2PD7A

2.0 angstrom crystal structure of the fungal blue-light photoreceptor vivid
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
149
structure length
149
Chain Sequence
MHTLYAPGGYDIMGYLIQIMNRPNPQVELGPVDTSCALILCDLKQKDTPIVYASEAFLYMTGYSNAEVLGRNCRFLQSPDGMVKPKSTRKYVDSNTINTMRKAIDRNAEVQVEVVNFKKNGQRFVNFLTMIPVRDETGEYRYSMGFQCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vivid PAS protein VVD
publication title Conformational switching in the fungal light sensor Vivid
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Circadian clock protein
total genus 37
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2pd7A00
3UE6A 3SW1A 4M4XA 1DP8A 3UMEA 4WUJA 2PYPA 4JGPA 5HD3A 5J3WA 1UWNX 1F98A 5TBMA 1XJ3A 5G4YA 4LRXC 3K3DA 3E4OA 3CLOA 4NXGA 4MN5A 2EA9A 4BBVA 5HSQA 4DJ2A 4R6LA 2YKFA 4EW7A 2PD8A 2QJ5A 4NXBA 4RQ9A 3UB9A 4LLOB 2VEAA 1V9ZA 4I38A 4HH2A 3E4PA 3OLOA 3RTYA 2PR5A 1XJ4A 2YKHA 4LRZE 5J4EA 1OTDA 3PYPA 3LI9A 2QWSA 3A0RA 5IU1A 2D01A 3A0VA 2M1CA 4R3AA 3IS2B 4JGOA 3MXQA 5DKLA 1TS8A 2V0UA 4H6JB 1XFQA 3LIAA 3C8CA 1XJ6A 3FG8A 1OT6A 5DJTA 2KDKA 1X0OA 4GHIA 5A8BA 4XT2A 5F6AA 3RH8B 2ZOHA 3F1PB 3BY9A 1OJGA 4GW9A 3H82B 1S1ZA 2PR6A 1T1BA 2V0WA 4PKYG 1LL8A 5HDSA 3LI8A 1NWZA 3VOLA 1GSVA 3CWFA 3EWKA 1XJ2A 3LIEA 5G4ZA 4GS9A 1T18A 5HD5A 4L9EA 2BASA 3BWLA 4EESA 2Z6CA 5HZHA 1N9LA 4EEPA 2H28A 4HIAA 1T19A 3T50A 3UMDA 2PDRA 2CMNA 3HJKA 4EEUA 5I5LA 4HNBA 1V9YA 4HJ6A 2W27A 3LICA 1DP9A 3H7WB 5HDCA 1S66L 2WKQA 1ODVA 2L4RA 5DJUA 2WKRA 1S67L 1F9IA 3ZQ5A 3F1NB 2VV7A 5HWTA 2I9VA 3H9WA 1LSXA 4L9FA 2A24A 3F1OA 4I3IA 3GECA 1UWPX 3UB8A 4B9OA 1D7EA 1N9OA 2V9AA 3MFXA 2Z6DA 1S1YA 5J7EA 4I39A 4EETB 3B33A 1LT0A 3E4QA 5IS1A 3UB7A 2ZBBA 3NOTC 3HJIA 4EXOA 3LYXA 3LIBA 3C2WA 4GS9B 2V1AA 3KX0X 3NHQA 2GJ3A 4MN6A 2VV8A 1DP6A 3LUQA 2B02A 4EERA 3MR0A 3GDIA 3P7NA 4GCZA 2L0WA 3NOPC 4HP4A 5TBMB 4E04A 4WN5A 4F3LA 1OJ5A 5F69A 4HJ4A 5F5YA 4HP9A 3F1PA 4R70A 1JNUA 1N9NA 4BBTA 1TS0A 1UGUA 1OTBA 2W0NA 4KQDA 1XFNA 3BY8A 4R38A 2OWHA 2KX6A 2PD7A 4WF0A 1Y28A 3NOUC 4HI4A 3MQQA 4HH3A 2VV6A 1GSXA 1S4SA 3EEHA 4I3AA 4BBUA 4JGQA 3MQOA 3VE4A 4PKYA 4WL9A 4HJ3A 1S4RA 3MJQA 2WKPA 2V1BA 1LSVA 1WA9A 2OOLA 1EW0A 1P0ZA 5AVFA 1KOUA 4LPZA 3K3CA 4YWZA 3NJAA 2A24B 3F1OB 4I3JA 1TS6A 2QKPA 5EFWA 4WLAA 1OTAA 4EQ1A 4LRYC 4NXEA 4GHIB 4K08A 2ZOIA 4XT2B 3VE3A 2HV1A 4HOIA 2QJ7A 4L9GA 5HDDA 1OTIA 5HWWA 5F68A 2PYRA 3H7WA 5KIZA 1T1CA 3A0SA 5AVEA 2INWA 1OT9A 4KUOA 2JN7A 4JGRA 2R78A 2PHYA 2L1MA 1BYWA 3G6OA 1DRMA 3LIDA 3IS2A 2VLGA 3F1NA 1OTEA 3LIFA 2JHEA 4I5SA 1D06A 4DJ3A 4H6JA 3IBRA 4F3LB 1TS7A 3PHYA 2P7JA 2QHKA 1MZUA 4NXFA 2D02A 2J80A 1VB6A 3ICYA 2OWJA 1LSWA 5HWVA 1P97A 3FC7A 4HHDA 5DKKA 3H82A 4HQAA 3CAXA 3D72A 1T1AA 4KUKA 1GSWA 1G28A 3UB6A 3ULFA 4HY8A 2K7SA
chains in the Genus database with same CATH superfamily
3UE6A 3SW1A 5KSHA 1DP8A 4UQIM 5HD3A 4HBUA 2Y2OA 3LEZA 1XKZA 5TBMA 2Y2GA 2WGVA 5G4YA 3K3DA 4KENB 2BLSA 3CLOA 4CQHA 2Y2KA 2ZMVA 2YKFA 4EW7A 5HARA 2X01A 4EU0A 2QJ5A 4EUVA 3UB9A 1W8YA 2XR0A 3D9YA 3E4PA 3OLOA 5FQMA 3HLEA 1XJ4A 2YKHA 3B47A 4LRZE 4E6WA 3FKWA 2XK1A 3EQVA 1OTDA 4P6ZS 2DMWA 3W2ZA 4DE1A 3M6BA 3C38A 3KSGA 1SKFA 2XEPA 2VJWA 3TJZC 3A0VA 5A92A 3ZG0A 2NUTC 4PM7A 2OLUA 3DTEA 5DKLA 3SH9A 5BOHA 3NIAA 3QP1A 3GR2A 4H6JB 2WZZA 3RXWA 3LIAA 4R4RA 3FG8A 2ZJ9A 3ZNYA 5DJTA 4KZ8A 2HDSA 2K2NA 4OOLA 2BTFP 4GHIA 3FWLA 5IHVA 2HZ5A 1K54A 3RH8B 3EQUA 3ZVWA 3BY9A 4GW9A 2XFSA 4IEDA 1P9WA 5FA7A 3T1SA 2PR6A 5TJJA 1EWZA 1T1BA 4OP5A 4NG2A 1U60A 1LL8A 2IA2A 1VHMA 5CXWA 4BWIA 2ZLYA 1K56D 3BFEA 4IBRA 3T1RA 2HGVA 3IF6A 1NWZA 3CWFA 4R1GA 1K56A 3NC8A 1GA9A 4DXCA 3RFBA 3PBNA 3DTKA 4QHCA 5EOOA 4BL2A 2Y55A 3HLDA 2AVXA 2BASA 2ZC4B 1ONHA 3BWLA 3TSGA 1KVMA 3SH7A 2Z6CA 4LCMA 1LL9A 4JPMA 1ESIA 4A5RA 4KG5A 2XDMA 3T50A 5CHUA 5C5KA 3UPOA 5J8XA 5EECA 1CQAA 5I5LA 4XXRA 1BLHA 1IYPA 3T4OA 4HJ6A 5LBRA 1JWVA 4O7DA 4UA6A 3Q1FA 1NJ4A 3KSIA 4Q0HA 3H7WB 2IWCA 4EBNA 3M6HA 1K6SA 4CLCD 2JE5A 3IH8A 5CHMA 1P9RA 5FAQA 3HREA 2H0YA 4QB8A 1BTLA 5HWTA 5DFYA 2EXAA 4DRTA 3H9WA 1FCNA 3VSLA 1XA7A 2W3FA 2EWVA 4XUXA 1E3UA 1IELA 3PTEA 4R3BA 1N9OA 2RL3A 2I72A 4YOFA 1JWZA 5FATA 4MDZA 2V1ZA 4PM9A 5DFXA 4I39A 4P6BA 4EETB 2C6WB 3B33A 5FEGA 1LT0A 3W4OA 4S2LA 3IWIA 3WS2A 3UB7A 4KZ7A 4B93A 3OCLA 5FQKA 3ZGAB 2PAVP 3NOTC 4GJ4A 5AQ7A 2P9VA 3HJIA 3IXHA 3T4TA 4Y0UA 4OVDA 1TVFA 3E2LA 4CLCC 3DTMA 5M18A 4QWOA 2V1AA 3NHQA 2VV8A 3ZHHA 3PBSA 1NRFA 1D1JA 2BG1A 5TBMB 4E04A 4Y5FA 3UO9A 4ID4A 5HAIA 4CJNA 3DW0A 1JNUA 1O7EA 3OPPA 3T1XA 2ZQ9A 1UGUA 3BRMA 2E8IA 4E3IA 2PD7A 5I94A 3G4PA 3NOUC 1MC0A 2Y2HA 4WZ5A 3MZDA 4ZJ3A 2PU2A 3IF5A 1LHYA 4PKYA 4WL9A 1WA9A 4Q8IA 4OKPA 2OSUA 3NDEA 1KOUA 1H3QA 2PU4A 3BJNA 1L0FA 1KGEA 2XD5A 4YWZA 1AWIA 3CUEC 4M3KA 5FI7A 4EQ1A 4GHIB 3V39A 4KZBA 2V8FA 4Y17A 1OMEA 3W8KA 3VE3A 5A93A 3P01A 1BLPA 2P74A 3GVBA 3MXSA 4LCLA 4OQ0A 2PYRA 4FTXA 2OAP1 2HP9A 5AVEA 1A0KA 5CEDA 1F2KA 1XGJA 3Q7ZA 3Q81A 5U47A 4OQHA 2WGIA 1CJFA 2FZ0A 5JYPA 3GQZA 3MZEA 2L1MA 5MC7A 3G6OA 1DRMA 5TGFA 3CI6A 1BSGA 3IF6B 5G18A 4II7A 1OTEA 4DKIA 3LIFA 2JHEA 4I5SA 1D06A 2OLVA 3HLFA 4H6JA 3NDGA 4MBKA 3WS4A 3PHYA 4DDYA 3L7HA 