2PD7A

2.0 angstrom crystal structure of the fungal blue-light photoreceptor vivid
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
149
structure length
149
Chain Sequence
MHTLYAPGGYDIMGYLIQIMNRPNPQVELGPVDTSCALILCDLKQKDTPIVYASEAFLYMTGYSNAEVLGRNCRFLQSPDGMVKPKSTRKYVDSNTINTMRKAIDRNAEVQVEVVNFKKNGQRFVNFLTMIPVRDETGEYRYSMGFQCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational switching in the fungal light sensor Vivid
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Circadian clock protein
molecule keywords Vivid PAS protein VVD
total genus 37
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2pd7A00
4HP9A 1OJ5A 1ODVA 2K7SA 4NXFA 4R70A 3BWLA 1JNUA 3MXQA 3OLOA 4R6LA 3ZQ5A 1XJ6A 2WKQA 4DJ3A 4HOIA 4L9EA 3FC7A 2D02A 4PKYG 2V1AA 3EEHA 5F69A 4HI4A 4I38A 3T50A 3MQQA 2INWA 1NWZA 2VLGA 1TS7A 2W27A 3MQOA 2L4RA 2V1BA 1GSVA 2PD8A 4HHDA 5AVFA 4H6JB 1T1AA 1DP9A 5HD5A 4L9GA 2PR5A 3LIAA 2OOLA 3IS2A 1DP6A 3F1PB 5HD3A 4EEUA 3E4OA 3UMEA 2H28A 3HJIA 3LIDA 5J7EA 3B33A 2V0WA 1OTIA 1X0OA 1D7EA 2Z6CA 4HJ4A 4KUOA 4RQ9A 3UB7A 3D72A 2J80A 3H82B 4HP4A 3SW1A 2V9AA 1LL8A 3BY9A 4HNBA 3MR0A 3KX0X 3LIFA 2GJ3A 4EXOA 3NHQA 1LT0A 2R78A 2BASA 4K08A 1LSVA 3P7NA 2PYPA 1DRMA 2HV1A 2WKRA 3H9WA 3LICA 3F1OB 4R3AA 2L0WA 3LIEA 4WL9A 4WUJA 4E04A 3F1OA 4EERA 2I9VA 5DJTA 4LRZE 2JN7A 2V0UA 4EETB 1T19A 3CWFA 3EWKA 3FG8A 3E4QA 3RH8B 4B9OA 4DJ2A 1N9NA 5A8BA 4HY8A 3ICYA 2ZOHA 1VB6A 4HH3A 3A0VA 1XJ3A 3GDIA 1OJGA 3LYXA 4I5SA 3F1NB 3GECA 5G4ZA 1OT6A 5AVEA 5HWTA 3F1NA 3LIBA 5J3WA 1XJ4A 2VV6A 5HDSA 2ZBBA 3C8CA 3MJQA 4JGQA 3VE4A 1OTBA 1S67L 5HWVA 5F5YA 1TS0A 2D01A 2VV8A 1T18A 2L1MA 2QHKA 2WKPA 1N9OA 1XJ2A 2Z6DA 4GW9A 4WLAA 5TBMA 4BBTA 1XFNA 3UE6A 5TBMB 4NXGA 4EW7A 4F3LA 1OT9A 1MZUA 1KOUA 3A0SA 2QKPA 4HH2A 3PHYA 1T1CA 2B02A 1BYWA 2PYRA 4L9FA 2EA9A 1T1BA 4GHIB 2QWSA 4GCZA 4GHIA 1Y28A 3K3DA 3PYPA 4LLOB 4I3IA 5DKKA 4LRXC 3UB9A 4EESA 4GS9B 4H6JA 5IS1A 4EEPA 5HSQA 2A24A 3H82A 3H7WA 3A0RA 4HIAA 4PKYA 1LSXA 1OTDA 1S1ZA 3F1PA 2QJ7A 4JGRA 3LUQA 4KUKA 2PHYA 1LSWA 4WF0A 3RTYA 1G28A 5IU1A 3UB6A 1XFQA 3NOPC 2YKFA 4BBVA 1OTEA 2VV7A 3NOUC 1TS6A 2A24B 3IS2B 2JHEA 1DP8A 1EW0A 2QJ5A 1P0ZA 2YKHA 1UWNX 3IBRA 5EFWA 5HDCA 5HWWA 1V9YA 4LPZA 4M4XA 5HDDA 1S4RA 5F6AA 4MN5A 1N9LA 4F3LB 4JGPA 4I3JA 3CAXA 2OWHA 3LI8A 3E4PA 1V9ZA 3UB8A 3MFXA 3ULFA 1GSWA 2PDRA 5I5LA 5F68A 1OTAA 3G6OA 1S66L 4I39A 2VEAA 5J4EA 4YWZA 2PR6A 4BBUA 3C2WA 1F98A 3NOTC 5G4YA 1UGUA 3UMDA 2KDKA 2M1CA 4NXEA 3NJAA 3HJKA 1WA9A 4KQDA 2ZOIA 4WN5A 2W0NA 5DJUA 4MN6A 4HJ6A 3BY8A 5DKLA 2KX6A 4I3AA 4HQAA 2P7JA 1D06A 1UWPX 3VOLA 3K3CA 4EQ1A 2CMNA 4XT2A 4NXBA 3LI9A 3CLOA 4LRYC 4GS9A 1P97A 4HJ3A 1GSXA 4JGOA 4XT2B 1F9IA 1S4SA 5HZHA 5KIZA 3H7WB 3VE3A 1S1YA 2OWJA 4R38A 1TS8A 2PD7A
chains in the Genus database with same CATH superfamily
4OOLA 3C7VA 4KZBA 2WAFA 2ZQCA 4DRTA 4Y13A 1GCEA 4Y0OA 1DJAA 1DP9A 3UDFA 4QJGA 2PR5A 1XP4A 5IHVA 1FILA 5GLAA 2V0WA 3LY4A 4MBKA 5FQKA 1J3WA 2WKHA 1ESIA 1NXYA 4FUWA 1LL8A 1M40A 5EVIB 4E3MA 1LT0A 2PAVP 3GR2A 5G4YA 3H9WA 4O7DA 5DJTA 2JN7A 4ME4A 3E4QA 3RH8B 2DCFA 3NIAA 3CPTB 4HY8A 5EM0A 4MBHA 1YLWA 3FYZA 4II7A 4OQIA 4DXBA 1FCOA 2K2NA 4MDZA 1T18A 1XJ2A 5E2HA 4ETZA 4NXGA 1MZUA 4LFUA 4BD0A 1T1BA 5GHXA 3A3FA 4LLOB 2FH5A 3CMZA 1DJBA 3LEQA 4H6JA 2A24A 2Y2LA 1BSGA 3H82A 1LSXA 5M19A 3LGOA 3NDGA 3LUQA 5EV0A 4U0TA 5GHYA 4IUHA 2VGLS 1YKDA 2M7UA 3L9KA 4RVAA 3BFEA 3NI9A 5F68A 3PR6A 2H5SA 2PRFA 5FEGA 4DE3A 1WA9A 5DF8A 4KENB 1N4OA 3BQ8A 3VOLA 4PPRA 3C38A 4UQIS 1Q2QA 5GL9A 4KZ5A 2V1ZA 4OH0A 1K57C 4GS9A 4HJ3A 3MQ0A 1F9IA 2H0YA 1H8ZA 2ZD8A 3DWKA 1OPXA 1WE4A 4R4RA 1TF1A 2J9PA 1W8YA 4E3JA 4ZDXA 1PNEA 4HI4A 3SS4A 4EUZA 3VV4A 3MQOA 1GSVA 2A3UA 1JVJA 2ZQAA 3F1PB 3V3SA 3LIDA 1GHIA 1OTIA 1JWPA 4HJ4A 3UB7A 4HP4A 3C5AA 4R3AA 4OKPA 3PBQA 1YAXA 3PBSA 3MBZA 5HPIA 3NULA 3LY3A 5F82A 4MMNA 1ES5A 3F1NA 2QYBA 2OV5A 4S2NA 3LR4A 3M6BA 1PZPA 3B3XA 4OPYA 3RXXA 4EW7A 2ZM0A 1AXBA 4UHUA 2XSSA 1KDWA 3IT9A 4X68A 2J3TD 1OTDA 1K56D 3KSGA 2PU4A 1G28A 4QD4A 3OCLA 2DNSA 2EWVA 4JXVA 3BJNA 2Y2MA 3MZEA 3GRJA 2QPNA 1D1JA 2O9BA 5HW3A 4Q8IA 1SHVA 3Q81A 4RX2A 1BLPA 4G3VA 1PRQA 4PM9A 4MN6A 3MFDA 3GTCA 1Z09A 3ZG7B 1FCMA 4HP9A 1ZG4A 5FATA 5AJGA 3K2NA 4LV3A 3FC7A 1MC0A 2JCHA 4HBTA 4HHDA 2W27A 1CK3A 1P9RA 4U3TA 1H3QA 5CHUA 2ZQ9A 2HDRA 3WS2A 1F5MA 4FH4A 3FZCA 3CITA 3GVBA 3BY9A 1E4DA 1PW1A 2ZMAA 1MKMA 1KVMA 3UB5P 3LIEA 3FG8A 3V67A 1I2WA 1MWRA 2W1TB 2EXAA 5U47A 3OPLA 3LCEA 3O3VA 2Y79A 5CHJA 3VP1A 3VE4A 4E6WA 3DW0A 3QP1A 1IKGA 4B88A 3A0SA 2B02A 2OSUA 3V5MA 1Y28A 1U60A 5E43A 4U0XA 2XH9A 3BLSA 4PAUA 3F1PA 4JGRA 3RTYA 3UB6A 1TDGA 4OOYA 5F1GA 2W3HA 4M4XA 1BLCA 3NECA 4MN5A 1KE0A 5EECA 3ULFA 4LV1A 5EVIC 3E0YA 1F98A 1TVFA 1XKZA 3HREA 1YLYA 3MS6A 3ITBA 1H0MA 2V20A 3OBFA 3QNBA 3E2KA 2E8JA 4EEPA 2WUQA 2VX8A 3CJMA 4NKPA 1FR6A 2EX2A 4PKYG 2E8IA 2INWA 4XUZA 3TJZC 4B93A 3LIAA 4E3NA 2KLIA 2XFTA 5EOOA 5GHZA 5EM1A 1NY0A 1IYPA 4HNBA 3LIFA 2R78A 2P9VA 4WELA 4EERA 1VEUB 1BT5A 3F1OA 1L3LA 3CWFA 2W1TA 4S2PA 1Z6FA 3CPTA 5IT5A 3SZTA 2XF3A 3LIBA 4LCLA 3TG9A 1FSYA 2VKSA 2D01A 2Y2GA 4EBPA 4H8RA 2J9OA 1YMXA 4GHIB 4GCZA 