GA 1PL9A 3A24A 4GUFA 3GZAA 5LNSA 1LLOA 1RLDA 4ZQOA 1KV8A 1PX4A 4LAZA 2ZA3A 2BB0A 4GIAA 3KDOA 1XGDA 2Z26A 2RKXA 3NDZA 4DQWA 3TOPA 3WLSA 4LWWA 5K9CA 4AD2A 4M7SA 4O17A 1PZ3A 4NX0A 5AN7A 1T41A 3ZSTA 4IICA 4QP0A 1J10A 1PX8A 3QC3A 4HN8A 2NVDA 1LWJA 3WF4A 3NQVA 2YDSA 3V16A 8CGTA 4JQAA 3S6OA 4LPCA 5C9UA 4F4RA 3TFCA 4P2VA 5CZ0A 4A8IA 2WZEA 3R43A 2QDHA 1ODUA 5CC5A 3N14A 3S2CA 4XAGA 3G77A 4TX9A 4N2YA 1VFOA 3K4AA 4C6KA 1BSLA 1RY0A 4HPJA 5FF4A 5PTDA 3REQB 3ZR5A 2Z1BA 4PUJA 2YYTA 3T0AA 3GHSA 3F1QA 3CIXA 5B7ZA 3A4XA 2DZSA 2WSQA 5GJPA 1MFUA 3LLFA 2DGAA 4IMFA 2ICSA 1MW0A 3NL2A 5XIAA 3FYYA 2WPBA 4WHBA 1QBAA 1KBLA 4NI8A 5HJLA 3T8QA 3N9SA 2NV9A 1Q63A 1Y7VA 4MPQA 1XR2A 1CNVA 3AZSA 4PFHA 4OBTA 3EXRA 2Y88A 3L5MA 1W3HA 4M6VA 2QCEA 4HZ7A 2J7HA 3L0KA 5AC7A 4LCSA 4MTVA 2Q3OA 1A0CA 3LOTA 3REQA 5CC3A 1B54A 2VXNA 4JL2A 4FB7A 2NQLA 1POJA 1BWKA 3ZQ9A 3TJIA 1OF6A 1FQ0A 1NOUA 3N12A 1OM0A 4R7JA 1Z8AA 5BOOA 4OKDA 3OZPA 2A0NA 3RILA 3V0SA 1T8QA 5A1AA 4LEQA 4B5XA 1AODA 4GPNA 4AY1A 3WBAA 2W91A 1FWIC 2RJGA 3L4WA 3MDWA 1ZRQA 4S3FA 3KBWA 1CB7B 1I9CB 2V3GA 3KWXA 4QNEA 1WBJA 3WDRA 4OIFA 4HZ6A 5FI8A 1G01A 1G4SA 3V0UA 1UR0A 2HBVA 4Q8WA 3M0ZA 2J66A 4E8CA 2OWXA 1HL8A 3LXAA 2GWGA 1TJ1A 4LBRA 5KZEA 2GPTA 2YL5A 3IJ9A 1ZAIA 1P1XA 3QVQA 2FPTA 3ZS4A 1NP2A 3E96A 1JD7A 1SQ7A 1D7KA 3N13A 4PCNA 1PKMA 3NGFA 3MPGA 3TLLA 2GJLA 2F2KA 2ZXQA 1X7FA 5E9XA 2YKKA 3LZ5A 1XW8A 4P61A 1FCQA 1Z44A 1DHPA 2E8YA 4ACYA 1DQWA 4ZXOA 4HD5A 2GQAA 3K2GA 1MI3A 4B90A 1YTEA 1UZ1A 3NSXA 4RL3A 2R14A 2ISFA 1T99A 4NRRA 4A2RA 1FWJC 3CPRA 4PB5A 8XIMA 1XBZA 3S42A 3J7HA 2WHMA 3UQNA 1QJWA 5DBTA 4MKVA 4OZOA 2AQWA 3CH9A 3RLHA 3CAVA 1N82A 4LVFA 1DXEA 3QV6A 3WLRA 1VH7A 3SCVA 4PTVA 4GCAA 4PN2A 1WXJA 3EX2A 1AJ0A 1CXKA 3ZLGA 2EG7A 1SO3A 3TP4A 3GDBA 2G3MA 3KBSA 2WMFA 1TPFA 1QHPA 3KVKA 1ZALA 4Y9NA 3B9DA 2OCZA 5DXYA 1LROA 1TCDA 1X8FA 1JD9A 2H3DA 2W3ZA 3WBXA 3WUEA 4PRRA 4IMCA 3CHEA 3AS1A 1OHLA 2PD5A 3L66A 4DWSB 3N4FA 3POCA 4ERAA 2HISA 4KS0A 1IEIA 4XVDA 6XIMA 4ZO6A 3U2CA 4FIRA 3CNYA 3L12A 4IL0A 2HXUA 3UWEA 1YXCA 3CV6A 3FK4A 2D23A 1W1ZA 2AQVA 4DJFD 4O18A 5HINA 3W7DA 4TXEA 5D9OA 2XVGA 5XINA 1KFKA 4AZIA 2I5IA 1MUCA 5D2YA 4EACA 3M4HA 4ERIA 4W8LA 2GVGA 3HIJA 5DMNA 1B3WA 3TNOA 4B91A 3UA4A 4UFHA 1IXOA 3WQEA 5LGXA 1A5MC 1WP6A 4Z42C 3WEZA 3G1RA 2A85A 3C8FA 4E3TA 1V6WA 5HUPA 1GYNA 3CWHA 3W7PA 4IOTA 4XD5A 3WQDA 3LHZA 3BQ5A 2YXGA 1AQHA 4OQVA 4M5PA 5MHBA 4IIHA 1UOKA 3MB9A 1WDDA 3NQEA 1H51A 2OEJA 2X42A 1KRCC 1XYMA 2JEQA 5HNRA 1TRIA 3Q2DA 1KNWA 1T96A 1S2CA 1TWDA 3MMWA 1OT1A 1A53A 1NOWA 3OYXA 4GZ7A 4NUWA 3HA1A 1L8PA 4PMVA 3HG3A 3G0XA 1HNYA 4MFDA 1KBBA 2VYOA 3HQ1A 4MFEA 2BHYA 4XAYA 1EYWA 2WM0A 5A2BA 5RUBA 3LBOA 4LYQA 2GL5A 4LH8A 3TTSA 3C5QA 3S5OA 1N8FA 5I3JA 2Z1XA 3BSHA 4J9JA 3P61A 5HQMA 2VUNA 2O9OA 2CXGA 4P8VA 4OUIA 1ONXA 4M8UA 1Y8BA 1KBIA 3H2EA 2Z00A 1VBGA 4JX6A 3B0XA 2OOFA 3RMJA 3IARA 1HG3A 4TOQA 4Q3MA 5REQA 4ALDA 2Z7KA 4J2MA 1XXXA 1JZ7A 1SM9A 3EXTA 1EBHA 3H2NA 3IPWA 3W27A 1E4NA 1P43A 5HJXA 3MP5A 3FYPA 3PSWA 4JX4A 5DBUA 1XLLA 5LNVA 1MRQA 2GGJA 3VIIA 4TVUA 4LB3A 3OA3A 4NXSA 3UFYA 2JALA 4NILA 3DYMA 3FA5A 4A3YA 2YLLA 3U4FA 1BSIA 3P6LA 2VELA 4NNCA 3M7SA 3MBDA 4HSNA 4FNRA 3F5KA 1ME8A 