2PD7A

2.0 angstrom crystal structure of the fungal blue-light photoreceptor vivid
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
149
structure length
149
Chain Sequence
b'MHTLYAPGGYDIMGYLIQIMNRPNPQVELGPVDTSCALILCDLKQKDTPIVYASEAFLYMTGYSNAEVLGRNCRFLQSPDGMVKPKSTRKYVDSNTINTMRKAIDRNAEVQVEVVNFKKNGQRFVNFLTMIPVRDETGEYRYSMGFQCE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vivid PAS protein VVD
publication title Conformational switching in the fungal light sensor Vivid
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Circadian clock protein
total genus 37
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2pd7A00
4GHIB 2PD8A 4EERA 3HJIA 4KUKA 1OTBA 5HD3A 2PD7A 4GS9A 3GDIA 5DJUA 1P97A 5F6AA 3A0VA 1T18A 1T1BA 4I39A 3VOLA 2A24B 1V9ZA 4HI4A 4GHIA 4HJ6A 3OLOA 4F3LB 3A0SA 3LIFA 1XJ6A 3B33A 4JGPA 1WA9A 3EEHA 4HH3A 3E4OA 3ZQ5A 3UB9A 2PR6A 3T50A 2OOLA 3PYPA 1TS7A 2PDRA 1F9IA 2A24A 3LIDA 4EESA 2W0NA 4YWZA 4LRYC 5HWWA 2D02A 4F3LA 3FG8A 3H7WA 4EETB 2WKPA 1GSXA 1T1CA 2R78A 1OJ5A 2EA9A 1DP8A 2H28A 4JGRA 1DRMA 1V9YA 3F1NB 3VE4A 3F1OB 1EW0A 2K7SA 5DKKA 3UB6A 4K08A 1XJ4A 3UB7A 1UWNX 2BASA 4I38A 1S4RA 3LI9A 4E04A 4I5SA 4JGQA 3KX0X 2OWJA 1D06A 1LSVA 1S4SA 3CWFA 1S1YA 2KDKA 4L9EA 2ZOHA 3GECA 3ULFA 3IBRA 5I5LA 4I3IA 1XJ3A 4HP4A 1P0ZA 3NOPC 4HNBA 1N9OA 4LPZA 2VV8A 4R3AA 2OWHA 1LSXA 5F5YA 5KIZA 3LYXA 1T1AA 4JGOA 2JN7A 2V0WA 2QKPA 1X0OA 1TS6A 2WKRA 1S66L 4HP9A 1KOUA 2QJ7A 4LLOB 5HD5A 4PKYA 5AVFA 3FC7A 3H82A 3UE6A 3H7WB 2Z6CA 4KQDA 5HDSA 2J80A 3VE3A 3MJQA 4KUOA 3MXQA 5AVEA 2GJ3A 2QHKA 4L9FA 3NOTC 3MFXA 4I3AA 4EW7A 1OTAA 1TS0A 5F69A 4HY8A 4MN6A 4LRXC 4NXBA 1DP9A 4HJ3A 1LSWA 4EEPA 2ZOIA 4HIAA 2JHEA 4MN5A 4R70A 2V1AA 3IS2B 5IS1A 4NXGA 4GCZA 3D72A 1F98A 2L0WA 2HV1A 5HWVA 2VV6A 3BWLA 4NXEA 4GW9A 4PKYG 4HJ4A 4R6LA 2PYRA 3IS2A 3P7NA 4LRZE 1OTIA 3G6OA 4M4XA 3RTYA 3UMDA 4H6JA 2D01A 4RQ9A 3LICA 2YKFA 2Z6DA 2WKQA 2M1CA 3MQOA 4HOIA 5J4EA 1LT0A 3UB8A 5G4YA 2B02A 3BY9A 3ICYA 4NXFA 1UWPX 4HH2A 3H82B 4EQ1A 2VV7A 5F68A 5EFWA 3F1PB 5G4ZA 1JNUA 1XJ2A 1OTEA 2W27A 5TBMB 3K3CA 3LIBA 1XFNA 4I3JA 2L1MA 2VLGA 1N9NA 2QJ5A 3E4PA 3NJAA 1VB6A 5HWTA 3LI8A 5IU1A 3NOUC 4WN5A 1DP6A 5HSQA 4HHDA 3MQQA 3SW1A 5J3WA 2V9AA 3F1PA 4EEUA 4B9OA 4XT2B 5TBMA 2VEAA 2PHYA 2ZBBA 4WLAA 3RH8B 3UMEA 1OTDA 3A0RA 5HDCA 1OT6A 4EXOA 4BBTA 1NWZA 1G28A 2PYPA 3CAXA 3MR0A 1S1ZA 1BYWA 1TS8A 1S67L 1N9LA 4XT2A 1GSVA 1OJGA 2QWSA 4DJ2A 2P7JA 4H6JB 2INWA 3C2WA 4WL9A 3EWKA 5A8BA 1ODVA 4WUJA 2YKHA 1Y28A 2PR5A 4HQAA 4DJ3A 1T19A 3PHYA 3LIEA 3C8CA 3H9WA 4BBUA 2KX6A 1XFQA 1MZUA 3NHQA 3LUQA 4WF0A 1OT9A 5HZHA 4BBVA 4R38A 2V0UA 3F1NA 3BY8A 3K3DA 5DJTA 1LL8A 3F1OA 1GSWA 1D7EA 5DKLA 4GS9B 2CMNA 5J7EA 1UGUA 5HDDA 3E4QA 3CLOA 3LIAA 2V1BA 2I9VA 2L4RA 3HJKA 4L9GA
chains in the Genus database with same CATH superfamily
4GHIB 4B93A 2BG1A 1MKIA 2G7UA 3RXWA 5GHZA 3HJIA 2W3FA 4GD6A 3LCEA 4NK3A 1FR6A 1P97A 2ZQ7A 5F6AA 1PNEA 3T4SA 3PBQA 1MWRA 1T18A 2Q9NA 4BD0A 2UWXA 3A3DA 4I39A 5L10A 4E3KA 3GQZA 3BFFA 3MKEA 3ITAA 2XD5A 3A0SA 3LIFA 3FYZA 2VGLS 4Q0JA 3R4KA 1J3WA 3O88A 5IHVA 2HDUA 3E4OA 2PR6A 3ZNYA 3GR2A 2G2WA 3RFBA 2VZWA 4Z1WA 3IH8A 2PDRA 2A24A 1IKGA 2W0NA 3HLCA 3T1XA 4X1MA 3DTEA 2JBFA 4JLFA 5HWWA 4F3LA 2R9XA 3DBAA 5FI2A 3FG8A 3T12B 3OPRA 5EVID 2JC7A 3BLSA 4GB7A 4PM9A 5FAOA 2H28A 4JGRA 4BENA 3F1NB 3SS4A 3MF0A 5DTSA 3FPWA 3MSHA 2IA2A 3F1OB 3BYDA 3IXHA 4C6YA 2K7SA 4K0XA 4K08A 4QY6A 2BASA 4A5RA 2QMIA 2PRFA 3IX3A 3V67A 1Z09A 4IVIA 5D3OA 4FD8A 1ES5A 3KX0X 4WMCA 1LSVA 3NI9A 1CK3A 1S1YA 5E43A 3R7WA 1CQAA 3E98A 4ZDXA 4GZBA 1K57A 2LB5A 4N92A 3VP1A 1XJ3A 4HP4A 2WKHA 4ID4A 3WRZA 1YT4A 4HNBA 2EX9A 5HX9A 2J9OA 1ZTUA 2XA7S 5KIZA 4C3QA 4MDZA 3CPTB 1T1AA 2XFTA 3NULA 4BWIA 5CTMA 4KQRA 5L07A 3MBZA 1TS6A 2OAP1 2WKRA 1S66L 3L7HA 2OLUA 4E6WA 2QJ7A 1FSYA 3HLEA 2ZM8A 2GNXA 3PBSA 4S2LA 1ES4A 4YOFA 1QMEA 4CLCC 4QD4A 3G4PA 4KUOA 2QHKA 4L9FA 3IH9A 4B88A 3NOTC 3VP2A 3MFXA 1PWDA 4KQOA 1TS0A 3VMAA 4N1XA 3C38A 1K4FA 1STZA 1DJCA 1YSPA 3LFVA 1P9RA 1JTDA 1DP9A 2Y2HA 5HL1A 5FATA 4EEPA 1KVMA 3TSGA 2JHEA 3MZEA 4Y13A 3N7WA 1L0GA 2HGVA 3B3XA 4GCZA 3D72A 1F98A 3TE8A 2HDSA 5EV0A 5HAQA 3ZG0A 5HL6A 1DJBA 4MBHA 5CGWA 2HV1A 1TVFA 4KZ7A 4S2PA 3BWLA 4NXEA 4CLCA 4EV4A 2WGWA 3G31A 4M3KA 3IHAA 3S7NA 4R3JA 4FUWA 2J3WA 2I72A 1SDNA 4JXGA 3LY3A 5FL3A 2V1ZA 2WKQA 3FKWA 4OP5A 1IKIA 3OPPA 4O01A 1LT0A 4QPRA 2HP9A 1TD5A 5G4YA 4R4SA 3BY9A 3SZTA 3NY4A 1EI5A 4HH2A 5GHXA 2O9AA 2CC1A 1W63Q 3BFCA 2WKIA 5G4ZA 1BLSA 1JNUA 4ZJ2A 1XJ2A 4JF6A 4GN2A 4LV3A 3UO9A 4E3LA 5A93A 3LIBA 3MXSA 2HP5A 2ZL1A 3NJAA 3ZDJA 2BLSA 5IU1A 1YKDA 4R1GA 5EVIA 4HHDA 4OONA 1VEUB 2A3UA 4MLLA 2DNSA 3HVFA 4BMWA 5DTKA 3GVBA 4KZ6A 1M6KA 2W3DA 3WS5A 4Q8IA 4K91A 2XDMA 3RH8B 5FQMA 5FAQA 4JKTA 1IYOA 2EFUA 5EVEA 2IWDA 1OT6A 3OCLA 4EU0A 1NWZA 2PYPA 1YAXA 1L3LA 3V39A 2V8CA 1S1ZA 2ZJ9A 1ERMA 4UQIS 3OZHA 2A2LA 1ZKJA 1RGZA 3ZG9B 1GSVA 2QWSA 4DJ2A 3AGEA 1H0MA 5DVAA 1HZOA 3Q82A 5DFYA 4R23A 2YKHA 1L0FA 1Y28A 4ZAMA 1E3UD 3M6HA 4DDYA 4PPRA 2Y79A 1L0DA 3ZHHA 4BBUA 5CX7A 3S7PA 5CGXA 5TR7A 4KZ5A 3SOIA 3LR3A 3WWXA 3BRMA 2Y2MA 1K56D 3GMWA 3Q7VA 1CEGA 