2PD7A

2.0 angstrom crystal structure of the fungal blue-light photoreceptor vivid
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
149
structure length
149
Chain Sequence
MHTLYAPGGYDIMGYLIQIMNRPNPQVELGPVDTSCALILCDLKQKDTPIVYASEAFLYMTGYSNAEVLGRNCRFLQSPDGMVKPKSTRKYVDSNTINTMRKAIDRNAEVQVEVVNFKKNGQRFVNFLTMIPVRDETGEYRYSMGFQCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational switching in the fungal light sensor Vivid
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Circadian clock protein
molecule keywords Vivid PAS protein VVD
total genus 37
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2pd7A00
1TS8A 5IU1A 3LYXA 4HQAA 5J4EA 3ICYA 3EEHA 4LLOB 5IS1A 1OT6A 2L4RA 3NHQA 4L9GA 3NOTC 3H7WB 4LRYC 4WLAA 3PHYA 5HDDA 4HJ3A 4LRZE 4GS9B 4MN5A 1GSVA 5F5YA 3RTYA 1S1YA 2JN7A 3RH8B 2ZBBA 1T1BA 1WA9A 2INWA 3PYPA 2WKQA 4I3JA 3KX0X 3H82A 3SW1A 1UGUA 4PKYG 1V9YA 3LIAA 5DKLA 5F69A 2D01A 3UB9A 3C8CA 2V1AA 1GSWA 4GS9A 4JGQA 5J7EA 4EEUA 5A8BA 2PYPA 4DJ2A 4F3LA 3F1PA 1P97A 1MZUA 1OJ5A 5TBMA 3UB8A 5HSQA 1OJGA 1P0ZA 1OT9A 3H82B 4HH3A 3ZQ5A 5HWVA 2WKRA 3CWFA 4HP4A 4JGOA 3T50A 3A0RA 2HV1A 3BY8A 4I3IA 2GJ3A 1LL8A 4HI4A 1N9LA 1DP8A 1T1CA 3NOPC 4GCZA 4HP9A 4L9FA 3CLOA 4WF0A 1N9NA 5DKKA 4BBUA 1UWNX 1GSXA 1OTEA 2D02A 2L1MA 3LUQA 1G28A 3D72A 4LRXC 4R70A 5J3WA 5HWWA 2VEAA 3LICA 4EW7A 2PDRA 1XFQA 2JHEA 3K3DA 4NXFA 4E04A 3GDIA 1TS7A 2I9VA 2VLGA 4LPZA 2P7JA 2Z6CA 4NXBA 4BBVA 2YKFA 5HWTA 2OWJA 2J80A 2VV6A 5HDCA 3MFXA 4BBTA 5HDSA 4GW9A 4H6JA 4PKYA 2VV7A 1KOUA 1UWPX 3A0SA 3K3CA 3E4PA 4HJ4A 3FG8A 1XJ3A 1TS6A 4XT2B 1N9OA 3UB6A 4EXOA 5F6AA 2QWSA 3NJAA 4EEPA 3MXQA 5AVFA 2VV8A 4NXGA 2QJ5A 1S1ZA 2EA9A 4I5SA 4RQ9A 4WL9A 4H6JB 3UE6A 4EESA 4DJ3A 1T1AA 3C2WA 4WUJA 2ZOHA 1LSWA 3MR0A 3FC7A 2M1CA 5HZHA 5HD5A 3CAXA 4KUOA 3UB7A 4HY8A 1X0OA 1EW0A 2KX6A 2WKPA 3B33A 3IS2B 2W0NA 3LIDA 5EFWA 2CMNA 4EQ1A 2QKPA 3LIFA 4NXEA 1XJ6A 2V1BA 1LSVA 1XJ4A 4R3AA 2OOLA 1T19A 4KUKA 2Z6DA 1F98A 2QJ7A 3LI8A 3UMEA 3VOLA 1VB6A 3IS2A 4HIAA 4I38A 3E4QA 4JGPA 1JNUA 2PYRA 5AVEA 2R78A 1OTIA 1DRMA 3NOUC 1S66L 4HHDA 4K08A 4HNBA 1LSXA 5F68A 1F9IA 4HH2A 5DJTA 5G4YA 3UMDA 2YKHA 4R6LA 1LT0A 1S4SA 1S67L 3E4OA 1S4RA 3LIEA 4GHIA 4HJ6A 3OLOA 4B9OA 3VE3A 2A24B 1ODVA 4JGRA 1XJ2A 3BWLA 3ULFA 5TBMB 2KDKA 2PR6A 4XT2A 1NWZA 4EERA 3EWKA 4MN6A 4L9EA 2PD8A 2ZOIA 3BY9A 1DP6A 3MQOA 3MQQA 1OTBA 2K7SA 3LIBA 1BYWA 2BASA 3F1OB 1V9ZA 3LI9A 4WN5A 2A24A 2OWHA 1Y28A 2PR5A 3IBRA 1D7EA 3G6OA 4EETB 2V0UA 1T18A 3VE4A 2W27A 4M4XA 4F3LB 3MJQA 4GHIB 2QHKA 3F1PB 2PHYA 2PD7A 3F1NA 1XFNA 3H9WA 4R38A 3HJKA 1OTAA 3HJIA 5KIZA 2B02A 5DJUA 2H28A 2V9AA 3F1OA 2L0WA 5I5LA 1DP9A 4KQDA 5G4ZA 3H7WA 3A0VA 5HD3A 1OTDA 4HOIA 3GECA 4I39A 1D06A 4I3AA 3F1NB 3P7NA 2V0WA 4YWZA 1TS0A
chains in the Genus database with same CATH superfamily
2ZQ7A 1AWIA 4PM8A 3EEHA 3NHQA 1CJFA 2ZC4B 3PHYA 1MY8A 5CX7A 4GS9B 3Q1FA 1TD5A 4OOYA 4I3JA 4UHUA 4R4SA 1L0DA 4C6YA 2ZQ9A 3LY3A 2LB5A 4JXGA 1L2SA 4RYEA 2R9WA 3H82B 1OT9A 1YQSA 3KSHA 1U60A 3R7WA 5HARA 1H8YA 2D02A 3Q7ZA 2DMWA 3S4XA 3G30A 2FH5A 4PPRA 4EW7A 1IEMA 4ZDXA 3K3DA 1XKZA 4BD1A 2VLGA 4QB8A 3VOYA 4WELA 2LB9A 3MKFA 5HDSA 4DMZA 1L0GA 4MNRA 1TS6A 3BQAA 4EU0A 1S1ZA 1XA7A 3AGDA 5HL1A 3MQ0A 2G7UA 4OPQA 4E3JA 3QNCA 4GZBA 4HESA 2XDMA 4UA7A 4EQ1A 3MBZA 4G3WA 1BSGA 1CF0A 4KZ5A 3BJNA 4JGPA 2ZMVA 2R78A 2UWXA 1YLJA 4HJ6A 1K55C 2J9PA 2ACGA 3ULFA 3VFHA 3PBTA 1DP6A 4CLCC 3P01A 4BWIA 1YLYA 4X6TA 2QHKA 3S7OA 5JYOA 2B02A 4BMWA 5EECA 1VQQA 3E2KA 5HD3A 5GLAA 1TS0A 5FA7A 2G2WA 4GJ4A 1W63M 5IS1A 2V20A 3ZHHA 3BQ8A 4KG6A 5IHVA 3RTYA 2ZBBA 4U3TA 3EQUA 1WA9A 1ZHHB 4WZ4A 1GA9A 2Y2NA 4R1GA 2M7UA 2FZ0A 1G68A 2XFTA 5J7EA 5FQKA 5M1AA 2WKIA 2B18A 4JF6A 5L10A 4OH0A 5FASA 4IEDA 1MWTA 3KYQA 5AQBA 4WBGA 4FCFA 4GD6A 5CHJA 5HDCA 2C5WB 1KVMA 2FFYA 3HCYA 3E4PA 4XT2B 3KYZA 3QP4A 4OONA 3V50A 3FC7A 5K5BA 3Q7VA 3B33A 3IXHA 1MBLA 3LEQA 2Y2KA 2EXAA 5TFQA 1XJ4A 3V3SA 1T19A 4Q8IA 5DF8A 3EGXC 4HIAA 4I38A 2FFFB 1S67L 2W3FA 3SS3A 3VP4A 5HPFA 3N6IA 3IT9A 4OPYA 4XT2A 2VKSA 5AQ9A 3HVFA 3NY4A 2K7SA 2O9BA 3F1OB 2P74A 4PM6A 1L0EA 3ISGA 4L0LA 2O0YA 2VGKA 1D1JA 1TF1A 3FKVA 4CQHA 1DP9A 3S7QA 4IHQA 3ZCZA 1H0MA 2X71A 1XGIA 3P7NA 3PBNA 4YWZA 1PWGA 1TS8A 5IU1A 4OVDA 3MS6A 3WS1A 5EE8A 4KQQA 2Y2MA 3UN7A 3NDEA 1JTGA 1P9WA 4ZAMA 1H8ZA 2ZM2A 5A93A 3U2AA 2HGVA 2KLIA 4IUHA 1O7EA 4E3MA 2JKTM 3HLCA 4E6WA 3P09A 5FAOA 3C8CA 3AGEA 2PYPA 3F1PA 1P97A 4KZAA 4U0TA 2K31A 4BD0A 1H3QA 2GJ3A 1PIOA 1T1CA 2XR0A 1BTLA 3NI9A 3AGFA 3CUEA 5L09A 5E2GA 5CEBA 2GZAA 3VSKA 3OZHA 4BBTA 2H10A 3G35A 3RFBA 4IVKA 2K2NA 1NXYA 1NRJA 2QJ5A 3BFEA 4WUJA 4R4RA 3C4OA 2M1CA 2PRFA 4KUOA 1I5QA 5HPIA 1FIKA 1C3BA 1LL5A 4KUKA 4JKTA 3IS2A 2W3GA 5F68A 4BQMA 2ZL1B 5KZHA 4QY6A 1SZVA 5AJGA 2WZXA 1FOFA 3BWLA 5TBMB 3EWKA 2ZQAA 5DFYA 3MF0A 2BASA 1SDEA 2A2LA 4X68A 4EWFA 4EETB 3NDGA 2PD7A 2W3EA 5I94A 4KZ8A 3PXPA 1Y4OA 4ZJ2A 4Y5FA 1OTDA 4DDYA 1D06A 3W4OA 1F5MA 1JWZA 1XP4A 3OPLA 4LRZE 4MN5A 3C7VA 1S1YA 4O0PA 3UE3A 4NK3A 4FOFA 3C30A 4Y13A 3CJMA 2D01A 4GS9A 1GSWA 4Y0TA 4R0QA 3S1YA 4RX2A 3FV7A 4OKPA 2WKRA 1FCMA 3Q7VB 4OQ0A 2XA7S 1VETA 3DAVA 2WGWA 