3KSFA 4QU3A 5DKKA 3G32A 2FFYA 3QP4A 5JYOA 5EUAA 1K4FA 3IWQA 5FI7A 1CEFA 3D9YA 2H0TA 2W3EA 4E3KA 1GSWA 3S22A 2LB9A 4NK3A 4GNUA 2PR6A 4EUVA 2JE5A 2GZAA 4KQDA 3IXDA 1UWPX 2ZC5B 4S2OA 2PBYA 2IA2A 1ALQA 1ODVA 3IQAA 5BOHA 4JPMA 4Y0TA 2ZM2A 1K54C 3VFFA 4OQGA 4EWFA 3UPOA 3QP6A 3PBTA 2Y8HA 2J80A 3HLWA 5FQIA 4KQRA 3Q7VB 3N8LA 3WRTA 4E04A 4OLGA 4LRZE 3PBRA 1T19A 3EWKA 4DJ2A 1K55A 4N92A 4R4SA 2P74A 3A0VA 3S1YA 4I5SA 3GECA 2J3WA 4Q0JA 4WZ5A 4PM6A 3T1QB 2NUPC 5FDSA 2QHKA 4X69A 1KGFA 5JYPA 1BUEA 3PYPA 3PXPA 4I3IA 3UB9A 1HLUP 5E2EA 5DFYA 5FAPA 3C7UA 4JKTA 1G6AA 1LL5A 3EGDC 2V8CA 1E3UD 2JKTI 5M18A 3FKWA 4WEJA 3HBRA 2A24B 2ZJ9A 3IBRA 1P0ZA 5EFWA 4BL3A 4K0XA 1WYBA 3LI8A 1FQGA 4XXRA 4WZ4A 1VQQA 3N8SA 3WS0A 4ARZB 4NXEA 3HJKA 4UA6A 2W1RA 3NCKA 1JWVA 4FCFA 3P01A 4GLQA 4KQQA 3UN7A 4E3OA 1EWZA 5CECA 4Y3IA 4BL2A 1KGEA 4EV4A 3HCYA 2HZ5A 3MKEA 4JF4A 2OAP1 3ISGA 4H6JB 4PM5A 3ZFZA 1DP6A 4EBLA 4LGWA 1H8MA 2BG1A 4GKUA 4G3WA 2OLUA 3ZHHA 4E6XA 2GJ3A 5CGWA 1SCWA 4B9OA 2RL3A 2AVXA 3ICYA 2WKEA 4E3LA 3IX4A 1W79A 1XJ3A 3E2LA 5J3WA 5L8MA 5FI6A 3MJQA 5CXWA 2XQZA 1EROA 3MSHA 1N9OA 2XR0A 2Y59A 5L2FA 3QP2A 5HFOA 1PWDA 2GX5A 4BD1A 2VA0A 3ZCZA 5HAIA 3BFFA 2J8YA 2V8FA 3VOYA 4OPZA 4RA7A 3A0RA 1TEMA 3WS4A 3Q07A 4ZJ1A 1UWNX 2B18A 3UY6A 3UE0A 4IBRA 3SH7A 2X71A 3CAXA 1S6RA 1Y54A 5HPFA 3BW6A 4N1XA 5J4EA 2EWWA 1FR1A 4UAAA 1S0WA 3N7WA 2GNXA 3AGEA 5KZHA 1DJCA 5FQ9A 4FH2A 1K54A 4GB7A 3H7WB 3B42A 3M2JA 5CRFA 2X01A 2Y2IA 3MXQA 1G68A 2HDSA 3NC8A 4WMCA 2L4RA 3ZVWA 4IVKA 4P85A 3M6HA 3IWIA 4A5RA 4DF6A 1D7EA 3Q82A 4OP8A 1K55C 4EU0A 3Q1FA 2DMWA 5AQBA 1NJ4A 4WL9A 4Y15A 1W63M 5EPHA 2XGNA 2V0UA 3MXSA 4S2JA 1L0EA 2Q9MA 4HH3A 3LYXA 3F1NB 1OT6A 5CERA 3PAGA 4Y5FA 3G35A 2W3FA 4IJGA 3S7QA 2G2UA 2XK1A 1YM1A 3O87A 1I5QA 2WKPA 3RFBA 1ACFA 4KZAA 4LV0A 2QKPA 4JF5A 3MZFA 4X1MA 5AQ7A 2MJ6A 4WM9A 3W8KA 4WYYA 2PBDP 5FASA 3V50A 4HIAA 4PKYA 5CEDA 1XFQA 2XEPA 4HBUA 1PI4A 3TE8A 4B4XA 3I7JA 1CEGA 3IH9A 4LCMA 5A90A 4CLCD 2HDUA 1HTZA 3S7NA 3QHYA 1JTDA 2KDKA 4Y7PA 3LEZA 4WZ5C 4CLCE 2Y2PA 3PBOA 1ERQA 4HQAA 5L10A 1SDNA 3UDXA 4CQHA 3IX3A 2XA7S 4NXFA 1LL9A 3FPVA 3ZQ5A 3DTIA 4X1LA 4O01A 3QP8A 1F2KA 4KG6A 4QY5A 5AVFA 4L9GA 3EEAA 4BLMA 3UMEA 2H28A 5CEBA 3AGDA 5F83A 2A2LA 2ZC6B 1YQSA 2JKRI 1O07A 3UE3A 3MF0A 5L09A 2DRWA 1YMSA 1YLZA 1KDSA 2PT7A 2I9VA 4ZJ2A 1YLJA 2C5WB 3KYEA 5AQAA 4N9LA 2QMIA 2IWDA 1JWZA 4WEKA 5FQMA 2WKIA 2L1MA 3T4KA 3UPPA 4S2KA 1CQAA 3BEBA 2BLSA 2OAQ1 4EESA 3HUOA 4KG5A 3ZYTA 3H7WA 2YKFA 1OTEA 1YSQA 2KOIA 4IVIA 3G4PA 4KG2A 2HP6A 4LPZA 3M2KA 5F6AA 5D3OA 4YINA 4N9KA 5GLCA 1K6SA 3O88A 3UB8A 3GQZA 1OTAA 4RYEA 4GDBA 4ESPA 4WN5A 4QHCA 4CLCB 5DKLA 4I3AA 2P7JA 4UQIM 3K3CA 3FWLA 4LRYC 3UE6A 3V3RA 1SKFA 2OWJA 4B4ZA 2PD7A 3ITAA 3PTEA 4IEDA 4I38A 4YFMA 4OQHA 4R3BA 3TRCA 4HESA 1ES2A 3D4FA 2HGVA 1X0OA 2GDNA 2JKTM 4ZRRA 3LR0A 3KX0X 3GV9A 4OQ0A 1SZVA 3EOIA 1YSPA 4EETB 1N9NA 2X02A 2W3GA 2P08A 4Y17A 1OTBA 4WLAA 4UA9A 1ZKJA 2WYXA 1CF0A 5DTSA 4JLFA 3HLEA 1Q2PA 4UEYA 3N6IA 3QNCA 5CTMA 2XD1A 5FA7A 4DDSA 1XXMA 3IXHA 3VP0A 3HLFA 3HLDA 4OONA 1ZHHB 2K31A 3WS5A 2ZC7A 4BBUA 1H5XA 1UGUA 4X53A 1QMEA 4S2IA 5GLDA 2M7VA 4KQOA 3GSGA 4ZJ3A 1GA9A 1G5UA 1P97A 1GSXA 2Y2NA 1EI5A 3ZG5A 3OLOA 3U2AA 4KZ4A 1SKOA 4MEZA 3JPUA 1CI8A 4D60A 3OPRA 5HL1A 1NWZA 3IH8A 4L0LA 1MPLA 5FAOA 4P6ZM 3IXBA 4FD8A 2WGIA 1NLZA 2ACGA 5J8XA 3OC2A 5J7EA 5M1AA 5I94A 3B33A 1VEUA 3D72A 3SH8A 2EX9A 1J9MA 1P9WA 4X25A 2WZXA 4C6YA 1BLSA 5L07A 4ZBEA 2L0WA 4YNRA 1CJFA 5CHMA 4KZ7A 1NZUA 3P09A 1YT4A 2IWBA 3KYQA 4MN7A 2XDMA 2ZOHA 1PZOA 3PBNA 1OJGA 5FSRA 1YPRA 2WZZA 3KYZA 4R3JA 1W7FA 4F94A 2ZMVA 3TOIA 4MCWA 3WWXA 5KSCA 4DE0A 1MWTA 4LENA 1MKIA 3VP2A 2EA9A 3W2ZA 3IHBA 1NLYA 1QMFA 2Y91A 3LO7A 4R23A 2JKRM 5HSQA 1M6KA 4JXWA 2QJ7A 4QPRA 1JTGA 1AWIA 4JXSA 3DAVA 5IU1A 5A93A 2WGWB 1DP8A 1EW0A 3HUNA 3BQAA 3Q7VA 5FQQA 1LI9A 4I3JA 5DF9A 2FZ0A 1PIOA 3MFXA 5DVAA 1NZOA 4QB8A 3G6OA 3DWZA 3FV7A 2P9VB 4K91A 4NETA 3C2WA 5DJUA 1YLPA 1CI9A 3MXRA 4KZ3A 3KSHA 1STZA 3DTKA 4ID4A 1D06A 2Y2OA 4EQ1A 1KGGA 4XT2A 1BULA 2Y4AA 2XRNA 1PWGA 2K7SA 4R6LA 4Q0IA 4DJ3A 5KMWA 3C4OA 2PU2A 5AQ9A 3P98A 2V1BA 5CGSA 2W3DA 4IUKA 5EVIA 2NUTC 2Z6CA 1E3UA 3CG5A 4R0QA 3H82B 3U4LP 3MR0A 4EXOA 3GMWA 1DY6A 1LSVA 2PYPA 5HDDA 3LICA 1PYYA 5E2FA 3KO6A 1KE4A 1K6RA 3G2YA 4JXGA 5A8BA 5TR7A 3VP3A 3GDIA 3L7HA 4X6TA 4RX3A 2ZBBA 3EQVA 2Y2QA 2Z6DA 3NDEA 3T4LA 1XFNA 3SS5A 1ESUA 4GJ4A 3VP4A 2ZL1A 2JKGA 4GD8A 1K38A 1Y4OA 1IOUA 2IWCA 1VHMA 3G31A 2ZL1B 1OMEA 5HWWA 1V9YA 2XD5A 3O86A 4BWIA 3JYIA 3ZVTA 1HZOA 2ZLYA 1RGZA 5I5LA 1GHPA 5C5KA 1XPBA 2ZOIA 4Y2FA 4GZBA 4HJ6A 3VOZA 3ZNTA 1MBLA 4LV2A 1TS8A 5CX7A 3BWLA 1XJ6A 3T4TA 4ETXA 2D02A 5F69A 4JF6A 2QZ6A 4K0WA 2VLGA 4P6ZS 3IS2A 2LB5A 3W4OA 4CLCC 3R7WA 3HJIA 3IF6A 3N4IA 1XA1A 4KUOA 5DTTA 3JVVA 4P0MA 1BTLA 1C3BA 5CTNA 3SW1A 1RCJA 3OPPA 3C30A 1ONGA 4WUJA 3B47A 4XUXA 3RJUA 3HUMA 5HL6A 1L2SA 1FOFA 4OVDA 4PMAA 5A91A 1K0KA 4C75A 1IYSA 1W63Q 3PAEA 2EFXA 4Z9QA 5HWVA 5F5YA 4Z1WA 3T1SA 3WRZA 2B5RA 2VV8A 3IF5A 4BBTA 1FCNA 1BZAA 4ZAMA 4BMWA 2UWXA 3BYDA 1RGYA 2QWSA 2ZC4B 1SKOB 5CGXA 3SH9A 2EFUA 1GA0A 4WF0A 4P87A 2WAEA 4BBVA 1TS6A 