4LV2A 4ESPA 3TJZC 4IUHA 5FQ9A 4MN7A 1GSWA 5J7EA 1TDLA 4OQHA 3P98A 4OVDA 3E4QA 1PYYA 3G35A 3T4OA 4Y3IA 2I9VA 2HJEA 3HJKA 2ZC3B 2WAFA 2ZQ8A 4L9GA 4DN0A 1KE0A 4OOMA 3CHWP 4P6ZS 5J8XA 3WS2A 1SKOA 4CJNA 2KLIA 2EXBA 1K38A 3PAGA 4X69A 1ZG4A 2W3GA 2W1TB 1D1JA 4OPZA 1PIOA 3HREA 1W63M 4G3WA 5FQQA 1T1BA 4PM5A 1BTLA 4OQIA 5HAIA 1ONGA 2A24B 3FV7A 1FILA 1V9ZA 4HI4A 4OPQA 4HJ6A 3HUNA 1WYBA 1VETA 5E2FA 4F3LB 3ZG5A 4U0TA 3HLGA 3SH8A 5FQIA 3UE1A 2Z2MB 3B33A 3LEZA 3G2YA 3EEHA 2XSSA 1Q2QA 4QWOA 4OPYA 5C5KA 5F82A 1E4DA 3T50A 2OOLA 4G3VA 1F9IA 2JKRM 3JVUA 4E3JA 4FCFA 4OKPA 2JCHA 3H7WA 1XKZA 1W5DA 1GSXA 1T1CA 2R78A 1CI9A 5GLBA 5FI7A 1MY8A 3ZGAB 3MMHA 3UB5P 1DRMA 3DTIA 1GHPA 3HLBA 1KVLA 1EW0A 1XP4A 3IWOA 3R7WB 4E3OA 3QP8A 1MKMA 2V8FA 5CTNA 5DFXA 2ZC4B 1XJ4A 3AGDA 4QHCA 5FDSA 3TG9A 3KSFA 3LI9A 4XUXA 5E2HA 5AQ7A 1D06A 5F1FA 1YLYA 3O5YA 2KDKA 1PW8A 3EQVA 1MPLA 4O0PA 4WEKA 2ZOHA 3ULFA 3ITBA 1NLYA 4BL3A 2UV0E 5EVLA 3G30A 3KO6A 2Y2IA 1LL5A 1H3QA 4LPZA 2EXAA 4ZBEA 3C7UA 3QP4A 3S4XA 2K31A 1LSXA 4L0LA 5BOHA 5F5YA 1Q2PA 3LYXA 3C5AA 1ZC2A 1ZG6A 4IVKA 1O7EA 2H5SA 3L9KA 3W8KA 4KZ3A 3JVVA 1G6OA 1X0OA 3GSGA 4HBUA 3NCKA 1K4EA 4LLOB 3CUEA 1PZOA 5AVFA 3H82A 4CLCE 5LBRA 3VE3A 2EFXA 3MJQA 5CRFA 5AVEA 1J9MA 5EPHA 4UA9A 4X1LA 1E3UA 1ESUA 2XROA 2EWWA 4HY8A 4EWFA 1PZPA 1WE4A 1KDSA 4ETZA 4Z9QA 3CI6A 3BQ8A 4CLCB 1ACFA 2O9BA 4BJPA 2ZOIA 3FKVA 1K57C 5A90A 1SHVA 1K56A 2M7UA 2C5WB 4O8GA 4KZ8A 5IS1A 1SKFA 4FSFA 3ZG8B 3LY4A 1NZOA 3M2JA 3CITA 4IUKA 4JF5A 4DDSA 2VV6A 2WGIA 1TDGA 4GW9A 1BT5A 4Q0HA 3C4PA 4R4RA 1JWZA 3T4TA 1BSGA 1OTIA 4Y5FA 4DF6A 5E2GA 2WZXA 4M4XA 1LL9A 2Y8HA 1NY0A 4GNUA 4RQ9A 1IELA 1JWVA 3MQOA 5F1GA 1F5MA 4ZRRA 2PBYA 2DRWA 1JTGA 3UB8A 1BZAA 2B02A 3P09A 4NXFA 1UWPX 1FCOA 4HBTA 4DE2A 2P9VA 4P85A 3K2NA 4Y0OA 1XXMA 3V50A 2ZM0A 4RVAA 3JYIA 4R0QA 3EGDC 4NETA 1OTEA 4IEDA 2W3EA 2VGJA 1K6RA 3ZG7B 1XFNA 4BLMA 3I7JA 3PBTA 3IF6C 1NXYA 2ZQDA 3O86A 1O07A 1N9NA 3GRJA 2QJ5A 3SS3A 2JKFA 3IXBA 4MEZA 1OMEA 1BLPA 1S6RA 1VB6A 2RL3A 5HWTA 4FH2A 3MXRA 4WN5A 2ZMVA 4YFMA 2ZQ9A 4IBRA 1HTZA 5HSQA 1RCJA 2WUQA 1PWGA 1MWTA 4P87A 5J3WA 2Y2KA 3F1PA 4PAUA 4EEUA 3Q7ZA 5TBMA 5FDHA 1FSWA 1JVJA 1YLTA 4GD8A 1XGIA 4Y0TA 1AWIA 1OTDA 3A0RA 2J8YA 3OOVA 5HDCA 4BBTA 3VP3A 2FFFB 3T1RA 2ZMAA 1AXBA 1NRFA 3D9YA 5M19A 1TS8A 5KMWA 1N9LA 4XT2A 1PI4A 1W8QA 1NJ4A 3IF6A 1MXOA 3A3IA 4H6JB 5K5BA 5EM0A 2PAVP 3C2WA 4WL9A 3EWKA 5A8BA 1XX2A 3T4KA 4O7DA 3BFEA 3OCNA 3Q7VB 3BEBA 3VP0A 3PHYA 1KGFA 1DJAA 4WF0A 1OT9A 1BUEA 1H5XA 1KGGA 5EVIC 2FFYA 4R38A 5FSRA 4JBFA 5DTTA 5CHMA 3F1NA 1Z6FA 1SKOB 2X71A 3VOYA 4WZ5C 2XQZA 1PI5A 3T4QA 3CJMA 3F1OA 3PBNA 5DKLA 2ZQAA 2CMNA 4OQ0A 4OLGA 1SCWA 2W1RA 4OH0A 2E8IA 5KSHA 3LIAA 4YINA 2L4RA 2RCXA 5HARA 2VA0A 3OPLA 5CXWA 1VETB 4EERA 5A92A 3TOIA 4GOGA 4NEED 1IYPA 5HD3A 1CJFA 2PD7A 5DJUA 3PXPA 4WELA 5IT5A 5I94A 3A0VA 2Y2NA 3HLDA 3ZVTA 3UPNA 3CMZA 3VOLA 5CERA 2ZMFA 5FI6A 3OLOA 4WZ5A 3S7QA 4JGPA 3C7VA 3IHBA 4II7A 4KZAA 4HH3A 5GHYA 1E25A 3ZQ5A 1PFLA 5L09A 3UB9A 3CPTA 3N8LA 2WKEA 2VGLM 4LENA 1TS7A 2ACGA 4YWZA 1IYSA 1N9BA 2Y59A 4LRYC 3SH7A 4QB8A 3BW6A 2PT7A 2JKGA 3LGOA 2P04A 3VP4A 2Y91A 2WKPA 2AVXA 4GJ4A 4BL2A 4DE3A 4KZ9A 2NUPC 1OJ5A 2EA9A 2ZQCA 1V9YA 1SDEA 3NDEA 2MJ6A 3VE4A 3EOIA 5CHJA 5G18A 1LHYA 3OC2A 3C30A 2JKRI 4G3KA 2H0TA 1NZUA 5EUAA 2IWBA 2X02A 4ZJ1A 5TJJA 5GL9A 3LR4A 3WS1A 1Y4OA 1MBLA 5EM1A 3EGXC 3UB7A 3LR0A 4ME4A 1S4RA 1KGEA 4E04A 4OQGA 1FOFA 3IQAA 1YLJA 4NG2A 3GV9A 4DMZA 3CWFA 1XPBA 1K25A 3HLFA 4L9EA 3GECA 2W3HA 1NLZA 5I5LA 3Q81A 4I3IA 1YPRA 3E2KA 4JXWA 4HESA 4IBXA 2PBDP 4Y0UA 3VSKA 4P6BA 5JYOA 2VV8A 3QP2A 4R3AA 2OWHA 5CEBA 4S2OA 1G5UA 2B95A 3N6IA 2H0YA 3D4FA 2JN7A 5FASA 2V0WA 4FOFA 2BTFP 4N9LA 2FZ0A 4MCWA 5DF9A 4HP9A 2XA7M 1KOUA 1XA7A 5HD5A 4H8RA 4PKYA 3FPVA 3FC7A 4S2KA 2ZM2A 2Z6CA 3NIAA 3MXQA 2GJ3A 1YSQA 2OAQ1 3HLWA 3JPUA 1GCEA 1YM1A 4I3AA 1OTAA 3MS6A 5HFOA 4MN6A 4LRXC 3VFFA 2XLNA 1FQGA 1YLWA 1H8YA 1LI0A 3E0YA 4LV0A 4WEJA 1MWUA 2QPNA 4E3MA 4ZTKA 2HP6A 4HJ3A 2QZ6A 3W4PA 1A0KA 2JKTM 3ZCZA 4HIAA 1VEUA 2G2UA 1K55A 4R70A 4X25A 5HW3A 1PRQA 4EBLA 4ETXA 3UDFA 4GDNA 4D2OA 3W4OA 5KZHA 2L0WA 3HUOA 3BFDA 4DE1A 2WYXA 4IHQA 2HDRA 1BLHA 1KDWA 1QMFA 3IS2A 3P7NA 3IF5A 4LRZE 3SS5A 2VK3A 2O0YA 3CUEC 5FEFA 2P9VB 5CEDA 3UMDA 2EX8A 2D01A 2H10A 3LICA 4X56A 4PM8A 2YKFA 4LCMA 1K54C 3KSHA 4HOIA 4X55A 2EX6A 4S2NA 1LLBA 4WBGA 4E3IA 1P9WA 3AGFA 5EOOA 4UA7A 3ICYA 3DTKA 1YLZA 4RX3A 4EQ1A 3KYQA 2VV7A 2HPBA 5EFWA 5FQKA 4KQQA 1ERQA 3F1PB 3V5MA 2XEPA 2W27A 4U3TA 1RGYA 5TBMB 2L1MA 1ZHHB 3IXDA 2VLGA 2XGNA 3E4PA 4Y17A 3ZNTA 4NKPA 2X01A 3NDGA 4HEFA 1DP6A 2C6WB 3BJNA 3MQQA 3SW1A 2V9AA 4FH4A 1K54A 4XT2B 2WK0A 3IF6B 2VEAA 2PHYA 2ZBBA 2K2NA 3VV4A 2XR0A 2Q9MA 3QNBA 2W1TA 4ARZA 1G68A 3BLMA 1G28A 3MR0A 3T1SA 1I5QA 4MBKA 2WGWB 3A3FA 3N8RA 3PAEA 1BYWA 1W79A 2HDQA 3NECA 1HLUP 1WYCA 4Y15A 1OJGA 3Q07A 1C3BA 3HUMA 4Q0IA 4UQIM 3PBRA 3KYEA 1YMXA 1ODVA 3A3JA 4UEYA 2WZZA 4AFIA 2R9WA 1ES3A 4X68A 4KZBA 1T19A 4D60A 2B5RA 3LIEA 1IOUA 1YLPA 2KX6A 1XFQA 1I2SA 1MZUA 3NHQA 3LUQA 1GHMA 3QP1A 5HZHA 2WGVA 3Q1FA 1S0WA 1M40A 2JE5A 3QP6A 3O3VA 2Y2GA 1NRJA 5EOEA 4OLDA 4UHUA 