2PD7A

2.0 angstrom crystal structure of the fungal blue-light photoreceptor vivid
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
149
structure length
149
Chain Sequence
b'MHTLYAPGGYDIMGYLIQIMNRPNPQVELGPVDTSCALILCDLKQKDTPIVYASEAFLYMTGYSNAEVLGRNCRFLQSPDGMVKPKSTRKYVDSNTINTMRKAIDRNAEVQVEVVNFKKNGQRFVNFLTMIPVRDETGEYRYSMGFQCE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational switching in the fungal light sensor Vivid
pubmed doi rcsb
molecule keywords Vivid PAS protein VVD
source organism Neurospora crassa
molecule tags Circadian clock protein
total genus 37
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2pd7A00
3P7NA 1TS0A 2PR6A 4JGPA 4XT2B 3ICYA 3F1PB 3VE4A 4HJ6A 1XJ3A 4EQ1A 4B9OA 1GSVA 2L4RA 2QHKA 3HJIA 1Y28A 1OTAA 1T1CA 3SW1A 3KX0X 3UB7A 4GS9A 1LL8A 3F1NB 2V1AA 4GHIA 2INWA 5IS1A 1OTEA 4HNBA 4BBTA 3LIFA 3HJKA 1D7EA 4DJ2A 4EXOA 4I3IA 2KX6A 1S1ZA 4HP4A 2W0NA 4HJ3A 2OOLA 1T1AA 1OTBA 3FC7A 3LYXA 3FG8A 4EERA 4I3JA 3ZQ5A 3UMDA 3MXQA 1UWPX 5HDDA 4L9EA 4NXFA 3VOLA 3NJAA 1BYWA 3RH8B 5TBMA 4LRYC 4PKYG 2H28A 1N9OA 4GW9A 3UB8A 3RTYA 4EEPA 3A0VA 4HHDA 3LIAA 5HWTA 1DP9A 2ZOIA 1S67L 4I38A 4H6JB 2QJ5A 4WN5A 2A24B 2J80A 4R38A 1OT6A 2M1CA 4WUJA 3H7WB 2EA9A 3LI9A 2QWSA 1KOUA 4NXBA 1JNUA 2V9AA 3OLOA 5AVEA 3LICA 2VV6A 3UB6A 3K3DA 2YKHA 3NOUC 3IBRA 4HP9A 3F1OA 3NOTC 3G6OA 4WLAA 5HD5A 4BBVA 2JN7A 5IU1A 1MZUA 3BY8A 4YWZA 4HQAA 1OTIA 2K7SA 2HV1A 4R3AA 3E4PA 4M4XA 4L9FA 5HD3A 2D02A 2V0WA 4LPZA 5G4YA 5J4EA 4HOIA 2VV8A 3LI8A 4DJ3A 5DJTA 2A24A 3UE6A 5F69A 2PD8A 3H82A 1GSWA 1F98A 3H7WA 3ULFA 3UMEA 1NWZA 4EETB 2ZOHA 3UB9A 4JGOA 4LRZE 5DKLA 1S4SA 1OJGA 4XT2A 1TS8A 1X0OA 3F1PA 1N9NA 4R70A 1T19A 3IS2B 5EFWA 4NXEA 4I3AA 3T50A 4MN6A 5J3WA 4HJ4A 4JGRA 4JGQA 4HI4A 2PHYA 1XJ4A 2ZBBA 3F1NA 5DKKA 1S1YA 3PHYA 3EWKA 3BWLA 1LSXA 3MQQA 3MR0A 2QJ7A 3E4OA 3C8CA 3CWFA 3PYPA 4GCZA 2PYPA 1TS7A 3H9WA 2B02A 2OWHA 2Z6CA 2WKPA 2V0UA 3K3CA 1ODVA 2QKPA 2VEAA 2CMNA 5AVFA 3MJQA 4HY8A 4EESA 1LT0A 4E04A 2WKRA 1GSXA 1WA9A 4L9GA 5I5LA 1S66L 1S4RA 2KDKA 2L1MA 4HIAA 4HH2A 1V9ZA 4H6JA 4GHIB 3MFXA 5F6AA 1T18A 3CAXA 2VLGA 3BY9A 4F3LB 4I39A 2YKFA 1OT9A 3E4QA 5HWWA 4LRXC 1OTDA 4MN5A 1XFQA 4HH3A 3D72A 5F5YA 2Z6DA 3MQOA 5J7EA 4KQDA 5DJUA 3CLOA 4LLOB 1OJ5A 4PKYA 3LIDA 3LIEA 1P97A 1P0ZA 4EW7A 2L0WA 2WKQA 4KUKA 3LIBA 3NHQA 5G4ZA 5TBMB 5HDCA 2PDRA 1UWNX 1G28A 5HZHA 4R6LA 2PR5A 2D01A 5HDSA 4F3LA 3VE3A 1TS6A 1F9IA 4KUOA 3C2WA 5A8BA 1XFNA 2I9VA 3EEHA 1XJ2A 3F1OB 2OWJA 3A0RA 1T1BA 3A0SA 4EEUA 1D06A 4RQ9A 1LSWA 2P7JA 3LUQA 2VV7A 1VB6A 2PD7A 4K08A 2PYRA 3NOPC 5HSQA 1DP8A 3IS2A 1V9YA 1DP6A 5HWVA 3H82B 1EW0A 2R78A 4NXGA 3GDIA 5F68A 4BBUA 1LSVA 1UGUA 3B33A 4WL9A 2BASA 1N9LA 1XJ6A 4GS9B 2JHEA 2GJ3A 5KIZA 1DRMA 2V1BA 4I5SA 2W27A 4WF0A 3GECA