3VV4A 2VEAA 3W8KA 1K55A 2M7VA 4O8GA 4ZJ3A 3WWXA 4LV1A 3OBFA 1SKOB 3FG8A 5A91A 4MCWA 5DFXA 1W79A 5MC7A 3OCNA 1FR6A 3CAXA 4R3AA 3L9KA 4OQIA 3PAGA 3BRMA 2Z6DA 5DF7A 5EOEA 2GX5A 3V39A 5DJTA 3C4PA 4F94A 1IKGA 2Y79A 2XH9A 3G31A 3PBRA 4KZ9A 3MQQA 1YAXA 3C5AA 3ITAA 1XPBA 5BOHA 4R3JA 4D2OA 3JYIA 3HUOA 3ICYA 2XEPA 4JBFA 3IHBA 3HUMA 3PBOA 2IWBA 1XGJA 3IX4A 5HDDA 3B3XA 2JN7A 4GDBA 3PR6A 3D9YA 4Q0HA 4Y0OA 3HREA 3UB8A 1I2SA 1P0ZA 5HWVA 2MJ6A 4WMCA 3A0RA 5DTKA 4ZJ1A 3QNBA 4HI4A 4QWOA 3CITA 4BBUA 3SS4A 1FQGA 3LUQA 3JVUA 3LICA 2PDRA 2YKFA 4H6JA 1CK3A 5CEDA 1UWPX 1KGGA 4DF6A 2EA9A 5CRFA 4GB7A 1T1AA 3VP2A 3CZDA 4KZ6A 5CTNA 3UPNA 2J3TD 2W0NA 4C3QA 2EX2A 1GHIA 1NJ4A 2JKRM 3T12B 3VFFA 4S2JA 4C75A 5C5KA 5GHXA 1H5XA 4HH2A 1ES5A 1S4RA 5HAIA 1QMEA 4DE2A 2VX8A 2PD8A 1TVFA 2ZOIA 3BY9A 3EEAA 1MKMA 4KENB 2WGIA 3JPUA 1SHVA 1HZOA 1D7EA 3VE4A 4DRTA 3LR3A 3UE1A 2H28A 2V1ZA 4ETZA 1FR1A 1E25A 5G4ZA 1KE0A 1S0WA 2HP9A 4HQAA 1Y54A 2XROA 2VGLS 4GNUA 3OC2A 4KQRA 4IBRA 3SZTA 1XA1A 3GSGA 3PYPA 4GKUA 3BLSA 3M6HA 3BLMA 2WGWB 3UB9A 1LLBA 3QP6A 3C38A 1YM1A 1VEUB 1AXBA 3V67A 3VSLA 1PWCA 3T4KA 1J9MA 1MWRA 5A92A 1HVBA 3TJZC 3EQVA 4L9FA 1PZPA 4LRXC 1IYOA 4YINA 3K2NA 1FSWA 4NXFA 1YLWA 2Y59A 3UPOA 5F1GA 3QP8A 4PKYA 1VM1A 5KMWA 4X25A 5F6AA 5U47A 3TRCA 3MXQA 4NXGA 3GR2A 4EBLA 2ZOHA 4WEJA 1SCWA 3LIFA 3ZFZA 1K56A 3LI8A 4BJPA 3OOVA 3GRJA 3KYEA 3MMHA 4DDSA 1YSPA 3T4OA 1OTBA 4Z9QA 1BYWA 1WE4A 3LIBA 1HLUP 2V8CA 4FSFA 2PBDP 3IBRA 3O3VA 2ZC5B 3W2ZA 4NEED 1PRQA 2W27A 2PHYA 3R4KA 4JXSA 5FSRA 3IXGA 3OPRA 4OLDA 5M18A 3LCEA 4IVIA 4E3OA 1K4FA 2Y4AA 3O86A 5G18A 1SKFA 3MKEA 3ZG5A 2HJ9C 1BZAA 2ZM0A 5EVID 1K0KA 3T4LA 1RP5A 1OJ5A 5HSQA 4Q0IA 2HDUA 2HV1A 3BY8A 2JKGA 1VEUA 1NZOA 1F2KA 3CLOA 5L8MA 1N9NA 4FH2A 2L1MA 3D72A 5EM1A 1YMXA 4Y7PA 4UA6A 4MDZA 2B5RA 2DNSA 2I9VA 1O07A 4X1MA 3WS4A 2W1TB 3NULA 1ZC2A 4DE3A 4F3LA 3IF6A 2VV8A 3DBAA 4EESA 4LGWA 1CEGA 3RJUA 2B95A 1ES3A 4LENA 1DJBA 3FPVA 5FAQA 1EW0A 1Z6FA 1E3UA 4NXEA 1CI8A 4A5RA 1LSVA 4JPMA 5AQ7A 1KGFA 2XGNA 3E4QA 1VETB 4EEUA 1LSXA 2YKHA 4R6LA 4B9OA 3LIEA 2XD5A 3A3IA 1W5DA 3U4LP 1ERQA 5E2EA 2PR6A 2XA7M 4WN5A 3RXXA 2A24A 3Q81A 4M4XA 2GDNA 4R38A 1PNEA 5GHZA 4Y2FA 4HBUA 2Y2IA 5E2FA 2ZD8A 4N92A 1PZOA 3L7HA 4I39A 5EPHA 2C6WB 2W1RA 3KSIA 4O7DA 3H7WB 3EGDC 5HAPA 3Q82A 2HP5A 3DTEA 3LR4A 3A3FA 4OQGA 4B88A 2OAQ1 3HLFA 3UO9A 1PW1A 3MXRA 3DWKA 3T1RA 4D60A 5TBMA 5D3OA 3ZG8B 3UPPA 1YLTA 1UWNX 5TJJA 4MN7A 5M19A 3QHYA 4PM7A 4CLCB 1K57A 3SH7A 3WRTA 1JWVA 4CJNA 2Z6CA 3HLEA 4BBVA 5HWTA 3LFVA 4Q0JA 1STZA 3I7JA 5E2HA 1MXOA 2EXBA 3N8RA 3PAEA 2JBFA 3NJAA 3QP5A 4P0MA 4RQ9A 4CLCD 3C2WA 5DVAA 5HZHA 3UB7A 1YLZA 2QKPA 1IFQA 1XJ6A 1YPRA 1YT4A 3UMEA 1VB6A 2Z2MB 4GDNA 4BL2A 1OTIA 4ESPA 3V3RA 4IJGA 3TSGA 3VOZA 2VZWA 4FTXA 1EWZA 1XJ2A 3PBQA 3S7PA 3GV9A 2DRWA 4Y15A 1FILA 3MSHA 3IBJA 3DW0A 2VA0A 4S2KA 4XXRA 5FDSA 1TDLA 3H9WA 2XFSA 5HFOA 1KE4A 1N4OA 4S2OA 5F83A 3ZDJA 3GVBA 1PWDA 3FWLA 3IHAA 4XUZA 4N9LA 4GHIA 3UMDA 5J4EA 1HTZA 3OPPA 3MFDA 2EFUA 1RGZA 2QYBA 2P9VA 1YLPA 1OMEA 2G2UA 2OV5A 4ID4A 3T1SA 3B47A 4WM9A 5F69A 3UY6A 5GHYA 2V1AA 3P98A 3WS2A 1IOUA 4ZRRA 2HDQA 3NCKA 4KG5A 4JGOA 3OPHA 1BULA 1G5UA 1KDSA 2HPBA 4R3BA 3NOPC 5DKKA 1K57C 4JXWA 5J3WA 5GLDA 3B42A 2JHEA 3UDFA 4DXBA 3O88A 5FATA 3KSGA 2PU4A 1G6OA 2E8JA 2J80A 2VV6A 4GW9A 1XXMA 2HP6A 3VP0A 2QWSA 5EVIA 4I5SA 5FI2A 1K38A 4UQIS 3MR0A 4QHCA 2WKPA 5EFWA 1MWSA 3BM6A 2QJ7A 2OAP1 4MLLA 4PM9A 1DRMA 5EVIC 2O99A 1KVLA 2OLVA 4JGRA 4E3LA 4QD4A 3E2LA 1LL9A 3CPTA 3TW8A 2HZ5A 2P08A 3VP3A 1Q2QA 3KSFA 4X56A 3CUEC 4RX3A 2Z2LB 5I5LA 3T4QA 5EM0A 1A0KA 2RCXA 4I3AA 3F1NB 3T1XA 4MMNA 3SOIA 5DF9A 3D3OA 1OT6A 2WADA 4LRYC 4HJ3A 5JYPA 2W3HA 5FQ9A 1DY6A 1UGUA 4PMAA 4N1XA 1ONGA 5TGFA 5A8BA 3W4PA 3SS5A 3W4QA 3BFCA 5GL9A 1EROA 4K91A 4P6ZM 4R70A 1ESUA 2A3UA 4BL3A 2H0TA 1EI5A 4N9KA 1Z09A 2Y2OA 1NLZA 3FYZA 4U0XA 1ONHA 3K3CA 1BLHA 2JKFA 1K6SA 2QPNA 2I72A 4CLCE 1K56D 2W1TA 2V2FF 2QMIA 5EOOA 1CQAA 1L0FA 1FCNA 4HY8A 2DCFA 1NLYA 1OPXA 3HLGA 4HHDA 3IX3A 1E4DA 1WYCA 3N7WA 3MZEA 1S4SA 5FAPA 4FD8A 2GNXA 5HW3A 4EUVA 4K0WA 1Y28A 2Q9NA 4UAAA 1XFNA 1OTAA 3IH8A 5CHMA 2ZM8A 1NZUA 1MKIA 3T4SA 4LV0A 4PM5A 2IA2A 3KO6A 3LYXA 4LLOB 2KOIA 3CI6A 1IELA 3LR0A 3RH8B 1BLCA 2EX8A 4YFMA 1V9YA 3NECA 3ZG9B 2ZQDA 5CERA 3ZQ5A 1QMFA 4Y0UA 3T50A 1K6RA 2ZMAA 4I3IA 4IUKA 3ITBA 2XLNA 2HDSA 4WMCD 3MZDA 1ZG4A 3A3EA 3FPWA 1Q2PA 2HF6A 2Y55A 2OWJA 2ZQCA 2VV7A 1LHYA 2UV0E 4HJ4A 2ZC3B 4S2MA 3LR5A 5FEFA 4S2PA 3G32A 1GHPA 3MXSA 4LFUA 1F98A 1IKIA 4B93A 2PYRA 2ZC6B 3O5YA 3BYDA 5KIZA 1LT0A 1P9RA 3VE3A 1ODVA 5CHUA 5FDHA 1CI9A 4GOGA 3BECA 1V9ZA 4B4XA 5LBRA 5CXWA 3HLWA 2Y2PA 4HBTA 3S22A 4KZ4A 3UDIA 4ZTKA 4EQIA 3BW6A 5CECA 4G3VA 5EV0A 3LI9A 1S6RA 5HAQA 1W63Q 4CLCA 4UQIM 2J3WA 3GTCA 2W3DA 1GSVA 4FUWA 1YMSA 2ZJ9A 3H82A 4ARZA 3SW1A 4PKYG 5DKLA 4WEKA 4BENA 4DE0A 2P9VB 1XX2A 3LY4A 3N8SA 3NC8A 4E3IA 4DJ2A 2J7VA 4HH3A 1RGYA 5CGXA 3IXDA 3CWFA 4E6XA 2IWCA 1N9LA 1HD8A 2VGJA 4N1HA 4YNRA 2EFXA 5HWWA 4PHTA 2HDRA 4YOFA 3FZCA 4Y17A 1I2WA 4NXBA 2A49A 5F1FA 1GA0A 1PI5A 3T1QB 4KQOA 4II7A 3ZYTA 1N9BA 3IQAA 3UB6A 4EEPA 4HEFA 4KZ3A 4H6JB 1W8QA 