2CLHA 4V27A 2V5JA 4F79A 3VE9A 1OBAA 1WUFA 3M7WA 3W1PA 2E1DA 2FKPA 4L4MA 3GUGA 2NXGA 1QOPA 5J8LA 3AJXA 3ES8A 1JIBA 1OT2A 1QPNA 4FLRA 4ROPA 1JDDA 4AWTA 3MHGA 4LAKA 5KETA 1UZHA 1P1MA 4I3GA 2VR2A 4H7ZA 3P84A 3OPSA 2UV8G 1XL9A 1L0PA 3ITXA 2A1YA 3GIYA 4NNBA 3FJLA 1A3WA 4Y96A 4ZGYA 3BLEA 1F73A 3OBEA 3IIOA 5DMMA 4LUTA 1CLXA 1V3IA 1SMAA 2Y7FA 3B97A 2BS9A 1E1CA 2E25A 4W87A 1SFJA 4O1BA 3QR0A 4YVVA 2EEXA 2CZVA 1MSSA 3SRDA 2VKZG 5C71A 2FQIA 2ZC8A 4F0RA 1X1OA 1XC6A 2FMNA 5EMKA 5LA1A 3KAOA 3CO8A 1V0LA 5C9ZA 2I17A 3W9ZA 3V0TA 1DVJA 3G18A 1D8CA 5A6KA 4DJDA 1W1TA 3E1F1 4NJGA 4F0LA 1F7BA 1KFJA 4D6CA 2WXDM 1E1EA 5MKGA 2CBUA 3GNNA 4AD5A 2Y5EA 2NXIA 3PK7A 1AW5A 2QQ6A 2QAPA 4KRZA 1K70A 3VDBA 3FOKA 3R89A 3KVJA 4O1DA 4LUJA 1JUEA 3QMRA 1JGMA 4GJ1A 3SRFA 5F4WA 3WK3A 1WAUA 3NZGA 3K5XA 1EEPA 4LEFA 1DWIM 1XIBA 5HMFA 1M7OA 4Z1CA 2E5CA 1PJ9A 1YHTA 5EFFA 3E9AA 4PC8A 2QKFA 2OGJA 4ZE4A 4Y8FA 1OG0A 4O4VA 4DIAA 2V68A 3AXHA 3MMDA 3VNJA 2VO5A 4MB1A 3MC5A 2PA6A 2X0SA 3F03K 3I7RA 1VENA 4KKXA 3NSMA 1P6WA 1JCYA 1GCYA 1OCNA 4IFKA 2F6KA 2DT1A 2DSUA 3NQCA 2FMOA 4DRSA 2DVXA 3UXKA 3ABQA 2ZIDA 1QW8A 2E6DA 3N19B 3IGXA 5G4EA 3AMLA 2FH8A 3A22A 4LF1A 3WELA 4MUPA 4LUSA 1V4YA 5FJUA 2J9ZA 3GSMA 2R6OA 5K2ZA 3A23A 5C55A 1IWAA 4C6JA 3VIJA 2G3IA 4MOZA 5J5DA 3WEOA 6ENLA 4AEFA 4IQJA 4J7RA 3CT7A 4ATLA 4DZ5A 3OG2A 3APTA 4O19A 2GZXA 5DMLA 4Z0JA 2QVHA 3IK4A 1UQZA 3NPUA 1Q2RA 2OWCA 4W7VA 1KXHA 1M3UA 2OYMA 1YIXA 1W3LA 1O95A 4WQ6A 5M1TA 4F3HA 4C65A 5C9RA 1PZ1A 4MIMA 3VUSA 2B81A 2ZWZA 2VFDA 3R1ZA 3ZJ8A 2WBKA 1UG6A 3GWQA 4JTKA 5A3HA 3C0SA 4GFIA 4MNMA 3FDKA 3TLQA 1X38A 4JEJA 3SQLA 3RX2A 4E4PA 4O12A 4B5NA 3T40A 3ZR6A 2FJUB 4GZEA 1SW0A 1V7YA 3GVGA 4NXKA 1E6XM 3EOSA 3PFRA 3CMJA 2XIOA 4F0HA 4B2DA 5HMDA 2PRHA 1KM2A 3P62A 5GPRA 4ACZA 5F7UA 1QNSA 4PCSA 4R9XA 2V2DA 3H7RA 3VOHA 1LG1A 1E56A 3UU0A 1QMLA 3ORWA 3TK7A 4IISA 1OX4B 4YWIA 2FIQA 2ZZ6A 3SCQA 3ZWSA 4AZHA 3VNLA 4Z1YA 3M47A 2AKZA 4LANA 4IXXA 4NL1A 3B0UX 3RM9A 4GYPC 2PWHA 4MAZA 1I75A 1EDTA 3R79A 1G5AA 4L4OA 3E2RA 3MU7A 7TIMA 2O56A 1RK5A 3SIMA 3DG3A 2PTZA 3MSGA 1UIOA 2PBOA 4JTQA 1YW1A 2YCKX 1EBGA 1S39A 4AYSA 1OG6A 5I5RA 2WCAA 3PBWA 4BEQA 4I7WA 1VBJA 2Y8KA 4EK7A 4D6JA 4H19A 4QJ1A 1RPXA 1OGGA 4JTCA 4NI3A 3W70A 3ABOA 5SWUA 4CD4A 5AB3A 5G4HC 4D8ZA 2OWWA 2V3DA 3VM7A 3B05A 1N2VA 3CQKA 4B9YA 1QO5A 1GQLA 4YS1A 1Z6KA 1D2KA 4BQ5A 1F05A 4XZNX 2VFIA 3DCPA 3QZAA 3R94A 4LV4A 3W02A 4XSLA 2YBUA 3W1TA 2WV8A 1V0NA 2IPGA 1PE1A 1DJWA 1XDLA 2YZ5A 5LIUX 4BQ2A 4XAFA 5M2FX 4HA1A 4C60A 4ZO7A 3ABZA 3OLEA 3QRHA 2JF7A 3SY5A 1C8XA 2WSRA 4OHQA 4IPIA 3C2YA 5AHFA 4RZ4A 4KCWA 3WLJA 4CQCA 1OIFA 3KBMA 2J25A 3U8GA 5G2HA 3VAVA 3IJLA 4US5D 2PD9A 3SSJA 1GTEA 4ZOAA 3RIKA 5JH1A 1LQ2A 4HGXA 4PH6A 4RW3A 1S5VA 1GZ1A 4IL2A 5A6BA 4IH3A 2XINA 1UP2A 4TUFA 4DPQA 4H01A 1P0DA 2AQOA 2VM8A 3AXXA 1ENUA 1O6IA 1TPEA 3QTGA 4XVEA 5AVHA 2JF6A 3TYAA 4QDMA 1RBLA 1WDSA 1XLBA 5LNRA 2PCQA 4IJBA 1TPVA 1EJSC 1P0KA 3D5HA 2NQ9A 1FWRA 3VO0A 2E67A 1GYLA 2YYUA 4X9SA 3SFWA 1ZUAX 2E9BA 4AZ7A 1DOSA 3PWGA 4B3LA 1GVYA 4IPNB 1RH9A 4UMBA 1J5TA 2OSXA 2NW0A 4HCHA 3NZQA 1C93A 3L2IA 4HNCA 3ARWA 3MBFA 1W9UA 1TPUA 3ZM8A 3CYJA 4AXKA 1Z9AA 3IIZA 2OTDA 2XGZA 5I79A 4JTFA 