chains in the Genus database with same CATH superfamily
4ESPA 2BLSA 4JGPA 2JE5A 4FH2A 3T1QB 1YAXA 3QP5A 3ZFZA 1YM1A 4BLMA 4EU0A 4FH4A 3T4TA 2J3TC 2B95A 1RP5A 1Z09A 1CEFA 5CGWA 2QHKA 4OOLA 2W3HA 4CLCA 2PU2A 3VP1A 2ZMVA 4Y0TA 1RGYA 1K25A 3NBLA 4OQIA 2PBYA 3SW1A 1QMFA 3NDEA 2EX6A 4GS9A 5DTSA 3V5MA 4RX3A 3QP4A 2KOIA 1CI8A 2R9WA 3EEAA 2V1AA 4KQOA 1M40A 5IS1A 1OTEA 4HNBA 3ZG5A 2FH5A 3HJKA 4MBHA 3CPTB 4S2NA 4I3IA 1S1ZA 4KZBA 4HJ3A 1E3UA 3Q81A 3G4PA 3FC7A 3T1XA 1YPRA 4GNUA 3UMDA 2Y59A 1LL9A 3BFEA 1FIKA 2Y55A 3RH8B 3IH9A 4LRYC 1GHMA 2Y2MA 1N9OA 3WRTA 5J8XA 5CHJA 3ITBA 4JPMA 1S67L 2J3TD 3IXBA 4UAAA 1MKIA 4I38A 2QJ5A 4WN5A 3TSGA 2M1CA 3V39A 4DE2A 3MZEA 2EXAA 1WE4A 2QWSA 4PM9A 1JNUA 2OV5A 3KSIA 3LFVA 3LICA 5GHZA 3NI9A 3K3DA 2WGWA 2YKHA 1YLJA 3S1YA 3WS0A 3DTEA 3W2ZA 1CQAA 5FQIA 3F1OA 4ZJ1A 3MBZA 3NOTC 1DY6A 4E3JA 2W3GA 5CEDA 3BY8A 3VFHA 1XA7A 1IFQA 2VJWA 3E4PA 5CGSA 4M4XA 3T4OA 3ZNTA 1TDLA 5HARA 2D02A 4LPZA 5G4YA 5J4EA 4ZDXA 4JLFA 1HVBA 4XUZA 4Y15A 3VOZA 2DRWA 2ZLYA 5DJTA 3UDIA 1MKMA 3A3EA 3H82A 1ZTUA 1F98A 4WMCA 3RXXA 1MPLA 5TGFA 1D1JA 2VZWA 3QNBA 5F1FA 5JYPA 1W63Q 4MLLA 5EM0A 1NWZA 1L0FA 4OQ0A 1SZVA 2GNXA 1FILA 3HUNA 4EETB 1DJAA 5GL9A 4Y7PA 4UA9A 5LBRA 1P9RA 4G3WA 2WAEA 1PW1A 4YOFA 1RCJA 3BM6A 3W4PA 1IOUA 2XR0A 1S4SA 3D4FA 3LY4A 4KZ9A 1OJGA 2XROA 3NDGA 2Z2LB 3L7HA 1OPXA 3O3VA 2PAVP 3LEZA 5EVIB 3TJZC 1N9NA 4IBXA 2Y2PA 3CZDA 2LB5A 1T19A 2ACGA 5GHYA 2Q9NA 5FASA 2A49A 1FCOA 1NZUA 5CHMA 4S2IA 1J3WA 4HJ4A 4FUWA 4C6YA 1JWPA 4Y13A 4P6ZM 1MWRA 1XGIA 5CECA 4B4ZA 4JGQA 1FSWA 2PHYA 4E3MA 3EQVA 2EX9A 4ME4A 1S1YA 2XF3A 3SS4A 3CHWP 5FAOA 4Q8IA 3EWKA 2B5RA 3C38A 4FCFA 4GDNA 3JPUA 1QMEA 1KGFA 3O5YA 1JVJA 5DFYA 2PYPA 1HZOA 2B02A 5TR7A 4MMNA 2V0UA 4WBGA 2EX8A 4KQRA 4N9KA 3NY4A 4GN2A 2ZM0A 2Y2GA 2E8JA 3NC8A 4E04A 5DTKA 4X69A 3C4OA 3WS1A 1IYQA 4OLGA 2HP6A 4L9GA 4OONA 3IQAA 2HF6A 4HEFA 4Y0UA 4JKTA 3CAXA 2VLGA 4M3KA 4CLCC 3UE1A 4WELA 1OT9A 2ZL1A 4OQGA 4U0XA 5HFOA 5HWWA 3OZHA 2ZQ8A 1OTDA 4O0PA 1H8ZA 3KYEA 1MC0A 2FZ0A 2Z6DA 2A3UA 5AQ9A 5F1GA 2K2NA 4YNRA 4S2NC 1SHVA 4EW7A 2W1TB 