4DJ3A 1IYQA 4DE1A 2JC7A 3IF6B 3LIDA 2XF3A 2V1BA 1ES4A 2X02A 1BLPA 1M40A 2H0YA 2Q9MA 3E0YA 4K08A 3QP2A 1F9IA 5G4YA 1PI4A 2EX6A 1L3LA 4EBNA 2BG1A 2WK0A 1BUEA 4ARZB 3IWOA 3IWQA 5L07A 3RXWA 4L9EA 1G6AA 4QPRA 2ZLYA 3WRZA 4BLMA 4GD8A 1T18A 3OCLA 5HL6A 5L2FA 3F1NA 3SH9A 1IYSA 4X69A 3LGOA 4DKIA 3HUNA 1GCEA 4KQDA 5EUAA 5KSHA 1W8YA 2Y91A 2E8IA 4HOIA 3GECA 3ZNYA 3WS5A 4Y3IA 4WYYA 5IT5A 2XQZA 4QU3A 1BT5A 4UA9A 1PFLA 1NRFA 3NIAA 3CMZA 1TEMA 3CPTB 5EVLA 2BLSA 3IF5A 3SH8A 3ZGAB 1LL8A 4GCZA 3IF6C 3NBLA 4WF0A 4K0XA 5FQQA 2JKTI 5EVIB 1XFQA 3UDXA 3HLBA 3GDIA 2EWVA 4S2NC 4OPZA 2X01A 4JXVA 1N9OA 1ERMA 2WZZA 5CGWA 4B4ZA 4G3KA 2OLUA 2Y2HA 1RCJA 4ME4A 1FSYA 3ZVWA 4NETA 1ACFA 1LSWA 1X0OA 2IWDA 3R7WB 4GN2A 4XUXA 5J8XA 1E3UD 1W7FA 5GLBA 3S7NA 1ESIA 1S66L 2AVXA 1DJCA 5TR7A 1M6KA 1MPLA 2VGLM 5DTSA 4OOLA 2ZMFA 5E43A 5GLCA 3O87A 3G4PA 5FEGA 3FKWA 5CGSA 2PR5A 2V0UA 2Q0OA 5F82A 3E98A 1BLSA 3ZG7B 3F1OA 2L0WA 1YSQA 4X53A 1NYMA 1ZTUA 3A0VA 2PAVP 3JVVA 5DTTA 4GLQA 3IH9A 4L9GA 3BFFA 3NOTC 2V8FA 4EERA 3GMWA 1SDNA 3KX0X 2VK3A 4EBPA 2Y2GA 3BEBA 1TDGA 2HJEA 1OJGA 4EV4A 3QP1A 4KG2A 4E3KA 4HP4A 2J3TC 1GSXA 4LCLA 2EWWA 3BFDA 3HL9A 4OOMA 5KSCA 4E04A 1NYYA 4LPZA 4DXCA 3ZVTA 4R23A 1KDWA 1JVJA 2BTFP 1KOUA 4ETXA 3A0SA 2NUTC 3HLDA 4KZBA 5FQMA 5AVFA 3VMAA 4LV3A 4WL9A 1ALQA 4NG2A 2O9AA 2RL3A 5HD5A 3PBSA 3IS2B 5FI7A 3IWIA 3TG9A 4P6ZS 2OOLA 3LEZA 4MEZA 3UB5P 2Y2JA 3LO7A 4HNBA 3E4OA 1K25A 3Q07A 2KDKA 2WKHA 4H8RA 4MN6A 4P85A 4X55A 1WYBA 2ZC7A 4M3KA 1FCOA 1ZG6A 3G2ZA 3MJQA 4UEYA 3HJKA 3HBRA 3MZFA 3HJIA 3GQZA 3DWZA 2V9AA 3TE8A 4KZ7A 2Y2QA 1K4EA 2P04A 2OSUA 2Y2LA 2L4RA 2XSSA 5F5YA 3V5MA 2INWA 4MBKA 2WKQA 3C7UA 1KGEA 3LIAA 2ZQ8A 4NKPA 3M2KA 1PYYA 3G34A 4PAUA 4LV2A 2NUPC 4HP9A 2WYXA 1OTEA 3VP1A 2J8YA 3D4FA 3N4IA 3T4TA 5FI6A 1TS7A 2P7JA 5AQAA 4S2LA 3DTMA 4JLFA 4Z1WA 1J3WA 4DN0A 1LI0A 1VHMA 4IBXA 3M2JA 2KX6A 4JF4A 3TOIA 2CMNA 4E3NA 1H8MA 4WZ5C 3M6BA 3VOLA 1JNUA 3NOUC 3UNWA 1GHMA 3OLOA 1NWZA 1MC0A 1YKDA 3N8LA 5CTMA 2XRNA 2R9XA 3CG5A 1NY0A 2H5SA 4P87A 4OP5A 4OPRA 4OQHA 5DJUA 2CC1A 1K54A 4MBHA 5FQJA 3A3DA 2XK1A 2XD1A 5A90A 2V0WA 2ZL1A 3EOIA 4WLAA 2WKEA 4S2NA 2EX9A 4RA7A 1JWPA 1T1BA 5FQIA 3G2YA 3ZNTA 4P6BA 4JGQA 1ZKJA 2PBYA 1MZUA 2WAFA 2JE5A 1DP8A 1G28A 2VJWA 4AFIA 2QZ6A 3ZG0A 1DJAA 3T4JA 3PTEA 2WGVA 5HX9A 1IYPA 3MFXA 5EVEA 1JTDA 3DTKA 4OLGA 4S2IA 1PW8A 2PT7A 4QY5A 1CEFA 1XJ3A 2Y8HA 2PU2A 4JF5A 4EXOA 3UE6A 2O9CA 3BFGA 3CHWP 5FL3A 4WZ5A 1LI9A 4CPKA 3A3JA 4FH4A 4MBFA 4O01A 5AVEA 1KE3A 2JKRI 4RVAA 4QJGA 2A24B 2WAEA 3IXBA 4OP8A 1MWUA 3MQOA 2WUQA 2OWHA 3G6OA 3IX8A 2J9OA 4EUZA 4GHIB 4F3LB 3F1PB 3UE0A 4ZBEA 1SKOA 2JCHA 1K54C 1ES2A 4X1LA 4LCMA 3DTIA 3H7WA 3WS0A
chains in the Genus database with same CATH topology
5J4EA 3ICYA 3EEHA 3NHQA 4Y3IA 3PBOA 3PHYA 5IT5A 5HDDA 5CX7A 2QYBA 4GS9B 2JN7A 1TD5A 4I3JA 3PR6A 4Q0HA 3B47A 5F69A 2V1AA 2LB5A 1IOUA 4ZRRA 3UB8A 1P0ZA 3H82B 1OT9A 5HWVA 3KSHA 2MJ6A 4JGOA 3R7WA 3A0RA 1LL8A 4HI4A 3NOPC 3CITA 4BBUA 4GCZA 4WF0A 5DKKA 2D02A 3LUQA 2DMWA 5J3WA 3JVUA 2FH5A 3LICA 3B42A 2JKTI 2PDRA 4EW7A 1XFQA 2JHEA 3K3DA 3GDIA 3KSGA 2VLGA 1G6OA 2EWVA 2YKFA 4WELA 2LB9A 2J80A 2VV6A 5HDSA 4DMZA 4GW9A 4H6JA 1UWPX 1TS6A 1N9OA 3BQAA 4EU0A 2QWSA 4G3KA 1S1ZA 2EA9A 4I5SA 4ME4A 1T1AA 3MQ0A 2G7UA 1LSWA 4UQIS 3MR0A 1X0OA 2WKPA 4EQ1A 3R7WB 2J3TD 2W0NA 5EFWA 4G3WA 3BJNA 2QJ7A 2OAP1 2JKRM 4JGPA 2ZMVA 3S7NA 2R78A 1DRMA 1S66L 5C5KA 4HH2A 2VGLM 2O99A 4HJ6A 1S4RA 4OOLA 2ZMFA 4JGRA 3ULFA 2VX8A 3PBTA 2PD8A 2ZOIA 3BY9A 3EEAA 1DP6A 1MKMA 4CLCC 2PR5A 3P01A 1D7EA 2V0UA 4BWIA 3VE4A 3TW8A 3LR3A 2P08A 2QHKA 3E98A 3S7OA 2B02A 2H28A 3KSFA 4BMWA 4ETZA 3F1OA 2L0WA 1YSQA 3CUEC 5I5LA 5G4ZA 3T4QA 1ZTUA 3A0VA 5HD3A 4I3AA 3F1NB 4MMNA 1TS0A 5DF9A 3D3OA 3JVVA 1W63M 4GJ4A 4HQAA 4GLQA 2XROA 2VGLS 5IS1A 1OT6A 4L9GA 3BQ8A 3NOTC 4LRYC 3OC2A 4HJ3A 4EERA 3RTYA 2ZBBA 2W3HA 3EQUA 1WA9A 3PYPA 1ZHHB 3KX0X 1UGUA 2M7UA 3UB9A 2FZ0A 5J7EA 3C38A 5A8BA 3V67A 2HJEA 1OJGA 3T4KA 2B18A 4HP4A 3TJZC 3EQVA 3KYQA 2J3TC 4L9FA 1GSXA 4LRXC 4P6ZM 4R70A 2EWWA 4OOMA 3K2NA 4NXFA 4E04A 4LPZA 1NLZA 5HDCA 4PKYA 1KOUA 4ETXA 3A0SA 3HCYA 3K3CA 2NUTC 3E4PA 4XT2B 3KYZA 5F6AA 3TRCA 4CLCE 3MXQA 5AVFA 4NXGA 4WL9A 2W1TA 2O9AA 2ZOHA 4WEJA 3FC7A 5K5BA 5HD5A 3PBSA 4HY8A 3IS2B 3B33A 1NLYA 3LIFA 1XJ4A 4P6ZS 2OOLA 1T19A 3LI8A 4BJPA 3EGXC 4HIAA 1OPXA 3OOVA 4I38A 3MMHA 4HHDA 4HNBA 1S4SA 1S67L 3E4OA 2W3FA 5HPFA 2KDKA 1YSPA 4XT2A 2GNXA 3T4OA 4MN6A 2VKSA 4EUVA 1OTBA 2K7SA 3LIBA 2O9BA 1BYWA 3F1OB 4FSFA 1Y28A 3IBRA 3W2ZA 4NEED 2W27A 3MJQA 2PHYA 4UEYA 1XFNA 3R4KA 3HJKA 4L0LA 1OTAA 2O0YA 3HJIA 1TF1A 2V9AA 3TE8A 4CQHA 1DP9A 3S7QA 4IHQA 3T4SA 3P7NA 3PBNA 2IA2A 4YWZA 1TS8A 2P04A 3KO6A 3LYXA 5IU1A 4LLOB 2KOIA 2L4RA 3CI6A 2XSSA 3LR0A 5F5YA 1P9WA 3RH8B 3U2AA 2INWA 2HGVA 2KLIA 2WKQA 4IUHA 2JKTM 1V9YA 2HJ9C 3LIAA 4NKPA 3C8CA 2PYPA 3F1PA 1P97A 3T4LA 1OJ5A 5HSQA 2K31A 4PAUA 3ZQ5A 4Q0IA 1H3QA 3T50A 2HV1A 3BY8A 4I3IA 2GJ3A 2NUPC 4IUKA 4HP9A 1T1CA 3CLOA 5L8MA 1N9NA 1OTEA 2L1MA 3D72A 3FPWA 3CUEA 3T4TA 4MDZA 1TS7A 2GZAA 2HF6A 2I9VA 2P7JA 2OWJA 4BBTA 2W1TB 2VV7A 3RFBA 4HJ4A 2K2NA 4F3LA 2VV8A 1NRJA 2QJ5A 