4QJ5B 1O94A 3GXNA 1KBKA 3HQPA 1M03A 5EMMA 3GH5A 3BZJA 3AXIA 3IJ8A 5A8QA 5I78A 1FKXA 1OX6A 1NELA 1LOLA 3WFZA 2ZA2A 3M46A 1LUCA 3W01A 1E73M 4JS3A 1O7AA 3SZ8A 3OQEA 4NZFA 3L4XA 1FWSA 1EX5A 3I3BA 2FB2A 3HPFA 1F3WA 3AMDA 3ANYA 1I2QA 3CPGA 4UQ9A 2BY2A 1KGUA 1JF5A 1EIXA 1GEQA 1U1JA 3KWSA 1ZENA 1Q7MA 3BAYA 2W67A 1AMKA 2XIMA 4UTIA 4NRSA 4JTSA 2B31A 4NJJA 3QOKA 1QRQA 5D2XA 7A3HA 1Q6EA 3PC0A 3UXAA 1YEYA 3NDYA 1TREA 4J3TA 4IGHA 2CBVA 3QZ6A 3TR2A 1KB3A 1Y5VA 2DUZA 4JD4A 1X1NA 1FUYA 2HK0A 3MANA 1DJZA 4ZA0A 2EXOA 2OGYA 5EGRA 3B9EA 3TYZA 3AHXA 4ASTA 1MYRA 2XTKA 2E3ZA 4MZ1A 3PNUA 1B0IA 3QZEA 2CLEA 1F8IA 4JTUA 1Q5MA 2YW4A 1E51A 5CAHA 1A3XA 1JJKA 3DYOA 1E15A 5A6TC 3T9PA 3AROA 2PTYA 3WJSA 4AD0A 2RGMA 2JKPA 3N4AA 4RNHA 4GH3A 5CGQA 3IGUA 3PJTA 3URNA 4DN1A 4S3BA 4UB9A 3P0XA 5A6MA 5A8NA 5EMYA 3VIMA 2FYMA 2PGFA 3FKKA 2FZNA 3IUIA 2RDUA 1W5PA 1L2QA 3OA5A 2VVSA 1FCUA 2PF0A 1OB0A 2P76A 4L61A 2MANA 4Z2HA 3K8MA 1W9PA 1RD6A 2CYGA 3H8AA 3DHDA 4LC8A 2QJJA 3T0CA 4XD4A 2V81A 1PIFA 1OFDA 4M29A 3PBVA 4DX3A 1YPIA 3PZQA 1J0ZA 2J6VA 3C2FA 4HMNA 4TX8A 2DPEA 1KLYA 4F2BA 4F66A 3ZVHB 2G50A 2EPHA 2BVDA 5AZ1A 3EX6A 3P93A 2KAUC 2DZPA 3W1LA 3M5ZA 3KP1A 5DY2A 1AMYA 4LVBA 4U33A 1Z42A 1HL2A 2PE4A 3O07A 1UBSA 3SJNA 3JVAA 4ZQPA 2QLYA 1QNRA 1REQB 4RE3A 2EPOA 2J9YA 4JHOA 3UR7A 4UMAA 3GLCA 4BQ3A 1W2VA 4PYSA 3SSZA 3F4NA 1B3ZA 5TQLA 4MB3A 1KW1A 1TWZA 3O05A 4NT0A 2C15A 2AMXA 3E49A 1XYZA 1E72M 4MB4A 3T78A 1O5RA 4MDOA 3NO3A 1QATA 1XLCA 3Q37A 5CPTA 4XAPA 3EOOA 4YJ5A 2P53A 1EJXC 3LZ3A 3AIVA 2OSYA 2OX4A 3KCJA 3TWBA 2WM1A 1UH3A 4GIEA 1I1WA 5CSSA 1TFVA 1QTWA 1KQYA 1MRAA 1BG9A 4HIBA 3EOLA 2FJKA 2OMAA 3OZOA 4Q4MA 3H2OA 1B3YA 5EMJA 3QLLA 3V4BA 1XIGA 1YYAA 4FNTA 2BXZA 1XIIA 2HS8A 4MF4A 2J7EA 1RA0A 4B16A 5E6ZA 3GFXA 3IJQA 3BGJA 1H7NA 5A6BD 3UESA 2OVLA 1HTIA 5LIWX 3CU2A 5AKQA 3IEBA 3GIPA 1BF2A 3GE7A 1CI1A 2WQPA 3PJWA 2RDTA 1R3RA 1RPKA 2PEVA 4LX4A 2ACRA 3EGJA 2B7QA 1R30A 1JZ2A 4DF1A 1LT7A 4UCGA 4N9CA 5K3VA 1H0IA 1M7JA 1MXGA 3ATZA 4S1FA 2J7CA 1ZHAA 2WLZA 1FHDA 2UBPC 1NQ6A 1H1YA 1UR1A 2C0AA 2ZX7A 2UY4A 2W79A 3AJ7A 5ABEA 8A3HA 4HPGA 1EDGA 1OVDA 1G0CA 3NQ7A 4GIRA 3NQ8A 4MWAC 2B0MA 4HHLA 4FEZA 1ZB5A 1NH6A 2WLYA 4O54A 4Q32A 3GM8A 4RV8A 4ZE5A 4LV9A 3R0DA 3V75A 4AWUA 3DGBA 1PWMA 2JEPA 1KD0A 3HPAA 5B80A 4P7LA 2CHOA 4BF5A 1XINA 5CLTA 1GOXA 4BWLC 1DIEA 2ISDA 5GQBA 3QH2A 3GFYA 1HN1A 4HYVA 2Z2UA 1Q85A 3M5VA 3MUXA 3RRXA 2CW6A 4K6AA 1B31A 2PCEA 1TWWA 1CWYA 2ACSA 3OHIA 2EAWA 2DV0A 3VM5A 4UTKA 3AZRA 3MVTA 2WJFA 1MEWA 3U7BA 4DAFA 1J96A 1IZJA 1BVZA 3GXPA 3LHUA 3W7EA 1PTGA 3ANVA 3GU9A 1FP8A 3UR8A 3VKJA 4E5TA 2V0TA 3A4WA 3T44A 5LSMA 3UZYA 3FCPA 2OU4A 3STFA 3ZZ1A 4X63A 1V79A 5MF5A 2CC0A 5CEWA 4M80A 2ISVA 4E2BA 2R1KA 1DWAM 1UPPA 4GUGA 4AQLA 3VIHA 1F3EA 1P6BA 5A2CA 2XFYA 4HPNA 1MVYA 4MLJA 4I7UA 5DMYA 3Q45A 2IUZA 3WSUA 4O14A 1G7UA 3PUEA 5CPQA 1TYGA 1TMLA 4FX7A 1EA0A 5H1WA 4NYYA 1V3KA 2BZNA 2C71A 4CVWA 3H22A 2IKIA 1W56A 4MB5A 3W7LA 3U9IA 3CB8A 2AGTA 3CUGA 4W9TA 3BGAA 3UF9A 4GUHA 1FH8A 2G3NA 4ZL1A 1DL3A 5CPMA 3LM7A 3PZIA 3AS3A 1JCLA 5AECA 4RK8A 3ARPA 5CGTA 1BKSA 1PDZA 1DIKA 2VZSA 3UZZA 1DKWA 4ATWA 3MHUA 1T6MA 3UWYA 1KTNA 3TJLA 3LB0A 3VGDA 1KXQA 3F7JA 1K8ZA 