1L0GA 4P87A 3FKVA 4D60A 4OH0A 1FILA 1VB6A 4FCFA 4KZ9A 4R0QA 3HLWA 2OWJA 3HL9A 5DTKA 1LSWA 4ZJ1A 1P97A 4OPZA 3BFFA 3S7QA 3S4XA 4KUKA 3BECA 4IVIA 3ULFA 1LLBA 3TRCA 4PM5A 4LV3A 5HL6A 3UMEA 3IXBA 4JGPA 3C4OA 4L0LA 3Q82A 5J3WA 1UWNX 1ZKJA 1RCJA 2HDRA 3O5YA 1XJ3A 3M2JA 4LRXC 3E4OA 5GLAA 5EUAA 4NXGA 3WRTA 4CLCB 5HSQA 3IH9A 4FD8A 5CRFA 4R6LA 2DRWA 4RQ9A 1YLZA 2PR5A 4X55A 4Q0JA 2PBYA 4RVAA 5J4EA 2Q9MA 3G32A 3PYPA 3PBTA 4X68A 4UQIS 3C5AA 1CK3A 2QWSA 3VSKA 4UHUA 3QHYA 4Y7PA 1MKIA 4YINA 1IYSA 2Y2QA 4N9LA 1ZHHB 2HDUA 4B4XA 5CEBA 3W4QA 2VA0A 1PZOA 3BLMA 4JF6A 3HLCA 3MXQA 3E0YA 5GL9A 5HX9A 4BD0A 3ZG5A 4Q0IA 3C8CA 1K57C 1OT6A 2Y79A 4UA9A 1VETA 2J7VA 5A8BA 4UA7A 3Q7VB 3A3JA 1JVJA 5CGSA 1PFLA 3MQ0A 3QP2A 3AGDA 4ETXA 4MLLA 4S2PA 3QP6A 3T1QB 1SZVA 1S1ZA 2XA7S 2V0WA 2XLNA 3IQAA 5M19A 1YPRA 2XROA 2A2LA 5HDSA 2V8CA 2UWXA 2Y2PA 3NBLA 1RGZA 3DWKA 3FZCA 3GSGA 2XGNA 5FQIA 4E6XA 5HPFA 3LIEA 5G4ZA 4N92A 1TEMA 3CG5A 5HL1A 1T18A 3KSFA 1FCMA 5HD5A 2Y2MA 3BM6A 2ZQ8A 1E25A 4KG2A 4FOFA 4EESA 2OV5A 1ACFA 3N8SA 2G2UA 2Y91A 3MF0A 3TOIA 1PZPA 1BUEA 3GTCA 3S1YA 2IWBA 5JYOA 4HIAA 2JKRM 3R7WA 3VP0A 4BLMA 3ZG8B 4EBLA 2H5SA 2O9BA 4PMAA 3FV7A 3OOVA 4X53A 4S2NC 4OOYA 2JKFA 2V20A 2Y2JA 1SDNA 3OZHA 5A90A 2WGWB 3LICA 1YKDA 1DP9A 3IWQA 2QMIA 1KDSA 1HVBA 4MNRA 2WKQA 3LEQA 4OLGA 2VZWA 1IKIA 1IYOA 4OOMA 3MXRA 1F9IA 5HAPA 3M2KA 3KYQA 3BFDA 2VV7A 2Z2MB 3PBQA 3ZYTA 1MWSA 4PHTA 2J3WA 3MKFA 4L9FA 4IBXA 4QPRA 1G5UA 5CX7A 1SHVA 1UWPX 4QJGA 4EBPA 1NLZA 4FSFA 2O9AA 4KQQA 3MFXA 1AXBA 3GRJA 4EQIA 5J7EA 3O88A 3E4QA 4OP8A 2ZC7A 4K91A 3N8RA 1TD5A 5FQ9A 3BFCA 4IUHA 2JKGA 3G34A 3CHWP 1ERMA 4EXOA 4N1HA 5TR7A 3WRZA 2JKTM 4ARZA 3JPUA 4IUKA 3PAGA 3A3EA 3U2AA 2VGLM 2GJ3A 1YM1A 1DP6A 3BLSA 3LUQA 2B02A 4RYEA 3GDIA 2XF3A 5E43A 1PNEA 3NOPC 4HP4A 3BQAA 2W1TA 4P85A 4HJ4A 5F5YA 2EFUA 4CPKA 2Y2LA 5GLBA 2VGJA 4MBHA 3U4LP 2J9OA 2HF6A 2B18A 1YLJA 4H8RA 5L07A 5GLDA 2H0TA 1I2WA 5EE8A 1OTBA 2ACGA 1XFNA 4WZ4A 3KSHA 1BT5A 2HP5A 2KX6A 3UE0A 4DE0A 5L09A 1HZOA 3WS0A 4KZ4A 3MQQA 4HH3A 1S4SA 4KZ6A 3OC2A 1WYBA 4U0TA 2LB5A 1ZG6A 4JKTA 3T4KA 4OQGA 5K5BA 4ETZA 3MQOA 1XXMA 3VE4A 2ZMAA 2V1BA 2OOLA 4X1MA 1EW0A 1NYMA 2JC7A 2DCFA 4LPZA 1SKOA 5EM0A 4EUZA 1NZOA 2A24B 4ZDXA 3G2YA 4CLCA 4BENA 4WLAA 4GD8A 4FH4A 4LRYC 4QU3A 1VETB 3PXPA 1ALQA 4OQIA 4UEYA 1QMFA 3V3RA 3T4QA 5F68A 2QPNA 1IOUA 3Q07A 3OPHA 1OT9A 4KUOA 1K55C 4JXSA 4JGRA 5F82A 1FSWA 1IEMA 2R78A 4X25A 4WMCD 1BYWA 2B95A 4ZBEA 2Y8HA 3F1NA 1ZG4A 5E2HA 2G2WA 5CTMA 2R9XA 5EVID 1L2SA 1NYYA 3IBRA 1TS7A 5F1FA 4NEED 4PM8A 3VP1A 2QHKA 1MZUA 1OPXA 3UDXA 2D02A 3VP3A 3Q7VA 3ICYA 2WUQA 4ZJ2A 3FC7A 3CUEA 4K0XA 3R7WB 3V67A 3CAXA 3UPNA 1BZAA 2EX8A 1HD8A 3LO7A 4O0PA 5FQQA 3ITBA 4PM6A 4M4XA 4HESA 1K0KA 5FAOA 4WUJA 3W4PA 5L8MA 2KOIA 2WK0A 2WAFA 3VP4A 3HUMA 4O01A 4Y13A 3N7WA 5EVIC 2EA9A 5CECA 2JKRI 4DDSA 4UAAA 4BBVA 3D4FA 2PD8A 4NXBA 2VEAA 1V9ZA 2XD1A 3L9KA 4I38A 4WEJA 2ZQDA 4C6YA 3RTYA 1PWCA 2WYXA 3V3SA 4MBFA 1YLWA 4B4ZA 3JVVA 4N1XA 4GD6A 1LI0A 1JTGA 1W79A 3HVFA 5CERA 1YMXA 3ZFZA 1BLSA 5IU1A 3O86A 1LL5A 2D01A 2WGWA 1FR6A 3LFVA 4X56A 2M1CA 4KG6A 1YLPA 3BEBA 3T4SA 3TE8A 2W3HA 4JGOA 3EGDC 1F5MA 4BQMA 4Y0TA 3HUNA 4Y0OA 2E8JA 4R23A 2V0UA 1KGGA 3HCYA 1XFQA 4ARZB 1XJ6A 3C30A 1PW1A 3T12B 5EVEA 3NCKA 3NY4A 1H8YA 2KDKA 3WWXA 4C3QA 1H8ZA 3UNWA 3VFHA 2W1TB 5F6AA 1ZC2A 1ESUA 1GA0A 2ZOHA 1S6RA 3RJUA 4MEZA 2J3TD 1VM1A 4JBFA 2Y2IA 1WE4A 4JLFA 2WKEA 4PKYG 2JKTI 1ERQA 1JTDA 1Y4OA 5CTNA 4S2OA 4E3JA 5E2GA 2P04A 1SDEA 5CGWA 1MY8A 1TDGA 2VGKA 3VOLA 3ZCZA 2RCXA 3IHAA 1XJ2A 1ES3A 4WEKA 2XSSA 3ZNTA 3SH8A 5CHJA 2FFFB 1FR1A 1PRQA 2O99A 3VP2A 3N4IA 2LB9A 4R3JA 4XUZA 1NRJA 5HZHA 4KQOA 1SKOB 1W63Q 2ZC5B 3OPLA 4EEPA 3OCNA 2H28A 1KVLA 1H0MA 3K2NA 1T19A 3UMDA 5FASA 1K57A 4HBTA 3IX3A 2CMNA 3SS5A 3HJKA 3A3FA 2J3TC 3MS6A 4HNBA 2PT7A 2V2FF 5EVLA 3MKEA 2W27A 1YSQA 4DF6A 4GN2A 1Y54A 5AQ9A 3VOZA 5HDCA 2MJ6A 1ODVA 1MXOA 3A3IA 1I2SA 5DJUA 3A3DA 2WKRA 1ONGA 2QZ6A 2WAEA 1S67L 4C75A 1JWPA 4Y2FA 3ZQ5A 2EXBA 3B42A 1N9BA 2PRFA 3F1NB 2KLIA 2I9VA 1G6OA 3C7VA 1LSXA 2ZM8A 2A24A 1MPLA 4LGWA 2VK3A 4IJGA 3AGEA 1XPBA 1W5DA 4B9OA 2V9AA 1PI5A 1S1YA 4OLDA 4KZAA 4OONA 3UN7A 4G3VA 1NY0A 3CZDA 2HJ9C 4AFIA 4DE3A 2ZBBA 3AGFA 1W63M 1CI9A 4U3TA 1J3WA 1YLYA 5FDSA 3LIBA 4S2NA 2NUPC 4BL3A 3C2WA 1BLCA 1CEGA 1STZA 1XP4A 1IFQA 4GS9B 1TDLA 4MN6A 1L3LA 3N6IA 3G31A 3MR0A 1NZUA 1IKGA 3VV4A 3V50A 4WN5A 2XQZA 3JVUA 1OJ5A 5F69A 2HDQA 4HP9A 4LV1A 3F1PA 4R70A 3CJMA 1N9NA 1HTZA 1L0EA 1H8MA 1K4EA 1ZTUA 3T4JA 1TS0A 3N8LA 2ZC6B 3P09A 2Q0OA 3NI9A 3HUOA 2W0NA 3G30A 4KQDA 3BY8A 4R38A 2OWHA 1KE0A 4EWFA 2J8YA 2Y4AA 4HI4A 4E3KA 2VGLS 3QP8A 1K38A 4GDBA 3EEHA 4I3AA 4FUWA 4BBUA 2GDNA 4JGQA 1G68A 5IT5A 5KZHA 1CF0A 1LSVA 1Q2PA 1EROA 3HLGA 5AVFA 4PAUA 3UE1A 3HBRA 1H5XA 4OPRA 2WKHA 2EX9A 4E3MA 2P08A 2UV0E 2VX8A 3EEAA 5GHZA 3F1OB 1PWDA 1TS6A 1OTAA 1RP5A 4NXEA 4K08A 2ZOIA 3MSHA 3PR6A 4E3LA 4Z1WA 3UDIA 2WZXA 3ZDJA 2M7VA 4L9GA 5HDDA 3LY4A 3UDFA 2XA7M 1T1CA 4Y3IA 2M7UA 1MWTA 3WS1A 4N9KA 3JYIA 3R4KA 1Z09A 4GDNA 3B3XA 4NETA 1HLUP 3UY6A 2PHYA 3G2ZA 3IX8A 5GHXA 3ISGA 4O8GA 5HFOA 4BD1A 3E98A 1W7FA 4DJ3A 