5FEFA 5DFXA 4BJPA 2ZM8A 1NYMA 4KZ9A 3NBLA 1MXOA 1PWCA 3O5YA 1PI5A 3C4PA 2WADA 4WMCD 4YWZA 4UA7A 3MMHA 3CHWP 3NJAA 2W0NA 1G6OA 4YOFA 1NRJA 2EXBA 3MKFA 3HLBA 3SOIA 5K5BA 4NXBA 3UE1A 5HZHA 5KIZA 4QWOA 2XA7M 5FL3A 5A92A 2ZQDA 2XROA 3Q7ZA 1OJ5A 3R4KA 4R70A 1ONHA 2EX6A 2WGWA 2R9XA 3EEHA 4DE2A 4G3KA 3BRMA 3E4OA 5TGFA 2JBFA 4S2MA 2BTFP 3CI6A 4K08A 1LLBA 2HV1A 4GN2A 4IBXA 1IYQA 4O8GA 1VB6A 1XX2A 3T4JA 4OPQA 2O9CA 1IELA 4DE1A 1ZTUA 3ZGAB 4R1GA 4F3LA 5FI2A 5F1FA 1OT9A 3A3JA 1MWUA 4HH2A 2HP5A 3PHYA 3BLMA 4L9FA 4GHIA 3EQUA 5TJJA 2Y2HA 4X55A 4GS9B 1KE3A 3IF6B 2H10A 2HJ9C 3HLGA 5EVID 2G7UA 1S4RA 3UDIA 3VFHA 4WBGA 1RP5A 3AGFA 2C6WB 4X56A 2PDRA 2Q9NA 3VSKA 1XGIA 4I39A 2VEAA 4BENA 3NOTC 3N8RA 2Y2JA 5EVLA 4QY6A 5EE8A 3IBJA 2CMNA 3NY4A 3LI9A 5HAQA 3MZDA 3IWOA 1S4SA 1VETA 3BECA 5EOEA 2WK0A 4R38A 4MBFA 1GHMA 1ZC2A 1IFQA 2WKQA 4HOIA 4L9EA 3S7PA 2V1AA 3HL9A 4OOMA 2V2FF 3MQQA 1TS7A 2PD8A 2ZQ7A 5HD5A 2VZWA 3IHAA 2OOLA 2EX8A 4EEUA 2JC7A 5TFQA 3FPWA 3A3EA 1I2SA 4ZTKA 2P04A 3SS3A 3OZHA 1E25A 1PFLA 3D3OA 2J3TC 4EQIA 2G2WA 3W4PA 5HARA 5AVEA 5HWTA 3ZG8B 2HDQA 3IX8A 4JGQA 3OOVA 4CPKA 4F3LB 5DTKA 3TSGA 1T1CA 5EVEA 1BYWA 3WS1A 2UV0E 2FFFB 1ERMA 3G34A 1LHYA 3T1XA 3BFDA 4Q0HA 3IF6C 3NOUC 4O0PA 5HDCA 2YKHA 3ZG9B 1ZG6A 4S2NC 1YLTA 2HP9A 1L0DA 4JGPA 5FAQA 4FSFA 2J7VA 5FQJA 4AFIA 4GOGA 3T4OA 4ARZA 3OPHA 2M1CA 3T12B 3HVFA 2B95A 3T4SA 2R9WA 3G2ZA 3DTMA 4MNRA 4PM7A 2VGKA 2A49A 4JGOA 1HVBA 4CJNA 1S1YA 1VETB 5GLBA 5FDHA 1JNUA 3DBAA 2O99A 3T50A 2XLNA 1KVLA 4OPRA 1T1AA 3HLCA 1N9BA 3R7WB 4KZ8A 5HD3A 4BQMA 1W8QA 3T1RA 4DKIA 3VSLA 4RQ9A 2Y55A 4N1HA 2V9AA 3DTEA 3NHQA 3P7NA 1DRMA 1FSWA 3F1OB 2O0YA 4IHQA 3E98A 4OP5A 1K25A 1O7EA 4PM8A 2I72A 3QP5A 3T4QA 2VGJA 2VV6A 3C8CA 4MLLA 1S67L 1TS0A 1IYOA 2ZC3B 1K57A 1MWSA 4GW9A 4Y0UA 5TBMA 1ES4A 3OCNA 4C3QA 1XGJA 3LR3A 3ZDJA 5KSHA 4D2OA 2ZMFA 3LFVA 3BM6A 4DDYA 2HF6A 4KUKA 1XA7A 1LSWA 3VMAA 5HAPA 1A0KA 3CZDA 2VV7A 1FIKA 3V39A 2QJ5A 2CC1A 2VK3A 2Y2KA 4FTXA 3BFCA 4JBFA 3E4PA 1MY8A 1K4EA 5G18A 2ZQ8A 4GD6A 3KSIA 4CLCA 4P6BA 3BY8A 2OLVA 1WYCA 1L0FA 3JVUA 4E3IA 4NEED 3UPNA 3CLOA 4XT2B 3S7OA 1HD8A 3RXWA 2HPBA 5MC7A 1NYYA 3A3DA 4DMZA 3FKVA 1W5DA 3A3IA 3LR5A 1SDEA 3CUEA 4DXCA 3S4XA 2O9AA 4NG2A 2Q0OA 2WGVA 1TDLA 2VGLM 3IXGA 2BASA 5G4ZA 1VM1A 2WKRA 1BLHA 5HX9A 4HEFA 1L0GA 1XJ4A 4KZ6A 5HDSA 1PW8A 3ZG0A 3EGXC 1H8YA 5TBMB 1KOUA 4S2LA 2PYRA 4GDNA 1IKIA 3K3DA 4LRXC 5IS1A 1S1ZA 2HJEA 3G30A 5LBRA 2PHYA 3NOPC 1TD5A 3ZNYA 3IS2B 2JHEA 1K56A 3UO9A 2XFSA 1N9LA 3CUEC 3W4QA 2OWHA 1V9ZA 4OLDA 4DN0A 1NRFA 4PHTA 1S66L 1ES3A 5DF7A 4EBNA 3UMDA 2Z2LB 3UNWA 2RCXA 2KX6A 2JKFA 3BFGA 4M3KA 5E2GA 1LI0A 4FOFA 1IEMA 3VE3A 2VJWA 3TW8A 2Z2MB
chains in the Genus database with same CATH topology
1OJ5A 1ODVA 3R4KA 4R70A 4OOLA 3EEHA 4I38A 3TRCA 1DP9A 2PR5A 4G3KA 3E4OA 3PBTA 2HGVA 2Y8HA 2V0WA 1X0OA 2JKTM 2J80A 4ZRRA 1LL8A 3LR0A 3KX0X 3CI6A 1LT0A 5G4YA 4K08A 2HV1A 3H9WA 3EOIA 4E04A 1YSPA 5DJTA 4LRZE 2JN7A 3PBRA 4EETB 1T19A 3EWKA 4ME4A 3E4QA 3RH8B 4DJ2A 1N9NA 4HY8A 4O8GA 1VB6A 3A0VA 4I5SA 3GECA 2J3WA 2W3GA 4Q0JA 3T4JA 2P08A 2O9CA 2NUPC 4II7A 1OTBA 2K2NA 4MDZA 1ZTUA 1T18A 2QHKA 1XJ2A 4WLAA 4F3LA 4ETZA 4NXGA 1OT9A 1MZUA 4HH2A 3PHYA 4L9FA 1T1BA 4UEYA 4GHIA 3EQUA 3PXPA 3PYPA 2FH5A 4LLOB 5TJJA 4I3IA 3UB9A 4GS9B 4H6JA 2A24A 5DFYA 3H82A 3EGDC 1LSXA 3LUQA 2JKTI 4WEJA 2HJ9C 2A24B 3IBRA 1P0ZA 5EFWA 2G7UA 1S4RA 4IUHA 2VGLS 1YKDA 2M7UA 3LI8A 1ZHHB 2K31A 2PDRA 5F68A 3PR6A 4I39A 2VEAA 4ARZB 4BBUA 3NOTC 1UGUA 4NXEA 3HJKA 1WA9A 2W1RA 3BQ8A 3VOLA 2M7VA 3IBJA 3C38A 2CMNA 4KQOA 4UQIS 3LI9A 3P01A 4GS9A 1P97A 4HJ3A 1GSXA 3MQ0A 1F9IA 1S4SA 4GLQA 4R38A 1OPXA 1TF1A 3OLOA 4Y3IA 1IFQA 3U2AA 2WKQA 4HOIA 4L9EA 3S7PA 2V1AA 4HI4A 4OOMA 3HCYA 3VV4A 3MQQA 1NWZA 1TS7A 3MQOA 4L0LA 1GSVA 2OAP1 2PD8A 4H6JB 5HD5A 4P6ZM 2VZWA 2OOLA 1DP6A 3F1PB 4EEUA 1NLZA 3LIDA 3OC2A 5J7EA 1H8MA 3B33A 1OTIA 4G3WA 4HJ4A 3UB7A 3D72A 4HP4A 1P9WA 2GJ3A 3FPWA 4R3AA 2L0WA 4YNRA 3PBQA 2P04A 1YAXA 3PBSA 5HPIA 4B9OA 3KYQA 3ICYA 3D3OA 2J3TC 2ZOHA 4MN7A 1XJ3A 3PBNA 1OJGA 4MMNA 5AVEA 5HWTA 3F1NA 3KYZA 2QYBA 5J3WA 5L8MA 2ZMVA 3LR4A 3MJQA 4JGQA 3OOVA 4MCWA 4F3LB 1N9OA 4EW7A 2GX5A 1T1CA 2VA0A 1BYWA 2XSSA 2EA9A 3W2ZA 1NLYA 2JKRM 5HSQA 3A0RA 2J3TD 1OTDA 3KSGA 2QJ7A 4QPRA 1G28A 5IU1A 4Q0HA 3OCLA 3NOUC 4O0PA 5HDCA 1DP8A 1EW0A 2YKHA 1UWNX 2B18A 2EWVA 3BQAA 3BJNA 4JGPA 4I3JA 3CAXA 5DF9A 2FZ0A 3MFXA 4FSFA 4AFIA 2O9BA 3G6OA 5HPFA 3T4OA 4ARZA 3BW6A 5J4EA 2EWWA 3C2WA 2M1CA 4G3VA 3T4SA 5DJUA 4MN6A 3KSHA 2GNXA 1STZA 1D06A 4EQ1A 4XT2A 4JGOA 3H7WB 3B42A 1S1YA 2XRNA 4HP9A 2K7SA 1JNUA 3MXQA 4R6LA 5AJGA 3K2NA 4Q0IA 4DJ3A 3FC7A 3DBAA 1MC0A 2O99A 3T50A 4HHDA 2W27A 2L4RA 2V1BA 2W3DA 1P9RA 1T1AA 4IUKA 1H3QA 3R7WB 5HD3A 1F5MA 2NUTC 4RQ9A 2Z6CA 1D7EA 3CITA 3H82B 2V9AA 3BY9A 4EU0A 3MR0A 4EXOA 1MKMA 2DMWA 3NHQA 1LSVA 3P7NA 2PYPA 1DRMA 5HDDA 3LICA 4WL9A 3F1OB 2O0YA 3LIEA 4IHQA 1W63M 2V0UA 3KO6A 3FG8A 3E98A 5A8BA 3V67A 2W1TB 4HH3A 3LYXA 3GDIA 3T4QA 3F1NB 1OT6A 2VV6A 4Y5FA 2Y79A 2ZBBA 3C8CA 2W3FA 4IJGA 3S7QA 3VE4A 1S67L 3EQVA 1TS0A 2Z6DA 2WKPA 4GW9A 5TBMA 3T4LA 1XFNA 3OCNA 3RFBA 3LR3A 4GJ4A 