5HPFA 3U2AA 4CQHA 2ZL1B 5DJTA 3BY8A 1W7FA 3K3DA 3GTCA 3B42A 5HAPA 3FZCA 1NYYA 4RYEA 1VHMA 4XXRA 5HDDA 5EVIB 2V1BA 3LR5A 3S1YA 1TEMA 2A49A 3WS0A 2HJ9C 4BD1A 2DCFA 4KENB 3LO7A 2PD8A 3V3SA 2Y2PA 3C4OA 2XRNA 4KUKA 3G2ZA 1OTBA 5AJGA 1JWPA 4GS9A 3GDIA 4P6ZM 3UDIA 4N9KA 2Q0OA 3G34A 1BLCA 4LCLA 4OPRA 5GLDA 3N8SA 4DKIA 3W2ZA 1W8YA 3IWQA 4GHIA 2VX8A 3DW0A 4PMAA 1ESIA 2Y2OA 2J3TD 4JF4A 2XH9A 1XJ6A 1WA9A 2LB9A 5AQ9A 3LEQA 5CECA 3DWKA 3UY6A 2OV5A 4B4XA 3IX4A 4DXCA 2B18A 1N4OA 3MZFA 1K6SA 2GX5A 3PYPA 3IXGA 4RX2A 3HCYA 3FWLA 3QNCA 3LIDA 4EESA 4PM7A 2D02A 4U0XA 5KSCA 3KSGA 4EETB 4LFUA 4IJGA 1G6AA 4PM6A 2XF3A 4UA6A 1U60A 1DP8A 5M18A 2WAEA 1KE3A 1SZVA 4Y2FA 4QU3A 3S7OA 5U47A 1MWSA 5DKKA 4E6XA 3UNWA 2M7VA 3UB6A 1KE4A 3IWIA 5TGFA 4EQIA 4E3NA 1EROA 1UWNX 1BULA 4I38A 1K0KA 5GLCA 2O9CA 5E2EA 2DMWA 2XFSA 3A3EA 3BFGA 4I5SA 5FA7A 3BQAA 4JGQA 3MZDA 2OWJA 2V2FF 1S4SA 5AQAA 4MNRA 3ZVWA 2E8JA 4C75A 1EWZA 3QP5A 1GA9A 4OP8A 3BECA 2VJWA 5CGSA 2FH5A 3IBRA 3W4QA 3M2KA 3M6BA 1I2WA 1P0ZA 3NOPC 1GHIA 2ZC5B 1N9OA 3S22A 3P01A 1YMSA 2ZLYA 3UPPA 2Y2QA 2Y55A 5GLAA 1IEMA 1F2KA 5HPIA 2Z2LB 4JGOA 1DY6A 4DRTA 5L8MA 3OPHA 2QKPA 1ES2A 1FCMA 4ZJ3A 2VKSA 1L2SA 3ZFZA 3UE6A 1OPXA 3H7WB 4KQDA 3PBOA 5HDSA 2J80A 1HD8A 4JXSA 2OSUA 1TF1A 5CHUA 3N4IA 4KG2A 3WS4A 1H8MA 4EW7A 2OLVA 5F69A 2VGKA 2V20A 1GA0A 2QYBA 4Y7PA 4NXBA 1FR1A 4DE0A 5TFQA 3CG5A 1LSWA 5L2FA 4OOYA 4S2MA 3DAVA 5FAPA 5JYPA 4MN5A 2Y2LA 2XK1A 5A91A 2V1AA 3IS2B 4QY5A 4YNRA 1ONHA 4NXGA 5F83A 2J3TC 3D3OA 3PTEA 5FEGA 3HL9A 2EX2A 1FIKA 3VFHA 3V3RA 1VM1A 5HWVA 3NC8A 4DXBA 5AQBA 4KG5A 4PKYG 2JKTI 4HJ4A 4R6LA 4KZ4A 2PYRA 2NUTC 3RJUA 2ZD8A 3MFDA 3MQ0A 3MKFA 1IYQA 5M1AA 2IWCA 3G6OA 4K0WA 2KOIA 3RTYA 4EUZA 4S2IA 4H6JA 3KSIA 4X6TA 4XUZA 5FQJA 4OOLA 4WM9A 2Z6DA 3T1QB 2M1CA 4RA7A 4MMNA 5MC7A 4GDBA 3QHYA 4B4ZA 5J4EA 4X53A 4EBNA 3UE3A 3SH9A 3ISGA 3VOZA 3H82B 3O87A 3IX8A 5F68A 4JPMA 3ZYTA 4S2JA 2P74A 1CI8A 1CF0A 3UDXA 3IT9A 2J7VA 2ZC7A 3OBFA 1XA1A 1K55C 1MC0A 4JXVA 1XGJA 1L0EA 1Y54A 3K3CA 3DTMA 2Y4AA 4N1HA 4I3JA 3VSLA 2EWVA 3RXXA 1VQQA 4WMCD 5DF7A 2J9PA 2HF6A 3WRTA 4ARZB 3LI8A 4CPKA 3NOUC 3KYZA 2O99A 1IFQA 3T4LA 1PW1A 2HZ5A 3EEAA 4PHTA 5EE8A 4B9OA 1YQSA 3BM6A 3G32A 3TRCA 4WLAA 3UMEA 3DWZA 3HBRA 2GZAA 4EXOA 1FCNA 4QJGA 1LI9A 2XD1A 3TW8A 3CAXA 2GDNA 4KG6A 3E2LA 3PR6A 4GLQA 3UN7A 4FTXA 4S2NC 4GKUA 5EECA 3NBLA 4LV1A 1S67L 1CEFA 3U4LP 2P7JA 1PWCA 1H8ZA 2INWA 4F94A 2PU2A 5DF8A 4EBPA 4WUJA 2WADA 1HVBA 2PR5A 4EUVA 2ZC6B 4HQAA 4DJ3A 2Y2JA 3CZDA 3C8CA 3H9WA 3T4JA 4P0MA 4R3BA 3UE0A 4BBVA 2PU4A 2V0UA 4WYYA 1ALQA 2P08A 4UAAA 3UPOA 4LGWA 1LL8A 3B47A 1D7EA 4GS9B 1UGUA 3EQUA 4WZ4A 3CLOA 4MBFA 4CLCD 3IBJA 4BQMA 1NYMA 1RP5A
chains in the Genus database with same CATH topology
4DN0A 4OOMA 4GHIB 4P6ZS 2PD8A 4EERA 4B93A 2G7UA 2KLIA 3HJIA 2W3FA 2XRNA 4KUKA 4NEED 1OTBA 5HD3A 2PD7A 5AJGA 4GS9A 3GDIA 5DJUA 2W3GA 3PXPA 2W1TB 1P97A 4WELA 5F6AA 5IT5A 4P6ZM 3A0VA 3T4SA 3PBQA 1T18A 1W63M 4G3WA 1T1BA 4I39A 3W2ZA 3VOLA 2A24B 1V9ZA 4HI4A 4GHIA 2ZMFA 4HJ6A 2VX8A 3OLOA 4F3LB 2J3TD 3A0SA 3LIFA 3S7QA 2VGLS 1XJ6A 4Q0JA 3B33A 4JGPA 3R4KA 1WA9A 2LB9A 4II7A 3EEHA 4HH3A 2XSSA 3E4OA 2B18A 3ZQ5A 5C5KA 3UB9A 2PR6A 2VGLM 3T50A 2OOLA 2GX5A 3RFBA 2VZWA 3PYPA 1TS7A 4Z1WA 4G3VA 2PDRA 1F9IA 3HCYA 2A24A 3LIDA 4EESA 2W0NA 2JKRM 3JVUA 4YWZA 4LRYC 5HWWA 2D02A 4F3LA 3DBAA 3BW6A 3FG8A 2PT7A 2P04A 3KSGA 3H7WA 4EETB 2WKPA 1GSXA 4GJ4A 1T1CA 2R78A 2NUPC 4IJGA 1OJ5A 2EA9A 3MMHA 1DP8A 2H28A 4JGRA 1DRMA 1V9YA 3F1NB 3MF0A 3FPWA 4Y2FA 3S7OA 2MJ6A 3VE4A 3EOIA 2IA2A 3F1OB 1EW0A 3OC2A 3C30A 2K7SA 2JKRI 5DKKA 4G3KA 2M7VA 3UB6A 4K08A 3R7WB 1MKMA 5TJJA 5DFXA 3LR4A 1XJ4A 3EGXC 3UB7A 1UWNX 2BASA 4I38A 3LR0A 2O9CA 2DMWA 1S4RA 3KSFA 4ME4A 3LI9A 3V67A 4E04A 4I5SA 3BQAA 4JGQA 3KX0X 2OWJA 1D06A 1LSVA 1S4SA 4DMZA 3CWFA 3O5YA 1S1YA 2KDKA 3EQVA 4O0PA 3R7WA 4WEKA 3E98A 4L9EA 2VJWA 2FH5A 2ZOHA 3GECA 2W3HA 3ULFA 1NLZA 1NLYA 3IBRA 2LB5A 5I5LA 4I3IA 1XJ3A 4HP4A 1P0ZA 3NOPC 3KO6A 4HNBA 1H3QA 1N9OA 4LPZA 2VV8A 3P01A 4R3AA 2K31A 2OWHA 1LSXA 4L0LA 1ZTUA 5F5YA 2XA7S 5KIZA 3LYXA 4MDZA 5HPIA 1T1AA 4JGOA 2JN7A 4BWIA 2V0WA 5L8MA 3JVVA 2QKPA 1G6OA 1TS6A 1X0OA 2OAP1 2WKRA 4FOFA 1S66L 2FZ0A 4MCWA 5DF9A 4HP9A 2XA7M 1KOUA 2QJ7A 4LLOB 5HD5A 3CUEA 2VKSA 4PKYA 5AVFA 3FPVA 3FC7A 3H82A 3UE6A 4CLCE 1OPXA 2GNXA 3H7WB 2Z6CA 3PBSA 4KQDA 3PBOA 5HDSA 5LBRA 2J80A 4YOFA 3VE3A 4CLCC 3MJQA 1TF1A 3MXQA 4KUOA 5AVEA 2GJ3A 2QHKA 4L9FA 1YSQA 2OAQ1 3NOTC 3MFXA 1H8MA 2XROA 4KQOA 2EWWA 4I3AA 4EW7A 1OTAA 1TS0A 5F69A 4HY8A 4MN6A 3C38A 2QYBA 4LRXC 1STZA 4NXBA 3E0YA 4WEJA 1YSPA 3LFVA 1P9RA 4ETZA 3CI6A 1DP9A 4HJ3A 1LSWA 3BQ8A 4CLCB 4EEPA 2O9BA 4BJPA 2ZOIA 2JKTM 4HIAA 2JHEA 4MN5A 4R70A 2M7UA 2V1AA 3IS2B 4O8GA 5IS1A 4YNRA 4FSFA 4ETXA 4NXGA 2HGVA 4GCZA 3D72A 2J3TC 3D3OA 1F98A 3TE8A 3CITA 2L0WA 5HL6A 4IUKA 2HV1A 5HWVA 2VV6A 3BWLA 4IHQA 4NXEA 4CLCA 4GW9A 4PKYG 2JKTI 4Q0HA 4HJ4A 4R6LA 2PYRA 2NUTC 3IS2A 3P7NA 3T4TA 4LRZE 3MQ0A 2O0YA 1OTIA 3CUEC 3S7NA 4Y5FA 3G6OA 2KOIA 4M4XA 2J3WA 3RTYA 2Y8HA 4H6JA 3KSIA 3UMDA 2D01A 4RQ9A 3LICA 4OOLA 5FL3A 2YKFA 2Z6DA 2WKQA 2M1CA 3KSHA 4MMNA 5MC7A 