3MZFA 5HPIA 2HP6A 4F3LB 1W8QA 4MCWA 4QD4A 3C7UA 1DY6A 1K25A 3KYZA 2O0YA 3PBOA 2B5RA 2A3UA 4BMWA 2J80A 4PPRA 5FL3A 4ZAMA 2ZM0A 3O87A 4YFMA 1QMEA 3FPVA 3S22A 5FDHA 3IBJA 2XRNA 4X69A 1T1AA 1GSWA 1G28A 3IT9A 1K4FA 3GV9A 2GZAA 3UB6A 5A91A 1XGIA 3UPPA 5DF7A 4RA7A 4HY8A 1L0DA 1K6RA 2K7SA 5GLCA 2EFXA 2OAQ1 4WM9A 4P6ZM 2PYPA 2EX2A 1VEUB 3QP4A 4LV2A 1GHPA 3UB5P 1F98A 5KMWA 4LENA 4GZBA 2JCHA 1K55A 2ZL1A 1FQGA 1K54C 3IHBA 2ZQAA 4MN5A 2ZD8A 1XA1A 3ITAA 1NLYA 4DJ2A 1I5QA 1DJBA 4Z9QA 1DJCA 4LLOB 4HH2A 4ESPA 3RXXA 5FSRA 3BW6A 5M1AA 3IF6C 3LI9A 2J9PA 1KGFA 3BYDA 3A0RA 1GHIA 2HJEA 4RX3A 4LV0A 4KQRA 3BQ8A 4DN0A 4R3AA 3IS2B 5KSCA 1C3BA 1ES2A 3I7JA 4F94A 1YT4A 3DBAA 2FH5A 5DF8A 1TS8A 5FEFA 5HW3A 1E3UD 2ZC3B 3MBZA 5E2EA 3C4PA 3T4LA 4WMCA 1ES4A 1Z6FA 3CPTA 1X0OA 1DJAA 3PBRA 3QNBA 1Q2QA 4XT2A 4Y15A 3IXGA 5AQAA 3UE3A 5EVIA 1MWRA 3F1PB 1OJGA 3H82B 1PI4A 2H10A 4DE2A 1CI8A 1M6KA 2HPBA 4BJPA 4JF5A 4JXWA 3TW8A 4R4SA 1RGYA 3LI8A 3MFDA 1NXYA 4CLCE 1GSVA 3EWKA 2Q9NA 2W1RA 3BFGA 1CEFA 4OPYA 4GS9A 2DNSA 1TF1A 4L9EA 4P0MA 5DVAA 5EV0A 1VQQA 3V5MA 3IXDA 2Z2LB 1FSYA 5AJGA 1N9LA 5DTSA 4ZRRA 3CMZA 4JXGA 4ZTKA 1BULA 2PDRA 4EEUA 3ZVTA 3TG9A 1FOFA 5EPHA 1V9YA 2ZQ7A 1MWUA 1S66L 2GNXA 1GHMA 2PBDP 3EGXC 2Y59A 2W3EA 2L4RA 3DTIA 4KZ5A 4ME4A 5FQJA 4FH2A 2QYBA 3S7PA 1XX2A 4QY5A 4EV4A 4MN7A 1EI5A 3LGOA 3VMAA 4GLQA 2A49A 3F1OA 4I3IA 3GECA 2X71A 5E2FA 3FYZA 3SOIA 3UB8A 1PW8A 4WBGA 1D7EA 3MMHA 4WZ5C 3LCEA 2Z6DA 4DXBA 3VFFA 5L2FA 3FPWA 3EOIA 2W3DA 2G7UA 1M40A 5IS1A 4LFUA 3G35A 3KYEA 4JXVA 1YSPA 3KO6A 1YLTA 2IWDA 1YQSA 5EM1A 4E3OA 3QP5A 4JF4A 3LYXA 3CITA 3ZG9B 3SS3A 3KX0X 5F83A 4E3NA 2FFYA 4EERA 3IWOA 1MBLA 1O07A 3P7NA 2L0WA 4GCZA 5DTTA 5F1GA 4NK3A 4WYYA 2ZL1B 3HLBA 4G3KA 3S7OA 4X1LA 1PIOA 4F3LA 3QNCA 1GCEA 4HEFA 3S7NA 4S2KA 4BBTA 3DWZA 2WKIA 3DAVA 5HAQA 4OPQA 3LR5A 5CGXA 2WADA 3NECA 4IHQA 5GHYA 1J9MA 1N4OA 4RX2A 2ZQCA 4WF0A 1Y28A 2VV6A 1GSXA 4IVKA 2CC1A 3WS5A 1YAXA 4HJ3A 1S4RA 3MJQA 4G3WA 3LR3A 2WKPA 2O9CA 4GB7A 5EOEA 3OPRA 1VEUA 2ZM2A 1P0ZA 3VOYA 2XFTA 4DMZA 5DF9A 4MMNA 1G6AA 4K0WA 3K3CA 1LI9A 4GOGA 3NJAA 3GMWA 4I3JA 1YMSA 2QKPA 5EFWA 3CPTB 2VKSA 1ES5A 3OBFA 1FCOA 3ZG7B 1E4DA 4XT2B 4S2JA 1WYCA 4U0XA 1KDWA 4WELA 4X6TA 2HV1A 4GNUA 4HOIA 2QJ7A 1OTIA 5EVIB 5HWWA 3H7WA 5KIZA 3IX4A 3A0SA 3LY3A 4NKPA 1FIKA 2INWA 3NULA 3PAEA 2ZMFA 2P9VB 2JN7A 2X02A 3E2KA 3SZTA 5FI6A 3D3OA 1MKMA 4YNRA 3P98A 2W3GA 3LIDA 1KE3A 3IS2A 2VLGA 2C5WB 3SS4A 4QY6A 2R9WA 2XH9A 5FAPA 4KZ3A 5L10A 2P7JA 4S2MA 5TFQA 4NXFA 2EWWA 1PYYA 2K31A 1IYQA 5AQBA 1KE4A 1SCWA 3LR0A 4B88A 2Y2NA 4S2IA 5FI2A 5HWVA 2JBFA 4HHDA 2GX5A 3H82A 5DKKA 4HQAA 3O3VA 3D72A 3LR4A 4GKUA 5D3OA 1S0WA 4D2OA 1PWGA 2EX6A
chains in the Genus database with same CATH topology
3UE6A 2OAQ1 3SW1A 4P6ZM 5KSHA 4M4XA 5HL6A 1DP8A 3UMEA 4WUJA 2PYPA 4JGPA 4UQIM 5HD3A 4L0LA 5L8MA 2KOIA 1UWNX 5J3WA 1F98A 5TBMA 3O5YA 1XJ3A 4O01A 5G4YA 4LRXC 3K3DA 3E4OA 3CLOA 4NXGA 4MN5A 2EA9A 4CQHA 2JKRI 4CLCB 4BBVA 5HSQA 1NLYA 2ZMVA 4DJ2A 4R6LA 2YKFA 4EW7A 2PD8A 4EU0A 2QJ5A 4NXBA 4RQ9A 4EUVA 3UB9A 4LLOB 2VEAA 1V9ZA 4I38A 4WEJA 4HH2A 3E4PA 3OLOA 3RTYA 2PR5A 1XJ4A 2YKHA 3B47A 4LRZE 4Q0JA 3BW6A 3JVVA 5J4EA 3EQVA 1OTDA 4P6ZS 3PYPA 2DMWA 3PBTA 3LI9A 3W2ZA 4UQIS 2QWSA 3A0RA 2HJEA 3C38A 3KSGA 5IU1A 2D01A 2VJWA 1ZHHB 3TJZC 3LFVA 3A0VA 2VA0A 2M1CA 3BQ8A 4DN0A 4R3AA 3IS2B 2NUTC 3T4SA 3TE8A 2W3HA 3DBAA 4JGOA 3EGDC 1F5MA 3MXQA 5DKLA 2FH5A 1TS8A 2V0UA 3E0YA 3HCYA 4H6JB 1XFQA 4ARZB 4Q0IA 3LIAA 3C8CA 1XJ6A 3C30A 3FG8A 3T4LA 1OT6A 5DJTA 2Y79A 2KDKA 2K2NA 1X0OA 4OOLA 4GHIA 3PBRA 5A8BA 4XT2A 2W1TB 5F6AA 3RH8B 3EQUA 3MQ0A 3UE3A 2ZOHA 3F1PB 3BY9A 4ETXA 1OJGA 4GW9A 3H82B 1S1ZA 1P9WA 2J3TD 2XA7S 2PR6A 5TJJA 1T1BA 2V0WA 4BJPA 4PKYG 2XROA 2JKTI 3TW8A 2A2LA 1LL8A 5HDSA 2IA2A 1VHMA 2P04A 4BWIA 3LI8A 2HGVA 1NWZA 3VOLA 4CLCE 1GSVA 3CWFA 3EWKA 1XJ2A 4WEKA 2XSSA 3RFBA 2W1RA 3PBNA 5HPFA 3LIEA 5G4ZA 2O99A 4GS9A 1T18A 1TF1A 3KSFA 4L9EA 2LB9A 5HD5A 2BASA 3BWLA 4FOFA 4EESA 5AJGA 2Z6CA 1NRJA 5HZHA 3MF0A 4KQOA 1W63Q 1N9LA 4EEPA 3OCNA 2H28A 4ZRRA 3K2NA 1T19A 4HIAA 3T50A 3UMDA 2JKRM 3R7WA 5C5KA 2PDRA 2CMNA 3HJKA 4EEUA 2O9BA 5I5LA 2J3TC 4HNBA 2PT7A 3OOVA 3T4OA 1V9YA 4HJ6A 2W27A 3LICA 5LBRA 1YSQA 1YKDA 1DP9A 3KSIA 4Q0HA 3H7WB 5HDCA 1S66L 2GNXA 2WKQA 2MJ6A 1ODVA 3EGXC 2W3EA 2L4RA 2VZWA 5DJUA 4CLCD 4ME4A 2WKRA 2QYBA 1S67L 4OOMA 1F9IA 1P9RA 3S7PA 4Y2FA 3ZQ5A 3KYQA 3B42A 3F1NB 2VV7A 4MN7A 2KLIA 5HWTA 3PBQA 5DFYA 2I9VA 3ZYTA 1G6OA 3H9WA 1LSXA 4PHTA 4GLQA 2J3WA 2W3FA 4L9FA 2A24A 3F1OA 4I3IA 4QPRA 5CX7A 3GECA 2EWVA 1UWPX 1NLZA 4IJGA 4FSFA 3UB8A 2O9AA 4B9OA 1D7EA 1N9OA 3MMHA 4YOFA 2V9AA 3MFXA 2Z6DA 1S1YA 4MDZA 3FPWA 3EOIA 5DFXA 4I39A 2W3DA 5J7EA 2G7UA 4G3VA 4EETB 3B33A 1LT0A 3E4QA 5IS1A 2HJ9C 1TD5A 4AFIA 3UB7A 1YSPA 3KO6A 4B93A 3OCLA 4IUHA 2ZBBA 1W63M 3NOTC 4GJ4A 3HJIA 3T4TA 4EXOA 3LYXA 3LIBA 3CITA 2NUPC 2JKTM 3C2WA 4ARZA 4IUKA 4CLCC 1STZA 1IFQA 4GS9B 2V1AA 3KX0X 3U2AA 3NHQA 2VGLM 2GJ3A 4MN6A 2VV8A 3PBSA 1DP6A 3LUQA 2B02A 4EERA 3MR0A 3GDIA 3P7NA 4GCZA 2L0WA 3NOPC 4HP4A 5TBMB 3VV4A 4E04A 3BQAA 2W1TA 4G3KA 3S7OA 4WN5A 4Y5FA 4F3LA 3JVUA 1OJ5A 