2VKSA 5HDCA 2PDRA 1UWNX 3N8SA 5HZHA 5FQMA 3KYZA 3PTEA 3Q7VA 2Q0OA 4ID4A 5HDSA 3VE3A 1TS6A 3G30A 4K91A 4BMWA 2W3DA 3G31A 1W5DA 1BLPA 4KZ3A 3N6IA 4S2LA 1MBLA 4JF5A 3MKEA 4ZJ3A 5AQAA 3IF6A 3T4QA 1G6AA 2OWJA 4NETA 2DCFA 1S6RA 1T1BA 1BULA 5KSHA 1YLYA 4DMZA 4CLCD 3EGXC 5EV0A 4IHQA 3VP0A 5KZHA 2Z2MB 2HPBA 3D3OA 4GB7A 4KENB 3O88A 1XGJA 4O01A 1DP6A 4OH0A 2ZQAA 4DDSA 2R78A 3BECA 3GDIA 5DTTA 1FR6A 4LCLA 3MMHA 3BYDA 1N9LA 1XJ6A 1EI5A 1LI0A 1VETA 2GJ3A 4JXGA 1DRMA 3QHYA 2P9VB 4LV2A 5FAQA 2WZZA 2C6WB 2HZ5A 1NLYA 5FI7A 5HX9A 1TS0A 2PR6A 2MJ6A 4XT2B 1XX2A 3F1PB 3HREA 4WEKA 5E2EA 1H8YA 2VGJA 3QP8A 3S7OA 1MWSA 2L4RA 3AGEA 3OCNA 2W3EA 1YLPA 4NKPA 4NK3A 1LI9A 1KGEA 3MXRA 1RGZA 3P01A 3KSHA 1CJFA 3UB7A 5HAIA 1LL8A 1ERMA 1HLUP 3F1NB 4R23A 4LFUA 2PBDP 4BBTA 2HDSA 3P98A 1N9BA 1D7EA 4XUXA 4EXOA 4IJGA 2ZM8A 4EBPA 1XA1A 4HP4A 3IF5A 4DN0A 2Y2HA 3ZG0A 3FYZA 4DE1A 1NRJA 1T1AA 3T4JA 1Z6FA 3PAEA 2NUTC 2J9PA 4S2KA 5EE8A 2VGLS 1ONGA 1UWPX 1IYPA 2K31A 4NXFA 3NJAA 2CC1A 1FCNA 5IHVA 5TBMA 2J3WA 4E3LA 2H28A 2EFXA 1G68A 4GW9A 4OP5A 3HLDA 3ZGAB 3PXPA 1FCMA 5HWTA 3C7UA 4DXCA 4UA7A 4K0XA 3W4QA 1IEMA 5L07A 5GLAA 2OAQ1 3MQ0A 4HESA 4MNRA 1OT6A 3G35A 4WUJA 3S7NA 1KOUA 2WUQA 5AVEA 3JVUA 2QYBA 1YQSA 3UO9A 5G18A 4YFMA 4HP9A 3PR6A 1SKOA 3R4KA 3G6OA 4ZRRA 4BBVA 3S4XA 4PM5A 3E98A 4MBFA 3C4PA 2Y2NA 2ZQDA 4PMAA 4L9FA 2V0WA 3DWZA 4IUKA 2VV8A 1E25A 5FQQA 4U0TA 1K57A 3HUOA 2PD8A 2WK0A 3A3FA 1Y4OA 5KSCA 3IT9A 2EX2A 4R3BA 2HP5A 5EVID 2QPNA 3RXWA 4JF6A 2OLVA 1IKIA 3IXGA 4C75A 2H0YA 2G2WA 2B18A 1U60A 3KYQA 4ZTKA 5A91A 4WYYA 4LRZE 1G5UA 5L09A 2RL3A 3A3JA 5EECA 3ISGA 1OMEA 3IF6C 1S0WA 4ARZB 1W7FA 3DTKA 1W79A 3IS2B 5CRFA 1PW8A 5FEFA 3WS5A 4FSFA 1EROA 3LR5A 1BZAA 5EFWA 2OLUA 2EFUA 3T50A 2Y79A 1W63M 3ZG9B 1K56D 4EBNA 5DVAA 2DMWA 5CXWA 3PBOA 1TD5A 3OOVA 4DE3A 4P85A 3O87A 1PZPA 2DNSA 1EWZA 1LSXA 3UE0A 3CPTA 3W4OA 3NECA 5K5BA 1KE0A 5EOEA 2QJ7A 2GX5A 3E4OA 3M2KA 4O7DA 4CPKA 3C8CA 3CWFA 5CTMA 4UQIS 1YMXA 4N1HA 3WS2A 5CTNA 4ARZA 3CITA 2V1ZA 2WKPA 3FKVA 3ZNYA 4GKUA 3ZCZA 3HUMA 4E3IA 3K3CA 1ODVA 2VEAA 2CMNA 4X68A 4HY8A 4MCWA 1MWTA 3IXDA 2J7VA 4EESA 2XFSA 2WKRA 1S66L 3DW0A 2VX8A 2L1MA 3UB5P 3HLGA 4KG5A 2HDRA 4GHIB 5FQJA 3G34A 4I39A 2YKFA 1DJBA 3BJNA 4N1XA 3HLFA 3A3DA 3HCYA 2W1RA 4HH3A 4DXBA 4BWIA 2V8FA 5F5YA 4LLOB 1N4OA 1TVFA 2XLNA 2WKQA 3LIBA 3NHQA 5G4ZA 1NZOA 3T1RA 4ZBEA 2UWXA 1PIOA 5I94A 4PAUA 3VFFA 2HJEA 1BT5A 1XP4A 1STZA 4FOFA 