3A0SA 2QKPA 2B02A 5KSHA 2MJ6A 1Y28A 2ZMFA 3LFVA 4HIAA 4PKYA 2HF6A 4PAUA 4KUKA 3F1PA 4JGRA 3RTYA 1LSWA 1IOUA 3UB6A 1XFQA 1VHMA 2VV7A 2QJ5A 3TE8A 5HWWA 2W3HA 1V9YA 4M4XA 4MN5A 4BWIA 3E4PA 3ULFA 5I5LA 4CLCD 3S7NA 5C5KA 3E0YA 1F98A 2KDKA 3KSIA 2ZOIA 4Y2FA 4CLCA 4CLCE 3PBOA 4HJ6A 3BY8A 4HQAA 3JVUA 4NEED 3CLOA 4XT2B 3OBFA 4CQHA 3S7OA 2XA7S 1TS8A 4EEPA 5MC7A 2VX8A 4NXFA 5CX7A 3BWLA 3FPVA 3ZQ5A 1XJ6A 4NKPA 3T4TA 4DMZA 4O01A 2D02A 4PKYG 4ETXA 5F69A 3LR5A 3CUEA 2INWA 2VLGA 5AVFA 4P6ZS 3TJZC 2O9AA 4L9GA 4B93A 3LIAA 3IS2A 3EEAA 2LB5A 2KLIA 4CLCC 3R7WA 3UMEA 2H28A 3HJIA 4KUOA 3JVVA 2A2LA 2VGLM 3SW1A 2JKRI 4HNBA 3LIFA 3UE3A 3MF0A 3C30A 2R78A 2BASA 5G4ZA 2WKRA 3B47A 4WELA 4WUJA 4EERA 2PT7A 3F1OA 2I9VA 5HL6A 3CWFA 2W1TA 5IT5A 3LIBA 1XJ4A 1W63Q 5HDSA 4WEKA 5F5YA 5HWVA 4Z1WA 2VKSA 2D01A 2VV8A 2L1MA 3EGXC 3T4KA 4BBTA 5TBMB 1KOUA 2PYRA 4BMWA 4GHIB 2QWSA 4GCZA 3K3DA 3KSFA 5DKKA 2OAQ1 4LRXC 4EESA 5IS1A 3ZYTA 3H7WA 1S1ZA 2HJEA 4WF0A 5LBRA 2PHYA 3NOPC 1TD5A 2YKFA 1OTEA 4BBVA 1TS6A 1YSQA 2JHEA 2KOIA 3IS2B 4LPZA 5DFXA 4BJPA 5F6AA 1N9LA 2W3EA 3CUEC 2OWHA 1V9ZA 3UB8A 1GSWA 1OTAA 4DN0A 2LB9A 4PHTA 1S66L 3O5YA 4YWZA 2PR6A 3UMDA 4EUVA 2GZAA 3MMHA 3NJAA 4KQDA 4WN5A 2W0NA 4CLCB 5DKLA 2KX6A 1G6OA 4I3AA 1NRJA 4YOFA 2P7JA 4UQIM 1UWPX 3K3CA 5K5BA 4NXBA 4LRYC 3UE6A 5HZHA 5KIZA 4FOFA 2XA7M 3VE3A 2OWJA 5FL3A 2VJWA 3TW8A 2XROA 2IA2A 2PD7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HP9 A;  1OJ5 A;  1ODV A;  2K7S A;  4NXF A;  4R70 A;  3BWL A;  1JNU A;  3MXQ A;  3OLO A;  4R6L A;  3ZQ5 A;  1XJ6 A;  2WKQ A;  4DJ3 A;  4HOI A;  4L9E A;  3FC7 A;  2D02 A;  4PKY G;  2V1A A;  3EEH A;  5F69 A;  4HI4 A;  4I38 A;  3T50 A;  3MQQ A;  2INW A;  1NWZ A;  2VLG A;  1TS7 A;  2W27 A;  3MQO A;  2L4R A;  2V1B A;  1GSV A;  2PD8 A;  4HHD A;  5AVF A;  4H6J B;  1T1A A;  1DP9 A;  5HD5 A;  4L9G A;  2PR5 A;  3LIA A;  2OOL A;  3IS2 A;  1DP6 A;  3F1P B;  5HD3 A;  4EEU A;  3E4O A;  3UME A;  2H28 A;  3HJI A;  3LID A;  5J7E A;  3B33 A;  2V0W A;  1OTI A;  1X0O A;  1D7E A;  2Z6C A;  4HJ4 A;  4KUO A;  4RQ9 A;  3UB7 A;  3D72 A;  2J80 A;  3H82 B;  4HP4 A;  3SW1 A;  2V9A A;  1LL8 A;  3BY9 A;  4HNB A;  3MR0 A;  3KX0 X;  3LIF A;  2GJ3 A;  4EXO A;  3NHQ A;  1LT0 A;  2R78 A;  2BAS A;  4K08 A;  1LSV A;  3P7N A;  2PYP A;  1DRM A;  2HV1 A;  2WKR A;  3H9W A;  3LIC A;  3F1O B;  4R3A A;  2L0W A;  3LIE A;  4WL9 A;  4WUJ A;  4E04 A;  3F1O A;  4EER A;  2I9V A;  5DJT A;  4LRZ E;  2JN7 A;  2V0U A;  4EET B;  1T19 A;  3CWF A;  3EWK A;  3FG8 A;  3E4Q A;  3RH8 B;  4B9O A;  4DJ2 A;  1N9N A;  5A8B A;  4HY8 A;  3ICY A;  2ZOH A;  1VB6 A;  4HH3 A;  3A0V A;  1XJ3 A;  3GDI A;  1OJG A;  3LYX A;  4I5S A;  3F1N B;  3GEC A;  5G4Z A;  1OT6 A;  5AVE A;  5HWT A;  3F1N A;  3LIB A;  5J3W A;  1XJ4 A;  2VV6 A;  5HDS A;  2ZBB A;  3C8C A;  3MJQ A;  4JGQ A;  3VE4 A;  1OTB A;  1S67 L;  5HWV A;  5F5Y A;  1TS0 A;  2D01 A;  2VV8 A;  1T18 A;  2L1M A;  2QHK A;  2WKP A;  1N9O A;  1XJ2 A;  2Z6D A;  4GW9 A;  4WLA A;  5TBM A;  4BBT A;  1XFN A;  3UE6 A;  5TBM B;  4NXG A;  4EW7 A;  4F3L A;  1OT9 A;  1MZU A;  1KOU A;  3A0S A;  2QKP A;  4HH2 A;  3PHY A;  1T1C A;  2B02 A;  1BYW A;  2PYR A;  4L9F A;  2EA9 A;  1T1B A;  4GHI B;  2QWS A;  4GCZ A;  4GHI A;  1Y28 A;  3K3D A;  3PYP A;  4LLO B;  4I3I A;  5DKK A;  4LRX C;  3UB9 A;  4EES A;  4GS9 B;  4H6J A;  5IS1 A;  4EEP A;  5HSQ A;  2A24 A;  3H82 A;  3H7W A;  3A0R A;  4HIA A;  4PKY A;  1LSX A;  1OTD A;  1S1Z A;  3F1P A;  2QJ7 A;  4JGR A;  3LUQ A;  4KUK A;  2PHY A;  1LSW A;  4WF0 A;  3RTY A;  1G28 A;  5IU1 A;  3UB6 A;  1XFQ A;  3NOP C;  2YKF A;  4BBV A;  1OTE A;  2VV7 A;  3NOU C;  1TS6 A;  2A24 B;  3IS2 B;  2JHE A;  1DP8 A;  1EW0 A;  2QJ5 A;  1P0Z A;  2YKH A;  1UWN X;  3IBR A;  5EFW A;  5HDC A;  5HWW A;  1V9Y A;  4LPZ A;  4M4X A;  5HDD A;  1S4R A;  5F6A A;  4MN5 A;  1N9L A;  4F3L B;  4JGP A;  4I3J A;  3CAX A;  2OWH A;  3LI8 A;  3E4P A;  1V9Z A;  3UB8 A;  3MFX A;  3ULF A;  1GSW A;  2PDR A;  5I5L A;  5F68 A;  1OTA A;  3G6O A;  1S66 L;  4I39 A;  2VEA A;  5J4E A;  4YWZ A;  2PR6 A;  4BBU A;  3C2W A;  1F98 A;  3NOT C;  5G4Y A;  1UGU A;  3UMD A;  2KDK A;  2M1C A;  4NXE A;  3NJA A;  3HJK A;  1WA9 A;  4KQD A;  2ZOI A;  4WN5 A;  2W0N A;  5DJU A;  4MN6 A;  4HJ6 A;  3BY8 A;  5DKL A;  2KX6 A;  4I3A A;  4HQA A;  2P7J A;  1D06 A;  1UWP X;  3VOL A;  3K3C A;  4EQ1 A;  2CMN A;  4XT2 A;  4NXB A;  3LI9 A;  3CLO A;  4LRY C;  4GS9 A;  1P97 A;  4HJ3 A;  1GSX A;  4JGO A;  4XT2 B;  1F9I A;  1S4S A;  5HZH A;  5KIZ A;  3H7W B;  3VE3 A;  1S1Y A;  2OWJ A;  4R38 A;  1TS8 A;  2PD7 A; 
#chains in the Genus database with same CATH topology