1LF1A 3L0GA 4ZTXA 2WMGA 2HNHA 1ZZMA 1DP0A 1K4GA 4OGZA 3MT1A 2VGFA 1ZJAA 2OELA 1F9CA 4JPGA 1A80A 3SEPA 1C9WA 1MQPA 5D05A 3KLKA 3CH0A 2WJDA 3WQ5A 1NSJA 2QV5A 3AWNA 2E68A 2PRMA 3VC6A 5HOSA 1PYMA 4P7RA 5GNXA 1GNXA 4IP5A 1FA2A 4DLFA 4FR1A 3AIQA 1I6NA 3TJ4A 2CKSA 1SFTA 5I3HA 1WXYA 5D9PA 1F3XA 3GUWA 3YPIA 1TWSA 2VC5A 3DBPA 4LVGA 7ENLA 2V5BA 4JOMA 1TTQA 4XZLX 3H2CA 3TFXA 2J7BA 4C7DA 4WK9A 5LIKX 4FXRA 2CHNA 1LTDA 2YJQA 3TE9A 2ZX5A 4FXFA 3IIXA 2GGHA 3T55A 1IE7C 3AXMA 5MKGB 2QZRA 3B9NA 1EJUC 2IXUA 2V8ZA 2WSPA 5EY5A 4QQ3A 1QPQA 3PHAA 4G7FA 3WF3A 1K77A 4OOUA 2ZTKA 4R3UA 4A8RA 4BWLA 3U0HA 1TV7A 4NZCA 3EWUA 2A2IA 3MI2A 4JBRA 1YDOA 5I03A 2Q02A 4JYEA 3GAYA 4GVHA 5FJPA 1W1VA 2NVCA 1XLHA 1SSDA 3TU9A 3NVDA 4B15A 1JYXA 1PKNA 3GD6A 3QLDA 1FWAC 2QEZA 1SR0A 2ZUTA 2NSXA 3GC2A 3W7MA 4IFRA 1TTPA 1IXNA 2XYLA 1BEUA 3P5YA 4JDYA 1CGVA 4TU1A 3UA3A 3BLLA 5AOUA 3W2LA 1XICA 3M0LA 5FESA 5HQEA 2FGLA 5LZLA 1XGZA 4D8AA 1TQXA 1AW2A 3FVMA 4Y9AA 3UCCA 1GWJA 3EB4A 3WLMA 3DN5A 4MYAA 4LFYA 5I09A 5CBIA 4E3VA 2EPLX 1SZGA 2Y0FA 2POTA 3VGBA 4XTIA 6CGTA 2FZMA 3WQ4A 1IGWA 4E6MA 2NQHA 1R3YA 4QSFA 1UZ4A 4HNUA 4HA0A 4NAEA 1K6WA 2F6XA 3FLUA 4JNMA 2QPUA 3HU7A 3RCMA 3SCNA 3G1AA 1ISWA 1E5JA 3EDDA 1KFBA 1RCXB 1G9HA 4IJCA 4XZHA 4BS0A 4DVOA 1FDJA 4KERA 2TPSA 4H9UA 5AC4A 4X2RA 3KS5A 3WIJA 3W74A 3KW3A 2WHKA 2PWEA 2Y70A 3JW7A 1M7PA 4BCEA 3QY7A 1JPMA 4A2SA 1JPHA 4R9OA 5C9WA 1RQBA 4GO9A 1JZ6A 1TPB1 4FX8A 4BI6A 3QYSA 4J3SA 1LG2A 4TV6A 3L67A 2PGRA 2CNCA 3CHCA 5REQB 5D2WA 4IX0A 3VC5A 4GK8A 1TCMA 1Y65A 3DC0A 3GG1A 1TMHA 3L9CA 4HPXA 1Z48A 2V63A 5H6HA 4US5A 1K9DA 1NIUA 1Q6DA 5E1QA 3DERA 3MSYA 2BY1A 3TQKA 3CBWA 3U48A 2TSYA 5DT7A 1J5SA 3O06A 4B5VA 1QNQA 1BWVA 2BASA 4EPBC 4KEUA 2O7SA 3P14A 3NQDA 1KFWA 3LG3A 4HK7A 1PZ2A 1AH0A 1XWYA 3N6JA 4XV0A 3IAQA 4Y8EA 4D6GA 3B9AA 4LYRA 4AVOA 2EQDA 3WG6A 4AAJA 3W2MA 1S3HA 3OZMA 3W7HA 3RXZA 4UIOA 5ENLA 2Z6JA 2JGYA 1Q2SA 5LIYX 4MWAD 4R7OA 3CHFA 4D72A 4EF9A 4H9ZA 4R27A 5BU6A 5HAOA 2A6NA 3FV9A 2C3ZA 4RDYA 2F38A 1N55A 4O4WA 3WDHA 1R3VA 2XFFA 3TX9A 2PODA 2PU1A 3BLIA 1W3JA 1K02A 4GVFA 4FP1A 3SECA 1D3CA 3BQ6A 4E2OA 1MZRA 5D4YA 3E2SA 1TPC1 3HG2A 2VT0A 3C3NA 4JN8A 3S47A 5A2AA 1K6AA 2VFGA 1XC4A 1KA9F 1XI3A 3VNZA 4AISA 3WNLA 4DBWA 1ADOA 1GW1A 1TUXA 5BXSA 1VCGA 4O50A 1X6LA 3TMQA 3IS4A 1A49A 3SGGA 3WD1A 5AHMA 1XM3A 3G3MA 4XD3A 3T2PA 1GHSA 1JRBA 2P10A 4GX9A 5DF0A 3WCZA 5FEPA 1EZWA 3TOYA 2PDLA 3MHFA 4KGJA 1E6NA 3KOWA 2BMBA 3CC1A 2GUYA 3PG9A 1S2WA 1JI2A 4GO8A 3EOUA 3B0YA 2BBFA 4IMEA 1J2BA 4HK5A 3FVDA 4AEEA 4Q22A 1VR6A 3GR4A 2YW3A 4ZQCA 1ZGDA 4HZ8A 1TRDA 5JUVA 4ML4A 2WMJA 2NV1A 1VLIA 3C86A 4DI9A 3ZO9A 3VOJA 1TPWA 3GVVA 4I5XA 2W4XA 2X30A 4O13A 1SJAA 4UTWC 1KM6A 1WV2A 3DFTA 3W1AA 3W38A 2VX4A 3THCA 5E9AA 4IG2B 1FKWA 3EWWA 1EO7A 1Q4NX 2Y7GA 4NKCA 1POKA 5EPDA 4XZWA 2ACQA 3WJXA 1ICPA 2IQ0A 2PZNA 3NNTA 4ZBCA 1FRBA 1YTDA 3MUAA 1QI4A 2OYKA 1QPOA 3BVJA 1BXCA 4K38A 5M5DA 1WKEA 3VZZA 4GXPA 4LUYA 2VUYA 2E5DA 1JNEA 3B9OA 4GI9A 3E0FA 3AO0A 3GBDA 2BTMA 1PYFA 1RVKA 1OABA 2FFCA 1EO5A 2REQB 4Q4QA 1O68A 2L5HA 1OFRA 2BFGA 2OQHA 2VOMA 1ZSXA 2NSOA 1TG7A 5LIXX 3OGVA 4J5NA 1S2TA 1Q8AA 2XWDA 4L6HA 1H60A 5D8WA 4X2PA 3UNDA 3R10A 1R0MA 1XLEA 