4R6LA 3DTMA 3TW8A 3IH8A 1M6KA 3SS5A 2XD1A 2XSSA 3O86A 4AFIA 4JXSA 4KUOA 3V67A 5A8BA 3G32A 2M7VA 4WEJA 5FL3A 5A93A 3EEHA 2AVXA 1XJ2A 5CERA 2ZMAA 4LV3A 2X02A 3SH8A 4EEUA 2ZJ9A 3G2ZA 5DF7A 4Y3IA 1LSWA 1NJ4A 2P7JA 4L0LA 3LUQA 3U2AA 2QMIA 4WZ5A 1NRFA 1VQQA 3ZDJA 2VV7A 1SDNA 4K08A 4UA6A 2JBFA 5EVIA 3NOPC 1ACFA 4QU3A 4BL3A 3D9YA 1DP8A 4ZJ2A 3E2KA 3GRJA 3MS6A 3RFBA 3EQUA 1ES3A 1HD8A 1GA9A 4R0QA 4YINA 1ES5A 2XRNA 3BFCA 4OPZA 2HDQA 4BBUA 2WKHA 1VEUB 1ZC2A 3ZG7B 2XH9A 3R7WB 4ETXA 4X25A 1K57C 3PBRA 3KO6A 4I5SA 1NXYA 4WM9A 2G2UA 4Q0JA 3N7WA 4BD1A 4S2JA 3GECA 4MDZA 4P87A 1FQGA 5TFQA 1K56A 3ICYA 4QB8A 4X56A 5GLBA 5E2HA 2JKTM 4KZ4A 1PWGA 1XJ3A 4EQ1A 4OPRA 2ZC6B 4F94A 1NYYA 4GOGA 1KVLA 4S2MA 5EM1A 1G6OA 1Y28A 4OOYA 4EBLA 4DF6A 3UE3A 1T1CA 5A90A 4BD0A 4G3VA 5A92A 3CUEA 3BLMA 3FV7A 2VGKA 2Y2IA 3EGDC 3OPRA 2INWA 1CI9A 3LIFA 4LV0A 1F5MA 4DJ2A 2WZXA 2WADA 4K0WA 1KVMA 2KX6A 1PRQA 2OOLA 4KZAA 1OTBA 3KSGA 1ALQA 3LYXA 2J9OA 2P08A 1L2SA 3CG5A 3MXQA 4G3KA 3BFGA 4R3JA 2W1TA 5M18A 1L3LA 2ZC7A 1KE4A 3CMZA 1BYWA 3OC2A 3T4LA 3NULA 2ZQCA 3UB8A 1LL5A 3AGFA 5EUAA 3A0VA 3C7VA 4EEPA 2VK3A 3LIAA 4JBFA 3B42A 2E8IA 3BFDA 4H6JB 5IT5A 2V8CA 1PNEA 4OKPA 3LCEA 1DJCA 3PBSA 4NG2A 1PFLA 1JTDA 4MBKA 3OLOA 1J9MA 3VP2A 4PPRA 5AQBA 2OAP1 3IBRA 4U3TA 4EQIA 3N8LA 1K55A 3QP6A 5FI6A 3GVBA 3MKFA 1WYBA 3V3RA 4WLAA 3UNWA 4C3QA 5IU1A 1IYOA 2ZM2A 1MZUA 4YWZA 5DFXA 4HQAA 5HAPA 3MZDA 1SDEA 3MSHA 4HOIA 3VV4A 3LI8A 3LY3A 3ZHHA 3GSGA 3SH9A 2GDNA 3UE6A 3IWOA 4P6BA 4KZ5A 4X55A 2JKTI 4E3OA 4PHTA 3UMEA 1PI5A 3C30A 4LENA 1H3QA 4B88A 4P0MA 5HPIA 3LR4A 3IHBA 4IUHA 4QD4A 4QJGA 1YKDA 4Y5FA 2P9VA 4BQMA 1PI4A 3N4IA 5E43A 3QNCA 5GLCA 1JWZA 4XT2A 1X0OA 3F1PA 5L2FA 2IWBA 4OOMA 4R70A 2WAFA 3GV9A 4UHUA 1K4FA 2PU4A 5EPHA 3M6BA 1L0GA 2M7UA 2JKRM 4NEED 4NXEA 5AQ7A 2ZQ9A 4WZ5C 2JC7A 5EVIC 1KE3A 4JGRA 2UV0E 3SH7A 5FDSA 3T12B 1H8MA 1XJ4A 2ZBBA 2H10A 2JKFA 3F1NA 5DKKA 1K6SA 2XDMA 3BWLA 5F83A 2WGIA 2XGNA 5GLDA 3TG9A 3V3SA 3TOIA 2G7UA 5CHUA 3PYPA 1BSGA 4GCZA 3V50A 4GDBA 4E3NA 5GHXA 4GD6A 1TS7A 3H9WA 4Z9QA 1K38A 2WKEA 2Y4AA 3IHAA 3HLWA 1XPBA 3Q1FA 2X01A 3WRZA 2ZC3B 4WZ4A 2J8YA 3TRCA 1SKFA 4CLCB 1LT0A 2ZD8A 3NIAA 5FQKA 4KQQA 1GSXA 3LGOA 4R4RA 3L9KA 1GA0A 5I5LA 3G2YA 1S4RA 2ZC5B 4PM6A 3MFXA 4FD8A 1T18A 5F6AA 3BRMA 4JF4A 3IX3A 4F3LB 4CJNA 4H8RA 4KZ6A 4LRXC 1Q2PA 1BLHA 4P6ZS 4MN5A 3CUEC 4B4XA 3MQOA 3P09A 3CJMA 2IWDA 4KQDA 3CLOA 4PKYA 5FEGA 3DAVA 1VHMA 