5F69A 4HJ4A 5F5YA 4HP9A 3F1PA 4R70A 3S7NA 1JNUA 1N9NA 4BBTA 1H8MA 2HF6A 2B18A 1ZTUA 3T4JA 1TS0A 1UGUA 3LR5A 1OTBA 2W0NA 4KQDA 1XFNA 4IHQA 3BY8A 4R38A 2OWHA 3KSHA 2KX6A 2PD7A 4WF0A 1Y28A 3NOUC 4HI4A 3MQQA 4HH3A 1MC0A 2VGLS 2VV6A 1GSXA 1S4SA 3OC2A 3EEHA 2LB5A 3T4KA 4I3AA 5K5BA 4BBUA 4JGQA 3MQOA 4ETZA 3VE4A 4PKYA 4WL9A 1YAXA 5IT5A 4HJ3A 1S4RA 3MJQA 4G3WA 3LR3A 2WKPA 2O9CA 2V1BA 1LSVA 1WA9A 2OOLA 1EW0A 4DMZA 1P0ZA 5AVFA 4PAUA 5DF9A 4MMNA 1KOUA 1H3QA 3BJNA 4LPZA 3K3CA 2P08A 2VX8A 3EEAA 4YWZA 3NJAA 2A24B 3F1OB 4I3JA 3CUEC 4CLCA 1TS6A 2QKPA 5EFWA 4WLAA 1OTAA 4EQ1A 4LRYC 2VKSA 3OBFA 4NXEA 4GHIB 4K08A 3PXPA 2ZOIA 3PR6A 4Z1WA 4XT2B 4UEYA 3T4QA 3VE3A 4WELA 2HV1A 2M7VA 4HOIA 2QJ7A 4L9GA 3P01A 5HDDA 1OTIA 5HWWA 2XA7M 5F68A 2PYRA 3H7WA 5KIZA 1IOUA 1T1CA 3A0SA 4Y3IA 2OAP1 5AVEA 2M7UA 4NKPA 2INWA 1OT9A 3R4KA 2ZMFA 4KUOA 2JN7A 4JGRA 2FZ0A 2R78A 3D3OA 2PHYA 1MKMA 2L1MA 4YNRA 5MC7A 1BYWA 3G6OA 2W3GA 1DRMA 3LIDA 2Y8HA 3CI6A 2VLGA 3IS2A 4O8GA 3F1NA 4II7A 1OTEA 3LIFA 3E98A 2JHEA 4I5SA 1D06A 4DJ3A 4H6JA 3IBRA 5HPIA 4F3LB 4MCWA 1TS7A 3PHYA 4NEED 2P7JA 3KYZA 2O0YA 2QHKA 3PBOA 1MZUA 4NXFA 4BMWA 1OPXA 2D02A 2EWWA 2J80A 2K31A 5FL3A 1VB6A 3ICYA 2OWJA 3LR0A 3FPVA 1LSWA 5HWVA 1P97A 3FC7A 3CUEA 4HHDA 2GX5A 3H82A 5DKKA 4HQAA 3R7WB 3V67A 3IBJA 3S7QA 2XRNA 3CAXA 3D72A 3LR4A 1T1AA 4KUKA 1GSWA 1G28A 2GZAA 3UB6A 3ULFA 4O0PA 4HY8A 3TRCA 2K7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UE6 A;  3SW1 A;  4M4X A;  1DP8 A;  3UME A;  4WUJ A;  2PYP A;  4JGP A;  5HD3 A;  5J3W A;  1UWN X;  1F98 A;  5TBM A;  1XJ3 A;  5G4Y A;  4LRX C;  3K3D A;  3E4O A;  3CLO A;  4NXG A;  4MN5 A;  2EA9 A;  4BBV A;  5HSQ A;  4DJ2 A;  4R6L A;  2YKF A;  4EW7 A;  2PD8 A;  2QJ5 A;  4NXB A;  4RQ9 A;  3UB9 A;  4LLO B;  2VEA A;  1V9Z A;  4I38 A;  4HH2 A;  3E4P A;  3OLO A;  3RTY A;  2PR5 A;  1XJ4 A;  2YKH A;  4LRZ E;  5J4E A;  1OTD A;  3PYP A;  3LI9 A;  2QWS A;  3A0R A;  5IU1 A;  2D01 A;  3A0V A;  2M1C A;  4R3A A;  3IS2 B;  4JGO A;  3MXQ A;  5DKL A;  1TS8 A;  2V0U A;  4H6J B;  1XFQ A;  3LIA A;  3C8C A;  1XJ6 A;  3FG8 A;  1OT6 A;  5DJT A;  2KDK A;  1X0O A;  4GHI A;  5A8B A;  4XT2 A;  5F6A A;  3RH8 B;  2ZOH A;  3F1P B;  3BY9 A;  1OJG A;  4GW9 A;  3H82 B;  1S1Z A;  2PR6 A;  1T1B A;  2V0W A;  4PKY G;  1LL8 A;  5HDS A;  3LI8 A;  1NWZ A;  3VOL A;  1GSV A;  3CWF A;  3EWK A;  1XJ2 A;  3LIE A;  5G4Z A;  4GS9 A;  1T18 A;  5HD5 A;  4L9E A;  2BAS A;  3BWL A;  4EES A;  2Z6C A;  5HZH A;  1N9L A;  4EEP A;  2H28 A;  4HIA A;  1T19 A;  3T50 A;  3UMD A;  2PDR A;  2CMN A;  3HJK A;  4EEU A;  5I5L A;  4HNB A;  1V9Y A;  4HJ6 A;  2W27 A;  3LIC A;  1DP9 A;  3H7W B;  5HDC A;  1S66 L;  2WKQ A;  1ODV A;  2L4R A;  5DJU A;  2WKR A;  1S67 L;  1F9I A;  3ZQ5 A;  3F1N B;  2VV7 A;  5HWT A;  2I9V A;  3H9W A;  1LSX A;  4L9F A;  2A24 A;  3F1O A;  4I3I A;  3GEC A;  1UWP X;  3UB8 A;  4B9O A;  1D7E A;  1N9O A;  2V9A A;  3MFX A;  2Z6D A;  1S1Y A;  5J7E A;  4I39 A;  4EET B;  3B33 A;  1LT0 A;  3E4Q A;  5IS1 A;  3UB7 A;  2ZBB A;  3NOT C;  3HJI A;  4EXO A;  3LYX A;  3LIB A;  3C2W A;  4GS9 B;  2V1A A;  3KX0 X;  3NHQ A;  2GJ3 A;  4MN6 A;  2VV8 A;  1DP6 A;  3LUQ A;  2B02 A;  4EER A;  3MR0 A;  3GDI A;  3P7N A;  4GCZ A;  2L0W A;  3NOP C;  4HP4 A;  5TBM B;  4E04 A;  4WN5 A;  4F3L A;  1OJ5 A;  5F69 A;  4HJ4 A;  5F5Y A;  4HP9 A;  3F1P A;  4R70 A;  1JNU A;  1N9N A;  4BBT A;  1TS0 A;  1UGU A;  1OTB A;  2W0N A;  4KQD A;  1XFN A;  3BY8 A;  4R38 A;  2OWH A;  2KX6 A;  2PD7 A;  4WF0 A;  1Y28 A;  3NOU C;  4HI4 A;  3MQQ A;  4HH3 A;  2VV6 A;  1GSX A;  1S4S A;  3EEH A;  4I3A A;  4BBU A;  4JGQ A;  3MQO A;  3VE4 A;  4PKY A;  4WL9 A;  4HJ3 A;  1S4R A;  3MJQ A;  2WKP A;  2V1B A;  1LSV A;  1WA9 A;  2OOL A;  1EW0 A;  1P0Z A;  5AVF A;  1KOU A;  4LPZ A;  3K3C A;  4YWZ A;  3NJA A;  2A24 B;  3F1O B;  4I3J A;  1TS6 A;  2QKP A;  5EFW A;  4WLA A;  1OTA A;  4EQ1 A;  4LRY C;  4NXE A;  4GHI B;  4K08 A;  2ZOI A;  4XT2 B;  3VE3 A;  2HV1 A;  4HOI A;  2QJ7 A;  4L9G A;  5HDD A;  1OTI A;  5HWW A;  5F68 A;  2PYR A;  3H7W A;  5KIZ A;  1T1C A;  3A0S A;  5AVE A;  2INW A;  1OT9 A;  4KUO A;  2JN7 A;  4JGR A;  2R78 A;  2PHY A;  2L1M A;  1BYW A;  3G6O A;  1DRM A;  3LID A;  3IS2 A;  2VLG A;  3F1N A;  1OTE A;  3LIF A;  2JHE A;  4I5S A;  1D06 A;  4DJ3 A;  4H6J A;  3IBR A;  4F3L B;  1TS7 A;  3PHY A;  2P7J A;  2QHK A;  1MZU A;  4NXF A;  2D02 A;  2J80 A;  1VB6 A;  3ICY A;  2OWJ A;  1LSW A;  5HWV A;  1P97 A;  3FC7 A;  4HHD A;  5DKK A;  3H82 A;  4HQA A;  3CAX A;  3D72 A;  1T1A A;  4KUK A;  1GSW A;  1G28 A;  3UB6 A;  3ULF A;  4HY8 A;  2K7S A; 
#chains in the Genus database with same CATH topology