 4OOL A;  3C7V A;  4KZB A;  2WAF A;  2ZQC A;  4DRT A;  4Y13 A;  1GCE A;  4Y0O A;  1DJA A;  1DP9 A;  3UDF A;  4QJG A;  2PR5 A;  1XP4 A;  5IHV A;  1FIL A;  5GLA A;  2V0W A;  3LY4 A;  4MBK A;  5FQK A;  1J3W A;  2WKH A;  1ESI A;  1NXY A;  4FUW A;  1LL8 A;  1M40 A;  5EVI B;  4E3M A;  1LT0 A;  2PAV P;  3GR2 A;  5G4Y A;  3H9W A;  4O7D A;  5DJT A;  2JN7 A;  4ME4 A;  3E4Q A;  3RH8 B;  2DCF A;  3NIA A;  3CPT B;  4HY8 A;  5EM0 A;  4MBH A;  1YLW A;  3FYZ A;  4II7 A;  4OQI A;  4DXB A;  1FCO A;  2K2N A;  4MDZ A;  1T18 A;  1XJ2 A;  5E2H A;  4ETZ A;  4NXG A;  1MZU A;  4LFU A;  4BD0 A;  1T1B A;  5GHX A;  3A3F A;  4LLO B;  2FH5 A;  3CMZ A;  1DJB A;  3LEQ A;  4H6J A;  2A24 A;  2Y2L A;  1BSG A;  3H82 A;  1LSX A;  5M19 A;  3LGO A;  3NDG A;  3LUQ A;  5EV0 A;  4U0T A;  5GHY A;  4IUH A;  2VGL S;  1YKD A;  2M7U A;  3L9K A;  4RVA A;  3BFE A;  3NI9 A;  5F68 A;  3PR6 A;  2H5S A;  2PRF A;  5FEG A;  4DE3 A;  1WA9 A;  5DF8 A;  4KEN B;  1N4O A;  3BQ8 A;  3VOL A;  4PPR A;  3C38 A;  4UQI S;  1Q2Q A;  5GL9 A;  4KZ5 A;  2V1Z A;  4OH0 A;  1K57 C;  4GS9 A;  4HJ3 A;  3MQ0 A;  1F9I A;  2H0Y A;  1H8Z A;  2ZD8 A;  3DWK A;  1OPX A;  1WE4 A;  4R4R A;  1TF1 A;  2J9P A;  1W8Y A;  4E3J A;  4ZDX A;  1PNE A;  4HI4 A;  3SS4 A;  4EUZ A;  3VV4 A;  3MQO A;  1GSV A;  2A3U A;  1JVJ A;  2ZQA A;  3F1P B;  3V3S A;  3LID A;  1GHI A;  1OTI A;  1JWP A;  4HJ4 A;  3UB7 A;  4HP4 A;  3C5A A;  4R3A A;  4OKP A;  3PBQ A;  1YAX A;  3PBS A;  3MBZ A;  5HPI A;  3NUL A;  3LY3 A;  5F82 A;  4MMN A;  1ES5 A;  3F1N A;  2QYB A;  2OV5 A;  4S2N A;  3LR4 A;  3M6B A;  1PZP A;  3B3X A;  4OPY A;  3RXX A;  4EW7 A;  2ZM0 A;  1AXB A;  4UHU A;  2XSS A;  1KDW A;  3IT9 A;  4X68 A;  2J3T D;  1OTD A;  1K56 D;  3KSG A;  2PU4 A;  1G28 A;  4QD4 A;  3OCL A;  2DNS A;  2EWV A;  4JXV A;  3BJN A;  2Y2M A;  3MZE A;  3GRJ A;  2QPN A;  1D1J A;  2O9B A;  5HW3 A;  4Q8I A;  1SHV A;  3Q81 A;  4RX2 A;  1BLP A;  4G3V A;  1PRQ A;  4PM9 A;  4MN6 A;  3MFD A;  3GTC A;  1Z09 A;  3ZG7 B;  1FCM A;  4HP9 A;  1ZG4 A;  5FAT A;  5AJG A;  3K2N A;  4LV3 A;  3FC7 A;  1MC0 A;  2JCH A;  4HBT A;  4HHD A;  2W27 A;  1CK3 A;  1P9R A;  4U3T A;  1H3Q A;  5CHU A;  2ZQ9 A;  2HDR A;  3WS2 A;  1F5M A;  4FH4 A;  3FZC A;  3CIT A;  3GVB A;  3BY9 A;  1E4D A;  1PW1 A;  2ZMA A;  1MKM A;  1KVM A;  3UB5 P;  3LIE A;  3FG8 A;  3V67 A;  1I2W A;  1MWR A;  2W1T B;  2EXA A;  5U47 A;  3OPL A;  3LCE A;  3O3V A;  2Y79 A;  5CHJ A;  3VP1 A;  3VE4 A;  4E6W A;  3DW0 A;  3QP1 A;  1IKG A;  4B88 A;  3A0S A;  2B02 A;  2OSU A;  3V5M A;  1Y28 A;  1U60 A;  5E43 A;  4U0X A;  2XH9 A;  3BLS A;  4PAU A;  3F1P A;  4JGR A;  3RTY A;  3UB6 A;  1TDG A;  4OOY A;  5F1G A;  2W3H A;  4M4X A;  1BLC A;  3NEC A;  4MN5 A;  1KE0 A;  5EEC A;  3ULF A;  4LV1 A;  5EVI C;  3E0Y A;  1F98 A;  1TVF A;  1XKZ A;  3HRE A;  1YLY A;  3MS6 A;  3ITB A;  1H0M A;  2V20 A;  3OBF A;  3QNB A;  3E2K A;  2E8J A;  4EEP A;  2WUQ A;  2VX8 A;  3CJM A;  4NKP A;  1FR6 A;  2EX2 A;  4PKY G;  2E8I A;  2INW A;  4XUZ A;  3TJZ C;  4B93 A;  3LIA A;  4E3N A;  2KLI A;  2XFT A;  5EOO A;  5GHZ A;  5EM1 A;  1NY0 A;  1IYP A;  4HNB A;  3LIF A;  2R78 A;  2P9V A;  4WEL A;  4EER A;  1VEU B;  1BT5 A;  3F1O A;  1L3L A;  3CWF A;  2W1T A;  4S2P A;  1Z6F A;  3CPT A;  5IT5 A;  3SZT A;  2XF3 A;  3LIB A;  4LCL A;  3TG9 A;  1FSY A;  2VKS A;  2D01 A;  2Y2G A;  4EBP A;  4H8R A;  2J9O A;  1YMX A;  4GHI B;  4GCZ A;  3KSF A;  4QU3 A;  5DKK A;  3G32 A;  2FFY A;  3QP4 A;  5JYO A;  5EUA A;  1K4F A;  3IWQ A;  5FI7 A;  1CEF A;  3D9Y A;  2H0T A;  2W3E A;  4E3K A;  1GSW A;  3S22 A;  2LB9 A;  4NK3 A;  4GNU A;  2PR6 A;  4EUV A;  2JE5 A;  2GZA A;  4KQD A;  3IXD A;  1UWP X;  2ZC5 B;  4S2O A;  2PBY A;  2IA2 A;  1ALQ A;  1ODV A;  3IQA A;  5BOH A;  4JPM A;  4Y0T A;  2ZM2 A;  1K54 C;  3VFF A;  4OQG A;  4EWF A;  3UPO A;  3QP6 A;  3PBT A;  2Y8H A;  2J80 A;  3HLW A;  5FQI A;  4KQR A;  3Q7V B;  3N8L A;  3WRT A;  4E04 A;  4OLG A;  4LRZ E;  3PBR A;  1T19 A;  3EWK A;  4DJ2 A;  1K55 A;  4N92 A;  4R4S A;  2P74 A;  3A0V A;  3S1Y A;  4I5S A;  3GEC A;  2J3W A;  4Q0J A;  4WZ5 A;  4PM6 A;  3T1Q B;  2NUP C;  5FDS A;  2QHK A;  4X69 A;  1KGF A;  5JYP A;  1BUE A;  3PYP A;  3PXP A;  4I3I A;  3UB9 A;  1HLU P;  5E2E A;  5DFY A;  5FAP A;  3C7U A;  4JKT A;  1G6A A;  1LL5 A;  3EGD C;  2V8C A;  1E3U D;  2JKT I;  5M18 A;  3FKW A;  4WEJ A;  3HBR A;  2A24 B;  2ZJ9 A;  3IBR A;  1P0Z A;  5EFW A;  4BL3 A;  4K0X A;  1WYB A;  3LI8 A;  1FQG A;  4XXR A;  4WZ4 A;  1VQQ A;  3N8S A;  3WS0 A;  4ARZ B;  4NXE A;  3HJK A;  4UA6 A;  2W1R A;  3NCK A;  1JWV A;  4FCF A;  3P01 A;  4GLQ A;  4KQQ A;  3UN7 A;  4E3O A;  1EWZ A;  5CEC A;  4Y3I A;  4BL2 A;  1KGE A;  4EV4 A;  3HCY A;  2HZ5 A;  3MKE A;  4JF4 A;  2OAP 1;  3ISG A;  4H6J B;  4PM5 A;  3ZFZ A;  1DP6 A;  4EBL A;  4LGW A;  1H8M A;  2BG1 A;  4GKU A;  4G3W A;  2OLU A;  3ZHH A;  4E6X A;  2GJ3 A;  5CGW A;  1SCW A;  4B9O A;  2RL3 A;  2AVX A;  3ICY A;  2WKE A;  4E3L A;  3IX4 A;  1W79 A;  1XJ3 A;  3E2L A;  5J3W A;  5L8M A;  5FI6 A;  3MJQ A;  5CXW A;  2XQZ A;  1ERO A;  3MSH A;  1N9O A;  2XR0 A;  2Y59 A;  5L2F A;  3QP2 A;  5HFO A;  1PWD A;  2GX5 A;  4BD1 A;  2VA0 A;  3ZCZ A;  5HAI A;  3BFF A;  2J8Y A;  2V8F A;  3VOY A;  4OPZ A;  4RA7 A;  3A0R A;  1TEM A;  3WS4 A;  3Q07 A;  4ZJ1 A;  1UWN X;  2B18 A;  3UY6 A;  3UE0 A;  4IBR A;  3SH7 A;  2X71 A;  3CAX A;  1S6R A;  1Y54 A;  5HPF A;  3BW6 A;  4N1X A;  5J4E A;  2EWW A;  1FR1 A;  4UAA A;  1S0W A;  3N7W A;  2GNX A;  3AGE A;  5KZH A;  1DJC A;  5FQ9 A;  4FH2 