1XXMA 4UEYA 1A0KA 5FQ9A 4PM7A 2L0WA 3OPLA 1ES4A 1MXOA 1GHPA 2WYXA 5L10A 3HLCA 4LV1A 2PR5A 2D01A 4F3LA 2JKGA 1L0DA 3IX4A 5U47A 5D3OA 3BLSA 2WGWB 1Q2QA 2ZC4B 4D2OA 4EUVA 1JTGA 2I9VA 2JKRI 2XEPA 3F1OB 3HLBA 3ZVWA 2IWCA 3OCLA 4CQHA 4ZAMA 3A0RA 4E6XA 3A0SA 3FZCA 4QPRA 5FA7A 4RQ9A 5M19A 1YT4A 4FTXA 3QP2A 1TEMA 4KG2A 1VB6A 2PD7A 1JWVA 4IVIA 5BOHA 1K55C 3BW6A 3IS2A 2O9BA 4OPQA 2XA7M 3S7PA 3VMAA 1CK3A 3JYIA 3NCKA 4KG6A 5HWVA 3H82B 3A3IA 1EW0A 4GD8A 4N9LA 1P9WA 5FDHA 5HAQA 4E3KA 1IELA 1LSVA 5L8MA 3DTIA 4Y2FA 2P04A 1ZG4A 2A2LA 4QY6A 3B33A 3BEBA 4WL9A 2BASA 5EVLA 2JHEA 1HTZA 4RA7A 3T4SA 2Y8HA 1YSQA 2VGLM 3C5AA 2O9CA 3GTCA 1K54A 3MXSA 3IXHA 2W27A 3UN7A 4WF0A 1YLTA 1XFQA 4BENA 3P7NA 4X1MA 2H0TA 4DE0A 1ONHA 3VE4A 4HJ6A 3FPWA 2FFYA 4B9OA 1GSVA 1FSYA 1TF1A 3GQZA 4HBTA 5F82A 4B93A 1IKGA 4OQHA 3HJIA 1OTAA 1TDGA 3IWIA 5CX7A 2V2FF 3FPVA 4DKIA 1E4DA 2Q9MA 3KX0X 5HW3A 2PT7A 2C5WB 4GHIA 3ZG8B 3Q07A 1XKZA 3Q7ZA 3VP3A 1BUEA 2W0NA 3ZYTA 3DBAA 4IBRA 2EXBA 1WYCA 3LEQA 3FG8A 4CLCE 4EERA 4OVDA 4I3JA 3UDFA 3ZQ5A 5CEBA 5HDDA 3GMWA 4L9EA 4MN7A 3VOLA 2XQZA 2I72A 4PKYG 3RTYA 4HHDA 4S2PA 2GZAA 1DP9A 2ZOIA 4S2OA 3RJUA 3ZVTA 3HVFA 4OP8A 2O9AA 2A24B 2KLIA 2J80A 4R38A 2HJ9C 1MY8A 3H7WB 2EA9A 3LI9A 5KMWA 4QWOA 4NXBA 2ZL1B 2V9AA 4Q0HA 2VV6A 3FKWA 3UB6A 3NOUC 2JCHA 2VA0A 2X71A 4R4SA 1ZG6A 1I2SA 4DDYA 3BQ8A 3BFFA 5HD5A 1ES2A 3UPPA 2JN7A 2HGVA 1IYSA 1OTIA 2K7SA 3SOIA 4O8GA 2HV1A 4R3AA 1KDWA 4GLQA 5E2GA 3WWXA 5HD3A 2BG1A 1NY0A 5HL1A 3EOIA 4DJ3A 1KDSA 3Q7VB 2V20A 3PBTA 5FSRA 2A24A 2Y91A 5F69A 1CEGA 1GSWA 1MWUA 3H7WA 1H0MA 3ULFA 3UPNA 3LR3A 2ZQ7A 2Y2OA 3OBFA 1VEUA 3IX8A 1VM1A 4UQIM 1I5QA 2XD5A 3IF6B 4N92A 3R7WA 3B47A 4LGWA 3UDXA 2ZOHA 3UB9A 1NLZA 3LO7A 4JGOA 5DKLA 2RCXA 3OPPA 4MEZA 3E0YA 3LR0A 4EV4A 4E6WA 1TS8A 2IA2A 4BL2A 3HBRA 2FFFB 4II7A 1BLCA 3OPHA 3VOYA 3CI6A 5DF9A 2BTFP 2H5SA 1CF0A 4I3AA 4MN6A 4JXVA 2QZ6A 4EWFA 4Q0IA 5J3WA 1PWCA 3W8KA 2Y2JA 5DF8A 2EWWA 4EUZA 4QHCA 5MC7A 4HI4A 5FI2A 1K6RA 1F2KA 1VETB 4BJPA 3PHYA 4X1LA 2HP9A 3MQQA 3MR0A 1LLBA 1AWIA 3PBQA 3VP4A 5HL6A 2WGVA 3B3XA 1ZKJA 4Y17A 4LCMA 3UPOA 2OWHA 2XK1A 2Z6CA 3T1SA 2EWVA 3DWKA 5CGXA 4DRTA 1K54C 3KSFA 3WS4A 1ESIA 1W8QA 2QKPA 3SZTA 3U4LP 5AVFA 2WKIA 3MJQA 5EOOA 3MFDA 4D60A 2XFTA 2OSUA 1E3UD 3PBNA 1WA9A 1NYMA 2KDKA 4IEDA 3SS3A 4HIAA 4HH2A 1V9ZA 2P74A 4H6JA 1GHIA 1YLWA 3BQAA 3BY9A 3HLEA 4QY5A 3M2JA 3E2LA 4X6TA 2Y2KA 1I2WA 5M1AA 3E4QA 4HBUA 4Y0OA 