3GYCA 5ABGA 2NZLA 3FFSA 3BJFA 1X96A 3II1A 2WHLA 4A3UA 1TVNA 2VEPA 3UGRA 3S46A 4AY8A 4M24A 4S39A 4HMCA 3N3TA 3WF2A 5I2UA 3M0IA 3KBNA 1NFPA 3G1DA 1ZQ5A 3EEGA 1XYFA 1W3KA 2NT0A 4DWSD 4E2DA 1WDWA 4JEQA 3B03A 1E5NA 1JYWA 1VCFA 4FNUA 3AHZA 1J6PA 3QGKC 3N04A 3KVLA 4GQ0A 3UWUA 3CLMA 1VD6A 3E0VA 5AHEA 3N17A 3I3DA 2P3ZA 1H7OA 1JCXA 1W17A 4GCXA 5DRIA 3EPMA 1H7WA 1RJPA 3B06A 4H6QA 2OB3A 3GYEA 3U6WA 1K03A 4ICMA 3N18A 3SRHA 1DIOA 1GKQA 3U5UA 1H50A 3K1DA 4W85A 2CU0A 1FWBC 1R47A 3LS9A 4QAIA 3CJPA 1JUKA 3V3WA 2Q01A 1MZHA 1LL6A 4JNZA 3G6MA 4HOXA 3KBVA 2WSYA 1XGEA 4L9ZA 2FFIA 4FF5A 4GGHA 4I6VA 1Q13A 3BARA 4XB3A 3W29A 4AZGA 1TJ2A 5KTLA 4GACA 1UUQA 4R34A 5AYBA 1DWGM 3FAXA 1PUDA 4AC7C 1CPUA 1V51A 3EWZA 1BXNA 1XIJA 4WRHA 3GR8A 5T9BG 4ZFCA 1U2YA 4UFKA 3SIZA 4JTAA 3F4CA 1O1ZA 3RYSA 1DJGA 4ADTA 3SI9A 4PTNA 1UWRA 3H4WA 4BZYA 2FVMA 2P8CA 4I6KA 2NLIA 4P7OA 3LUTA 4H6RA 1EWDA 4NG3A 2FZDA 2GJXA 4MG4A 2Y62A 4DZAA 3TW6A 1IR2A 3EDJA 4PMYA 2J88A 3KRSA 4DWSC 1OCBA 1P0EA 3DKLA 2QCCA 4NZ5A 2HMCA 1VHNA 4GKTA 2OLSA 4KWOA 3SN1A 3PP7A 1VAHA 3MCNA 1UWQA 4OBRA 3MP3A 4RDVA 3G8EA 4TTUA 3EX3A 3ZWTA 5KZMA 2YA0A 3LCHA 3MZNA 3TWAA 4HNNA 1BVWA 2QCDA 2CLOA 3IAPA 5TIMA 5I3GA 2W92A 2YBVA 1BQGA 1UKQA 3DU0A 3EPOA 2CZEA 3WMSA 4QIUA 5FJRA 3BLDA 3M0HA 3LGEA 3H53A 4HPHA 4B5UA 3CO4A 3T6CA 1HIZA 4H8VA 2CLPA 1IYXA 2F2HA 3UD6A 4Z2GA 3H7UA 3V5CA 4BF7A 4REQA 5AC8A 4U4MA 1J4EA 4KEMA 4UQCA 2RGLA 1E0WA 5I23A 1JUBA 1ZNNA 5JIWA 3RPMA 3T7VA 1YRRA 3M0XA 4DAIA 1Q6FA 4H00A 2FGZA 2DZVA 4M56A 2JKAA 4CN1A 3O6AA 1JEZA 2JIWA 5T8GA 5E09A 3H21A 2IW0A 2HROA 2C1IA 4K68A 4UQDA 2VGIA 4QSHA 5CPOA 1VYSX 4PUEA 1CW2A 1LCOA 3K8LA 1UB3A 3MUY1 2DW7A 4JFWA 4PULA 1F4AA 1F4HA 3OHMB 2HRWA 1F6KA 3C3UA 3AMGA 5FJJA 3NFUA 3EWYA 4ZTYA 3URQA 3AIWA 4LRTA 2DSZA 4JTIA 1ZS2A 5AYIA 2XHYA 4JTGA 1GPWA 3SCUA 1ZY9A 4IUOA 1U30A 3ITYA 4U28A 2VZUA 3VMNA 2OZ3A 3T2OA 5C2GA 1PHQA 1R5YA 2E8ZA 4J4KA 3MV01 2B7OA 2NLYA 1L6GA 3C0JA 1ML1A 4JFSA 1XHGA 4B4FA 3OP2A 1W1IE 4QEHA 3VE7A 4XTDA 3H54A 1MW2A 4C6DA 4HTYA 1W5QA 3HBLA 2GJXB 4PL1A 3WLQA 1H7PA 1L6WA 1FDZA 1J0JA 2XDFA 2QMKA 3ARVA 4L1XA 1WPCA 2I9EA 2BHZA 1XRTA 1QDSA 2Z1SA 2YXOA 1ZP4A 3UETA 4C5YA 2PWDA 2WVTA 3GHRA 2CESA 4CQ9A 3CPUA 4DBSA 2I9UA 4PB3A 1MEIA 4K2SA 3WUBA 2XPKA 1V03A 1TWIA 4HZMA 1NFGA 1CZ1A 1OF8A 3RM8A 4PUUA 2Y2WA 4QRNA 1G7VA 2QJGA 1K3UA 1DBTA 2ZRYA 1EKOA 3AU2A 2TYSA 5BZAA 1RJRA 2Y4SA 3WN6A 1O60A 5HPCA 5E93A 3AAMA 3N15A 1SZEA 4QE1A 4W8AA 4ZENA 4L64A 1UUMA 1X6UA 3THDA 3KBJA 2GDVA 3UY7A 2PDPA 2J8GA 4UR9A 2BWGA 2HBXA 4CCEA 4IXHA 1VPQA 5D09A 2GUBA 1XBXA 1T40A 3UWVA 2CITA 4AYGA 3RCNA 4S2BA 3IANA 4O0KA 5TAOA 1RK6A 3DESA 4LVAA 3WLPA 1JDAA 2NT1A 4OU1A 1SW3A 3UPWA 3SUUA 3O8AA 4NY2A 2WKGA 4MJ4A 4QCEA 2P50A 2QCLA 4OWGA 1NEYA 3W7IA 2ZXBA 3CQJA 2WQDA 1J79A 1ALDA 1XCFA 4GBUA 3MSDA 4MZYA 1W3TA 4PMDA 3PS7A 3GKFA 2YX0A 3MUCA 4C1NB 1WCGA 2CBIA 3FN9A 3GRIA 1UW9A 4UTTC 3RITA 3BGGA 5DCEA 1L8NA 1F74A 2D2OA 2WWDA 3LCLA 4N6EA 4D6HA 1E40A 3BMXA 1H1ZA 3R13A 4LTSA 4G9PA 4P8WA 3CHVA 3GZ3A 2YL8A 3N2MA 3QY6A 4ERGA 1HO4A 4MVAA 5JMUA 1AG1O 4H7CA 3W6YA 3URAA 4EPEC 1YBQB 3KVMA 3A9IA 4EXQA 4BJHA 3FXYA 1OD8A 5T26A 4DZIA 3W87A 1DEDA 3PZOA 4RLIA 3O1NA 2XSBA 