A;  1K54 A;  4GB7 A;  3H7W B;  3B42 A;  3M2J A;  5CRF A;  2X01 A;  2Y2I A;  3MXQ A;  1G68 A;  2HDS A;  3NC8 A;  4WMC A;  2L4R A;  3ZVW A;  4IVK A;  4P85 A;  3M6H A;  3IWI A;  4A5R A;  4DF6 A;  1D7E A;  3Q82 A;  4OP8 A;  1K55 C;  4EU0 A;  3Q1F A;  2DMW A;  5AQB A;  1NJ4 A;  4WL9 A;  4Y15 A;  1W63 M;  5EPH A;  2XGN A;  2V0U A;  3MXS A;  4S2J A;  1L0E A;  2Q9M A;  4HH3 A;  3LYX A;  3F1N B;  1OT6 A;  5CER A;  3PAG A;  4Y5F A;  3G35 A;  2W3F A;  4IJG A;  3S7Q A;  2G2U A;  2XK1 A;  1YM1 A;  3O87 A;  1I5Q A;  2WKP A;  3RFB A;  1ACF A;  4KZA A;  4LV0 A;  2QKP A;  4JF5 A;  3MZF A;  4X1M A;  5AQ7 A;  2MJ6 A;  4WM9 A;  3W8K A;  4WYY A;  2PBD P;  5FAS A;  3V50 A;  4HIA A;  4PKY A;  5CED A;  1XFQ A;  2XEP A;  4HBU A;  1PI4 A;  3TE8 A;  4B4X A;  3I7J A;  1CEG A;  3IH9 A;  4LCM A;  5A90 A;  4CLC D;  2HDU A;  1HTZ A;  3S7N A;  3QHY A;  1JTD A;  2KDK A;  4Y7P A;  3LEZ A;  4WZ5 C;  4CLC E;  2Y2P A;  3PBO A;  1ERQ A;  4HQA A;  5L10 A;  1SDN A;  3UDX A;  4CQH A;  3IX3 A;  2XA7 S;  4NXF A;  1LL9 A;  3FPV A;  3ZQ5 A;  3DTI A;  4X1L A;  4O01 A;  3QP8 A;  1F2K A;  4KG6 A;  4QY5 A;  5AVF A;  4L9G A;  3EEA A;  4BLM A;  3UME A;  2H28 A;  5CEB A;  3AGD A;  5F83 A;  2A2L A;  2ZC6 B;  1YQS A;  2JKR I;  1O07 A;  3UE3 A;  3MF0 A;  5L09 A;  2DRW A;  1YMS A;  1YLZ A;  1KDS A;  2PT7 A;  2I9V A;  4ZJ2 A;  1YLJ A;  2C5W B;  3KYE A;  5AQA A;  4N9L A;  2QMI A;  2IWD A;  1JWZ A;  4WEK A;  5FQM A;  2WKI A;  2L1M A;  3T4K A;  3UPP A;  4S2K A;  1CQA A;  3BEB A;  2BLS A;  2OAQ 1;  4EES A;  3HUO A;  4KG5 A;  3ZYT A;  3H7W A;  2YKF A;  1OTE A;  1YSQ A;  2KOI A;  4IVI A;  3G4P A;  4KG2 A;  2HP6 A;  4LPZ A;  3M2K A;  5F6A A;  5D3O A;  4YIN A;  4N9K A;  5GLC A;  1K6S A;  3O88 A;  3UB8 A;  3GQZ A;  1OTA A;  4RYE A;  4GDB A;  4ESP A;  4WN5 A;  4QHC A;  4CLC B;  5DKL A;  4I3A A;  2P7J A;  4UQI M;  3K3C A;  3FWL A;  4LRY C;  3UE6 A;  3V3R A;  1SKF A;  2OWJ A;  4B4Z A;  2PD7 A;  3ITA A;  3PTE A;  4IED A;  4I38 A;  4YFM A;  4OQH A;  4R3B A;  3TRC A;  4HES A;  1ES2 A;  3D4F A;  2HGV A;  1X0O A;  2GDN A;  2JKT M;  4ZRR A;  3LR0 A;  3KX0 X;  3GV9 A;  4OQ0 A;  1SZV A;  3EOI A;  1YSP A;  4EET B;  1N9N A;  2X02 A;  2W3G A;  2P08 A;  4Y17 A;  1OTB A;  4WLA A;  4UA9 A;  1ZKJ A;  2WYX A;  1CF0 A;  5DTS A;  4JLF A;  3HLE A;  1Q2P A;  4UEY A;  3N6I A;  3QNC A;  5CTM A;  2XD1 A;  5FA7 A;  4DDS A;  1XXM A;  3IXH A;  3VP0 A;  3HLF A;  3HLD A;  4OON A;  1ZHH B;  2K31 A;  3WS5 A;  2ZC7 A;  4BBU A;  1H5X A;  1UGU A;  4X53 A;  1QME A;  4S2I A;  5GLD A;  2M7V A;  4KQO A;  3GSG A;  4ZJ3 A;  1GA9 A;  1G5U A;  1P97 A;  1GSX A;  2Y2N A;  1EI5 A;  3ZG5 A;  3OLO A;  3U2A A;  4KZ4 A;  1SKO A;  4MEZ A;  3JPU A;  1CI8 A;  4D60 A;  3OPR A;  5HL1 A;  1NWZ A;  3IH8 A;  4L0L A;  1MPL A;  5FAO A;  4P6Z M;  3IXB A;  4FD8 A;  2WGI A;  1NLZ A;  2ACG A;  5J8X A;  3OC2 A;  5J7E A;  5M1A A;  5I94 A;  3B33 A;  1VEU A;  3D72 A;  3SH8 A;  2EX9 A;  1J9M A;  1P9W A;  4X25 A;  2WZX A;  4C6Y A;  1BLS A;  5L07 A;  4ZBE A;  2L0W A;  4YNR A;  1CJF A;  5CHM A;  4KZ7 A;  1NZU A;  3P09 A;  1YT4 A;  2IWB A;  3KYQ A;  4MN7 A;  2XDM A;  2ZOH A;  1PZO A;  3PBN A;  1OJG A;  5FSR A;  1YPR A;  2WZZ A;  3KYZ A;  4R3J A;  1W7F A;  4F94 A;  2ZMV A;  3TOI A;  4MCW A;  3WWX A;  5KSC A;  4DE0 A;  1MWT A;  4LEN A;  1MKI A;  3VP2 A;  2EA9 A;  3W2Z A;  3IHB A;  1NLY A;  1QMF A;  2Y91 A;  3LO7 A;  4R23 A;  2JKR M;  5HSQ A;  1M6K A;  4JXW A;  2QJ7 A;  4QPR A;  1JTG A;  1AWI A;  4JXS A;  3DAV A;  5IU1 A;  5A93 A;  2WGW B;  1DP8 A;  1EW0 A;  3HUN A;  3BQA A;  3Q7V A;  5FQQ A;  1LI9 A;  4I3J A;  5DF9 A;  2FZ0 A;  1PIO A;  3MFX A;  5DVA A;  1NZO A;  4QB8 A;  3G6O A;  3DWZ A;  3FV7 A;  2P9V B;  4K91 A;  4NET A;  3C2W A;  5DJU A;  1YLP A;  1CI9 A;  3MXR A;  4KZ3 A;  3KSH A;  1STZ A;  3DTK A;  4ID4 A;  1D06 A;  2Y2O A;  4EQ1 A;  1KGG A;  4XT2 A;  1BUL A;  2Y4A A;  2XRN A;  1PWG A;  2K7S A;  4R6L A;  4Q0I A;  4DJ3 A;  5KMW A;  3C4O A;  2PU2 A;  5AQ9 A;  3P98 A;  2V1B A;  5CGS A;  2W3D A;  4IUK A;  5EVI A;  2NUT C;  2Z6C A;  1E3U A;  3CG5 A;  4R0Q A;  3H82 B;  3U4L P;  3MR0 A;  4EXO A;  3GMW A;  1DY6 A;  1LSV A;  2PYP A;  5HDD A;  3LIC A;  1PYY A;  5E2F A;  3KO6 A;  1KE4 A;  1K6R A;  3G2Y A;  4JXG A;  5A8B A;  5TR7 A;  3VP3 A;  3GDI A;  3L7H A;  4X6T A;  4RX3 A;  2ZBB A;  3EQV A;  2Y2Q A;  2Z6D A;  3NDE A;  3T4L A;  1XFN A;  3SS5 A;  1ESU A;  4GJ4 A;  3VP4 A;  2ZL1 A;  2JKG A;  4GD8 A;  1K38 A;  1Y4O A;  1IOU A;  2IWC A;  1VHM A;  3G31 A;  2ZL1 B;  1OME A;  5HWW A;  1V9Y A;  2XD5 A;  3O86 A;  4BWI A;  3JYI A;  3ZVT A;  1HZO A;  2ZLY A;  1RGZ A;  5I5L A;  1GHP A;  5C5K A;  1XPB A;  2ZOI A;  4Y2F A;  4GZB A;  4HJ6 A;  3VOZ A;  3ZNT A;  1MBL A;  4LV2 A;  1TS8 A;  5CX7 A;  3BWL A;  1XJ6 A;  3T4T A;  4ETX A;  2D02 A;  5F69 A;  4JF6 A;  2QZ6 A;  4K0W A;  2VLG A;  4P6Z S;  3IS2 A;  2LB5 A;  3W4O A;  4CLC C;  3R7W A;  3HJI A;  3IF6 A;  3N4I A;  1XA1 A;  4KUO A;  5DTT A;  3JVV A;  4P0M A;  1BTL A;  1C3B A;  5CTN A;  3SW1 A;  1RCJ A;  3OPP A;  3C30 A;  1ONG A;  4WUJ A;  