3S22A 1YLZA 5AJGA 4JXWA 3D72A 4OPYA 1PZOA 1ESUA 4GJ4A 5J7EA 3HL9A 4R1GA 5DJUA 1OJ5A 5C5KA 3LIDA 3FWLA 3LIEA 1P97A 1C3BA 3IWQA 3VSKA 1P0ZA 2Y2QA 3AGDA 4KUKA 3ITAA 1PYYA 5TBMB 4ETZA 3Q82A 1G28A 3PAGA 1O07A 4OLDA 2R9XA 4GZBA 5EVEA 1K4EA 2XA7S 1AXBA 1YMSA 3K2NA 3M6HA 4RYEA 5TJJA 1YSPA 1KGGA 3N8RA 1F9IA 5FAPA 3C2WA 4KZ7A 3IBJA 1H5XA 3T4KA 1O7EA 3GR2A 1XFNA 1L0EA 1Y54A 1ERQA 5HPFA 1SKOB 4RVAA 1LHYA 2O0YA 1BLSA 2W3FA 1BTLA 4KZ8A 4WMCD 1D06A 1FOFA 3I7JA 2NUPC 1GCEA 2PYRA 3VSLA 5E2FA 4A5RA 4X53A 4PM8A 2O99A 3JVVA 5HSQA 3UY6A 1V9YA 2LB9A 1K0KA 3QP1A 4RX2A 4NXGA 3S7QA 3TE8A 5F68A 4Z1WA 1FR1A 1UGUA 2ZMFA 1SCWA 3MF0A 1W8YA 4GS9B 5FATA 4IVKA 5JYOA 2HDUA 5KIZA 1PWDA 2V1BA 2Y2LA 2PRFA 1ZHHB 3MZFA 4XXRA
chains in the Genus database with same CATH topology
4MDZA 3P7NA 1TS0A 2PR6A 4JGPA 2MJ6A 4XT2B 3ICYA 3F1PB 3VE4A 2JKTM 4WEKA 1YAXA 4HJ6A 3FPWA 4EU0A 3T4TA 1XJ3A 2J3TC 4EQ1A 3S7OA 4B9OA 1GSVA 2L4RA 4B93A 1TF1A 3OCNA 2W3EA 2QHKA 4NKPA 4OOLA 2W3HA 4CLCA 1G6OA 1Y28A 3HJIA 1OTAA 5CX7A 2ZMVA 3FPVA 3UE3A 1T1CA 3P01A 3SW1A 3KSHA 3KX0X 3UB7A 4G3VA 4GS9A 3CUEA 1LL8A 2KOIA 3EGDC 2PT7A 3F1NB 3EEAA 2V1AA 4GHIA 4KQOA 2INWA 5IS1A 1OTEA 4HNBA 4BBTA 2FH5A 3LIFA 1F5MA 3HJKA 1D7EA 4DJ2A 4EXOA 4IJGA 4I3IA 2KX6A 1S1ZA 4HP4A 4DN0A 2W0NA 4HJ3A 3ZYTA 2OOLA 3DBAA 1NRJA 1T1AA 3T4JA 1OTBA 3KSGA 2NUTC 3FC7A 3LYXA 3FG8A 4CLCE 2P08A 4EERA 4I3JA 2VGLS 3ZQ5A 3UMDA 3MXQA 1UWPX 4G3KA 5HDDA 4L9EA 2K31A 4NXFA 4MN7A 2W1TA 3VOLA 3NJAA 1BYWA 3RH8B 3OC2A 5TBMA 2J3WA 4LRYC 3T4LA 4PKYG 2H28A 1N9OA 4GW9A 3UB8A 3PXPA 3RTYA 4EEPA 3A0VA 4HHDA 3LIAA 5HWTA 3B42A 2GZAA 1DP9A 2ZOIA 1S67L 2J3TD 4I38A 4H6JB 2QJ5A 5IT5A 2O9AA 2OAQ1 4WN5A 2A24B 2KLIA 2J80A 4R38A 3MQ0A 1OT6A 2HJ9C 2M1CA 3PBSA 4WUJA 3S7NA 3H7WB 2EA9A 3LI9A 2QWSA 1KOUA 4NXBA 1JNUA 2V9AA 3KSIA 3OLOA 3LFVA 5AVEA 3LICA 2VV6A 3JVUA 4Q0HA 3UB6A 3K3DA 2YKHA 2QYBA 3NOUC 2OAP1 3IBRA 3W2ZA 4HP9A 3PR6A 3F1OA 2VA0A 3NOTC 3R4KA 3G6OA 4WLAA 4ZRRA 3BQ8A 5HD5A 4BBVA 2W3GA 2JN7A 3E98A 2HGVA 5IU1A 1MZUA 3BY8A 4YWZA 5DFXA 4HQAA 1OTIA 2K7SA 1IFQA 4O8GA 2HV1A 4R3AA 2VJWA 3E4PA 4GLQA 4M4XA 3T4OA 4L9FA 5HD3A 2D02A 2V0WA 4LPZA 5G4YA 5J4EA 4IUKA 4HOIA 3VV4A 3LI8A 2VV8A 3EOIA 4DJ3A 3PBTA 5DJTA 2A24A 3UE6A 1MKMA 5F69A 2PD8A 3H82A 1GSWA 1ZTUA 1F98A 3H7WA 3ULFA 2JKTI 2VZWA 4PHTA 3UMEA 1W63Q 3LR3A 1NWZA 3C30A 3OBFA 1H3QA 4UQIM 5HPIA 3R7WA 2GNXA 2B18A 3LR4A 3B47A 4EETB 2ZOHA 4IUHA 3UB9A 3KYQA 