3LR5A 3DBAA 4EESA 4Z1WA 4WUJA 4DN0A 1VHMA 2M1CA 3FPVA 4KUOA 5HPIA 1EW0A 2KX6A 2CMNA 4NXEA 1LSVA 1H8MA 4KUKA 3VOLA 1F98A 3IS2A 4B93A 3E4QA 1JNUA 2PYRA 3O5YA 2W3GA 3NOUC 5F68A 4EEUA 1LSXA 5KIZA 2YKHA 4R6LA 1LT0A 4B9OA 3LIEA 1P9RA 3OLOA 3VE3A 5AJGA 1ODVA 3BWLA 5TBMB 2PR6A 1NWZA 1MC0A 3EWKA 1YKDA 2XA7M 5DFYA 3MF0A 4WN5A 2BASA 1V9ZA 2A2LA 2XRNA 2A24A 4EETB 5LBRA 4M4XA 2PD7A 4R38A 2W3EA 5DJUA 3PXPA 4Y2FA 4Y5FA 3BW6A 1OTDA 4I39A 4G3VA 1D06A 2V0WA 3LI9A 1F5MA 2W1RA 1W63Q 3KSIA 4CLCA 3EOIA 3H7WB 4WLAA 4UQIM 2J3WA 2W3DA 3EGDC 4LRZE 4MN5A 1GSVA 1S1YA 4O0PA 3UE3A 3LR4A 1T1BA 3H82A 4ARZA 3SW1A 2OAQ1 4FOFA 3C30A 4PKYG 5DKLA 4WEKA 2D01A 4GS9A 4JGQA 1GSWA 4DJ2A 1MZUA 5TBMA 4HH3A 2WKRA 3CWFA 2XA7S 1N9LA 1DP8A 4YNRA 1UWNX 5TJJA 5HWWA 1G28A 2VJWA 3VV4A 4PHTA 4MN7A 4YOFA 2VEAA 4AFIA 4CLCB 3T4JA 4NXBA 2M7VA 2Z6CA 4BBVA 4O8GA 5HWTA 3LFVA 3MFXA 4Q0JA 1STZA 3OBFA 4KQOA 2PT7A 4II7A 3ZYTA 3FG8A 1XJ3A 2Y8HA 3UB6A 4EXOA 4MCWA 5DFXA 4EEPA 3NJAA 5MC7A 3UE6A 4RQ9A 4H6JB 2O9CA 4DJ3A 4CLCD 3C2WA 3OCNA 5HZHA 3CAXA 3UB7A 5FL3A 3LIDA 2QKPA 1IFQA 1XJ6A 2V1BA 4R3AA 2Z6DA 3UMEA 4O01A 1VB6A 5AVEA 2GX5A 1OTIA 3E0YA 4K08A 4IJGA 1F9IA 5DJTA 5G4YA 2JKRI 2VZWA 2A24B 4ARZB 2Y79A 1XJ2A 3PBQA 3S7PA 3PBRA 4L9EA 3MQQA 3MQOA 1YAXA 3IBJA 2OWHA 4QPRA 2VA0A 3G6OA 5HL6A 1T18A 3OCLA 4F3LB 4GHIB 3F1PB 3H9WA 3F1NA 4KQDA 5KSHA 3H7WA 4HOIA 3GECA 3UMDA 4GHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TS8 A;  5IU1 A;  3LYX A;  4HQA A;  5J4E A;  3ICY A;  3EEH A;  4LLO B;  5IS1 A;  1OT6 A;  2L4R A;  3NHQ A;  4L9G A;  3NOT C;  3H7W B;  4LRY C;  4WLA A;  3PHY A;  5HDD A;  4HJ3 A;  4LRZ E;  4GS9 B;  4MN5 A;  1GSV A;  5F5Y A;  3RTY A;  1S1Y A;  2JN7 A;  3RH8 B;  2ZBB A;  1T1B A;  1WA9 A;  2INW A;  3PYP A;  2WKQ A;  4I3J A;  3KX0 X;  3H82 A;  3SW1 A;  1UGU A;  4PKY G;  1V9Y A;  3LIA A;  5DKL A;  5F69 A;  2D01 A;  3UB9 A;  3C8C A;  2V1A A;  1GSW A;  4GS9 A;  4JGQ A;  5J7E A;  4EEU A;  5A8B A;  2PYP A;  4DJ2 A;  4F3L A;  3F1P A;  1P97 A;  1MZU A;  1OJ5 A;  5TBM A;  3UB8 A;  5HSQ A;  1OJG A;  1P0Z A;  1OT9 A;  3H82 B;  4HH3 A;  3ZQ5 A;  5HWV A;  2WKR A;  3CWF A;  4HP4 A;  4JGO A;  3T50 A;  3A0R A;  2HV1 A;  3BY8 A;  4I3I A;  2GJ3 A;  1LL8 A;  4HI4 A;  1N9L A;  1DP8 A;  1T1C A;  3NOP C;  4GCZ A;  4HP9 A;  4L9F A;  3CLO A;  4WF0 A;  1N9N A;  5DKK A;  4BBU A;  1UWN X;  1GSX A;  1OTE A;  2D02 A;  2L1M A;  3LUQ A;  1G28 A;  3D72 A;  4LRX C;  4R70 A;  5J3W A;  5HWW A;  2VEA A;  3LIC A;  4EW7 A;  2PDR A;  1XFQ A;  2JHE A;  3K3D A;  4NXF A;  4E04 A;  3GDI A;  1TS7 A;  2I9V A;  2VLG A;  4LPZ A;  2P7J A;  2Z6C A;  4NXB A;  4BBV A;  2YKF A;  5HWT A;  2OWJ A;  2J80 A;  2VV6 A;  5HDC A;  3MFX A;  4BBT A;  5HDS A;  4GW9 A;  4H6J A;  4PKY A;  2VV7 A;  1KOU A;  1UWP X;  3A0S A;  3K3C A;  3E4P A;  4HJ4 A;  3FG8 A;  1XJ3 A;  1TS6 A;  4XT2 B;  1N9O A;  3UB6 A;  4EXO A;  5F6A A;  2QWS A;  3NJA A;  4EEP A;  3MXQ A;  5AVF A;  2VV8 A;  4NXG A;  2QJ5 A;  1S1Z A;  2EA9 A;  4I5S A;  4RQ9 A;  4WL9 A;  4H6J B;  3UE6 A;  4EES A;  4DJ3 A;  1T1A A;  3C2W A;  4WUJ A;  2ZOH A;  1LSW A;  3MR0 A;  3FC7 A;  2M1C A;  5HZH A;  5HD5 A;  3CAX A;  4KUO A;  3UB7 A;  4HY8 A;  1X0O A;  1EW0 A;  2KX6 A;  2WKP A;  3B33 A;  3IS2 B;  2W0N A;  3LID A;  5EFW A;  2CMN A;  4EQ1 A;  2QKP A;  3LIF A;  4NXE A;  1XJ6 A;  2V1B A;  1LSV A;  1XJ4 A;  4R3A A;  2OOL A;  1T19 A;  4KUK A;  2Z6D A;  1F98 A;  2QJ7 A;  3LI8 A;  3UME A;  3VOL A;  1VB6 A;  3IS2 A;  4HIA A;  4I38 A;  3E4Q A;  4JGP A;  1JNU A;  2PYR A;  5AVE A;  2R78 A;  1OTI A;  1DRM A;  3NOU C;  1S66 L;  4HHD A;  4K08 A;  4HNB A;  1LSX A;  5F68 A;  1F9I A;  4HH2 A;  5DJT A;  5G4Y A;  3UMD A;  2YKH A;  4R6L A;  1LT0 A;  1S4S A;  1S67 L;  3E4O A;  1S4R A;  3LIE A;  4GHI A;  4HJ6 A;  3OLO A;  4B9O A;  3VE3 A;  2A24 B;  1ODV A;  4JGR A;  1XJ2 A;  3BWL A;  3ULF A;  5TBM B;  2KDK A;  2PR6 A;  4XT2 A;  1NWZ A;  4EER A;  3EWK A;  4MN6 A;  4L9E A;  2PD8 A;  2ZOI A;  3BY9 A;  1DP6 A;  3MQO A;  3MQQ A;  1OTB A;  2K7S A;  3LIB A;  1BYW A;  2BAS A;  3F1O B;  1V9Z A;  3LI9 A;  4WN5 A;  2A24 A;  2OWH A;  1Y28 A;  2PR5 A;  3IBR A;  1D7E A;  3G6O A;  4EET B;  2V0U A;  1T18 A;  3VE4 A;  2W27 A;  4M4X A;  4F3L B;  3MJQ A;  4GHI B;  2QHK A;  3F1P B;  2PHY A;  2PD7 A;  3F1N A;  1XFN A;  3H9W A;  4R38 A;  3HJK A;  1OTA A;  3HJI A;  5KIZ A;  2B02 A;  5DJU A;  2H28 A;  2V9A A;  3F1O A;  2L0W A;  5I5L A;  1DP9 A;  4KQD A;  5G4Z A;  3H7W A;  3A0V A;  5HD3 A;  1OTD A;  4HOI A;  3GEC A;  4I39 A;  1D06 A;  4I3A A;  3F1N B;  3P7N A;  2V0W A;  4YWZ A;  1TS0 A; 
#chains in the Genus database with same CATH topology