3MQOA 4HOIA 1F5MA 5J4EA 4O01A 4ZRRA 1LT0A 4QPRA 1P9WA 1TD5A 3UE3A 3UB8A 5G4YA 2B02A 3BY9A 3ICYA 4NXFA 1UWPX 4HH2A 3H82B 4EQ1A 3KYQA 2VV7A 2O9AA 5F68A 5EFWA 3ZYTA 3K2NA 1W63Q 3OBFA 3EGDC 3F1PB 5G4ZA 1JNUA 1MC0A 1XJ2A 1OTEA 2W27A 2W3EA 5TBMB 3K3CA 3LIBA 1XFNA 3PBTA 4I3JA 2L1MA 2EWVA 1ZHHB 2VLGA 1N9NA 2QJ5A 3E4PA 3NJAA 4NKPA 1VB6A 2HF6A 5HWTA 4ARZB 3LI8A 5IU1A 1YKDA 3NOUC 4WN5A 2ZMVA 3KYZA 1DP6A 2O99A 5HSQA 4HHDA 1IFQA 3T4LA 3BJNA 3MQQA 3SW1A 5J3WA 2V9AA 4PAUA 3F1PA 3EEAA 4EEUA 4PHTA 4B9OA 4BMWA 4XT2B 5TBMA 2W3DA 2VEAA 3TRCA 2PHYA 2ZBBA 2K2NA 4WLAA 3RH8B 3UMEA 3VV4A 1OTDA 3A0RA 3OOVA 2GZAA 5HDCA 1OT6A 2W1TA 4EXOA 4ARZA 4BBTA 3OCLA 4EU0A 1NWZA 1G28A 3TW8A 2PYPA 1YAXA 3CAXA 3MR0A 1S1ZA 3PR6A 4GLQA 4UQIS 1BYWA 2A2LA 1TS8A 1S67L 1N9LA 4XT2A 1GSVA 1OJGA 2QWSA 4DJ2A 2P7JA 4H6JB 5K5BA 4Q0IA 2INWA 3C2WA 4UQIM 3PBRA 4WL9A 3EWKA 5A8BA 1ODVA 4WUJA 5DFYA 3T4KA 2YKHA 1Y28A 4UEYA 2PR5A 3OCNA 4EUVA 4AFIA 4HQAA 4DJ3A 1T19A 2Y79A 3PHYA 3LIEA 3C8CA 1IOUA 3H9WA 4BBUA 2KX6A 1XFQA 5CX7A 1MZUA 3NHQA 3S7PA 3T4JA 3LUQA 4WF0A 1OT9A 5HZHA 3LR3A 4BBVA 4R38A 2V0UA 2P08A 3F1NA 1NRJA 5HPFA 3T4QA 3TJZC 3U2AA 3K3DA 3BY8A 4IUHA 5DJTA 4CQHA 1LL8A 3F1OA 3PBNA 3B47A 3B42A 4MN7A 1GSWA 1D7EA 5DKLA 4GS9B 2CMNA 5J7EA 1UGUA 2W1RA 1VHMA 5HDDA 3EQUA 3E4QA 3LIAA 3CLOA 5KSHA 3T4OA 2V1BA 4CLCD 3LR5A 4Y3IA 3IBJA 2I9VA 2HJ9C 2L4RA 2HJEA 3HJKA 2VA0A 4L9GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GHI B;  2PD8 A;  4EER A;  3HJI A;  4KUK A;  1OTB A;  5HD3 A;  2PD7 A;  4GS9 A;  3GDI A;  5DJU A;  1P97 A;  5F6A A;  3A0V A;  1T18 A;  1T1B A;  4I39 A;  3VOL A;  2A24 B;  1V9Z A;  4HI4 A;  4GHI A;  4HJ6 A;  3OLO A;  4F3L B;  3A0S A;  3LIF A;  1XJ6 A;  3B33 A;  4JGP A;  1WA9 A;  3EEH A;  4HH3 A;  3E4O A;  3ZQ5 A;  3UB9 A;  2PR6 A;  3T50 A;  2OOL A;  3PYP A;  1TS7 A;  2PDR A;  1F9I A;  2A24 A;  3LID A;  4EES A;  2W0N A;  4YWZ A;  4LRY C;  5HWW A;  2D02 A;  4F3L A;  3FG8 A;  3H7W A;  4EET B;  2WKP A;  1GSX A;  1T1C A;  2R78 A;  1OJ5 A;  2EA9 A;  1DP8 A;  2H28 A;  4JGR A;  1DRM A;  1V9Y A;  3F1N B;  3VE4 A;  3F1O B;  1EW0 A;  2K7S A;  5DKK A;  3UB6 A;  4K08 A;  1XJ4 A;  3UB7 A;  1UWN X;  2BAS A;  4I38 A;  1S4R A;  3LI9 A;  4E04 A;  4I5S A;  4JGQ A;  3KX0 X;  2OWJ A;  1D06 A;  1LSV A;  1S4S A;  3CWF A;  1S1Y A;  2KDK A;  4L9E A;  2ZOH A;  3GEC A;  3ULF A;  3IBR A;  5I5L A;  4I3I A;  1XJ3 A;  4HP4 A;  1P0Z A;  3NOP C;  4HNB A;  1N9O A;  4LPZ A;  2VV8 A;  4R3A A;  2OWH A;  1LSX A;  5F5Y A;  5KIZ A;  3LYX A;  1T1A A;  4JGO A;  2JN7 A;  2V0W A;  2QKP A;  1X0O A;  1TS6 A;  2WKR A;  1S66 L;  4HP9 A;  1KOU A;  2QJ7 A;  4LLO B;  5HD5 A;  4PKY A;  5AVF A;  3FC7 A;  3H82 A;  3UE6 A;  3H7W B;  2Z6C A;  4KQD A;  5HDS A;  2J80 A;  3VE3 A;  3MJQ A;  4KUO A;  3MXQ A;  5AVE A;  2GJ3 A;  2QHK A;  4L9F A;  3NOT C;  3MFX A;  4I3A A;  4EW7 A;  1OTA A;  1TS0 A;  5F69 A;  4HY8 A;  4MN6 A;  4LRX C;  4NXB A;  1DP9 A;  4HJ3 A;  1LSW A;  4EEP A;  2ZOI A;  4HIA A;  2JHE A;  4MN5 A;  4R70 A;  2V1A A;  3IS2 B;  5IS1 A;  4NXG A;  4GCZ A;  3D72 A;  1F98 A;  2L0W A;  2HV1 A;  5HWV A;  2VV6 A;  3BWL A;  4NXE A;  4GW9 A;  4PKY G;  4HJ4 A;  4R6L A;  2PYR A;  3IS2 A;  3P7N A;  4LRZ E;  1OTI A;  3G6O A;  4M4X A;  3RTY A;  3UMD A;  4H6J A;  2D01 A;  4RQ9 A;  3LIC A;  2YKF A;  2Z6D A;  2WKQ A;  2M1C A;  3MQO A;  4HOI A;  5J4E A;  1LT0 A;  3UB8 A;  5G4Y A;  2B02 A;  3BY9 A;  3ICY A;  4NXF A;  1UWP X;  4HH2 A;  3H82 B;  4EQ1 A;  2VV7 A;  5F68 A;  5EFW A;  3F1P B;  5G4Z A;  1JNU A;  1XJ2 A;  1OTE A;  2W27 A;  5TBM B;  3K3C A;  3LIB A;  1XFN A;  4I3J A;  2L1M A;  2VLG A;  1N9N A;  2QJ5 A;  3E4P A;  3NJA A;  1VB6 A;  5HWT A;  3LI8 A;  5IU1 A;  3NOU C;  4WN5 A;  1DP6 A;  5HSQ A;  4HHD A;  3MQQ A;  3SW1 A;  5J3W A;  2V9A A;  3F1P A;  4EEU A;  4B9O A;  4XT2 B;  5TBM A;  2VEA A;  2PHY A;  2ZBB A;  4WLA A;  3RH8 B;  3UME A;  1OTD A;  3A0R A;  5HDC A;  1OT6 A;  4EXO A;  4BBT A;  1NWZ A;  1G28 A;  2PYP A;  3CAX A;  3MR0 A;  1S1Z A;  1BYW A;  1TS8 A;  1S67 L;  1N9L A;  4XT2 A;  1GSV A;  1OJG A;  2QWS A;  4DJ2 A;  2P7J A;  4H6J B;  2INW A;  3C2W A;  4WL9 A;  3EWK A;  5A8B A;  1ODV A;  4WUJ A;  2YKH A;  1Y28 A;  2PR5 A;  4HQA A;  4DJ3 A;  1T19 A;  3PHY A;  3LIE A;  3C8C A;  3H9W A;  4BBU A;  2KX6 A;  1XFQ A;  1MZU A;  3NHQ A;  3LUQ A;  4WF0 A;  1OT9 A;  5HZH A;  4BBV A;  4R38 A;  2V0U A;  3F1N A;  3BY8 A;  3K3D A;  5DJT A;  1LL8 A;  3F1O A;  1GSW A;  1D7E A;  5DKL A;  4GS9 B;  2CMN A;  5J7E A;  1UGU A;  5HDD A;  3E4Q A;  3CLO A;  3LIA A;  2V1B A;  2I9V A;  2L4R A;  3HJK A;  4L9G A; 
#chains in the Genus database with same CATH topology