5LBRA 1P9RA 4G3WA 1YKDA 4Y5FA 1NLZA 4JGOA 4LRZE 5DKLA 4YOFA 1IOUA 1S4SA 1OJGA 2XROA 3E0YA 3LR0A 4XT2A 1TS8A 1OPXA 2IA2A 1X0OA 3F1PA 3TJZC 1N9NA 4OOMA 4R70A 2LB5A 4II7A 4ARZB 1T19A 3CI6A 3IS2B 5DF9A 2M7UA 4FSFA 2JKRM 3LR5A 5EFWA 4NEED 4NXEA 4I3AA 3T50A 4MN6A 2Y79A 1W63M 4Q0IA 5J3WA 4HJ4A 2DMWA 3PBOA 1TD5A 3OOVA 4JGRA 4P6ZM 2EWWA 5MC7A 4JGQA 4HI4A 1H8MA 2PHYA 1XJ4A 2ZBBA 3EQVA 4BJPA 3F1NA 4ME4A 1S1YA 5DKKA 3PHYA 3EWKA 3BWLA 1LSXA 3C38A 3MQQA 3MR0A 5K5BA 2QJ7A 2GX5A 3PBQA 3E4OA 2G7UA 3C8CA 3CWFA 3O5YA 3PYPA 4GCZA 5HL6A 5DFYA 4UQIS 2PYPA 1TS7A 3H9WA 2B02A 4ARZA 2OWHA 2Z6CA 3CITA 2WKPA 2EWVA 4MMNA 2V0UA 3KSFA 3K3CA 1ODVA 2QKPA 2VEAA 2CMNA 5AVFA 3MJQA 4HY8A 3TRCA 4MCWA 4CLCB 1LT0A 4EESA 4E04A 2WKRA 1GSXA 3PBNA 1WA9A 4L9GA 5I5LA 1S66L 1S4RA 2KDKA 2HF6A 2VX8A 2L1MA 4HIAA 4HH2A 1V9ZA 4H6JA 4GHIB 3MFXA 5F6AA 1T18A 3CAXA 2VLGA 3BQAA 3BY9A 4F3LB 4CLCC 4WELA 4I39A 2YKFA 1OT9A 3BJNA 3E4QA 5HWWA 4LRXC 5AJGA 1OTDA 4P6ZS 4O0PA 4MN5A 3HCYA 3CUEC 2W1RA 1XFQA 1MC0A 2FZ0A 4HH3A 4BWIA 3D72A 5F5YA 2Z6DA 3MQOA 4GJ4A 5J7EA 4KQDA 2K2NA 3CLOA 4LLOB 1OJ5A 4PKYA 3LIDA 5DJUA 1VHMA 3LIEA 5C5KA 1P97A 4UEYA 4YNRA 1P0ZA 4EW7A 2L0WA 2WKQA 2W1TB 2VKSA 4KUKA 3LIBA 3NHQA 5G4ZA 5TBMB 5HDCA 4ETZA 2PDRA 1UWNX 1G28A 5HZHA 3KYZA 4PAUA 2HJEA 1STZA 4FOFA 4R6LA 2PR5A 3TW8A 2XA7S 2D01A 3K2NA 5TJJA 5HDSA 4F3LA 1YSPA 3VE3A 2XSSA 1TS6A 4AFIA 1F9IA 4BMWA 4KUOA 2W3DA 3C2WA 3IBJA 3T4KA 3V67A 5A8BA 1XFNA 2M7VA 4WEJA 5FL3A 5HPFA 4EUVA 3T4QA 2I9VA 2JKRI 3EEHA 1XJ2A 3F1OB 2O0YA 2OWJA 3OCLA 4CQHA 2W3FA 3A0RA 1T1BA 3A0SA 4EEUA 5KSHA 4QPRA 1D06A 4RQ9A 4Y3IA 4DMZA 1LSWA 4CLCD 3EGXC 2P7JA 4L0LA 3LUQA 4IHQA 3U2AA 2VV7A 1VB6A 2PD7A 2NUPC 4K08A 2PYRA 3D3OA 3NOPC 3BW6A 2O99A 3JVVA 5HSQA 1DP8A 3IS2A 2O9BA 1V9YA 2XA7M 3S7PA 4O01A 1DP6A 3RFBA 3EQUA 5HWVA 2LB9A 3H82B 1EW0A 2R78A 1P9WA 2XRNA 4NXGA 3S7QA 3TE8A 3GDIA 5F68A 4Z1WA 4BBUA 1LSVA 5L8MA 1UGUA 2P04A 4Y2FA 2ZMFA 3MMHA 2A2LA 3B33A 3MF0A 4WL9A 2BASA 1N9LA 1XJ6A 4GS9B 3R7WB 2JHEA 4ETXA 2GJ3A 3T4SA 2Y8HA 1DRMA 1YSQA 2VGLM 3PBRA 5KIZA 2O9CA 2V1BA 3KO6A 4I5SA 1ZHHB 4Q0JA 2W27A 1NLYA 4WF0A 3GECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P7N A;  1TS0 A;  2PR6 A;  4JGP A;  4XT2 B;  3ICY A;  3F1P B;  3VE4 A;  4HJ6 A;  1XJ3 A;  4EQ1 A;  4B9O A;  1GSV A;  2L4R A;  2QHK A;  3HJI A;  1Y28 A;  1OTA A;  1T1C A;  3SW1 A;  3KX0 X;  3UB7 A;  4GS9 A;  1LL8 A;  3F1N B;  2V1A A;  4GHI