 3UE6 A;  3SW1 A;  5KSH A;  1DP8 A;  4UQI M;  5HD3 A;  4HBU A;  2Y2O A;  3LEZ A;  1XKZ A;  5TBM A;  2Y2G A;  2WGV A;  5G4Y A;  3K3D A;  4KEN B;  2BLS A;  3CLO A;  4CQH A;  2Y2K A;  2ZMV A;  2YKF A;  4EW7 A;  5HAR A;  2X01 A;  4EU0 A;  2QJ5 A;  4EUV A;  3UB9 A;  1W8Y A;  2XR0 A;  3D9Y A;  3E4P A;  3OLO A;  5FQM A;  3HLE A;  1XJ4 A;  2YKH A;  3B47 A;  4LRZ E;  4E6W A;  3FKW A;  2XK1 A;  3EQV A;  1OTD A;  4P6Z S;  2DMW A;  3W2Z A;  4DE1 A;  3M6B A;  3C38 A;  3KSG A;  1SKF A;  2XEP A;  2VJW A;  3TJZ C;  3A0V A;  5A92 A;  3ZG0 A;  2NUT C;  4PM7 A;  2OLU A;  3DTE A;  5DKL A;  3SH9 A;  5BOH A;  3NIA A;  3QP1 A;  3GR2 A;  4H6J B;  2WZZ A;  3RXW A;  3LIA A;  4R4R A;  3FG8 A;  2ZJ9 A;  3ZNY A;  5DJT A;  4KZ8 A;  2HDS A;  2K2N A;  4OOL A;  2BTF P;  4GHI A;  3FWL A;  5IHV A;  2HZ5 A;  1K54 A;  3RH8 B;  3EQU A;  3ZVW A;  3BY9 A;  4GW9 A;  2XFS A;  4IED A;  1P9W A;  5FA7 A;  3T1S A;  2PR6 A;  5TJJ A;  1EWZ A;  1T1B A;  4OP5 A;  4NG2 A;  1U60 A;  1LL8 A;  2IA2 A;  1VHM A;  5CXW A;  4BWI A;  2ZLY A;  1K56 D;  3BFE A;  4IBR A;  3T1R A;  2HGV A;  3IF6 A;  1NWZ A;  3CWF A;  4R1G A;  1K56 A;  3NC8 A;  1GA9 A;  4DXC A;  3RFB A;  3PBN A;  3DTK A;  4QHC A;  5EOO A;  4BL2 A;  2Y55 A;  3HLD A;  2AVX A;  2BAS A;  2ZC4 B;  1ONH A;  3BWL A;  3TSG A;  1KVM A;  3SH7 A;  2Z6C A;  4LCM A;  1LL9 A;  4JPM A;  1ESI A;  4A5R A;  4KG5 A;  2XDM A;  3T50 A;  5CHU A;  5C5K A;  3UPO A;  5J8X A;  5EEC A;  1CQA A;  5I5L A;  4XXR A;  1BLH A;  1IYP A;  3T4O A;  4HJ6 A;  5LBR A;  1JWV A;  4O7D A;  4UA6 A;  3Q1F A;  1NJ4 A;  3KSI A;  4Q0H A;  3H7W B;  2IWC A;  4EBN A;  3M6H A;  1K6S A;  4CLC D;  2JE5 A;  3IH8 A;  5CHM A;  1P9R A;  5FAQ A;  3HRE A;  2H0Y A;  4QB8 A;  1BTL A;  5HWT A;  5DFY A;  2EXA A;  4DRT A;  3H9W A;  1FCN A;  3VSL A;  1XA7 A;  2W3F A;  2EWV A;  4XUX A;  1E3U A;  1IEL A;  3PTE A;  4R3B A;  1N9O A;  2RL3 A;  2I72 A;  4YOF A;  1JWZ A;  5FAT A;  4MDZ A;  2V1Z A;  4PM9 A;  5DFX A;  4I39 A;  4P6B A;  4EET B;  2C6W B;  3B33 A;  5FEG A;  1LT0 A;  3W4O A;  4S2L A;  3IWI A;  3WS2 A;  3UB7 A;  4KZ7 A;  4B93 A;  3OCL A;  5FQK A;  3ZGA B;  2PAV P;  3NOT C;  4GJ4 A;  5AQ7 A;  2P9V A;  3HJI A;  3IXH A;  3T4T A;  4Y0U A;  4OVD A;  1TVF A;  3E2L A;  4CLC C;  3DTM A;  5M18 A;  4QWO A;  2V1A A;  3NHQ A;  2VV8 A;  3ZHH A;  3PBS A;  1NRF A;  1D1J A;  2BG1 A;  5TBM B;  4E04 A;  4Y5F A;  3UO9 A;  4ID4 A;  5HAI A;  4CJN A;  3DW0 A;  1JNU A;  1O7E A;  3OPP A;  3T1X A;  2ZQ9 A;  1UGU A;  3BRM A;  2E8I A;  4E3I A;  2PD7 A;  5I94 A;  3G4P A;  3NOU C;  1MC0 A;  2Y2H A;  4WZ5 A;  3MZD A;  4ZJ3 A;  2PU2 A;  3IF5 A;  1LHY A;  4PKY A;  4WL9 A;  1WA9 A;  4Q8I A;  4OKP A;  2OSU A;  3NDE A;  1KOU A;  1H3Q A;  2PU4 A;  3BJN A;  1L0F A;  1KGE A;  2XD5 A;  4YWZ A;  1AWI A;  3CUE C;  4M3K A;  5FI7 A;  4EQ1 A;  4GHI B;  3V39 A;  4KZB A;  2V8F A;  4Y17 A;  1OME A;  3W8K A;  3VE3 A;  5A93 A;  3P01 A;  1BLP A;  2P74 A;  3GVB A;  3MXS A;  4LCL A;  4OQ0 A;  2PYR A;  4FTX A;  2OAP 1;  2HP9 A;  5AVE A;  1A0K A;  5CED A;  1F2K A;  1XGJ A;  3Q7Z A;  3Q81 A;  5U47 A;  4OQH A;  2WGI A;  1CJF A;  2FZ0 A;  5JYP A;  3GQZ A;  3MZE A;  2L1M A;  5MC7 A;  3G6O A;  1DRM A;  5TGF A;  3CI6 A;  1BSG A;  3IF6 B;  5G18 A;  4II7 A;  1OTE A;  4DKI A;  3LIF A;  2JHE A;  4I5S A;  1D06 A;  2OLV A;  3HLF A;  4H6J A;  3NDG A;  4MBK A;  3WS4 A;  3PHY A;  4DDY A;  3L7H A;  1L0G A;  4P87 A;  3FKV A;  4D60 A;  4OH0 A;  1FIL A;  1VB6 A;  4FCF A;  4KZ9 A;  4R0Q A;  3HLW A;  2OWJ A;  3HL9 A;  5DTK A;  1LSW A;  4ZJ1 A;  1P97 A;  4OPZ A;  3BFF A;  3S7Q A;  3S4X A;  4KUK A;  3BEC A;  4IVI A;  3ULF A;  1LLB A;  3TRC A;  4PM5 A;  4LV3 A;  5HL6 A;  3UME A;  3IXB A;  4JGP A;  3C4O A;  4L0L A;  3Q82 A;  5J3W A;  1UWN X;  1ZKJ A;  1RCJ A;  2HDR A;  3O5Y A;  1XJ3 A;  3M2J A;  4LRX C;  3E4O A;  5GLA A;  5EUA A;  4NXG A;  3WRT A;  4CLC B;  5HSQ A;  3IH9 A;  4FD8 A;  5CRF A;  4R6L A;  2DRW A;  4RQ9 A;  1YLZ A;  2PR5 A;  4X55 A;  4Q0J A;  2PBY A;  4RVA A;  5J4E A;  2Q9M A;  3G32 A;  3PYP A;  3PBT A;  4X68 A;  4UQI S;  3C5A A;  1CK3 A;  2QWS A;  3VSK A;  4UHU A;  3QHY A;  4Y7P A;  1MKI A;  4YIN A;  1IYS A;  2Y2Q A;  4N9L A;  1ZHH B;  2HDU A;  4B4X A;  5CEB A;  3W4Q A;  2VA0 A;  1PZO A;  3BLM A;  4JF6 A;  3HLC A;  3MXQ A;  3E0Y A;  5GL9 A;  5HX9 A;  4BD0 A;  3ZG5 A;  4Q0I A;  3C8C A;  1K57 C;  1OT6 A;  2Y79 A;  4UA9 A;  1VET A;  2J7V A;  5A8B A;  4UA7 A;  3Q7V B;  3A3J A;  1JVJ A;  5CGS A;  1PFL A;  3MQ0 A;  3QP2 A;  3AGD A;  4ETX A;  4MLL A;  4S2P A;  3QP6 A;  3T1Q B;  1SZV A;  1S1Z A;  2XA7 S;  2V0W A;  2XLN A;  3IQA A;  5M19 A;  1YPR A;  2XRO A;  2A2L A;  5HDS A;  2V8C A;  2UWX A;  2Y2P A;  3NBL A;  1RGZ A;  3DWK A;  3FZC A;  3GSG A;  2XGN A;  5FQI A;  4E6X A;  5HPF A;  3LIE A;  5G4Z A;  4N92 A;  1TEM A;  3CG5 A;  5HL1 A;  1T18 A;  3KSF A;  1FCM A;  5HD5 A;  2Y2M A;  3BM6 A;  2ZQ8 A;  1E25 A;  4KG2 A;  4FOF A;  4EES A;  2OV5 A;  1ACF A;  3N8S A;  2G2U A;  2Y91 A;  3MF0 A;  3TOI A;  1PZP A;  1BUE A;  3GTC A;  3S1Y A;  2IWB A;  5JYO A;  4HIA A;  2JKR M;  3R7W A;  3VP0 A;  4BLM A;  3ZG8 B;  4EBL A;  2H5S A;  2O9B A;  4PMA A;  3FV7 A;  3OOV A;  4X53 A;  4S2N C;  4OOY A;  2JKF A;  2V20 A;  2Y2J A;  1SDN A;  3OZH A;  5A90 A;  2WGW B;  3LIC A;  1YKD A;  1DP9 A;  3IWQ A;  2QMI A;  1KDS A;  1HVB A;  4MNR A;  2WKQ A;  3LEQ A;  4OLG A;  2VZW A;  1IKI A;  1IYO A;  4OOM A;  3MXR A;  1F9I A;  5HAP A;  3M2K A;  3KYQ A;  3BFD A;  2VV7 A;  2Z2M B;  3PBQ A;  3ZYT A;  1MWS A;  