 4GHI B;  4B93 A;  2BG1 A;  1MKI A;  2G7U A;  3RXW A;  5GHZ A;  3HJI A;  2W3F A;  4GD6 A;  3LCE A;  4NK3 A;  1FR6 A;  1P97 A;  2ZQ7 A;  5F6A A;  1PNE A;  3T4S A;  3PBQ A;  1MWR A;  1T18 A;  2Q9N A;  4BD0 A;  2UWX A;  3A3D A;  4I39 A;  5L10 A;  4E3K A;  3GQZ A;  3BFF A;  3MKE A;  3ITA A;  2XD5 A;  3A0S A;  3LIF A;  3FYZ A;  2VGL S;  4Q0J A;  3R4K A;  1J3W A;  3O88 A;  5IHV A;  2HDU A;  3E4O A;  2PR6 A;  3ZNY A;  3GR2 A;  2G2W A;  3RFB A;  2VZW A;  4Z1W A;  3IH8 A;  2PDR A;  2A24 A;  1IKG A;  2W0N A;  3HLC A;  3T1X A;  4X1M A;  3DTE A;  2JBF A;  4JLF A;  5HWW A;  4F3L A;  2R9X A;  3DBA A;  5FI2 A;  3FG8 A;  3T12 B;  3OPR A;  5EVI D;  2JC7 A;  3BLS A;  4GB7 A;  4PM9 A;  5FAO A;  2H28 A;  4JGR A;  4BEN A;  3F1N B;  3SS4 A;  3MF0 A;  5DTS A;  3FPW A;  3MSH A;  2IA2 A;  3F1O B;  3BYD A;  3IXH A;  4C6Y A;  2K7S A;  4K0X A;  4K08 A;  4QY6 A;  2BAS A;  4A5R A;  2QMI A;  2PRF A;  3IX3 A;  3V67 A;  1Z09 A;  4IVI A;  5D3O A;  4FD8 A;  1ES5 A;  3KX0 X;  4WMC A;  1LSV A;  3NI9 A;  1CK3 A;  1S1Y A;  5E43 A;  3R7W A;  1CQA A;  3E98 A;  4ZDX A;  4GZB A;  1K57 A;  2LB5 A;  4N92 A;  3VP1 A;  1XJ3 A;  4HP4 A;  2WKH A;  4ID4 A;  3WRZ A;  1YT4 A;  4HNB A;  2EX9 A;  5HX9 A;  2J9O A;  1ZTU A;  2XA7 S;  5KIZ A;  4C3Q A;  4MDZ A;  3CPT B;  1T1A A;  2XFT A;  3NUL A;  4BWI A;  5CTM A;  4KQR A;  5L07 A;  3MBZ A;  1TS6 A;  2OAP 1;  2WKR A;  1S66 L;  3L7H A;  2OLU A;  4E6W A;  2QJ7 A;  1FSY A;  3HLE A;  2ZM8 A;  2GNX A;  3PBS A;  4S2L A;  1ES4 A;  4YOF A;  1QME A;  4CLC C;  4QD4 A;  3G4P A;  4KUO A;  2QHK A;  4L9F A;  3IH9 A;  4B88 A;  3NOT C;  3VP2 A;  3MFX A;  1PWD A;  4KQO A;  1TS0 A;  3VMA A;  4N1X A;  3C38 A;  1K4F A;  1STZ A;  1DJC A;  1YSP A;  3LFV A;  1P9R A;  1JTD A;  1DP9 A;  2Y2H A;  5HL1 A;  5FAT A;  4EEP A;  1KVM A;  3TSG A;  2JHE A;  3MZE A;  4Y13 A;  3N7W A;  1L0G A;  2HGV A;  3B3X A;  4GCZ A;  3D72 A;  1F98 A;  3TE8 A;  2HDS A;  5EV0 A;  5HAQ A;  3ZG0 A;  5HL6 A;  1DJB A;  4MBH A;  5CGW A;  2HV1 A;  1TVF A;  4KZ7 A;  4S2P A;  3BWL A;  4NXE A;  4CLC A;  4EV4 A;  2WGW A;  3G31 A;  4M3K A;  3IHA A;  3S7N A;  4R3J A;  4FUW A;  2J3W A;  2I72 A;  1SDN A;  4JXG A;  3LY3 A;  5FL3 A;  2V1Z A;  2WKQ A;  3FKW A;  4OP5 A;  1IKI A;  3OPP A;  4O01 A;  1LT0 A;  4QPR A;  2HP9 A;  1TD5 A;  5G4Y A;  4R4S A;  3BY9 A;  3SZT A;  3NY4 A;  1EI5 A;  4HH2 A;  5GHX A;  2O9A A;  2CC1 A;  1W63 Q;  3BFC A;  2WKI A;  5G4Z A;  1BLS A;  1JNU A;  4ZJ2 A;  1XJ2 A;  4JF6 A;  4GN2 A;  4LV3 A;  3UO9 A;  4E3L A;  5A93 A;  3LIB A;  3MXS A;  2HP5 A;  2ZL1 A;  3NJA A;  3ZDJ A;  2BLS A;  5IU1 A;  1YKD A;  4R1G A;  5EVI A;  4HHD A;  4OON A;  1VEU B;  2A3U A;  4MLL A;  2DNS A;  3HVF A;  4BMW A;  5DTK A;  3GVB A;  4KZ6 A;  1M6K A;  2W3D A;  3WS5 A;  4Q8I A;  4K91 A;  2XDM A;  3RH8 B;  5FQM A;  5FAQ A;  4JKT A;  1IYO A;  2EFU A;  5EVE A;  2IWD A;  1OT6 A;  3OCL A;  4EU0 A;  1NWZ A;  2PYP A;  1YAX A;  1L3L A;  3V39 A;  2V8C A;  1S1Z A;  2ZJ9 A;  1ERM A;  4UQI S;  3OZH A;  2A2L A;  1ZKJ A;  1RGZ A;  3ZG9 B;  1GSV A;  2QWS A;  4DJ2 A;  3AGE A;  1H0M A;  5DVA A;  1HZO A;  3Q82 A;  5DFY A;  4R23 A;  2YKH A;  1L0F A;  1Y28 A;  4ZAM A;  1E3U D;  3M6H A;  4DDY A;  4PPR A;  2Y79 A;  1L0D A;  3ZHH A;  4BBU A;  5CX7 A;  3S7P A;  5CGX A;  5TR7 A;  4KZ5 A;  3SOI A;  3LR3 A;  3WWX A;  3BRM A;  2Y2M A;  1K56 D;  3GMW A;  3Q7V A;  1CEG A;  4LV2 A;  4ESP A;  3TJZ C;  4IUH A;  5FQ9 A;  4MN7 A;  1GSW A;  5J7E A;  1TDL A;  4OQH A;  3P98 A;  4OVD A;  3E4Q A;  1PYY A;  3G35 A;  3T4O A;  4Y3I A;  2I9V A;  2HJE A;  3HJK A;  2ZC3 B;  2WAF A;  2ZQ8 A;  4L9G A;  4DN0 A;  1KE0 A;  4OOM A;  3CHW P;  4P6Z S;  5J8X A;  3WS2 A;  1SKO A;  4CJN A;  2KLI A;  2EXB A;  1K38 A;  3PAG A;  4X69 A;  1ZG4 A;  2W3G A;  2W1T B;  1D1J A;  4OPZ A;  1PIO A;  3HRE A;  1W63 M;  4G3W A;  5FQQ A;  1T1B A;  4PM5 A;  1BTL A;  4OQI A;  5HAI A;  1ONG A;  2A24 B;  3FV7 A;  1FIL A;  1V9Z A;  4HI4 A;  4OPQ A;  4HJ6 A;  3HUN A;  1WYB A;  1VET A;  5E2F A;  4F3L B;  3ZG5 A;  4U0T A;  3HLG A;  3SH8 A;  5FQI A;  3UE1 A;  2Z2M B;  3B33 A;  3LEZ A;  3G2Y A;  3EEH A;  2XSS A;  1Q2Q A;  4QWO A;  4OPY A;  5C5K A;  5F82 A;  1E4D A;  3T50 A;  2OOL A;  4G3V A;  1F9I A;  2JKR M;  3JVU A;  4E3J A;  4FCF A;  4OKP A;  2JCH A;  3H7W A;  1XKZ A;  1W5D A;  1GSX A;  1T1C A;  2R78 A;  1CI9 A;  5GLB A;  5FI7 A;  1MY8 A;  3ZGA B;  3MMH A;  3UB5 P;  1DRM A;  3DTI A;  1GHP A;  3HLB A;  1KVL A;  1EW0 A;  1XP4 A;  3IWO A;  3R7W B;  4E3O A;  3QP8 A;  1MKM A;  2V8F A;  5CTN A;  5DFX A;  2ZC4 B;  1XJ4 A;  3AGD A;  4QHC A;  5FDS A;  3TG9 A;  3KSF A;  3LI9 A;  4XUX A;  5E2H A;  5AQ7 A;  1D06 A;  5F1F A;  1YLY A;  3O5Y A;  2KDK A;  1PW8 A;  3EQV A;  1MPL A;  4O0P A;  4WEK A;  2ZOH A;  3ULF A;  3ITB A;  1NLY A;  4BL3 A;  2UV0 E;  5EVL A;  3G30 A;  3KO6 A;  2Y2I A;  1LL5 A;  1H3Q A;  4LPZ A;  2EXA A;  4ZBE A;  3C7U A;  3QP4 A;  3S4X A;  2K31 A;  1LSX A;  4L0L A;  5BOH A;  5F5Y A;  1Q2P A;  3LYX A;  3C5A A;  1ZC2 A;  1ZG6 A;  4IVK A;  1O7E A;  2H5S A;  3L9K A;  3W8K A;  4KZ3 A;  3JVV A;  1G6O A;  1X0O A;  3GSG A;  4HBU A;  3NCK A;  1K4E A;  4LLO B;  3CUE A;  1PZO A;  5AVF A;  3H82 A;  4CLC E;  5LBR A;  3VE3 A;  2EFX A;  3MJQ A;  5CRF A;  5AVE A;  1J9M A;  5EPH A;  4UA9 A;  4X1L A;  1E3U A;  1ESU A;  2XRO A;  2EWW A;  4HY8 A;  4EWF A;  1PZP A;  1WE4 A;  1KDS A;  4ETZ A;  4Z9Q A;  3CI6 A;  3BQ8 A;  4CLC B;  1ACF A;  2O9B A;  4BJP A;  2ZOI A;  3FKV A;  1K57 C;  5A90 A;  1SHV A;  1K56 A;  2M7U A;  