 2ZQ7 A;  1AWI A;  4PM8 A;  3EEH A;  3NHQ A;  1CJF A;  2ZC4 B;  3PHY A;  1MY8 A;  5CX7 A;  4GS9 B;  3Q1F A;  1TD5 A;  4OOY A;  4I3J A;  4UHU A;  4R4S A;  1L0D A;  4C6Y A;  2ZQ9 A;  3LY3 A;  2LB5 A;  4JXG A;  1L2S A;  4RYE A;  2R9W A;  3H82 B;  1OT9 A;  1YQS A;  3KSH A;  1U60 A;  3R7W A;  5HAR A;  1H8Y A;  2D02 A;  3Q7Z A;  2DMW A;  3S4X A;  3G30 A;  2FH5 A;  4PPR A;  4EW7 A;  1IEM A;  4ZDX A;  3K3D A;  1XKZ A;  4BD1 A;  2VLG A;  4QB8 A;  3VOY A;  4WEL A;  2LB9 A;  3MKF A;  5HDS A;  4DMZ A;  1L0G A;  4MNR A;  1TS6 A;  3BQA A;  4EU0 A;  1S1Z A;  1XA7 A;  3AGD A;  5HL1 A;  3MQ0 A;  2G7U A;  4OPQ A;  4E3J A;  3QNC A;  4GZB A;  4HES A;  2XDM A;  4UA7 A;  4EQ1 A;  3MBZ A;  4G3W A;  1BSG A;  1CF0 A;  4KZ5 A;  3BJN A;  4JGP A;  2ZMV A;  2R78 A;  2UWX A;  1YLJ A;  4HJ6 A;  1K55 C;  2J9P A;  2ACG A;  3ULF A;  3VFH A;  3PBT A;  1DP6 A;  4CLC C;  3P01 A;  4BWI A;  1YLY A;  4X6T A;  2QHK A;  3S7O A;  5JYO A;  2B02 A;  4BMW A;  5EEC A;  1VQQ A;  3E2K A;  5HD3 A;  5GLA A;  1TS0 A;  5FA7 A;  2G2W A;  4GJ4 A;  1W63 M;  5IS1 A;  2V20 A;  3ZHH A;  3BQ8 A;  4KG6 A;  5IHV A;  3RTY A;  2ZBB A;  4U3T A;  3EQU A;  1WA9 A;  1ZHH B;  4WZ4 A;  1GA9 A;  2Y2N A;  4R1G A;  2M7U A;  2FZ0 A;  1G68 A;  2XFT A;  5J7E A;  5FQK A;  5M1A A;  2WKI A;  2B18 A;  4JF6 A;  5L10 A;  4OH0 A;  5FAS A;  4IED A;  1MWT A;  3KYQ A;  5AQB A;  4WBG A;  4FCF A;  4GD6 A;  5CHJ A;  5HDC A;  2C5W B;  1KVM A;  2FFY A;  3HCY A;  3E4P A;  4XT2 B;  3KYZ A;  3QP4 A;  4OON A;  3V50 A;  3FC7 A;  5K5B A;  3Q7V A;  3B33 A;  3IXH A;  1MBL A;  3LEQ A;  2Y2K A;  2EXA A;  5TFQ A;  1XJ4 A;  3V3S A;  1T19 A;  4Q8I A;  5DF8 A;  3EGX C;  4HIA A;  4I38 A;  2FFF B;  1S67 L;  2W3F A;  3SS3 A;  3VP4 A;  5HPF A;  3N6I A;  3IT9 A;  4OPY A;  4XT2 A;  2VKS A;  5AQ9 A;  3HVF A;  3NY4 A;  2K7S A;  2O9B A;  3F1O B;  2P74 A;  4PM6 A;  1L0E A;  3ISG A;  4L0L A;  2O0Y A;  2VGK A;  1D1J A;  1TF1 A;  3FKV A;  4CQH A;  1DP9 A;  3S7Q A;  4IHQ A;  3ZCZ A;  1H0M A;  2X71 A;  1XGI A;  3P7N A;  3PBN A;  4YWZ A;  1PWG A;  1TS8 A;  5IU1 A;  4OVD A;  3MS6 A;  3WS1 A;  5EE8 A;  4KQQ A;  2Y2M A;  3UN7 A;  3NDE A;  1JTG A;  1P9W A;  4ZAM A;  1H8Z A;  2ZM2 A;  5A93 A;  3U2A A;  2HGV A;  2KLI A;  4IUH A;  1O7E A;  4E3M A;  2JKT M;  3HLC A;  4E6W A;  3P09 A;  5FAO A;  3C8C A;  3AGE A;  2PYP A;  3F1P A;  1P97 A;  4KZA A;  4U0T A;  2K31 A;  4BD0 A;  1H3Q A;  2GJ3 A;  1PIO A;  1T1C A;  2XR0 A;  1BTL A;  3NI9 A;  3AGF A;  3CUE A;  5L09 A;  5E2G A;  5CEB A;  2GZA A;  3VSK A;  3OZH A;  4BBT A;  2H10 A;  3G35 A;  3RFB A;  4IVK A;  2K2N A;  1NXY A;  1NRJ A;  2QJ5 A;  3BFE A;  4WUJ A;  4R4R A;  3C4O A;  2M1C A;  2PRF A;  4KUO A;  1I5Q A;  5HPI A;  1FIK A;  1C3B A;  1LL5 A;  4KUK A;  4JKT A;  3IS2 A;  2W3G A;  5F68 A;  4BQM A;  2ZL1 B;  5KZH A;  4QY6 A;  1SZV A;  5AJG A;  2WZX A;  1FOF A;  3BWL A;  5TBM B;  3EWK A;  2ZQA A;  5DFY A;  3MF0 A;  2BAS A;  1SDE A;  2A2L A;  4X68 A;  4EWF A;  4EET B;  3NDG A;  2PD7 A;  2W3E A;  5I94 A;  4KZ8 A;  3PXP A;  1Y4O A;  4ZJ2 A;  4Y5F A;  1OTD A;  4DDY A;  1D06 A;  3W4O A;  1F5M A;  1JWZ A;  1XP4 A;  3OPL A;  4LRZ E;  4MN5 A;  3C7V A;  1S1Y A;  4O0P A;  3UE3 A;  4NK3 A;  4FOF A;  3C30 A;  4Y13 A;  3CJM A;  2D01 A;  4GS9 A;  1GSW A;  4Y0T A;  4R0Q A;  3S1Y A;  4RX2 A;  3FV7 A;  4OKP A;  2WKR A;  1FCM A;  3Q7V B;  4OQ0 A;  2XA7 S;  1VET A;  3DAV A;  2WGW A;  3VV4 A;  2VEA A;  3W8K A;  1K55 A;  2M7V A;  4O8G A;  4ZJ3 A;  3WWX A;  4LV1 A;  3OBF A;  1SKO B;  3FG8 A;  5A91 A;  4MCW A;  5DFX A;  1W79 A;  5MC7 A;  3OCN A;  1FR6 A;  3CAX A;  4R3A A;  3L9K A;  4OQI A;  3PAG A;  3BRM A;  2Z6D A;  5DF7 A;  5EOE A;  2GX5 A;  3V39 A;  5DJT A;  3C4P A;  4F94 A;  1IKG A;  2Y79 A;  2XH9 A;  3G31 A;  3PBR A;  4KZ9 A;  3MQQ A;  1YAX A;  3C5A A;  3ITA A;  1XPB A;  5BOH A;  4R3J A;  4D2O A;  3JYI A;  3HUO A;  3ICY A;  2XEP A;  4JBF A;  3IHB A;  3HUM A;  3PBO A;  2IWB A;  1XGJ A;  3IX4 A;  5HDD A;  3B3X A;  2JN7 A;  4GDB A;  3PR6 A;  3D9Y A;  4Q0H A;  4Y0O A;  3HRE A;  3UB8 A;  1I2S A;  1P0Z A;  5HWV A;  2MJ6 A;  4WMC A;  3A0R A;  5DTK A;  4ZJ1 A;  3QNB A;  4HI4 A;  4QWO A;  3CIT A;  4BBU A;  3SS4 A;  1FQG A;  3LUQ A;  3JVU A;  3LIC A;  2PDR A;  2YKF A;  4H6J A;  1CK3 A;  5CED A;  1UWP X;  1KGG A;  4DF6 A;  2EA9 A;  5CRF A;  4GB7 A;  1T1A A;  3VP2 A;  3CZD A;  4KZ6 A;  5CTN A;  3UPN A;  2J3T D;  2W0N A;  4C3Q A;  2EX2 A;  1GHI A;  1NJ4 A;  2JKR M;  3T12 B;  3VFF A;  4S2J A;  4C75 A;  5C5K A;  5GHX A;  1H5X A;  4HH2 A;  1ES5 A;  1S4R A;  5HAI A;  1QME A;  4DE2 A;  2VX8 A;  2PD8 A;  1TVF A;  2ZOI A;  3BY9 A;  3EEA A;  1MKM A;  4KEN B;  2WGI A;  3JPU A;  1SHV A;  1HZO A;  1D7E A;  3VE4 A;  4DRT A;  3LR3 A;  3UE1 A;  2H28 A;  2V1Z A;  4ETZ A;  1FR1 A;  1E25 A;  5G4Z A;  1KE0 A;  1S0W A;  2HP9 A;  4HQA A;  1Y54 A;  2XRO A;  2VGL S;  4GNU A;  3OC2 A;  4KQR A;  4IBR A;  3SZT A;  1XA1 A;  3GSG A;  3PYP A;  4GKU A;  3BLS A;  3M6H A;  3BLM A;  2WGW B;  3UB9 A;  1LLB A;  3QP6 A;  3C38 A;  1YM1 A;  1VEU B;  1AXB A;  3V67 A;  3VSL A;  1PWC A;  3T4K A;  1J9M A;  1MWR A;  5A92 A;  1HVB A;  3TJZ C;  3EQV A;  4L9F A;  1PZP A;  4LRX C;  1IYO A;  4YIN A;  3K2N A;  1FSW A;  4NXF A;  1YLW A;  2Y59 A;  3UPO A;  5F1G A;  3QP8 A;  4PKY A;  1VM1 A;  5KMW A;  4X25 A;  5F6A A;  5U47 A;  3TRC A;  3MXQ A;  4NXG A;  3GR2 A;  4EBL A;  2ZOH A;  4WEJ A;  1SCW A;  3LIF A;  3ZFZ A;  1K56 A;  3LI8 A;  4BJP A;  3OOV A;  3GRJ A;  3KYE A;  3MMH A;  4DDS A;  1YSP A;  3T4O A;  1OTB