4PHT A;  2J3W A;  3MKF A;  4L9F A;  4IBX A;  4QPR A;  1G5U A;  5CX7 A;  1SHV A;  1UWP X;  4QJG A;  4EBP A;  1NLZ A;  4FSF A;  2O9A A;  4KQQ A;  3MFX A;  1AXB A;  3GRJ A;  4EQI A;  5J7E A;  3O88 A;  3E4Q A;  4OP8 A;  2ZC7 A;  4K91 A;  3N8R A;  1TD5 A;  5FQ9 A;  3BFC A;  4IUH A;  2JKG A;  3G34 A;  3CHW P;  1ERM A;  4EXO A;  4N1H A;  5TR7 A;  3WRZ A;  2JKT M;  4ARZ A;  3JPU A;  4IUK A;  3PAG A;  3A3E A;  3U2A A;  2VGL M;  2GJ3 A;  1YM1 A;  1DP6 A;  3BLS A;  3LUQ A;  2B02 A;  4RYE A;  3GDI A;  2XF3 A;  5E43 A;  1PNE A;  3NOP C;  4HP4 A;  3BQA A;  2W1T A;  4P85 A;  4HJ4 A;  5F5Y A;  2EFU A;  4CPK A;  2Y2L A;  5GLB A;  2VGJ A;  4MBH A;  3U4L P;  2J9O A;  2HF6 A;  2B18 A;  1YLJ A;  4H8R A;  5L07 A;  5GLD A;  2H0T A;  1I2W A;  5EE8 A;  1OTB A;  2ACG A;  1XFN A;  4WZ4 A;  3KSH A;  1BT5 A;  2HP5 A;  2KX6 A;  3UE0 A;  4DE0 A;  5L09 A;  1HZO A;  3WS0 A;  4KZ4 A;  3MQQ A;  4HH3 A;  1S4S A;  4KZ6 A;  3OC2 A;  1WYB A;  4U0T A;  2LB5 A;  1ZG6 A;  4JKT A;  3T4K A;  4OQG A;  5K5B A;  4ETZ A;  3MQO A;  1XXM A;  3VE4 A;  2ZMA A;  2V1B A;  2OOL A;  4X1M A;  1EW0 A;  1NYM A;  2JC7 A;  2DCF A;  4LPZ A;  1SKO A;  5EM0 A;  4EUZ A;  1NZO A;  2A24 B;  4ZDX A;  3G2Y A;  4CLC A;  4BEN A;  4WLA A;  4GD8 A;  4FH4 A;  4LRY C;  4QU3 A;  1VET B;  3PXP A;  1ALQ A;  4OQI A;  4UEY A;  1QMF A;  3V3R A;  3T4Q A;  5F68 A;  2QPN A;  1IOU A;  3Q07 A;  3OPH A;  1OT9 A;  4KUO A;  1K55 C;  4JXS A;  4JGR A;  5F82 A;  1FSW A;  1IEM A;  2R78 A;  4X25 A;  4WMC D;  1BYW A;  2B95 A;  4ZBE A;  2Y8H A;  3F1N A;  1ZG4 A;  5E2H A;  2G2W A;  5CTM A;  2R9X A;  5EVI D;  1L2S A;  1NYY A;  3IBR A;  1TS7 A;  5F1F A;  4NEE D;  4PM8 A;  3VP1 A;  2QHK A;  1MZU A;  1OPX A;  3UDX A;  2D02 A;  3VP3 A;  3Q7V A;  3ICY A;  2WUQ A;  4ZJ2 A;  3FC7 A;  3CUE A;  4K0X A;  3R7W B;  3V67 A;  3CAX A;  3UPN A;  1BZA A;  2EX8 A;  1HD8 A;  3LO7 A;  4O0P A;  5FQQ A;  3ITB A;  4PM6 A;  4M4X A;  4HES A;  1K0K A;  5FAO A;  4WUJ A;  3W4P A;  5L8M A;  2KOI A;  2WK0 A;  2WAF A;  3VP4 A;  3HUM A;  4O01 A;  4Y13 A;  3N7W A;  5EVI C;  2EA9 A;  5CEC A;  2JKR I;  4DDS A;  4UAA A;  4BBV A;  3D4F A;  2PD8 A;  4NXB A;  2VEA A;  1V9Z A;  2XD1 A;  3L9K A;  4I38 A;  4WEJ A;  2ZQD A;  4C6Y A;  3RTY A;  1PWC A;  2WYX A;  3V3S A;  4MBF A;  1YLW A;  4B4Z A;  3JVV A;  4N1X A;  4GD6 A;  1LI0 A;  1JTG A;  1W79 A;  3HVF A;  5CER A;  1YMX A;  3ZFZ A;  1BLS A;  5IU1 A;  3O86 A;  1LL5 A;  2D01 A;  2WGW A;  1FR6 A;  3LFV A;  4X56 A;  2M1C A;  4KG6 A;  1YLP A;  3BEB A;  3T4S A;  3TE8 A;  2W3H A;  4JGO A;  3EGD C;  1F5M A;  4BQM A;  4Y0T A;  3HUN A;  4Y0O A;  2E8J A;  4R23 A;  2V0U A;  1KGG A;  3HCY A;  1XFQ A;  4ARZ B;  1XJ6 A;  3C30 A;  1PW1 A;  3T12 B;  5EVE A;  3NCK A;  3NY4 A;  1H8Y A;  2KDK A;  3WWX A;  4C3Q A;  1H8Z A;  3UNW A;  3VFH A;  2W1T B;  5F6A A;  1ZC2 A;  1ESU A;  1GA0 A;  2ZOH A;  1S6R A;  3RJU A;  4MEZ A;  2J3T D;  1VM1 A;  4JBF A;  2Y2I A;  1WE4 A;  4JLF A;  2WKE A;  4PKY G;  2JKT I;  1ERQ A;  1JTD A;  1Y4O A;  5CTN A;  4S2O A;  4E3J A;  5E2G A;  2P04 A;  1SDE A;  5CGW A;  1MY8 A;  1TDG A;  2VGK A;  3VOL A;  3ZCZ A;  2RCX A;  3IHA A;  1XJ2 A;  1ES3 A;  4WEK A;  2XSS A;  3ZNT A;  3SH8 A;  5CHJ A;  2FFF B;  1FR1 A;  1PRQ A;  2O99 A;  3VP2 A;  3N4I A;  2LB9 A;  4R3J A;  4XUZ A;  1NRJ A;  5HZH A;  4KQO A;  1SKO B;  1W63 Q;  2ZC5 B;  3OPL A;  4EEP A;  3OCN A;  2H28 A;  1KVL A;  1H0M A;  3K2N A;  1T19 A;  3UMD A;  5FAS A;  1K57 A;  4HBT A;  3IX3 A;  2CMN A;  3SS5 A;  3HJK A;  3A3F A;  2J3T C;  3MS6 A;  4HNB A;  2PT7 A;  2V2F F;  5EVL A;  3MKE A;  2W27 A;  1YSQ A;  4DF6 A;  4GN2 A;  1Y54 A;  5AQ9 A;  3VOZ A;  5HDC A;  2MJ6 A;  1ODV A;  1MXO A;  3A3I A;  1I2S A;  5DJU A;  3A3D A;  2WKR A;  1ONG A;  2QZ6 A;  2WAE A;  1S67 L;  4C75 A;  1JWP A;  4Y2F A;  3ZQ5 A;  2EXB A;  3B42 A;  1N9B A;  2PRF A;  3F1N B;  2KLI A;  2I9V A;  1G6O A;  3C7V A;  1LSX A;  2ZM8 A;  2A24 A;  1MPL A;  4LGW A;  2VK3 A;  4IJG A;  3AGE A;  1XPB A;  1W5D A;  4B9O A;  2V9A A;  1PI5 A;  1S1Y A;  4OLD A;  4KZA A;  4OON A;  3UN7 A;  4G3V A;  1NY0 A;  3CZD A;  2HJ9 C;  4AFI A;  4DE3 A;  2ZBB A;  3AGF A;  1W63 M;  1CI9 A;  4U3T A;  1J3W A;  1YLY A;  5FDS A;  3LIB A;  4S2N A;  2NUP C;  4BL3 A;  3C2W A;  1BLC A;  1CEG A;  1STZ A;  1XP4 A;  1IFQ A;  4GS9 B;  1TDL A;  4MN6 A;  1L3L A;  3N6I A;  3G31 A;  3MR0 A;  1NZU A;  1IKG A;  3VV4 A;  3V50 A;  4WN5 A;  2XQZ A;  3JVU A;  1OJ5 A;  5F69 A;  2HDQ A;  4HP9 A;  4LV1 A;  3F1P A;  4R70 A;  3CJM A;  1N9N A;  1HTZ A;  1L0E A;  1H8M A;  1K4E A;  1ZTU A;  3T4J A;  1TS0 A;  3N8L A;  2ZC6 B;  3P09 A;  2Q0O A;  3NI9 A;  3HUO A;  2W0N A;  3G30 A;  4KQD A;  3BY8 A;  4R38 A;  2OWH A;  1KE0 A;  4EWF A;  2J8Y A;  2Y4A A;  4HI4 A;  4E3K A;  2VGL S;  3QP8 A;  1K38 A;  4GDB A;  3EEH A;  4I3A A;  4FUW A;  4BBU A;  2GDN A;  4JGQ A;  1G68 A;  5IT5 A;  5KZH A;  1CF0 A;  1LSV A;  1Q2P A;  1ERO A;  3HLG A;  5AVF A;  4PAU A;  3UE1 A;  3HBR A;  1H5X A;  4OPR A;  2WKH A;  2EX9 A;  4E3M A;  2P08 A;  2UV0 E;  2VX8 A;  3EEA A;  5GHZ A;  3F1O B;  1PWD A;  