2C5W B;  4O8G A;  4KZ8 A;  5IS1 A;  1SKF A;  4FSF A;  3ZG8 B;  3LY4 A;  1NZO A;  3M2J A;  3CIT A;  4IUK A;  4JF5 A;  4DDS A;  2VV6 A;  2WGI A;  1TDG A;  4GW9 A;  1BT5 A;  4Q0H A;  3C4P A;  4R4R A;  1JWZ A;  3T4T A;  1BSG A;  1OTI A;  4Y5F A;  4DF6 A;  5E2G A;  2WZX A;  4M4X A;  1LL9 A;  2Y8H A;  1NY0 A;  4GNU A;  4RQ9 A;  1IEL A;  1JWV A;  3MQO A;  5F1G A;  1F5M A;  4ZRR A;  2PBY A;  2DRW A;  1JTG A;  3UB8 A;  1BZA A;  2B02 A;  3P09 A;  4NXF A;  1UWP X;  1FCO A;  4HBT A;  4DE2 A;  2P9V A;  4P85 A;  3K2N A;  4Y0O A;  1XXM A;  3V50 A;  2ZM0 A;  4RVA A;  3JYI A;  4R0Q A;  3EGD C;  4NET A;  1OTE A;  4IED A;  2W3E A;  2VGJ A;  1K6R A;  3ZG7 B;  1XFN A;  4BLM A;  3I7J A;  3PBT A;  3IF6 C;  1NXY A;  2ZQD A;  3O86 A;  1O07 A;  1N9N A;  3GRJ A;  2QJ5 A;  3SS3 A;  2JKF A;  3IXB A;  4MEZ A;  1OME A;  1BLP A;  1S6R A;  1VB6 A;  2RL3 A;  5HWT A;  4FH2 A;  3MXR A;  4WN5 A;  2ZMV A;  4YFM A;  2ZQ9 A;  4IBR A;  1HTZ A;  5HSQ A;  1RCJ A;  2WUQ A;  1PWG A;  1MWT A;  4P87 A;  5J3W A;  2Y2K A;  3F1P A;  4PAU A;  4EEU A;  3Q7Z A;  5TBM A;  5FDH A;  1FSW A;  1JVJ A;  1YLT A;  4GD8 A;  1XGI A;  4Y0T A;  1AWI A;  1OTD A;  3A0R A;  2J8Y A;  3OOV A;  5HDC A;  4BBT A;  3VP3 A;  2FFF B;  3T1R A;  2ZMA A;  1AXB A;  1NRF A;  3D9Y A;  5M19 A;  1TS8 A;  5KMW A;  1N9L A;  4XT2 A;  1PI4 A;  1W8Q A;  1NJ4 A;  3IF6 A;  1MXO A;  3A3I A;  4H6J B;  5K5B A;  5EM0 A;  2PAV P;  3C2W A;  4WL9 A;  3EWK A;  5A8B A;  1XX2 A;  3T4K A;  4O7D A;  3BFE A;  3OCN A;  3Q7V B;  3BEB A;  3VP0 A;  3PHY A;  1KGF A;  1DJA A;  4WF0 A;  1OT9 A;  1BUE A;  1H5X A;  1KGG A;  5EVI C;  2FFY A;  4R38 A;  5FSR A;  4JBF A;  5DTT A;  5CHM A;  3F1N A;  1Z6F A;  1SKO B;  2X71 A;  3VOY A;  4WZ5 C;  2XQZ A;  1PI5 A;  3T4Q A;  3CJM A;  3F1O A;  3PBN A;  5DKL A;  2ZQA A;  2CMN A;  4OQ0 A;  4OLG A;  1SCW A;  2W1R A;  4OH0 A;  2E8I A;  5KSH A;  3LIA A;  4YIN A;  2L4R A;  2RCX A;  5HAR A;  2VA0 A;  3OPL A;  5CXW A;  1VET B;  4EER A;  5A92 A;  3TOI A;  4GOG A;  4NEE D;  1IYP A;  5HD3 A;  1CJF A;  2PD7 A;  5DJU A;  3PXP A;  4WEL A;  5IT5 A;  5I94 A;  3A0V A;  2Y2N A;  3HLD A;  3ZVT A;  3UPN A;  3CMZ A;  3VOL A;  5CER A;  2ZMF A;  5FI6 A;  3OLO A;  4WZ5 A;  3S7Q A;  4JGP A;  3C7V A;  3IHB A;  4II7 A;  4KZA A;  4HH3 A;  5GHY A;  1E25 A;  3ZQ5 A;  1PFL A;  5L09 A;  3UB9 A;  3CPT A;  3N8L A;  2WKE A;  2VGL M;  4LEN A;  1TS7 A;  2ACG A;  4YWZ A;  1IYS A;  1N9B A;  2Y59 A;  4LRY C;  3SH7 A;  4QB8 A;  3BW6 A;  2PT7 A;  2JKG A;  3LGO A;  2P04 A;  3VP4 A;  2Y91 A;  2WKP A;  2AVX A;  4GJ4 A;  4BL2 A;  4DE3 A;  4KZ9 A;  2NUP C;  1OJ5 A;  2EA9 A;  2ZQC A;  1V9Y A;  1SDE A;  3NDE A;  2MJ6 A;  3VE4 A;  3EOI A;  5CHJ A;  5G18 A;  1LHY A;  3OC2 A;  3C30 A;  2JKR I;  4G3K A;  2H0T A;  1NZU A;  5EUA A;  2IWB A;  2X02 A;  4ZJ1 A;  5TJJ A;  5GL9 A;  3LR4 A;  3WS1 A;  1Y4O A;  1MBL A;  5EM1 A;  3EGX C;  3UB7 A;  3LR0 A;  4ME4 A;  1S4R A;  1KGE A;  4E04 A;  4OQG A;  1FOF A;  3IQA A;  1YLJ A;  4NG2 A;  3GV9 A;  4DMZ A;  3CWF A;  1XPB A;  1K25 A;  3HLF A;  4L9E A;  3GEC A;  2W3H A;  1NLZ A;  5I5L A;  3Q81 A;  4I3I A;  1YPR A;  3E2K A;  4JXW A;  4HES A;  4IBX A;  2PBD P;  4Y0U A;  3VSK A;  4P6B A;  5JYO A;  2VV8 A;  3QP2 A;  4R3A A;  2OWH A;  5CEB A;  4S2O A;  1G5U A;  2B95 A;  3N6I A;  2H0Y A;  3D4F A;  2JN7 A;  5FAS A;  2V0W A;  4FOF A;  2BTF P;  4N9L A;  2FZ0 A;  4MCW A;  5DF9 A;  4HP9 A;  2XA7 M;  1KOU A;  1XA7 A;  5HD5 A;  4H8R A;  4PKY A;  3FPV A;  3FC7 A;  4S2K A;  2ZM2 A;  2Z6C A;  3NIA A;  3MXQ A;  2GJ3 A;  1YSQ A;  2OAQ 1;  3HLW A;  3JPU A;  1GCE A;  1YM1 A;  4I3A A;  1OTA A;  3MS6 A;  5HFO A;  4MN6 A;  4LRX C;  3VFF A;  2XLN A;  1FQG A;  1YLW A;  1H8Y A;  1LI0 A;  3E0Y A;  4LV0 A;  4WEJ A;  1MWU A;  2QPN A;  4E3M A;  4ZTK A;  2HP6 A;  4HJ3 A;  2QZ6 A;  3W4P A;  1A0K A;  2JKT M;  3ZCZ A;  4HIA A;  1VEU A;  2G2U A;  1K55 A;  4R70 A;  4X25 A;  5HW3 A;  1PRQ A;  4EBL A;  4ETX A;  3UDF A;  4GDN A;  4D2O A;  3W4O A;  5KZH A;  2L0W A;  3HUO A;  3BFD A;  4DE1 A;  2WYX A;  4IHQ A;  2HDR A;  1BLH A;  1KDW A;  1QMF A;  3IS2 A;  3P7N A;  3IF5 A;  4LRZ E;  3SS5 A;  2VK3 A;  2O0Y A;  3CUE C;  5FEF A;  2P9V B;  5CED A;  3UMD A;  2EX8 A;  2D01 A;  2H10 A;  3LIC A;  4X56 A;  4PM8 A;  2YKF A;  4LCM A;  1K54 C;  3KSH A;  4HOI A;  4X55 A;  2EX6 A;  4S2N A;  1LLB A;  4WBG A;  4E3I A;  1P9W A;  3AGF A;  5EOO A;  4UA7 A;  3ICY A;  3DTK A;  1YLZ A;  4RX3 A;  4EQ1 A;  3KYQ A;  2VV7 A;  2HPB A;  5EFW A;  5FQK A;  4KQQ A;  1ERQ A;  3F1P B;  3V5M A;  2XEP A;  2W27 A;  4U3T A;  1RGY A;  5TBM B;  2L1M A;  1ZHH B;  3IXD A;  2VLG A;  2XGN A;  3E4P A;  4Y17 A;  3ZNT A;  4NKP A;  2X01 A;  3NDG A;  4HEF A;  1DP6 A;  2C6W B;  3BJN A;  3MQQ A;  3SW1 A;  2V9A A;  4FH4 A;  1K54 A;  4XT2 B;  2WK0 A;  3IF6 B;  2VEA A;  2PHY A;  2ZBB A;  2K2N A;  3VV4 A;  2XR0 A;  2Q9M A;  3QNB A;  2W1T A;  4ARZ A;  1G68 A;  3BLM A;  1G28 A;  3MR0 A;  3T1S A;  1I5Q A;  4MBK A;  2WGW B;  3A3F A;  3N8R A;  3PAE A;  1BYW A;  1W79 A;  2HDQ A;  3NEC A;  1HLU P;  1WYC A;  4Y15 A;  1OJG A;  