4QFUA 3O15A 1VIZA 3DKJA 1WXZA 3OBAA 1Q6QA 3NL5A 3GTHA 4B4HA 4S3CA 4KWUA 3DG7A 3SCTA 3RFAA 3PB2A 4IIBA 3A5FA 3TSMA 4M7TA 4BY3A 4I8YA 4D6FA 3WQ6A 2A7RA 1UC4A 4GVIA 1ZBCA 4ENLA 3C2VA 3NJ3A 3WLLA 4YCOA 2O92A 3I6EA 4DI8A 3W1UA 4RZBA 4U3AA 4UTLA 2IQTA 2WNWA 2WNZA 1KKOA 3W75A 4J3WA 4MNLA 1K7EA 3CZKA 3OEXA 1GJUA 1VRXA 4E38A 4ZO9A 2GQ3A 1GVIA 5DCBA 1VPYA 4C6EA 3UXLA 1HJXA 3DAQA 4XUGA 1XRFA 4NJIA 1BTCA 2PS2A 2VFHA 3G1YA 4GHRA 3AI0A 3NM1A 5CC6A 1CX9A 2FZ9A 4HMDA 4CEUC 3FJNA 2ZWYA 4CGTA 1JZ3A 1A5AA 4WSJA 1RALA 1QCWA 1C90A 3OU8A 5E0FA 3SN4A 4N6FA 1XP3A 2ZZ7A 1JI1A 3LTPA 4XKYA 4QTGA 1EJTC 1B57A 3PPHA 5I3IA 1GVOA 1GK8A 1XKJA 1QWKA 1R9ZA 3WH9A 2J6XA 4X22A 2XIBA 4OECA 4OUEA 5JBFA 1CECA 4UOQA 1W9XA 5IHRA 3EWDA 1CXHA 1CT5A 1MQQA 1E4MM 1TR1A 2PDWA 4QS5A 4OOZA 3P60A 1CIUA 2NUXA 3RN6A 2ZTJA 1JGIA 1SW7A 2Q3RA 4QX4A 1H0GA 1F6YA 1NQKA 3VD4A 4CQDA 2DH3A 3UPMA 5IHSA 4WDWA 3MI3A 3RCYA 2JQXA 4HJFA 4Y9OA 2UY2A 3R12A 1H11A 2WKLA 5K9DA 3FAWA 1IWPA 4INFA 3R25A 3C2OA 4GYPA 3PJUA 2A3CA 3A12A 3QJAA 4B92A 3UPBA 4GC4A 1G6CA 2FVKA 3R2GA 4JXCA 3JZUA 2OODA 1MFVA 5AYYA 2GVJA 4KGLA 4Q4OA 2BOGX 2Z29A 1K7XA 3QY8A 2ZVIA 3JZEA 3NQGA 3BV7A 4I9JA 3WNNA 1MDLA 2G37A 5LNWA 3LNPA 1NY1A 4RV3A 3HPSA 1GOIA 3BAKA 3EPNA 5AFDA 1F61A 2GDQA 3TNBA 2D20A 4KRUA 3W3OA 1J12A 4HYRA 4YTSA 4LAUA 4ECLA 1W2PA 1RAKA 1IT0A 3I4EA 3TYDA 5A8OA 4KCTA 2Z1VA 1PBGA 3NO1A 2DSKA 1XYAA 4ZSUA 3O3RA 4MJMA 3ONCA 3BSMA 3AQUA 1OZQA 3L65A 3P67A 4Y9MA 4G6CA 4LAMA 4JFUA 3LMZA 5EMLA 1R3WA 5DLCA 4FALA 1K8YA 3W37A 4KIRA 4DJED 1XJBA 4RE2A 3WH6A 1EXPA 3QGVA 4FX6M 5EFDA 3WD3A 3UXDA 3SCSA 4GI6A 1O1HA 1REQA 4QISA 1IEVA 1TSIA 1MQRA 3C0QA 4AWSA 1LWIA 3W72A 3HB9A 2BY0A 2YL6A 1XLAA 1PV8A 2DZTA 1KM3A 2EKCA 5BRQA 1J2WA 1JXJA 2PWGA 1KC7A 4DJEA 4PE8A 2X0YA 3IIPA 2VMFA 3LCGA 3S3GA 2QJIA 4HP5A 1GG0A 1R3SA 1E6SM 2PDUA 4MSSA 1O5QA 4IQDA 2X40A 1IEXA 2XFRA 3EX1A 4O15A 3RM4A 2BGSA 4CUCA 5HXMA 4AUBA 1QAPA 4JTLA 1XKYA 3AIBA 1KRMA 3CT2A 4Q33A 3DX5A 2G3FA 2DDXA 5AHIA 1E0VA 5FF2A 1BG4A 3NQFA 3DHFA 1WKFA 1S5NA 1UD6A 3IV8A 1CBGA 4DYKA 1UD8A 1LLZA 3U3HA 5IOBA 4N7QA 3N11A 3QEZA 1CXLA 2GK1A 3I68A 2EKGA 4K3ZA 2PFHA 3EAUA 2OOGA 3GS6A 1XH2A 2XG9A 2HDJA 3KM8A 1DJIA 1ONEA 2X2GA 1GT8A 2VQTA 3CUXA 5GJNA 2VRJA 2C6QA 1EF3A 4RXFA 4AB4A 5CBJA 3BWWA 3DXIA 1UROA 5G1TA 3R8HA 4Z08A 4KESA 3W07A 4WXZA 2GSEA 1S5WA 4Q8VA 3TV8A 1EOKA 5HULA 3IIVA 2E77A 4EVZA 3BW2A 4JIHA 2V3EA 2ZZ1A 2GYIA 4K8GA 3QMSA 4J3VA 3H7VA 1GHRA 4F9DA 3TN3A 1AA1B 1VFLA 3ECQA 3E5BA 2ZCGA 4GRSA 1HX0A 1TV3A 4M3PA 4M51A 2G95A 2R24A 3DI0A 3L23A 4DO7A 5FL1A 1IZKA 2Y85A 2Z25A 1Y5WA 3ALGA 3ARSA 2WOQA 3TYCA 4O11A 1RR2A 4MKSA 4O28A 1NAL1 2E1WA 2F7FA 2FB3A 1XPYA 2XZ9A 1E55A 3GHTA 3WBEA 3BAXA 3I10A 1P7TB 4PZVA 1WBHA 1TV5A 3C6CA 3LLDA 3EKZA 4J3ZA 4AIEA 2GGEA 3DDMA 3KRBA 2A3AA 4MNKA 1O4UA 5CC7A 1YE4A 2WMIA 4QJ3B 2E6FA 3UYIA 4FF7A 1UKTA 2GSJA 2XGIA 5GNZA 2HSAA 3H26A 1EEXA 4DUWA 3WQOA 3W73A 2X8RA 4IF2A 4DXXA 1AK5A 2PDMA 1J9YA 1SR9A 3LCIA 2H6RA 1FDYA 3LU2A 5AHNA 1IXQA 3DFQA 3EOEA 1TV8A 1MMFA 3HO8A 3VCRA 5IFPA 4G5DA 2X05A 3OOQA 4A8NA 1LBFA 1U5HA 4A3RA 4MGGA 3TDFA 3ZOAA 2VGGA 3VMOA 4AG0A 5FOOA 2ABAA 4JIQA 1XH1A 3WH5A 4V33A 5D8ZA 3QFEA 4X3ZA 2XIJA 