A;  4Z9Q A;  1BYW A;  1WE4 A;  3LIB A;  1HLU P;  2V8C A;  4FSF A;  2PBD P;  3IBR A;  3O3V A;  2ZC5 B;  3W2Z A;  4NEE D;  1PRQ A;  2W27 A;  2PHY A;  3R4K A;  4JXS A;  5FSR A;  3IXG A;  3OPR A;  4OLD A;  5M18 A;  3LCE A;  4IVI A;  4E3O A;  1K4F A;  2Y4A A;  3O86 A;  5G18 A;  1SKF A;  3MKE A;  3ZG5 A;  2HJ9 C;  1BZA A;  2ZM0 A;  5EVI D;  1K0K A;  3T4L A;  1RP5 A;  1OJ5 A;  5HSQ A;  4Q0I A;  2HDU A;  2HV1 A;  3BY8 A;  2JKG A;  1VEU A;  1NZO A;  1F2K A;  3CLO A;  5L8M A;  1N9N A;  4FH2 A;  2L1M A;  3D72 A;  5EM1 A;  1YMX A;  4Y7P A;  4UA6 A;  4MDZ A;  2B5R A;  2DNS A;  2I9V A;  1O07 A;  4X1M A;  3WS4 A;  2W1T B;  3NUL A;  1ZC2 A;  4DE3 A;  4F3L A;  3IF6 A;  2VV8 A;  3DBA A;  4EES A;  4LGW A;  1CEG A;  3RJU A;  2B95 A;  1ES3 A;  4LEN A;  1DJB A;  3FPV A;  5FAQ A;  1EW0 A;  1Z6F A;  1E3U A;  4NXE A;  1CI8 A;  4A5R A;  1LSV A;  4JPM A;  5AQ7 A;  1KGF A;  2XGN A;  3E4Q A;  1VET B;  4EEU A;  1LSX A;  2YKH A;  4R6L A;  4B9O A;  3LIE A;  2XD5 A;  3A3I A;  1W5D A;  3U4L P;  1ERQ A;  5E2E A;  2PR6 A;  2XA7 M;  4WN5 A;  3RXX A;  2A24 A;  3Q81 A;  4M4X A;  2GDN A;  4R38 A;  1PNE A;  5GHZ A;  4Y2F A;  4HBU A;  2Y2I A;  5E2F A;  2ZD8 A;  4N92 A;  1PZO A;  3L7H A;  4I39 A;  5EPH A;  2C6W B;  2W1R A;  3KSI A;  4O7D A;  3H7W B;  3EGD C;  5HAP A;  3Q82 A;  2HP5 A;  3DTE A;  3LR4 A;  3A3F A;  4OQG A;  4B88 A;  2OAQ 1;  3HLF A;  3UO9 A;  1PW1 A;  3MXR A;  3DWK A;  3T1R A;  4D60 A;  5TBM A;  5D3O A;  3ZG8 B;  3UPP A;  1YLT A;  1UWN X;  5TJJ A;  4MN7 A;  5M19 A;  3QHY A;  4PM7 A;  4CLC B;  1K57 A;  3SH7 A;  3WRT A;  1JWV A;  4CJN A;  2Z6C A;  3HLE A;  4BBV A;  5HWT A;  3LFV A;  4Q0J A;  1STZ A;  3I7J A;  5E2H A;  1MXO A;  2EXB A;  3N8R A;  3PAE A;  2JBF A;  3NJA A;  3QP5 A;  4P0M A;  4RQ9 A;  4CLC D;  3C2W A;  5DVA A;  5HZH A;  3UB7 A;  1YLZ A;  2QKP A;  1IFQ A;  1XJ6 A;  1YPR A;  1YT4 A;  3UME A;  1VB6 A;  2Z2M B;  4GDN A;  4BL2 A;  1OTI A;  4ESP A;  3V3R A;  4IJG A;  3TSG A;  3VOZ A;  2VZW A;  4FTX A;  1EWZ A;  1XJ2 A;  3PBQ A;  3S7P A;  3GV9 A;  2DRW A;  4Y15 A;  1FIL A;  3MSH A;  3IBJ A;  3DW0 A;  2VA0 A;  4S2K A;  4XXR A;  5FDS A;  1TDL A;  3H9W A;  2XFS A;  5HFO A;  1KE4 A;  1N4O A;  4S2O A;  5F83 A;  3ZDJ A;  3GVB A;  1PWD A;  3FWL A;  3IHA A;  4XUZ A;  4N9L A;  4GHI A;  3UMD A;  5J4E A;  1HTZ A;  3OPP A;  3MFD A;  2EFU A;  1RGZ A;  2QYB A;  2P9V A;  1YLP A;  1OME A;  2G2U A;  2OV5 A;  4ID4 A;  3T1S A;  3B47 A;  4WM9 A;  5F69 A;  3UY6 A;  5GHY A;  2V1A A;  3P98 A;  3WS2 A;  1IOU A;  4ZRR A;  2HDQ A;  3NCK A;  4KG5 A;  4JGO A;  3OPH A;  1BUL A;  1G5U A;  1KDS A;  2HPB A;  4R3B A;  3NOP C;  5DKK A;  1K57 C;  4JXW A;  5J3W A;  5GLD A;  3B42 A;  2JHE A;  3UDF A;  4DXB A;  3O88 A;  5FAT A;  3KSG A;  2PU4 A;  1G6O A;  2E8J A;  2J80 A;  2VV6 A;  4GW9 A;  1XXM A;  2HP6 A;  3VP0 A;  2QWS A;  5EVI A;  4I5S A;  5FI2 A;  1K38 A;  4UQI S;  3MR0 A;  4QHC A;  2WKP A;  5EFW A;  1MWS A;  3BM6 A;  2QJ7 A;  2OAP 1;  4MLL A;  4PM9 A;  1DRM A;  5EVI C;  2O99 A;  1KVL A;  2OLV A;  4JGR A;  4E3L A;  4QD4 A;  3E2L A;  1LL9 A;  3CPT A;  3TW8 A;  2HZ5 A;  2P08 A;  3VP3 A;  1Q2Q A;  3KSF A;  4X56 A;  3CUE C;  4RX3 A;  2Z2L B;  5I5L A;  3T4Q A;  5EM0 A;  1A0K A;  2RCX A;  4I3A A;  3F1N B;  3T1X A;  4MMN A;  3SOI A;  5DF9 A;  3D3O A;  1OT6 A;  2WAD A;  4LRY C;  4HJ3 A;  5JYP A;  2W3H A;  5FQ9 A;  1DY6 A;  1UGU A;  4PMA A;  4N1X A;  1ONG A;  5TGF A;  5A8B A;  3W4P A;  3SS5 A;  3W4Q A;  3BFC A;  5GL9 A;  1ERO A;  4K91 A;  4P6Z M;  4R70 A;  1ESU A;  2A3U A;  4BL3 A;  2H0T A;  1EI5 A;  4N9K A;  1Z09 A;  2Y2O A;  1NLZ A;  3FYZ A;  4U0X A;  1ONH A;  3K3C A;  1BLH A;  2JKF A;  1K6S A;  2QPN A;  2I72 A;  4CLC E;  1K56 D;  2W1T A;  2V2F F;  2QMI A;  5EOO A;  1CQA A;  1L0F A;  1FCN A;  4HY8 A;  2DCF A;  1NLY A;  1OPX A;  3HLG A;  4HHD A;  3IX3 A;  1E4D A;  1WYC A;  3N7W A;  3MZE A;  1S4S A;  5FAP A;  4FD8 A;  2GNX A;  5HW3 A;  4EUV A;  4K0W A;  1Y28 A;  2Q9N A;  4UAA A;  1XFN A;  1OTA A;  3IH8 A;  5CHM A;  2ZM8 A;  1NZU A;  1MKI A;  3T4S A;  4LV0 A;  4PM5 A;  2IA2 A;  3KO6 A;  3LYX A;  4LLO B;  2KOI A;  3CI6 A;  1IEL A;  3LR0 A;  3RH8 B;  1BLC A;  2EX8 A;  4YFM A;  1V9Y A;  3NEC A;  3ZG9 B;  2ZQD A;  5CER A;  3ZQ5 A;  1QMF A;  4Y0U A;  3T50 A;  1K6R A;  2ZMA A;  4I3I A;  4IUK A;  3ITB A;  2XLN A;  2HDS A;  4WMC D;  3MZD A;  1ZG4 A;  3A3E A;  3FPW A;  1Q2P A;  2HF6 A;  2Y55 A;  2OWJ A;  2ZQC A;  2VV7 A;  1LHY A;  2UV0 E;  4HJ4 A;  2ZC3 B;  4S2M A;  3LR5 A;  5FEF A;  4S2P A;  3G32 A;  1GHP A;  3MXS A;  4LFU A;  1F98 A;  1IKI A;  4B93 A;  2PYR A;  2ZC6 B;  3O5Y A;  3BYD A;  5KIZ A;  1LT0 A;  1P9R A;  3VE3 A;  1ODV A;  5CHU A;  5FDH A;  1CI9 A;  4GOG A;  3BEC A;  1V9Z A;  4B4X A;  5LBR A;  5CXW A;  3HLW A;  2Y2P A;  4HBT A;  3S22 A;  4KZ4 A;  3UDI A;  4ZTK A;  4EQI A;  3BW6 A;  5CEC A;  4G3V A;  5EV0 A;  3LI9 A;  1S6R A;  5HAQ A;  1W63 Q;  4CLC A;  4UQI M;  2J3W A;  3GTC A;  2W3D A;  1GSV A;  4FUW A;  1YMS A;  2ZJ9 A;  3H82 A;  4ARZ A;  3SW1 A;  4PKY G;  5DKL A;  4WEK A;  4BEN A;  4DE0 A;  