3B47 A;  4XUX A;  3RJU A;  3HUM A;  5HL6 A;  1L2S A;  1FOF A;  4OVD A;  4PMA A;  5A91 A;  1K0K A;  4C75 A;  1IYS A;  1W63 Q;  3PAE A;  2EFX A;  4Z9Q A;  5HWV A;  5F5Y A;  4Z1W A;  3T1S A;  3WRZ A;  2B5R A;  2VV8 A;  3IF5 A;  4BBT A;  1FCN A;  1BZA A;  4ZAM A;  4BMW A;  2UWX A;  3BYD A;  1RGY A;  2QWS A;  2ZC4 B;  1SKO B;  5CGX A;  3SH9 A;  2EFU A;  1GA0 A;  4WF0 A;  4P87 A;  2WAE A;  4BBV A;  1TS6 A;  5FEF A;  5DFX A;  4BJP A;  2ZM8 A;  1NYM A;  4KZ9 A;  3NBL A;  1MXO A;  1PWC A;  3O5Y A;  1PI5 A;  3C4P A;  2WAD A;  4WMC D;  4YWZ A;  4UA7 A;  3MMH A;  3CHW P;  3NJA A;  2W0N A;  1G6O A;  4YOF A;  1NRJ A;  2EXB A;  3MKF A;  3HLB A;  3SOI A;  5K5B A;  4NXB A;  3UE1 A;  5HZH A;  5KIZ A;  4QWO A;  2XA7 M;  5FL3 A;  5A92 A;  2ZQD A;  2XRO A;  3Q7Z A;  1OJ5 A;  3R4K A;  4R70 A;  1ONH A;  2EX6 A;  2WGW A;  2R9X A;  3EEH A;  4DE2 A;  4G3K A;  3BRM A;  3E4O A;  5TGF A;  2JBF A;  4S2M A;  2BTF P;  3CI6 A;  4K08 A;  1LLB A;  2HV1 A;  4GN2 A;  4IBX A;  1IYQ A;  4O8G A;  1VB6 A;  1XX2 A;  3T4J A;  4OPQ A;  2O9C A;  1IEL A;  4DE1 A;  1ZTU A;  3ZGA B;  4R1G A;  4F3L A;  5FI2 A;  5F1F A;  1OT9 A;  3A3J A;  1MWU A;  4HH2 A;  2HP5 A;  3PHY A;  3BLM A;  4L9F A;  4GHI A;  3EQU A;  5TJJ A;  2Y2H A;  4X55 A;  4GS9 B;  1KE3 A;  3IF6 B;  2H10 A;  2HJ9 C;  3HLG A;  5EVI D;  2G7U A;  1S4R A;  3UDI A;  3VFH A;  4WBG A;  1RP5 A;  3AGF A;  2C6W B;  4X56 A;  2PDR A;  2Q9N A;  3VSK A;  1XGI A;  4I39 A;  2VEA A;  4BEN A;  3NOT C;  3N8R A;  2Y2J A;  5EVL A;  4QY6 A;  5EE8 A;  3IBJ A;  2CMN A;  3NY4 A;  3LI9 A;  5HAQ A;  3MZD A;  3IWO A;  1S4S A;  1VET A;  3BEC A;  5EOE A;  2WK0 A;  4R38 A;  4MBF A;  1GHM A;  1ZC2 A;  1IFQ A;  2WKQ A;  4HOI A;  4L9E A;  3S7P A;  2V1A A;  3HL9 A;  4OOM A;  2V2F F;  3MQQ A;  1TS7 A;  2PD8 A;  2ZQ7 A;  5HD5 A;  2VZW A;  3IHA A;  2OOL A;  2EX8 A;  4EEU A;  2JC7 A;  5TFQ A;  3FPW A;  3A3E A;  1I2S A;  4ZTK A;  2P04 A;  3SS3 A;  3OZH A;  1E25 A;  1PFL A;  3D3O A;  2J3T C;  4EQI A;  2G2W A;  3W4P A;  5HAR A;  5AVE A;  5HWT A;  3ZG8 B;  2HDQ A;  3IX8 A;  4JGQ A;  3OOV A;  4CPK A;  4F3L B;  5DTK A;  3TSG A;  1T1C A;  5EVE A;  1BYW A;  3WS1 A;  2UV0 E;  2FFF B;  1ERM A;  3G34 A;  1LHY A;  3T1X A;  3BFD A;  4Q0H A;  3IF6 C;  3NOU C;  4O0P A;  5HDC A;  2YKH A;  3ZG9 B;  1ZG6 A;  4S2N C;  1YLT A;  2HP9 A;  1L0D A;  4JGP A;  5FAQ A;  4FSF A;  2J7V A;  5FQJ A;  4AFI A;  4GOG A;  3T4O A;  4ARZ A;  3OPH A;  2M1C A;  3T12 B;  3HVF A;  2B95 A;  3T4S A;  2R9W A;  3G2Z A;  3DTM A;  4MNR A;  4PM7 A;  2VGK A;  2A49 A;  4JGO A;  1HVB A;  4CJN A;  1S1Y A;  1VET B;  5GLB A;  5FDH A;  1JNU A;  3DBA A;  2O99 A;  3T50 A;  2XLN A;  1KVL A;  4OPR A;  1T1A A;  3HLC A;  1N9B A;  3R7W B;  4KZ8 A;  5HD3 A;  4BQM A;  1W8Q A;  3T1R A;  4DKI A;  3VSL A;  4RQ9 A;  2Y55 A;  4N1H A;  2V9A A;  3DTE A;  3NHQ A;  3P7N A;  1DRM A;  1FSW A;  3F1O B;  2O0Y A;  4IHQ A;  3E98 A;  4OP5 A;  1K25 A;  1O7E A;  4PM8 A;  2I72 A;  3QP5 A;  3T4Q A;  2VGJ A;  2VV6 A;  3C8C A;  4MLL A;  1S67 L;  1TS0 A;  1IYO A;  2ZC3 B;  1K57 A;  1MWS A;  4GW9 A;  4Y0U A;  5TBM A;  1ES4 A;  3OCN A;  4C3Q A;  1XGJ A;  3LR3 A;  3ZDJ A;  5KSH A;  4D2O A;  2ZMF A;  3LFV A;  3BM6 A;  4DDY A;  2HF6 A;  4KUK A;  1XA7 A;  1LSW A;  3VMA A;  5HAP A;  1A0K A;  3CZD A;  2VV7 A;  1FIK A;  3V39 A;  2QJ5 A;  2CC1 A;  2VK3 A;  2Y2K A;  4FTX A;  3BFC A;  4JBF A;  3E4P A;  1MY8 A;  1K4E A;  5G18 A;  2ZQ8 A;  4GD6 A;  3KSI A;  4CLC A;  4P6B A;  3BY8 A;  2OLV A;  1WYC A;  1L0F A;  3JVU A;  4E3I A;  4NEE D;  3UPN A;  3CLO A;  4XT2 B;  3S7O A;  1HD8 A;  3RXW A;  2HPB A;  5MC7 A;  1NYY A;  3A3D A;  4DMZ A;  3FKV A;  1W5D A;  3A3I A;  3LR5 A;  1SDE A;  3CUE A;  4DXC A;  3S4X A;  2O9A A;  4NG2 A;  2Q0O A;  2WGV A;  1TDL A;  2VGL M;  3IXG A;  2BAS A;  5G4Z A;  1VM1 A;  2WKR A;  1BLH A;  5HX9 A;  4HEF A;  1L0G A;  1XJ4 A;  4KZ6 A;  5HDS A;  1PW8 A;  3ZG0 A;  3EGX C;  1H8Y A;  5TBM B;  1KOU A;  4S2L A;  2PYR A;  4GDN A;  1IKI A;  3K3D A;  4LRX C;  5IS1 A;  1S1Z A;  2HJE A;  3G30 A;  5LBR A;  2PHY A;  3NOP C;  1TD5 A;  3ZNY A;  3IS2 B;  2JHE A;  1K56 A;  3UO9 A;  2XFS A;  1N9L A;  3CUE C;  3W4Q A;  2OWH A;  1V9Z A;  4OLD A;  4DN0 A;  1NRF A;  4PHT A;  1S66 L;  1ES3 A;  5DF7 A;  4EBN A;  3UMD A;  2Z2L B;  3UNW A;  2RCX A;  2KX6 A;  2JKF A;  3BFG A;  4M3K A;  5E2G A;  1LI0 A;  4FOF A;  1IEM A;  3VE3 A;  2VJW A;  3TW8 A;  2Z2M B; 
#chains in the Genus database with same CATH homology