4FPSA 2IXVA 2ISSA 3WH8A 1XLIA 5FACA 2WNNA 1BYBA 3W85A 3LNMA 3W2JA 1H41A 3AIUA 4Q4PA 4OV9A 2WZMA 2YDRA 3UP8A 1TMQA 1X39A 1K9TA 5C8BB 3NDOA 4HTBA 1NP0A 4DM1A 5CPSA 5HMSA 2OR2A 4HQVA 3AS2A 1XSIA 2HZGA 3VD7A 1JNDA 1J6OA 4MY8A 4TR9A 5CAKA 5D2VA 1ZU8A 4Q8OA 5HWNA 1EA9C 3GNOA 3NA8A 2DVTA 2OKOA 1FP9A 1JQVA 4IMGA 3STGA 3F5LA 4EAYA 3IGSA 2E9LA 3TJXA 3DEQA 1WE5A 1CXIA 2O9PA 5D38A 1GORA 1GZGA 2EPNA 2PLJA 4PMUA 3DOPA 4Q8NA 5EBUA 2IKGA 3DG6A 1YQ2A 2PDQA 4UNKA 2INFA 3NGJA 3PPGA 1G4PA 4WR3A 4QG6A 3QFWA 1W1A1 4PMJA 4XQ6A 5K9XA 3DFHA 1HP4A 1IR1A 1ISVA 2EJAA 3THQA 4D2JA 1MEHA 5DXXA 3C4UA 3K8KA 2DU2A 1KR1A 4GGBA 4YTRA 3LHVA 1ICQA 1K8XA 1Q6CA 2YCLA 2YA1A 5FEWA 2F61A 3W1NA 1YPFA 3RUBL 1GKPA 1ME7A 1QK0A 1VYPX 4UTWA 4Q4SA 1AUSL 4BQ4A 3FY1A 4WJ8A 2NUWA 4GABA 5BNKA 1A4MA 3L4VA 1KCKA 2GLKA 5HJYA 3H4XA 4PFMA 1XLFA 1PTDA 1W5NA 3N9RA 2EHHA 4GNJA 4CCDA 4EXBA 1ODZA 3RK8A 3N2OA 4GI4A 5HPOA 3VOGA 1Q6LA 1DORA 5JBDA 4Y6GA 1DWJM 5DO8A 2ABBA 2G0WA 4PCFA 1IHIA 4JAWA 2J27A 2BOEX 3BH4A 3H2FA 1EJ7L 2F9RA 2PWFA 2C7FA 3U2OA 2YDAA 4QJ4B 3UJ2A 1FWEC 1NU5A 3GH7A 3PWIA 3QBUA 4LQ1A 4L65A 4JN6A 1JZ4A 5G2WA 1OADA 1AJ2A 4X61A 1H5YA 5GNYA 1SMDA 2Y61A 4FR6A 1S46A 3PPFA 1VGAA 3O7UA 4EKJA 4FNPA 2VRQA 2Y5JA 2CERA 1KGWA 4RR4A 3NPXA 1SSGA 3GY1A 2ZRXA 3OG3A 2J75A 1X7IA 4WIWA 1NWRA 3NQ2A 4HHHA 1OYBA 1VHCA 3WBYA 3ARQA 3SM0A 2E6AA 1X98A 3W7JA 2QCNA 5U7SA 3JR2A 4HA4A 2CZDA 3LBCA 3O6YX 2HVMA 5AVNA 4DM2A 1Q6RA 3TTYA 5JIPA 3EEZA 1EHAA 4IIFA 5CZSA 5H8PA 3UBPC 3W0KA 1E4IA 1AD4A 3TZFA 3RX3A 4M6QA 1XYBA 4WJXA 4LYKA 3QPZA 3HN3A 1LQ0A 1XSKA 2D0HA 2PTWA 3ABSA 4AZCB 4WGHA 4WX2A 4C6PA 4HBKA 2NUYA 3OGSA 3UGVA 1HVQA 3WQWA 4C6OA 4JQ4A 4RNFA 4YHGA 3S2NA 4F8XA 1QW9A 2QCFA 2R1LA 2FTWA 5BMXA 2VEIA 2QGHA 3I65A 3BAIA 3MP4A 1FWNA 1UJQA 3NCOA 1T0OA 2P1FA 4WJEA 4CU6A 1VFFA 2PLKA 5E0CA 1OYCA 1DE5A 3MWCA 1WZMA 4AC1X 2Z28A 2PTDA 2WWCA 1VEOA 5LYRA 2R1MA 3SUWA 4PEEA 3VILA 3LXCA 3CS2A 3A13A 1CGTA 2QDGA 4EWND 4JL1A 1CLVA 4U5KA 1KBJA 5CKSA 1FHLA 5T91A 1E6PA 2IKJA 4PTMA 3S5ZA 1RY8A 3GFZA 2A79A 3FX4A 3LPPA 3WDIA 1CCWB 1GGOA 1XQLA 1OGSA 3DZ1A 1IIGA 3S9ZA 4XBJA 4PMXA 3TC7A 4G7EA 4GMEA 4CLMA 2XH7A 2YFOA 5FIPA 1B3VA 3WNOA 1PX3A 4J1OA 4D9PA 4XKYB 3CUFA 1H61A 1R46A 1QHOA 4OBSA 3W22A 4JNYA 3MTWA 3GTNA 1J18A 3Q58A 1DXFA 4H9MA 3SN0A 4QDPA 3TTQA 2PDYA 4DXVA 1Q6GA 1B3XA 2PDJA 3LCWA 1SFLA 2VJXA 4U2YA 3TC6A 3HTWA 4HT3A 1J11A 1EP1A 4MJ2A 4B3KA 3LERA 1QW7A 3E12A 2GJPA 1OFPA 4IP4A 3OTRA 3CMFA 2WSKA 3IK2A 1BF6A 1KWKA 3KL0A 1UA3A 1GW9A 3SAZA 3A64A 2OYLA 4LS0A 3WK0A 1L6SA 4RE4A 1PIIA 3BURA 4HNOA 3WLOA 3SY1A 3WQCA 3PJXA 4R53A 3NXFA 3N2XA 1YXYA 4FNSA 3VIOA 2Z7GA 5E70A 3BPWA 3AMKA 1LL4A 4L56A 2C1GA 3ZT5A 2ZQ0A 1EC7A 2Y1HA 3BOXA 3EKLA 4UQEA 3CAKA 4MNJA 1RBAA 4L9YA 3XINA 4H1ZA 3FDGA 2FZ8A 2WVSA 3KTCA 4AX7A 1JULA 4QLKA 4PCTA 4KW2A 4XO6A 3R58A 1TZZA 4GYFA 4CNPA 3N29A 4I90A 2X1IA 1E1CB 4BI7A 1XYCA 3P7YA 1XS2A 2FPVA 2IPWA 2HVNA 3ZIZA 3MW7A 3GB6A 1BD0A 1OFBA 3LHWA 2Q09A 3MCMA 1T7LA 1W54A 2JIEA 3QKEA 5C9XA 5EKYA 1BYAA 3DFSA 2PP3A 1AQMA 3CB3A 1FX6A 3WD4A 2UY5A 4RPPA 3IGHX 1W8GA 3NZRA 3WD2A 3LK6A 3BZGA 3D6NA 2DZXA 5HMEA 4DELA 3NXLA 1TQJA 2ANUA 2EPKX 3SUSA 2WBGA 3U2ZA 2VEFA 5JXQA 2DP3A 