2P9V B;  1XX2 A;  3LY4 A;  3N8S A;  3NC8 A;  4E3I A;  4DJ2 A;  2J7V A;  4HH3 A;  1RGY A;  5CGX A;  3IXD A;  3CWF A;  4E6X A;  2IWC A;  1N9L A;  1HD8 A;  2VGJ A;  4N1H A;  4YNR A;  2EFX A;  5HWW A;  4PHT A;  2HDR A;  4YOF A;  3FZC A;  4Y17 A;  1I2W A;  4NXB A;  2A49 A;  5F1F A;  1GA0 A;  1PI5 A;  3T1Q B;  4KQO A;  4II7 A;  3ZYT A;  1N9B A;  3IQA A;  3UB6 A;  4EEP A;  4HEF A;  4KZ3 A;  4H6J B;  1W8Q A;  4DJ3 A;  1IYQ A;  4DE1 A;  2JC7 A;  3IF6 B;  3LID A;  2XF3 A;  2V1B A;  1ES4 A;  2X02 A;  1BLP A;  1M40 A;  2H0Y A;  2Q9M A;  3E0Y A;  4K08 A;  3QP2 A;  1F9I A;  5G4Y A;  1PI4 A;  2EX6 A;  1L3L A;  4EBN A;  2BG1 A;  2WK0 A;  1BUE A;  4ARZ B;  3IWO A;  3IWQ A;  5L07 A;  3RXW A;  4L9E A;  1G6A A;  4QPR A;  2ZLY A;  3WRZ A;  4BLM A;  4GD8 A;  1T18 A;  3OCL A;  5HL6 A;  5L2F A;  3F1N A;  3SH9 A;  1IYS A;  4X69 A;  3LGO A;  4DKI A;  3HUN A;  1GCE A;  4KQD A;  5EUA A;  5KSH A;  1W8Y A;  2Y91 A;  2E8I A;  4HOI A;  3GEC A;  3ZNY A;  3WS5 A;  4Y3I A;  4WYY A;  5IT5 A;  2XQZ A;  4QU3 A;  1BT5 A;  4UA9 A;  1PFL A;  1NRF A;  3NIA A;  3CMZ A;  1TEM A;  3CPT B;  5EVL A;  2BLS A;  3IF5 A;  3SH8 A;  3ZGA B;  1LL8 A;  4GCZ A;  3IF6 C;  3NBL A;  4WF0 A;  4K0X A;  5FQQ A;  2JKT I;  5EVI B;  1XFQ A;  3UDX A;  3HLB A;  3GDI A;  2EWV A;  4S2N C;  4OPZ A;  2X01 A;  4JXV A;  1N9O A;  1ERM A;  2WZZ A;  5CGW A;  4B4Z A;  4G3K A;  2OLU A;  2Y2H A;  1RCJ A;  4ME4 A;  1FSY A;  3ZVW A;  4NET A;  1ACF A;  1LSW A;  1X0O A;  2IWD A;  3R7W B;  4GN2 A;  4XUX A;  5J8X A;  1E3U D;  1W7F A;  5GLB A;  3S7N A;  1ESI A;  1S66 L;  2AVX A;  1DJC A;  5TR7 A;  1M6K A;  1MPL A;  2VGL M;  5DTS A;  4OOL A;  2ZMF A;  5E43 A;  5GLC A;  3O87 A;  3G4P A;  5FEG A;  3FKW A;  5CGS A;  2PR5 A;  2V0U A;  2Q0O A;  5F82 A;  3E98 A;  1BLS A;  3ZG7 B;  3F1O A;  2L0W A;  1YSQ A;  4X53 A;  1NYM A;  1ZTU A;  3A0V A;  2PAV P;  3JVV A;  5DTT A;  4GLQ A;  3IH9 A;  4L9G A;  3BFF A;  3NOT C;  2V8F A;  4EER A;  3GMW A;  1SDN A;  3KX0 X;  2VK3 A;  4EBP A;  2Y2G A;  3BEB A;  1TDG A;  2HJE A;  1OJG A;  4EV4 A;  3QP1 A;  4KG2 A;  4E3K A;  4HP4 A;  2J3T C;  1GSX A;  4LCL A;  2EWW A;  3BFD A;  3HL9 A;  4OOM A;  5KSC A;  4E04 A;  1NYY A;  4LPZ A;  4DXC A;  3ZVT A;  4R23 A;  1KDW A;  1JVJ A;  2BTF P;  1KOU A;  4ETX A;  3A0S A;  2NUT C;  3HLD A;  4KZB A;  5FQM A;  5AVF A;  3VMA A;  4LV3 A;  4WL9 A;  1ALQ A;  4NG2 A;  2O9A A;  2RL3 A;  5HD5 A;  3PBS A;  3IS2 B;  5FI7 A;  3IWI A;  3TG9 A;  4P6Z S;  2OOL A;  3LEZ A;  4MEZ A;  3UB5 P;  2Y2J A;  3LO7 A;  4HNB A;  3E4O A;  1K25 A;  3Q07 A;  2KDK A;  2WKH A;  4H8R A;  4MN6 A;  4P85 A;  4X55 A;  1WYB A;  2ZC7 A;  4M3K A;  1FCO A;  1ZG6 A;  3G2Z A;  3MJQ A;  4UEY A;  3HJK A;  3HBR A;  3MZF A;  3HJI A;  3GQZ A;  3DWZ A;  2V9A A;  3TE8 A;  4KZ7 A;  2Y2Q A;  1K4E A;  2P04 A;  2OSU A;  2Y2L A;  2L4R A;  2XSS A;  5F5Y A;  3V5M A;  2INW A;  4MBK A;  2WKQ A;  3C7U A;  1KGE A;  3LIA A;  2ZQ8 A;  4NKP A;  3M2K A;  1PYY A;  3G34 A;  4PAU A;  4LV2 A;  2NUP C;  4HP9 A;  2WYX A;  1OTE A;  3VP1 A;  2J8Y A;  3D4F A;  3N4I A;  3T4T A;  5FI6 A;  1TS7 A;  2P7J A;  5AQA A;  4S2L A;  3DTM A;  4JLF A;  4Z1W A;  1J3W A;  4DN0 A;  1LI0 A;  1VHM A;  4IBX A;  3M2J A;  2KX6 A;  4JF4 A;  3TOI A;  2CMN A;  4E3N A;  1H8M A;  4WZ5 C;  3M6B A;  3VOL A;  1JNU A;  3NOU C;  3UNW A;  1GHM A;  3OLO A;  1NWZ A;  1MC0 A;  1YKD A;  3N8L A;  5CTM A;  2XRN A;  2R9X A;  3CG5 A;  1NY0 A;  2H5S A;  4P87 A;  4OP5 A;  4OPR A;  4OQH A;  5DJU A;  2CC1 A;  1K54 A;  4MBH A;  5FQJ A;  3A3D A;  2XK1 A;  2XD1 A;  5A90 A;  2V0W A;  2ZL1 A;  3EOI A;  4WLA A;  2WKE A;  4S2N A;  2EX9 A;  4RA7 A;  1JWP A;  1T1B A;  5FQI A;  3G2Y A;  3ZNT A;  4P6B A;  4JGQ A;  1ZKJ A;  2PBY A;  1MZU A;  2WAF A;  2JE5 A;  1DP8 A;  1G28 A;  2VJW A;  4AFI A;  2QZ6 A;  3ZG0 A;  1DJA A;  3T4J A;  3PTE A;  2WGV A;  5HX9 A;  1IYP A;  3MFX A;  5EVE A;  1JTD A;  3DTK A;  4OLG A;  4S2I A;  1PW8 A;  2PT7 A;  4QY5 A;  1CEF A;  1XJ3 A;  2Y8H A;  2PU2 A;  4JF5 A;  4EXO A;  3UE6 A;  2O9C A;  3BFG A;  3CHW P;  5FL3 A;  4WZ5 A;  1LI9 A;  4CPK A;  3A3J A;  4FH4 A;  4MBF A;  4O01 A;  5AVE A;  1KE3 A;  2JKR I;  4RVA A;  4QJG A;  2A24 B;  2WAE A;  3IXB A;  4OP8 A;  1MWU A;  3MQO A;  2WUQ A;  2OWH A;  3G6O A;  3IX8 A;  2J9O A;  4EUZ A;  4GHI B;  4F3L B;  3F1P B;  3UE0 A;  4ZBE A;  1SKO A;  2JCH A;  1K54 C;  1ES2 A;  4X1L A;  4LCM A;  3DTI A;  3H7W A;  3WS0 A; 
#chains in the Genus database with same CATH homology