1TS6 A;  1OTA A;  1RP5 A;  4NXE A;  4K08 A;  2ZOI A;  3MSH A;  3PR6 A;  4E3L A;  4Z1W A;  3UDI A;  2WZX A;  3ZDJ A;  2M7V A;  4L9G A;  5HDD A;  3LY4 A;  3UDF A;  2XA7 M;  1T1C A;  4Y3I A;  2M7U A;  1MWT A;  3WS1 A;  4N9K A;  3JYI A;  3R4K A;  1Z09 A;  4GDN A;  3B3X A;  4NET A;  1HLU P;  3UY6 A;  2PHY A;  3G2Z A;  3IX8 A;  5GHX A;  3ISG A;  4O8G A;  5HFO A;  4BD1 A;  3E98 A;  1W7F A;  4DJ3 A;  3MZF A;  5HPI A;  2HP6 A;  4F3L B;  1W8Q A;  4MCW A;  4QD4 A;  3C7U A;  1DY6 A;  1K25 A;  3KYZ A;  2O0Y A;  3PBO A;  2B5R A;  2A3U A;  4BMW A;  2J80 A;  4PPR A;  5FL3 A;  4ZAM A;  2ZM0 A;  3O87 A;  4YFM A;  1QME A;  3FPV A;  3S22 A;  5FDH A;  3IBJ A;  2XRN A;  4X69 A;  1T1A A;  1GSW A;  1G28 A;  3IT9 A;  1K4F A;  3GV9 A;  2GZA A;  3UB6 A;  5A91 A;  1XGI A;  3UPP A;  5DF7 A;  4RA7 A;  4HY8 A;  1L0D A;  1K6R A;  2K7S A;  5GLC A;  2EFX A;  2OAQ 1;  4WM9 A;  4P6Z M;  2PYP A;  2EX2 A;  1VEU B;  3QP4 A;  4LV2 A;  1GHP A;  3UB5 P;  1F98 A;  5KMW A;  4LEN A;  4GZB A;  2JCH A;  1K55 A;  2ZL1 A;  1FQG A;  1K54 C;  3IHB A;  2ZQA A;  4MN5 A;  2ZD8 A;  1XA1 A;  3ITA A;  1NLY A;  4DJ2 A;  1I5Q A;  1DJB A;  4Z9Q A;  1DJC A;  4LLO B;  4HH2 A;  4ESP A;  3RXX A;  5FSR A;  3BW6 A;  5M1A A;  3IF6 C;  3LI9 A;  2J9P A;  1KGF A;  3BYD A;  3A0R A;  1GHI A;  2HJE A;  4RX3 A;  4LV0 A;  4KQR A;  3BQ8 A;  4DN0 A;  4R3A A;  3IS2 B;  5KSC A;  1C3B A;  1ES2 A;  3I7J A;  4F94 A;  1YT4 A;  3DBA A;  2FH5 A;  5DF8 A;  1TS8 A;  5FEF A;  5HW3 A;  1E3U D;  2ZC3 B;  3MBZ A;  5E2E A;  3C4P A;  3T4L A;  4WMC A;  1ES4 A;  1Z6F A;  3CPT A;  1X0O A;  1DJA A;  3PBR A;  3QNB A;  1Q2Q A;  4XT2 A;  4Y15 A;  3IXG A;  5AQA A;  3UE3 A;  5EVI A;  1MWR A;  3F1P B;  1OJG A;  3H82 B;  1PI4 A;  2H10 A;  4DE2 A;  1CI8 A;  1M6K A;  2HPB A;  4BJP A;  4JF5 A;  4JXW A;  3TW8 A;  4R4S A;  1RGY A;  3LI8 A;  3MFD A;  1NXY A;  4CLC E;  1GSV A;  3EWK A;  2Q9N A;  2W1R A;  3BFG A;  1CEF A;  4OPY A;  4GS9 A;  2DNS A;  1TF1 A;  4L9E A;  4P0M A;  5DVA A;  5EV0 A;  1VQQ A;  3V5M A;  3IXD A;  2Z2L B;  1FSY A;  5AJG A;  1N9L A;  5DTS A;  4ZRR A;  3CMZ A;  4JXG A;  4ZTK A;  1BUL A;  2PDR A;  4EEU A;  3ZVT A;  3TG9 A;  1FOF A;  5EPH A;  1V9Y A;  2ZQ7 A;  1MWU A;  1S66 L;  2GNX A;  1GHM A;  2PBD P;  3EGX C;  2Y59 A;  2W3E A;  2L4R A;  3DTI A;  4KZ5 A;  4ME4 A;  5FQJ A;  4FH2 A;  2QYB A;  3S7P A;  1XX2 A;  4QY5 A;  4EV4 A;  4MN7 A;  1EI5 A;  3LGO A;  3VMA A;  4GLQ A;  2A49 A;  3F1O A;  4I3I A;  3GEC A;  2X71 A;  5E2F A;  3FYZ A;  3SOI A;  3UB8 A;  1PW8 A;  4WBG A;  1D7E A;  3MMH A;  4WZ5 C;  3LCE A;  2Z6D A;  4DXB A;  3VFF A;  5L2F A;  3FPW A;  3EOI A;  2W3D A;  2G7U A;  1M40 A;  5IS1 A;  4LFU A;  3G35 A;  3KYE A;  4JXV A;  1YSP A;  3KO6 A;  1YLT A;  2IWD A;  1YQS A;  5EM1 A;  4E3O A;  3QP5 A;  4JF4 A;  3LYX A;  3CIT A;  3ZG9 B;  3SS3 A;  3KX0 X;  5F83 A;  4E3N A;  2FFY A;  4EER A;  3IWO A;  1MBL A;  1O07 A;  3P7N A;  2L0W A;  4GCZ A;  5DTT A;  5F1G A;  4NK3 A;  4WYY A;  2ZL1 B;  3HLB A;  4G3K A;  3S7O A;  4X1L A;  1PIO A;  4F3L A;  3QNC A;  1GCE A;  4HEF A;  3S7N A;  4S2K A;  4BBT A;  3DWZ A;  2WKI A;  3DAV A;  5HAQ A;  4OPQ A;  3LR5 A;  5CGX A;  2WAD A;  3NEC A;  4IHQ A;  5GHY A;  1J9M A;  1N4O A;  4RX2 A;  2ZQC A;  4WF0 A;  1Y28 A;  2VV6 A;  1GSX A;  4IVK A;  2CC1 A;  3WS5 A;  1YAX A;  4HJ3 A;  1S4R A;  3MJQ A;  4G3W A;  3LR3 A;  2WKP A;  2O9C A;  4GB7 A;  5EOE A;  3OPR A;  1VEU A;  2ZM2 A;  1P0Z A;  3VOY A;  2XFT A;  4DMZ A;  5DF9 A;  4MMN A;  1G6A A;  4K0W A;  3K3C A;  1LI9 A;  4GOG A;  3NJA A;  3GMW A;  4I3J A;  1YMS A;  2QKP A;  5EFW A;  3CPT B;  2VKS A;  1ES5 A;  3OBF A;  1FCO A;  3ZG7 B;  1E4D A;  4XT2 B;  4S2J A;  1WYC A;  4U0X A;  1KDW A;  4WEL A;  4X6T A;  2HV1 A;  4GNU A;  4HOI A;  2QJ7 A;  1OTI A;  5EVI B;  5HWW A;  3H7W A;  5KIZ A;  3IX4 A;  3A0S A;  3LY3 A;  4NKP A;  1FIK A;  2INW A;  3NUL A;  3PAE A;  2ZMF A;  2P9V B;  2JN7 A;  2X02 A;  3E2K A;  3SZT A;  5FI6 A;  3D3O A;  1MKM A;  4YNR A;  3P98 A;  2W3G A;  3LID A;  1KE3 A;  3IS2 A;  2VLG A;  2C5W B;  3SS4 A;  4QY6 A;  2R9W A;  2XH9 A;  5FAP A;  4KZ3 A;  5L10 A;  2P7J A;  4S2M A;  5TFQ A;  4NXF A;  2EWW A;  1PYY A;  2K31 A;  1IYQ A;  5AQB A;  1KE4 A;  1SCW A;  3LR0 A;  4B88 A;  2Y2N A;  4S2I A;  5FI2 A;  5HWV A;  2JBF A;  4HHD A;  2GX5 A;  3H82 A;  5DKK A;  4HQA A;  3O3V A;  3D72 A;  3LR4 A;  4GKU A;  5D3O A;  1S0W A;  4D2O A;  1PWG A;  2EX6 A; 
#chains in the Genus database with same CATH homology