3QSTA 1FH9A 3PN8A 1UWTA 4DUVA 4DNMA 1TA3B 3N34A 8XIAA 2WW5A 3UXIA 4PSPA 3BE7A 1B1YA 4ZOBA 2ZZ2A 4O53A 1BTMA 3LLXA 4K37A 2EG6A 3PZMA 3VD9A 4Z2IA 1P7TA 4K7VA 4P8XA 4CEXC 2WC4A 1M68A 1GPFA 1B3OA 5HATA 3MKKA 5TBOA 5BRBA 3NTYA 4H2CA 3VUPA 5A94A 3NAVA 4Z2KA 1VC4A 3AALA 4IX2A 1H2JA 3BAJA 3UR5A 4AZBA 5FF3A 3NVTA 1VJIA 4PTWA 1UIPA 1YXDA 3CYVA 2XUCA 5K7JA 4DZHA 2C14A 3H4GA 2GOUA 4HA3A 5AYXA 1PCWA 1K7FA 3MWAA 1HW6A 1XQKA 4DNHA 3ZFHA 3DENA 5B7YA 1HJWA 1Q65A 4ZB2A 2Z2AA 1OQFA 4YU1A 1BLIA 1UD5A 1UP0A 1B9BA 2FTPA 1E4LA 2OFJA 4QBXA 4Z0SA 5DCDA 3M16A 3T1GA 3BLPX 3QN3A 3KZPA 4H7VA 1V02A 4FK9A 2ATMA 4BEUA 1JFXA 3NZPA 4W5UA 3ME3A 3P74A 1I0BA 2FPYA 3VKBA 2XFWA 4Y9PA 3C0LA 3TCEA 2V5LA 3FNDA 1M04A 3RO6A 2GJNA 1OX4A 4GXWA 1KFEA 1W9VA 1DYSA 2D3LA 1AVAA 1JRCA 4N9DA 3MKVA 3NQAA 4MKNA 3U5YA 4KWSA 2NVAA 2GVEA 2CLIA 5AC5A 1UOZA 3USZA 4F2UA 3TUUA 1QR7A 4MY1A 1ELSA 1SZFA 2YIHA 1BYDA 3V36A 1SUXA 3WUGA 1JCJA 1VEMA 2O0TA 1KKRA 1ZAHA 1R3QA 4G2DA 1UUOA 3AISA 2NV2A 1HQTA 1CDGA 3W23A 2WO5A 3GNXA 1PKLA 4I9MA 4WDTA 4E8DA 1RQHA 3TROA 3CZ8A 3CV2A 2J77A 3FYOA 1QHZA 4PUNA 3PB0A 3TZNA 1GZJA 1U1HA 4LBSA 2Q6ZA 1BVNP 1LBLA 1TO3A 2O9RA 3E0LA 1PHWA 1RZMA 4ES4A 3URBA 3NUKA 3W7NA 5D33A 1BWLA 3BCJA 1TELA 1SVDA 4XISA 4S38A 1UHVA 2O9TA 3PAOA 1TPDA 4CU7A 3RPTA 4AWEA 4DWSA 3GNPA 1EH9A 3G0SA 2WVVB 4M82A 5BCAA 3M6YA 1UJPA 3ZVHA 3GAKA 3F4WA 3MCOA 3SCPA 4UQAA 1EP3A 1TVLA 2Y8VA 3ES7A 2WVVA 2E5BA 1GJPA 5IBXA 1L9WA 2Z24A 1V5XA 5A5WA 3N2TA 4Q8MA 2QDEA 5DT5A 3MZ2A 4J2PA 2V3FA 1DTNA 4YWSA 3VIKA 1WZLA 3LI0A 1UR8A 2Z27A 2QUVA 1I45A 3BL3A 3TC3A 3Q94A 3HPXA 4QCFA 3WJWA 4LVDA 4OJYA 1J8VA 3OLGA 3CMGA 3VXGA 3OIXA 3FGCB 2R94A 3KFTA 5IM51 3LQGA 1KCXA 4YTQA 1JFHA 3PAJA 3NYZA 1K4HA 3FXGA 5CSYA 1HL9A 1UYQA 4NQ1A 3OYZA 3EWBX 4E8GA 5EU9A 1QFEA 4AZCA 3SDOA 3WDQA 1KXVA 3BCDA 2Y24A 1KFCA 3UG3A 5DELA 3L4TA 1IV8A 4S3DA 3N1AA 1WKDA 3G1VA 3CASA 3LPFA 4H9YA 1VCVA 4JQ1A 4EP8C 2Q8XA 1DJQA 1DTUA 1J0IA 4XX6A 2FVLA 1QT1A 1QK2A 1W3IA 3ALFA 1FBAA 3ARUA 2FZBA 1KLZA 1QOQA 3W88A 1SJBA 4WZHA 3KOYA 3U4AA 1PKYA 1XLJA 3AHTA 2QUTA 2GQ9A 3MSRA 2BY3A 2DT3A 1A5SA 4JIPA 5AC6A 4L80A 1Q7QA 4KMQA 4GVGA 4XSMA 3WLTA 1T5AA 5HR6A 3GC5A 1X6NA 2A3EA 3NSNA 1CENA 3PUGA 1QNVA 3A4JA 3ISIX 3LENA 3QGAC 3ZVIA 2Y5SA 4Q7BA 1YNYA 2YLAA 5GJMA 3W1MA 1VKFA 2TAAA 4HMEA 1W5OA 4P7QA 1XLGA 3SCRA 1EPXA 1Z69A 3MUZ1 3RLVA 3I7SA 4HCLA 4GLEA 3WKZA 3ARTA 2D69A 4MY9A 4EF8A 3NOEA 1FWTA 1X97A 3PUDA 3GQYA 2E28A 1QPKA 1Z89A 3ZJ6A 3IVTA 3VGGA 1FHUA 3K46A 3WQFA 4N9BA 5HWMA 4FS9A 4G1NA 1TJ0A 4LY4A 2YCLB 2RUSA 4LUTB 3PBYA 4C6NA 4W89A 2QF7A 4GISA 4GUIA 3W86A 3NM3A 3WLKX 1ZTVA 2X7VA 3DBNA 1OD0A 4LC6A 5A8MA 3BDKA 4U3CA 3OVQA 3O16A 5F2IA 4LSBA 4JIIX 1QI2A 1EPVA 2MNRA 5I0DA 4JQ2A 2C13A 2GOKA 2PBGA 3TN5A 4UXDA 3B4YA 2ZX9A 1AW1A 1RV8A 1LOSA 3EA2A 1AH4A 1B5TA 4S23A 3SCWA 5L9FA 1TA3A 1TJPA 1TKKA 3OJGA 3AYSA 1JPDX 4MWAE 4YLWA 4DO5A 5BOFA 4K1WA 2A7NA 3WNKA 5F4XA 5DX7A 1S2VA 4MHBA 4ZCWA 3VDGA 2HK1A 4XKMA 1AFSA 4XWUA 4A4AA 4RCXA 5LNUA 3UWQA 1V0MA 1ZBVA 2PF8A 2QVNA 1EZ2A 2YZRA 3CK5A 2W27A 3FSTA 2PGEA 4HN4A 2X41A 3VKDA 3A3WA 4F0KA 1LM1A 1CYGA 4M81A 1HKIA 1PPIA 1P48A 4LYPA 1H1NA 2XVNA 4O1FA 3RX4A 1XD1A 4V1YA 4LAOA 3VFLA