 5J4E A;  3ICY A;  3EEH A;  3NHQ A;  4Y3I A;  3PBO A;  3PHY A;  5IT5 A;  5HDD A;  5CX7 A;  2QYB A;  4GS9 B;  2JN7 A;  1TD5 A;  4I3J A;  3PR6 A;  4Q0H A;  3B47 A;  5F69 A;  2V1A A;  2LB5 A;  1IOU A;  4ZRR A;  3UB8 A;  1P0Z A;  3H82 B;  1OT9 A;  5HWV A;  3KSH A;  2MJ6 A;  4JGO A;  3R7W A;  3A0R A;  1LL8 A;  4HI4 A;  3NOP C;  3CIT A;  4BBU A;  4GCZ A;  4WF0 A;  5DKK A;  2D02 A;  3LUQ A;  2DMW A;  5J3W A;  3JVU A;  2FH5 A;  3LIC A;  3B42 A;  2JKT I;  2PDR A;  4EW7 A;  1XFQ A;  2JHE A;  3K3D A;  3GDI A;  3KSG A;  2VLG A;  1G6O A;  2EWV A;  2YKF A;  4WEL A;  2LB9 A;  2J80 A;  2VV6 A;  5HDS A;  4DMZ A;  4GW9 A;  4H6J A;  1UWP X;  1TS6 A;  1N9O A;  3BQA A;  4EU0 A;  2QWS A;  4G3K A;  1S1Z A;  2EA9 A;  4I5S A;  4ME4 A;  1T1A A;  3MQ0 A;  2G7U A;  1LSW A;  4UQI S;  3MR0 A;  1X0O A;  2WKP A;  4EQ1 A;  3R7W B;  2J3T D;  2W0N A;  5EFW A;  4G3W A;  3BJN A;  2QJ7 A;  2OAP 1;  2JKR M;  4JGP A;  2ZMV A;  3S7N A;  2R78 A;  1DRM A;  1S66 L;  5C5K A;  4HH2 A;  2VGL M;  2O99 A;  4HJ6 A;  1S4R A;  4OOL A;  2ZMF A;  4JGR A;  3ULF A;  2VX8 A;  3PBT A;  2PD8 A;  2ZOI A;  3BY9 A;  3EEA A;  1DP6 A;  1MKM A;  4CLC C;  2PR5 A;  3P01 A;  1D7E A;  2V0U A;  4BWI A;  3VE4 A;  3TW8 A;  3LR3 A;  2P08 A;  2QHK A;  3E98 A;  3S7O A;  2B02 A;  2H28 A;  3KSF A;  4BMW A;  4ETZ A;  3F1O A;  2L0W A;  1YSQ A;  3CUE C;  5I5L A;  5G4Z A;  3T4Q A;  1ZTU A;  3A0V A;  5HD3 A;  4I3A A;  3F1N B;  4MMN A;  1TS0 A;  5DF9 A;  3D3O A;  3JVV A;  1W63 M;  4GJ4 A;  4HQA A;  4GLQ A;  2XRO A;  2VGL S;  5IS1 A;  1OT6 A;  4L9G A;  3BQ8 A;  3NOT C;  4LRY C;  3OC2 A;  4HJ3 A;  4EER A;  3RTY A;  2ZBB A;  2W3H A;  3EQU A;  1WA9 A;  3PYP A;  1ZHH B;  3KX0 X;  1UGU A;  2M7U A;  3UB9 A;  2FZ0 A;  5J7E A;  3C38 A;  5A8B A;  3V67 A;  2HJE A;  1OJG A;  3T4K A;  2B18 A;  4HP4 A;  3TJZ C;  3EQV A;  3KYQ A;  2J3T C;  4L9F A;  1GSX A;  4LRX C;  4P6Z M;  4R70 A;  2EWW A;  4OOM A;  3K2N A;  4NXF A;  4E04 A;  4LPZ A;  1NLZ A;  5HDC A;  4PKY A;  1KOU A;  4ETX A;  3A0S A;  3HCY A;  3K3C A;  2NUT C;  3E4P A;  4XT2 B;  3KYZ A;  5F6A A;  3TRC A;  4CLC E;  3MXQ A;  5AVF A;  4NXG A;  4WL9 A;  2W1T A;  2O9A A;  2ZOH A;  4WEJ A;  3FC7 A;  5K5B A;  5HD5 A;  3PBS A;  4HY8 A;  3IS2 B;  3B33 A;  1NLY A;  3LIF A;  1XJ4 A;  4P6Z S;  2OOL A;  1T19 A;  3LI8 A;  4BJP A;  3EGX C;  4HIA A;  1OPX A;  3OOV A;  4I38 A;  3MMH A;  4HHD A;  4HNB A;  1S4S A;  1S67 L;  3E4O A;  2W3F A;  5HPF A;  2KDK A;  1YSP A;  4XT2 A;  2GNX A;  3T4O A;  4MN6 A;  2VKS A;  4EUV A;  1OTB A;  2K7S A;  3LIB A;  2O9B A;  1BYW A;  3F1O B;  4FSF A;  1Y28 A;  3IBR A;  3W2Z A;  4NEE D;  2W27 A;  3MJQ A;  2PHY A;  4UEY A;  1XFN A;  3R4K A;  3HJK A;  4L0L A;  1OTA A;  2O0Y A;  3HJI A;  1TF1 A;  2V9A A;  3TE8 A;  4CQH A;  1DP9 A;  3S7Q A;  4IHQ A;  3T4S A;  3P7N A;  3PBN A;  2IA2 A;  4YWZ A;  1TS8 A;  2P04 A;  3KO6 A;  3LYX A;  5IU1 A;  4LLO B;  2KOI A;  2L4R A;  3CI6 A;  2XSS A;  3LR0 A;  5F5Y A;  1P9W A;  3RH8 B;  3U2A A;  2INW A;  2HGV A;  2KLI A;  2WKQ A;  4IUH A;  2JKT M;  1V9Y A;  2HJ9 C;  3LIA A;  4NKP A;  3C8C A;  2PYP A;  3F1P A;  1P97 A;  3T4L A;  1OJ5 A;  5HSQ A;  2K31 A;  4PAU A;  3ZQ5 A;  4Q0I A;  1H3Q A;  3T50 A;  2HV1 A;  3BY8 A;  4I3I A;  2GJ3 A;  2NUP C;  4IUK A;  4HP9 A;  1T1C A;  3CLO A;  5L8M A;  1N9N A;  1OTE A;  2L1M A;  3D72 A;  3FPW A;  3CUE A;  3T4T A;  4MDZ A;  1TS7 A;  2GZA A;  2HF6 A;  2I9V A;  2P7J A;  2OWJ A;  4BBT A;  2W1T B;  2VV7 A;  3RFB A;  4HJ4 A;  2K2N A;  4F3L A;  2VV8 A;  1NRJ A;  2QJ5 A;  3LR5 A;  3DBA A;  4EES A;  4Z1W A;  4WUJ A;  4DN0 A;  1VHM A;  2M1C A;  3FPV A;  4KUO A;  5HPI A;  1EW0 A;  2KX6 A;  2CMN A;  4NXE A;  1LSV A;  1H8M A;  4KUK A;  3VOL A;  1F98 A;  3IS2 A;  4B93 A;  3E4Q A;  1JNU A;  2PYR A;  3O5Y A;  2W3G A;  3NOU C;  5F68 A;  4EEU A;  1LSX A;  5KIZ A;  2YKH A;  4R6L A;  1LT0 A;  4B9O A;  3LIE A;  1P9R A;  3OLO A;  3VE3 A;  5AJG A;  1ODV A;  3BWL A;  5TBM B;  2PR6 A;  1NWZ A;  1MC0 A;  3EWK A;  1YKD A;  2XA7 M;  5DFY A;  3MF0 A;  4WN5 A;  2BAS A;  1V9Z A;  2A2L A;  2XRN A;  2A24 A;  4EET B;  5LBR A;  4M4X A;  2PD7 A;  4R38 A;  2W3E A;  5DJU A;  3PXP A;  4Y2F A;  4Y5F A;  3BW6 A;  1OTD A;  4I39 A;  4G3V A;  1D06 A;  2V0W A;  3LI9 A;  1F5M A;  2W1R A;  1W63 Q;  3KSI A;  4CLC A;  3EOI A;  3H7W B;  4WLA A;  4UQI M;  2J3W A;  2W3D A;  3EGD C;  4LRZ E;  4MN5 A;  1GSV A;  1S1Y A;  4O0P A;  3UE3 A;  3LR4 A;  1T1B A;  3H82 A;  4ARZ A;  3SW1 A;  2OAQ 1;  4FOF A;  3C30 A;  4PKY G;  5DKL A;  4WEK A;  2D01 A;  4GS9 A;  4JGQ A;  1GSW A;  4DJ2 A;  1MZU A;  5TBM A;  4HH3 A;  2WKR A;  3CWF A;  2XA7 S;  1N9L A;  1DP8 A;  4YNR A;  1UWN X;  5TJJ A;  5HWW A;  1G28 A;  2VJW A;  3VV4 A;  4PHT A;  4MN7 A;  4YOF A;  2VEA A;  4AFI A;  4CLC B;  3T4J A;  4NXB A;  2M7V A;  2Z6C A;  4BBV A;  4O8G A;  5HWT A;  3LFV A;  3MFX A;  4Q0J A;  1STZ A;  3OBF A;  4KQO A;  2PT7 A;  4II7 A;  3ZYT A;  3FG8 A;  1XJ3 A;  2Y8H A;  3UB6 A;  4EXO A;  4MCW A;  5DFX A;  4EEP A;  3NJA A;  5MC7 A;  3UE6 A;  4RQ9 A;  4H6J B;  2O9C A;  4DJ3 A;  4CLC D;  3C2W A;  3OCN A;  5HZH A;  3CAX A;  3UB7 A;  5FL3 A;  3LID A;  2QKP A;  1IFQ A;  1XJ6 A;  2V1B A;  4R3A A;  2Z6D A;  3UME A;  4O01 A;  1VB6 A;  5AVE A;  2GX5 A;  1OTI A;  3E0Y A;  4K08 A;  4IJG A;  1F9I A;  5DJT A;  5G4Y A;  2JKR I;  2VZW A;  2A24 B;  4ARZ B;  2Y79 A;  1XJ2 A;  3PBQ A;  3S7P A;  3PBR A;  4L9E A;  3MQQ A;  3MQO A;  1YAX A;  3IBJ A;  2OWH A;  4QPR A;  2VA0 A;  3G6O A;  5HL6 A;  1T18 A;  3OCL A;  4F3L B;  4GHI B;  3F1P B;  3H9W A;  3F1N A;  4KQD A;  5KSH A;  3H7W A;  4HOI A;  3GEC A;  3UMD A;  4GHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...