3Q07 A;  1C3B A;  3HUM A;  4Q0I A;  4UQI M;  3PBR A;  3KYE A;  1YMX A;  1ODV A;  3A3J A;  4UEY A;  2WZZ A;  4AFI A;  2R9W A;  1ES3 A;  4X68 A;  4KZB A;  1T19 A;  4D60 A;  2B5R A;  3LIE A;  1IOU A;  1YLP A;  2KX6 A;  1XFQ A;  1I2S A;  1MZU A;  3NHQ A;  3LUQ A;  1GHM A;  3QP1 A;  5HZH A;  2WGV A;  3Q1F A;  1S0W A;  1M40 A;  2JE5 A;  3QP6 A;  3O3V A;  2Y2G A;  1NRJ A;  5EOE A;  4OLD A;  4UHU A;  5HPF A;  3U2A A;  4CQH A;  2ZL1 B;  5DJT A;  3BY8 A;  1W7F A;  3K3D A;  3GTC A;  3B42 A;  5HAP A;  3FZC A;  1NYY A;  4RYE A;  1VHM A;  4XXR A;  5HDD A;  5EVI B;  2V1B A;  3LR5 A;  3S1Y A;  1TEM A;  2A49 A;  3WS0 A;  2HJ9 C;  4BD1 A;  2DCF A;  4KEN B;  3LO7 A;  2PD8 A;  3V3S A;  2Y2P A;  3C4O A;  2XRN A;  4KUK A;  3G2Z A;  1OTB A;  5AJG A;  1JWP A;  4GS9 A;  3GDI A;  4P6Z M;  3UDI A;  4N9K A;  2Q0O A;  3G34 A;  1BLC A;  4LCL A;  4OPR A;  5GLD A;  3N8S A;  4DKI A;  3W2Z A;  1W8Y A;  3IWQ A;  4GHI A;  2VX8 A;  3DW0 A;  4PMA A;  1ESI A;  2Y2O A;  2J3T D;  4JF4 A;  2XH9 A;  1XJ6 A;  1WA9 A;  2LB9 A;  5AQ9 A;  3LEQ A;  5CEC A;  3DWK A;  3UY6 A;  2OV5 A;  4B4X A;  3IX4 A;  4DXC A;  2B18 A;  1N4O A;  3MZF A;  1K6S A;  2GX5 A;  3PYP A;  3IXG A;  4RX2 A;  3HCY A;  3FWL A;  3QNC A;  3LID A;  4EES A;  4PM7 A;  2D02 A;  4U0X A;  5KSC A;  3KSG A;  4EET B;  4LFU A;  4IJG A;  1G6A A;  4PM6 A;  2XF3 A;  4UA6 A;  1U60 A;  1DP8 A;  5M18 A;  2WAE A;  1KE3 A;  1SZV A;  4Y2F A;  4QU3 A;  3S7O A;  5U47 A;  1MWS A;  5DKK A;  4E6X A;  3UNW A;  2M7V A;  3UB6 A;  1KE4 A;  3IWI A;  5TGF A;  4EQI A;  4E3N A;  1ERO A;  1UWN X;  1BUL A;  4I38 A;  1K0K A;  5GLC A;  2O9C A;  5E2E A;  2DMW A;  2XFS A;  3A3E A;  3BFG A;  4I5S A;  5FA7 A;  3BQA A;  4JGQ A;  3MZD A;  2OWJ A;  2V2F F;  1S4S A;  5AQA A;  4MNR A;  3ZVW A;  2E8J A;  4C75 A;  1EWZ A;  3QP5 A;  1GA9 A;  4OP8 A;  3BEC A;  2VJW A;  5CGS A;  2FH5 A;  3IBR A;  3W4Q A;  3M2K A;  3M6B A;  1I2W A;  1P0Z A;  3NOP C;  1GHI A;  2ZC5 B;  1N9O A;  3S22 A;  3P01 A;  1YMS A;  2ZLY A;  3UPP A;  2Y2Q A;  2Y55 A;  5GLA A;  1IEM A;  1F2K A;  5HPI A;  2Z2L B;  4JGO A;  1DY6 A;  4DRT A;  5L8M A;  3OPH A;  2QKP A;  1ES2 A;  1FCM A;  4ZJ3 A;  2VKS A;  1L2S A;  3ZFZ A;  3UE6 A;  1OPX A;  3H7W B;  4KQD A;  3PBO A;  5HDS A;  2J80 A;  1HD8 A;  4JXS A;  2OSU A;  1TF1 A;  5CHU A;  3N4I A;  4KG2 A;  3WS4 A;  1H8M A;  4EW7 A;  2OLV A;  5F69 A;  2VGK A;  2V20 A;  1GA0 A;  2QYB A;  4Y7P A;  4NXB A;  1FR1 A;  4DE0 A;  5TFQ A;  3CG5 A;  1LSW A;  5L2F A;  4OOY A;  4S2M A;  3DAV A;  5FAP A;  5JYP A;  4MN5 A;  2Y2L A;  2XK1 A;  5A91 A;  2V1A A;  3IS2 B;  4QY5 A;  4YNR A;  1ONH A;  4NXG A;  5F83 A;  2J3T C;  3D3O A;  3PTE A;  5FEG A;  3HL9 A;  2EX2 A;  1FIK A;  3VFH A;  3V3R A;  1VM1 A;  5HWV A;  3NC8 A;  4DXB A;  5AQB A;  4KG5 A;  4PKY G;  2JKT I;  4HJ4 A;  4R6L A;  4KZ4 A;  2PYR A;  2NUT C;  3RJU A;  2ZD8 A;  3MFD A;  3MQ0 A;  3MKF A;  1IYQ A;  5M1A A;  2IWC A;  3G6O A;  4K0W A;  2KOI A;  3RTY A;  4EUZ A;  4S2I A;  4H6J A;  3KSI A;  4X6T A;  4XUZ A;  5FQJ A;  4OOL A;  4WM9 A;  2Z6D A;  3T1Q B;  2M1C A;  4RA7 A;  4MMN A;  5MC7 A;  4GDB A;  3QHY A;  4B4Z A;  5J4E A;  4X53 A;  4EBN A;  3UE3 A;  3SH9 A;  3ISG A;  3VOZ A;  3H82 B;  3O87 A;  3IX8 A;  5F68 A;  4JPM A;  3ZYT A;  4S2J A;  2P74 A;  1CI8 A;  1CF0 A;  3UDX A;  3IT9 A;  2J7V A;  2ZC7 A;  3OBF A;  1XA1 A;  1K55 C;  1MC0 A;  4JXV A;  1XGJ A;  1L0E A;  1Y54 A;  3K3C A;  3DTM A;  2Y4A A;  4N1H A;  4I3J A;  3VSL A;  2EWV A;  3RXX A;  1VQQ A;  4WMC D;  5DF7 A;  2J9P A;  2HF6 A;  3WRT A;  4ARZ B;  3LI8 A;  4CPK A;  3NOU C;  3KYZ A;  2O99 A;  1IFQ A;  3T4L A;  1PW1 A;  2HZ5 A;  3EEA A;  4PHT A;  5EE8 A;  4B9O A;  1YQS A;  3BM6 A;  3G32 A;  3TRC A;  4WLA A;  3UME A;  3DWZ A;  3HBR A;  2GZA A;  4EXO A;  1FCN A;  4QJG A;  1LI9 A;  2XD1 A;  3TW8 A;  3CAX A;  2GDN A;  4KG6 A;  3E2L A;  3PR6 A;  4GLQ A;  3UN7 A;  4FTX A;  4S2N C;  4GKU A;  5EEC A;  3NBL A;  4LV1 A;  1S67 L;  1CEF A;  3U4L P;  2P7J A;  1PWC A;  1H8Z A;  2INW A;  4F94 A;  2PU2 A;  5DF8 A;  4EBP A;  4WUJ A;  2WAD A;  1HVB A;  2PR5 A;  4EUV A;  2ZC6 B;  4HQA A;  4DJ3 A;  2Y2J A;  3CZD A;  3C8C A;  3H9W A;  3T4J A;  4P0M A;  4R3B A;  3UE0 A;  4BBV A;  2PU4 A;  2V0U A;  4WYY A;  1ALQ A;  2P08 A;  4UAA A;  3UPO A;  4LGW A;  1LL8 A;  3B47 A;  1D7E A;  4GS9 B;  1UGU A;  3EQU A;  4WZ4 A;  3CLO A;  4MBF A;  4CLC D;  3IBJ A;  4BQM A;  1NYM A;  1RP5 A; 
#chains in the Genus database with same CATH homology