 3UE6 A;  2OAQ 1;  3SW1 A;  4P6Z M;  5KSH A;  4M4X A;  5HL6 A;  1DP8 A;  3UME A;  4WUJ A;  2PYP A;  4JGP A;  4UQI M;  5HD3 A;  4L0L A;  5L8M A;  2KOI A;  1UWN X;  5J3W A;  1F98 A;  5TBM A;  3O5Y A;  1XJ3 A;  4O01 A;  5G4Y A;  4LRX C;  3K3D A;  3E4O A;  3CLO A;  4NXG A;  4MN5 A;  2EA9 A;  4CQH A;  2JKR I;  4CLC B;  4BBV A;  5HSQ A;  1NLY A;  2ZMV A;  4DJ2 A;  4R6L A;  2YKF A;  4EW7 A;  2PD8 A;  4EU0 A;  2QJ5 A;  4NXB A;  4RQ9 A;  4EUV A;  3UB9 A;  4LLO B;  2VEA A;  1V9Z A;  4I38 A;  4WEJ A;  4HH2 A;  3E4P A;  3OLO A;  3RTY A;  2PR5 A;  1XJ4 A;  2YKH A;  3B47 A;  4LRZ E;  4Q0J A;  3BW6 A;  3JVV A;  5J4E A;  3EQV A;  1OTD A;  4P6Z S;  3PYP A;  2DMW A;  3PBT A;  3LI9 A;  3W2Z A;  4UQI S;  2QWS A;  3A0R A;  2HJE A;  3C38 A;  3KSG A;  5IU1 A;  2D01 A;  2VJW A;  1ZHH B;  3TJZ C;  3LFV A;  3A0V A;  2VA0 A;  2M1C A;  3BQ8 A;  4DN0 A;  4R3A A;  3IS2 B;  2NUT C;  3T4S A;  3TE8 A;  2W3H A;  3DBA A;  4JGO A;  3EGD C;  1F5M A;  3MXQ A;  5DKL A;  2FH5 A;  1TS8 A;  2V0U A;  3E0Y A;  3HCY A;  4H6J B;  1XFQ A;  4ARZ B;  4Q0I A;  3LIA A;  3C8C A;  1XJ6 A;  3C30 A;  3FG8 A;  3T4L A;  1OT6 A;  5DJT A;  2Y79 A;  2KDK A;  2K2N A;  1X0O A;  4OOL A;  4GHI A;  3PBR A;  5A8B A;  4XT2 A;  2W1T B;  5F6A A;  3RH8 B;  3EQU A;  3MQ0 A;  3UE3 A;  2ZOH A;  3F1P B;  3BY9 A;  4ETX A;  1OJG A;  4GW9 A;  3H82 B;  1S1Z A;  1P9W A;  2J3T D;  2XA7 S;  2PR6 A;  5TJJ A;  1T1B A;  2V0W A;  4BJP A;  4PKY G;  2XRO A;  2JKT I;  3TW8 A;  2A2L A;  1LL8 A;  5HDS A;  2IA2 A;  1VHM A;  2P04 A;  4BWI A;  3LI8 A;  2HGV A;  1NWZ A;  3VOL A;  4CLC E;  1GSV A;  3CWF A;  3EWK A;  1XJ2 A;  4WEK A;  2XSS A;  3RFB A;  2W1R A;  3PBN A;  5HPF A;  3LIE A;  5G4Z A;  2O99 A;  4GS9 A;  1T18 A;  1TF1 A;  3KSF A;  4L9E A;  2LB9 A;  5HD5 A;  2BAS A;  3BWL A;  4FOF A;  4EES A;  5AJG A;  2Z6C A;  1NRJ A;  5HZH A;  3MF0 A;  4KQO A;  1W63 Q;  1N9L A;  4EEP A;  3OCN A;  2H28 A;  4ZRR A;  3K2N A;  1T19 A;  4HIA A;  3T50 A;  3UMD A;  2JKR M;  3R7W A;  5C5K A;  2PDR A;  2CMN A;  3HJK A;  4EEU A;  2O9B A;  5I5L A;  2J3T C;  4HNB A;  2PT7 A;  3OOV A;  3T4O A;  1V9Y A;  4HJ6 A;  2W27 A;  3LIC A;  5LBR A;  1YSQ A;  1YKD A;  1DP9 A;  3KSI A;  4Q0H A;  3H7W B;  5HDC A;  1S66 L;  2GNX A;  2WKQ A;  2MJ6 A;  1ODV A;  3EGX C;  2W3E A;  2L4R A;  2VZW A;  5DJU A;  4CLC D;  4ME4 A;  2WKR A;  2QYB A;  1S67 L;  4OOM A;  1F9I A;  1P9R A;  3S7P A;  4Y2F A;  3ZQ5 A;  3KYQ A;  3B42 A;  3F1N B;  2VV7 A;  4MN7 A;  2KLI A;  5HWT A;  3PBQ A;  5DFY A;  2I9V A;  3ZYT A;  1G6O A;  3H9W A;  1LSX A;  4PHT A;  4GLQ A;  2J3W A;  2W3F A;  4L9F A;  2A24 A;  3F1O A;  4I3I A;  4QPR A;  5CX7 A;  3GEC A;  2EWV A;  1UWP X;  1NLZ A;  4IJG A;  4FSF A;  3UB8 A;  2O9A A;  4B9O A;  1D7E A;  1N9O A;  3MMH A;  4YOF A;  2V9A A;  3MFX A;  2Z6D A;  1S1Y A;  4MDZ A;  3FPW A;  3EOI A;  5DFX A;  4I39 A;  2W3D A;  5J7E A;  2G7U A;  4G3V A;  4EET B;  3B33 A;  1LT0 A;  3E4Q A;  5IS1 A;  2HJ9 C;  1TD5 A;  4AFI A;  3UB7 A;  1YSP A;  3KO6 A;  4B93 A;  3OCL A;  4IUH A;  2ZBB A;  1W63 M;  3NOT C;  4GJ4 A;  3HJI A;  3T4T A;  4EXO A;  3LYX A;  3LIB A;  3CIT A;  2NUP C;  2JKT M;  3C2W A;  4ARZ A;  4IUK A;  4CLC C;  1STZ A;  1IFQ A;  4GS9 B;  2V1A A;  3KX0 X;  3U2A A;  3NHQ A;  2VGL M;  2GJ3 A;  4MN6 A;  2VV8 A;  3PBS A;  1DP6 A;  3LUQ A;  2B02 A;  4EER A;  3MR0 A;  3GDI A;  3P7N A;  4GCZ A;  2L0W A;  3NOP C;  4HP4 A;  5TBM B;  3VV4 A;  4E04 A;  3BQA A;  2W1T A;  4G3K A;  3S7O A;  4WN5 A;  4Y5F A;  4F3L A;  3JVU A;  1OJ5 A;  5F69 A;  4HJ4 A;  5F5Y A;  4HP9 A;  3F1P A;  4R70 A;  3S7N A;  1JNU A;  1N9N A;  4BBT A;  1H8M A;  2HF6 A;  2B18 A;  1ZTU A;  3T4J A;  1TS0 A;  1UGU A;  3LR5 A;  1OTB A;  2W0N A;  4KQD A;  1XFN A;  4IHQ A;  3BY8 A;  4R38 A;  2OWH A;  3KSH A;  2KX6 A;  2PD7 A;  4WF0 A;  1Y28 A;  3NOU C;  4HI4 A;  3MQQ A;  4HH3 A;  1MC0 A;  2VGL S;  2VV6 A;  1GSX A;  1S4S A;  3OC2 A;  3EEH A;  2LB5 A;  3T4K A;  4I3A A;  5K5B A;  4BBU A;  4JGQ A;  3MQO A;  4ETZ A;  3VE4 A;  4PKY A;  4WL9 A;  1YAX A;  5IT5 A;  4HJ3 A;  1S4R A;  3MJQ A;  4G3W A;  3LR3 A;  2WKP A;  2O9C A;  2V1B A;  1LSV A;  1WA9 A;  2OOL A;  1EW0 A;  4DMZ A;  1P0Z A;  5AVF A;  4PAU A;  5DF9 A;  4MMN A;  1KOU A;  1H3Q A;  3BJN A;  4LPZ A;  3K3C A;  2P08 A;  2VX8 A;  3EEA A;  4YWZ A;  3NJA A;  2A24 B;  3F1O B;  4I3J A;  3CUE C;  4CLC A;  1TS6 A;  2QKP A;  5EFW A;  4WLA A;  1OTA A;  4EQ1 A;  4LRY C;  2VKS A;  3OBF A;  4NXE A;  4GHI B;  4K08 A;  3PXP A;  2ZOI A;  3PR6 A;  4Z1W A;  4XT2 B;  4UEY A;  3T4Q A;  3VE3 A;  4WEL A;  2HV1 A;  2M7V A;  4HOI A;  2QJ7 A;  4L9G A;  3P01 A;  5HDD A;  1OTI A;  5HWW A;  2XA7 M;  5F68 A;  2PYR A;  3H7W A;  5KIZ A;  1IOU A;  1T1C A;  3A0S A;  4Y3I A;  2OAP 1;  5AVE A;  2M7U A;  4NKP A;  2INW A;  1OT9 A;  3R4K A;  2ZMF A;  4KUO A;  2JN7 A;  4JGR A;  2FZ0 A;  2R78 A;  3D3O A;  2PHY A;  1MKM A;  2L1M A;  4YNR A;  5MC7 A;  1BYW A;  3G6O A;  2W3G A;  1DRM A;  3LID A;  2Y8H A;  3CI6 A;  2VLG A;  3IS2 A;  4O8G A;  3F1N A;  4II7 A;  1OTE A;  3LIF A;  3E98 A;  2JHE A;  4I5S A;  1D06 A;  4DJ3 A;  4H6J A;  3IBR A;  5HPI A;  4F3L B;  4MCW A;  1TS7 A;  3PHY A;  4NEE D;  2P7J A;  3KYZ A;  2O0Y A;  2QHK A;  3PBO A;  1MZU A;  4NXF A;  4BMW A;  1OPX A;  2D02 A;  2EWW A;  2J80 A;  2K31 A;  5FL3 A;  1VB6 A;  3ICY A;  2OWJ A;  3LR0 A;  3FPV A;  1LSW A;  5HWV A;  1P97 A;  3FC7 A;  3CUE A;  4HHD A;  2GX5 A;  3H82 A;  5DKK A;  4HQA A;  3R7W B;  3V67 A;  3IBJ A;  3S7Q A;  2XRN A;  3CAX A;  3D72 A;  3LR4 A;  1T1A A;  4KUK A;  1GSW A;  1G28 A;  2GZA A;  3UB6 A;  3ULF A;  4O0P A;  4HY8 A;  3TRC A;  2K7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...