 1OJ5 A;  1ODV A;  3R4K A;  4R70 A;  4OOL A;  3EEH A;  4I38 A;  3TRC A;  1DP9 A;  2PR5 A;  4G3K A;  3E4O A;  3PBT A;  2HGV A;  2Y8H A;  2V0W A;  1X0O A;  2JKT M;  2J80 A;  4ZRR A;  1LL8 A;  3LR0 A;  3KX0 X;  3CI6 A;  1LT0 A;  5G4Y A;  4K08 A;  2HV1 A;  3H9W A;  3EOI A;  4E04 A;  1YSP A;  5DJT A;  4LRZ E;  2JN7 A;  3PBR A;  4EET B;  1T19 A;  3EWK A;  4ME4 A;  3E4Q A;  3RH8 B;  4DJ2 A;  1N9N A;  4HY8 A;  4O8G A;  1VB6 A;  3A0V A;  4I5S A;  3GEC A;  2J3W A;  2W3G A;  4Q0J A;  3T4J A;  2P08 A;  2O9C A;  2NUP C;  4II7 A;  1OTB A;  2K2N A;  4MDZ A;  1ZTU A;  1T18 A;  2QHK A;  1XJ2 A;  4WLA A;  4F3L A;  4ETZ A;  4NXG A;  1OT9 A;  1MZU A;  4HH2 A;  3PHY A;  4L9F A;  1T1B A;  4UEY A;  4GHI A;  3EQU A;  3PXP A;  3PYP A;  2FH5 A;  4LLO B;  5TJJ A;  4I3I A;  3UB9 A;  4GS9 B;  4H6J A;  2A24 A;  5DFY A;  3H82 A;  3EGD C;  1LSX A;  3LUQ A;  2JKT I;  4WEJ A;  2HJ9 C;  2A24 B;  3IBR A;  1P0Z A;  5EFW A;  2G7U A;  1S4R A;  4IUH A;  2VGL S;  1YKD A;  2M7U A;  3LI8 A;  1ZHH B;  2K31 A;  2PDR A;  5F68 A;  3PR6 A;  4I39 A;  2VEA A;  4ARZ B;  4BBU A;  3NOT C;  1UGU A;  4NXE A;  3HJK A;  1WA9 A;  2W1R A;  3BQ8 A;  3VOL A;  2M7V A;  3IBJ A;  3C38 A;  2CMN A;  4KQO A;  4UQI S;  3LI9 A;  3P01 A;  4GS9 A;  1P97 A;  4HJ3 A;  1GSX A;  3MQ0 A;  1F9I A;  1S4S A;  4GLQ A;  4R38 A;  1OPX A;  1TF1 A;  3OLO A;  4Y3I A;  1IFQ A;  3U2A A;  2WKQ A;  4HOI A;  4L9E A;  3S7P A;  2V1A A;  4HI4 A;  4OOM A;  3HCY A;  3VV4 A;  3MQQ A;  1NWZ A;  1TS7 A;  3MQO A;  4L0L A;  1GSV A;  2OAP 1;  2PD8 A;  4H6J B;  5HD5 A;  4P6Z M;  2VZW A;  2OOL A;  1DP6 A;  3F1P B;  4EEU A;  1NLZ A;  3LID A;  3OC2 A;  5J7E A;  1H8M A;  3B33 A;  1OTI A;  4G3W A;  4HJ4 A;  3UB7 A;  3D72 A;  4HP4 A;  1P9W A;  2GJ3 A;  3FPW A;  4R3A A;  2L0W A;  4YNR A;  3PBQ A;  2P04 A;  1YAX A;  3PBS A;  5HPI A;  4B9O A;  3KYQ A;  3ICY A;  3D3O A;  2J3T C;  2ZOH A;  4MN7 A;  1XJ3 A;  3PBN A;  1OJG A;  4MMN A;  5AVE A;  5HWT A;  3F1N A;  3KYZ A;  2QYB A;  5J3W A;  5L8M A;  2ZMV A;  3LR4 A;  3MJQ A;  4JGQ A;  3OOV A;  4MCW A;  4F3L B;  1N9O A;  4EW7 A;  2GX5 A;  1T1C A;  2VA0 A;  1BYW A;  2XSS A;  2EA9 A;  3W2Z A;  1NLY A;  2JKR M;  5HSQ A;  3A0R A;  2J3T D;  1OTD A;  3KSG A;  2QJ7 A;  4QPR A;  1G28 A;  5IU1 A;  4Q0H A;  3OCL A;  3NOU C;  4O0P A;  5HDC A;  1DP8 A;  1EW0 A;  2YKH A;  1UWN X;  2B18 A;  2EWV A;  3BQA A;  3BJN A;  4JGP A;  4I3J A;  3CAX A;  5DF9 A;  2FZ0 A;  3MFX A;  4FSF A;  4AFI A;  2O9B A;  3G6O A;  5HPF A;  3T4O A;  4ARZ A;  3BW6 A;  5J4E A;  2EWW A;  3C2W A;  2M1C A;  4G3V A;  3T4S A;  5DJU A;  4MN6 A;  3KSH A;  2GNX A;  1STZ A;  1D06 A;  4EQ1 A;  4XT2 A;  4JGO A;  3H7W B;  3B42 A;  1S1Y A;  2XRN A;  4HP9 A;  2K7S A;  1JNU A;  3MXQ A;  4R6L A;  5AJG A;  3K2N A;  4Q0I A;  4DJ3 A;  3FC7 A;  3DBA A;  1MC0 A;  2O99 A;  3T50 A;  4HHD A;  2W27 A;  2L4R A;  2V1B A;  2W3D A;  1P9R A;  1T1A A;  4IUK A;  1H3Q A;  3R7W B;  5HD3 A;  1F5M A;  2NUT C;  4RQ9 A;  2Z6C A;  1D7E A;  3CIT A;  3H82 B;  2V9A A;  3BY9 A;  4EU0 A;  3MR0 A;  4EXO A;  1MKM A;  2DMW A;  3NHQ A;  1LSV A;  3P7N A;  2PYP A;  1DRM A;  5HDD A;  3LIC A;  4WL9 A;  3F1O B;  2O0Y A;  3LIE A;  4IHQ A;  1W63 M;  2V0U A;  3KO6 A;  3FG8 A;  3E98 A;  5A8B A;  3V67 A;  2W1T B;  4HH3 A;  3LYX A;  3GDI A;  3T4Q A;  3F1N B;  1OT6 A;  2VV6 A;  4Y5F A;  2Y79 A;  2ZBB A;  3C8C A;  2W3F A;  4IJG A;  3S7Q A;  3VE4 A;  1S67 L;  3EQV A;  1TS0 A;  2Z6D A;  2WKP A;  4GW9 A;  5TBM A;  3T4L A;  1XFN A;  3OCN A;  3RFB A;  3LR3 A;  4GJ4 A;  3A0S A;  2QKP A;  2B02 A;  5KSH A;  2MJ6 A;  1Y28 A;  2ZMF A;  3LFV A;  4HIA A;  4PKY A;  2HF6 A;  4PAU A;  4KUK A;  3F1P A;  4JGR A;  3RTY A;  1LSW A;  1IOU A;  3UB6 A;  1XFQ A;  1VHM A;  2VV7 A;  2QJ5 A;  3TE8 A;  5HWW A;  2W3H A;  1V9Y A;  4M4X A;  4MN5 A;  4BWI A;  3E4P A;  3ULF A;  5I5L A;  4CLC D;  3S7N A;  5C5K A;  3E0Y A;  1F98 A;  2KDK A;  3KSI A;  2ZOI A;  4Y2F A;  4CLC A;  4CLC E;  3PBO A;  4HJ6 A;  3BY8 A;  4HQA A;  3JVU A;  4NEE D;  3CLO A;  4XT2 B;  3OBF A;  4CQH A;  3S7O A;  2XA7 S;  1TS8 A;  4EEP A;  5MC7 A;  2VX8 A;  4NXF A;  5CX7 A;  3BWL A;  3FPV A;  3ZQ5 A;  1XJ6 A;  4NKP A;  3T4T A;  4DMZ A;  4O01 A;  2D02 A;  4PKY G;  4ETX A;  5F69 A;  3LR5 A;  3CUE A;  2INW A;  2VLG A;  5AVF A;  4P6Z S;  3TJZ C;  2O9A A;  4L9G A;  4B93 A;  3LIA A;  3IS2 A;  3EEA A;  2LB5 A;  2KLI A;  4CLC C;  3R7W A;  3UME A;  2H28 A;  3HJI A;  4KUO A;  3JVV A;  2A2L A;  2VGL M;  3SW1 A;  2JKR I;  4HNB A;  3LIF A;  3UE3 A;  3MF0 A;  3C30 A;  2R78 A;  2BAS A;  5G4Z A;  2WKR A;  3B47 A;  4WEL A;  4WUJ A;  4EER A;  2PT7 A;  3F1O A;  2I9V A;  5HL6 A;  3CWF A;  2W1T A;  5IT5 A;  3LIB A;  1XJ4 A;  1W63 Q;  5HDS A;  4WEK A;  5F5Y A;  5HWV A;  4Z1W A;  2VKS A;  2D01 A;  2VV8 A;  2L1M A;  3EGX C;  3T4K A;  4BBT A;  5TBM B;  1KOU A;  2PYR A;  4BMW A;  4GHI B;  2QWS A;  4GCZ A;  3K3D A;  3KSF A;  5DKK A;  2OAQ 1;  4LRX C;  4EES A;  5IS1 A;  3ZYT A;  3H7W A;  1S1Z A;  2HJE A;  4WF0 A;  5LBR A;  2PHY A;  3NOP C;  1TD5 A;  2YKF A;  1OTE A;  4BBV A;  1TS6 A;  1YSQ A;  2JHE A;  2KOI A;  3IS2 B;  4LPZ A;  5DFX A;  4BJP A;  5F6A A;  1N9L A;  2W3E A;  3CUE C;  2OWH A;  1V9Z A;  3UB8 A;  1GSW A;  1OTA A;  4DN0 A;  2LB9 A;  4PHT A;  1S66 L;  3O5Y A;  4YWZ A;  2PR6 A;  3UMD A;  4EUV A;  2GZA A;  3MMH A;  3NJA A;  4KQD A;  4WN5 A;  2W0N A;  4CLC B;  5DKL A;  2KX6 A;  1G6O A;  4I3A A;  1NRJ A;  4YOF A;  2P7J A;  4UQI M;  1UWP X;  3K3C A;  5K5B A;  4NXB A;  4LRY C;  3UE6 A;  5HZH A;  5KIZ A;  4FOF A;  2XA7 M;  3VE3 A;  2OWJ A;  5FL3 A;  2VJW A;  3TW8 A;  2XRO A;  2IA2 A;  2PD7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...