 4DN0 A;  4OOM A;  4GHI B;  4P6Z S;  2PD8 A;  4EER A;  4B93 A;  2G7U A;  2KLI A;  3HJI A;  2W3F A;  2XRN A;  4KUK A;  4NEE D;  1OTB A;  5HD3 A;  2PD7 A;  5AJG A;  4GS9 A;  3GDI A;  5DJU A;  2W3G A;  3PXP A;  2W1T B;  1P97 A;  4WEL A;  5F6A A;  5IT5 A;  4P6Z M;  3A0V A;  3T4S A;  3PBQ A;  1T18 A;  1W63 M;  4G3W A;  1T1B A;  4I39 A;  3W2Z A;  3VOL A;  2A24 B;  1V9Z A;  4HI4 A;  4GHI A;  2ZMF A;  4HJ6 A;  2VX8 A;  3OLO A;  4F3L B;  2J3T D;  3A0S A;  3LIF A;  3S7Q A;  2VGL S;  1XJ6 A;  4Q0J A;  3B33 A;  4JGP A;  3R4K A;  1WA9 A;  2LB9 A;  4II7 A;  3EEH A;  4HH3 A;  2XSS A;  3E4O A;  2B18 A;  3ZQ5 A;  5C5K A;  3UB9 A;  2PR6 A;  2VGL M;  3T50 A;  2OOL A;  2GX5 A;  3RFB A;  2VZW A;  3PYP A;  1TS7 A;  4Z1W A;  4G3V A;  2PDR A;  1F9I A;  3HCY A;  2A24 A;  3LID A;  4EES A;  2W0N A;  2JKR M;  3JVU A;  4YWZ A;  4LRY C;  5HWW A;  2D02 A;  4F3L A;  3DBA A;  3BW6 A;  3FG8 A;  2PT7 A;  2P04 A;  3KSG A;  3H7W A;  4EET B;  2WKP A;  1GSX A;  4GJ4 A;  1T1C A;  2R78 A;  2NUP C;  4IJG A;  1OJ5 A;  2EA9 A;  3MMH A;  1DP8 A;  2H28 A;  4JGR A;  1DRM A;  1V9Y A;  3F1N B;  3MF0 A;  3FPW A;  4Y2F A;  3S7O A;  2MJ6 A;  3VE4 A;  3EOI A;  2IA2 A;  3F1O B;  1EW0 A;  3OC2 A;  3C30 A;  2K7S A;  2JKR I;  5DKK A;  4G3K A;  2M7V A;  3UB6 A;  4K08 A;  3R7W B;  1MKM A;  5TJJ A;  5DFX A;  3LR4 A;  1XJ4 A;  3EGX C;  3UB7 A;  1UWN X;  2BAS A;  4I38 A;  3LR0 A;  2O9C A;  2DMW A;  1S4R A;  3KSF A;  4ME4 A;  3LI9 A;  3V67 A;  4E04 A;  4I5S A;  3BQA A;  4JGQ A;  3KX0 X;  2OWJ A;  1D06 A;  1LSV A;  1S4S A;  4DMZ A;  3CWF A;  3O5Y A;  1S1Y A;  2KDK A;  3EQV A;  4O0P A;  3R7W A;  4WEK A;  3E98 A;  4L9E A;  2VJW A;  2FH5 A;  2ZOH A;  3GEC A;  2W3H A;  3ULF A;  1NLZ A;  1NLY A;  3IBR A;  2LB5 A;  5I5L A;  4I3I A;  1XJ3 A;  4HP4 A;  1P0Z A;  3NOP C;  3KO6 A;  4HNB A;  1H3Q A;  1N9O A;  4LPZ A;  2VV8 A;  3P01 A;  4R3A A;  2K31 A;  2OWH A;  1LSX A;  4L0L A;  1ZTU A;  5F5Y A;  2XA7 S;  5KIZ A;  3LYX A;  4MDZ A;  5HPI A;  1T1A A;  4JGO A;  2JN7 A;  4BWI A;  2V0W A;  5L8M A;  3JVV A;  2QKP A;  1G6O A;  1TS6 A;  1X0O A;  2OAP 1;  2WKR A;  4FOF A;  1S66 L;  2FZ0 A;  4MCW A;  5DF9 A;  4HP9 A;  2XA7 M;  1KOU A;  2QJ7 A;  4LLO B;  5HD5 A;  3CUE A;  2VKS A;  4PKY A;  5AVF A;  3FPV A;  3FC7 A;  3H82 A;  3UE6 A;  4CLC E;  1OPX A;  2GNX A;  3H7W B;  2Z6C A;  3PBS A;  4KQD A;  3PBO A;  5HDS A;  5LBR A;  2J80 A;  4YOF A;  3VE3 A;  4CLC C;  3MJQ A;  1TF1 A;  3MXQ A;  4KUO A;  5AVE A;  2GJ3 A;  2QHK A;  4L9F A;  1YSQ A;  2OAQ 1;  3NOT C;  3MFX A;  1H8M A;  2XRO A;  4KQO A;  2EWW A;  4I3A A;  4EW7 A;  1OTA A;  1TS0 A;  5F69 A;  4HY8 A;  4MN6 A;  3C38 A;  2QYB A;  4LRX C;  1STZ A;  4NXB A;  3E0Y A;  4WEJ A;  1YSP A;  3LFV A;  1P9R A;  4ETZ A;  3CI6 A;  1DP9 A;  4HJ3 A;  1LSW A;  3BQ8 A;  4CLC B;  4EEP A;  2O9B A;  4BJP A;  2ZOI A;  2JKT M;  4HIA A;  2JHE A;  4MN5 A;  4R70 A;  2M7U A;  2V1A A;  3IS2 B;  4O8G A;  5IS1 A;  4YNR A;  4FSF A;  4ETX A;  4NXG A;  2HGV A;  4GCZ A;  3D72 A;  2J3T C;  3D3O A;  1F98 A;  3TE8 A;  3CIT A;  2L0W A;  5HL6 A;  4IUK A;  2HV1 A;  5HWV A;  2VV6 A;  3BWL A;  4IHQ A;  4NXE A;  4CLC A;  4GW9 A;  4PKY G;  2JKT I;  4Q0H A;  4HJ4 A;  4R6L A;  2PYR A;  2NUT C;  3IS2 A;  3P7N A;  3T4T A;  4LRZ E;  3MQ0 A;  2O0Y A;  1OTI A;  3CUE C;  3S7N A;  4Y5F A;  3G6O A;  2KOI A;  4M4X A;  2J3W A;  3RTY A;  2Y8H A;  4H6J A;  3KSI A;  3UMD A;  2D01 A;  4RQ9 A;  3LIC A;  4OOL A;  5FL3 A;  2YKF A;  2Z6D A;  2WKQ A;  2M1C A;  3KSH A;  4MMN A;  5MC7 A;  3MQO A;  4HOI A;  1F5M A;  5J4E A;  4O01 A;  4ZRR A;  1LT0 A;  4QPR A;  1P9W A;  1TD5 A;  3UE3 A;  3UB8 A;  5G4Y A;  2B02 A;  3BY9 A;  3ICY A;  4NXF A;  1UWP X;  4HH2 A;  3H82 B;  4EQ1 A;  3KYQ A;  2VV7 A;  2O9A A;  5F68 A;  5EFW A;  3ZYT A;  3K2N A;  1W63 Q;  3OBF A;  3EGD C;  3F1P B;  5G4Z A;  1JNU A;  1MC0 A;  1XJ2 A;  1OTE A;  2W27 A;  2W3E A;  5TBM B;  3K3C A;  3LIB A;  1XFN A;  3PBT A;  4I3J A;  2L1M A;  2EWV A;  1ZHH B;  2VLG A;  1N9N A;  2QJ5 A;  3E4P A;  3NJA A;  4NKP A;  1VB6 A;  2HF6 A;  5HWT A;  4ARZ B;  3LI8 A;  5IU1 A;  1YKD A;  3NOU C;  4WN5 A;  2ZMV A;  3KYZ A;  1DP6 A;  2O99 A;  5HSQ A;  4HHD A;  1IFQ A;  3T4L A;  3BJN A;  3MQQ A;  3SW1 A;  5J3W A;  2V9A A;  4PAU A;  3F1P A;  3EEA A;  4EEU A;  4PHT A;  4B9O A;  4BMW A;  4XT2 B;  5TBM A;  2W3D A;  2VEA A;  3TRC A;  2PHY A;  2ZBB A;  2K2N A;  4WLA A;  3RH8 B;  3UME A;  3VV4 A;  1OTD A;  3A0R A;  3OOV A;  2GZA A;  5HDC A;  1OT6 A;  2W1T A;  4EXO A;  4ARZ A;  4BBT A;  3OCL A;  4EU0 A;  1NWZ A;  1G28 A;  3TW8 A;  2PYP A;  1YAX A;  3CAX A;  3MR0 A;  1S1Z A;  3PR6 A;  4GLQ A;  4UQI S;  1BYW A;  2A2L A;  1TS8 A;  1S67 L;  1N9L A;  4XT2 A;  1GSV A;  1OJG A;  2QWS A;  4DJ2 A;  2P7J A;  4H6J B;  5K5B A;  4Q0I A;  2INW A;  3C2W A;  4UQI M;  3PBR A;  4WL9 A;  3EWK A;  5A8B A;  1ODV A;  4WUJ A;  5DFY A;  3T4K A;  2YKH A;  1Y28 A;  4UEY A;  2PR5 A;  3OCN A;  4EUV A;  4AFI A;  4HQA A;  4DJ3 A;  1T19 A;  2Y79 A;  3PHY A;  3LIE A;  3C8C A;  1IOU A;  3H9W A;  4BBU A;  2KX6 A;  1XFQ A;  5CX7 A;  1MZU A;  3NHQ A;  3S7P A;  3T4J A;  3LUQ A;  4WF0 A;  1OT9 A;  5HZH A;  3LR3 A;  4BBV A;  4R38 A;  2V0U A;  2P08 A;  3F1N A;  1NRJ A;  5HPF A;  3T4Q A;  3TJZ C;  3U2A A;  3K3D A;  3BY8 A;  4IUH A;  5DJT A;  4CQH A;  1LL8 A;  3F1O A;  3PBN A;  3B47 A;  3B42 A;  4MN7 A;  1GSW A;  1D7E A;  5DKL A;  4GS9 B;  2CMN A;  5J7E A;  1UGU A;  2W1R A;  1VHM A;  5HDD A;  3EQU A;  3E4Q A;  3LIA A;  3CLO A;  5KSH A;  3T4O A;  2V1B A;  4CLC D;  3LR5 A;  4Y3I A;  3IBJ A;  2I9V A;  2HJ9 C;  2L4R A;  2HJE A;  3HJK A;  2VA0 A;  4L9G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...