A;  2INW A;  5IS1 A;  1OTE A;  4HNB A;  4BBT A;  3LIF A;  3HJK A;  1D7E A;  4DJ2 A;  4EXO A;  4I3I A;  2KX6 A;  1S1Z A;  4HP4 A;  2W0N A;  4HJ3 A;  2OOL A;  1T1A A;  1OTB A;  3FC7 A;  3LYX A;  3FG8 A;  4EER A;  4I3J A;  3ZQ5 A;  3UMD A;  3MXQ A;  1UWP X;  5HDD A;  4L9E A;  4NXF A;  3VOL A;  3NJA A;  1BYW A;  3RH8 B;  5TBM A;  4LRY C;  4PKY G;  2H28 A;  1N9O A;  4GW9 A;  3UB8 A;  3RTY A;  4EEP A;  3A0V A;  4HHD A;  3LIA A;  5HWT A;  1DP9 A;  2ZOI A;  1S67 L;  4I38 A;  4H6J B;  2QJ5 A;  4WN5 A;  2A24 B;  2J80 A;  4R38 A;  1OT6 A;  2M1C A;  4WUJ A;  3H7W B;  2EA9 A;  3LI9 A;  2QWS A;  1KOU A;  4NXB A;  1JNU A;  2V9A A;  3OLO A;  5AVE A;  3LIC A;  2VV6 A;  3UB6 A;  3K3D A;  2YKH A;  3NOU C;  3IBR A;  4HP9 A;  3F1O A;  3NOT C;  3G6O A;  4WLA A;  5HD5 A;  4BBV A;  2JN7 A;  5IU1 A;  1MZU A;  3BY8 A;  4YWZ A;  4HQA A;  1OTI A;  2K7S A;  2HV1 A;  4R3A A;  3E4P A;  4M4X A;  4L9F A;  5HD3 A;  2D02 A;  2V0W A;  4LPZ A;  5G4Y A;  5J4E A;  4HOI A;  2VV8 A;  3LI8 A;  4DJ3 A;  5DJT A;  2A24 A;  3UE6 A;  5F69 A;  2PD8 A;  3H82 A;  1GSW A;  1F98 A;  3H7W A;  3ULF A;  3UME A;  1NWZ A;  4EET B;  2ZOH A;  3UB9 A;  4JGO A;  4LRZ E;  5DKL A;  1S4S A;  1OJG A;  4XT2 A;  1TS8 A;  1X0O A;  3F1P A;  1N9N A;  4R70 A;  1T19 A;  3IS2 B;  5EFW A;  4NXE A;  4I3A A;  3T50 A;  4MN6 A;  5J3W A;  4HJ4 A;  4JGR A;  4JGQ A;  4HI4 A;  2PHY A;  1XJ4 A;  2ZBB A;  3F1N A;  5DKK A;  1S1Y A;  3PHY A;  3EWK A;  3BWL A;  1LSX A;  3MQQ A;  3MR0 A;  2QJ7 A;  3E4O A;  3C8C A;  3CWF A;  3PYP A;  4GCZ A;  2PYP A;  1TS7 A;  3H9W A;  2B02 A;  2OWH A;  2Z6C A;  2WKP A;  2V0U A;  3K3C A;  1ODV A;  2QKP A;  2VEA A;  2CMN A;  5AVF A;  3MJQ A;  4HY8 A;  4EES A;  1LT0 A;  4E04 A;  2WKR A;  1GSX A;  1WA9 A;  4L9G A;  5I5L A;  1S66 L;  1S4R A;  2KDK A;  2L1M A;  4HIA A;  4HH2 A;  1V9Z A;  4H6J A;  4GHI B;  3MFX A;  5F6A A;  1T18 A;  3CAX A;  2VLG A;  3BY9 A;  4F3L B;  4I39 A;  2YKF A;  1OT9 A;  3E4Q A;  5HWW A;  4LRX C;  1OTD A;  4MN5 A;  1XFQ A;  4HH3 A;  3D72 A;  5F5Y A;  2Z6D A;  3MQO A;  5J7E A;  4KQD A;  5DJU A;  3CLO A;  4LLO B;  1OJ5 A;  4PKY A;  3LID A;  3LIE A;  1P97 A;  1P0Z A;  4EW7 A;  2L0W A;  2WKQ A;  4KUK A;  3LIB A;  3NHQ A;  5G4Z A;  5TBM B;  5HDC A;  2PDR A;  1UWN X;  1G28 A;  5HZH A;  4R6L A;  2PR5 A;  2D01 A;  5HDS A;  4F3L A;  3VE3 A;  1TS6 A;  1F9I A;  4KUO A;  3C2W A;  5A8B A;  1XFN A;  2I9V A;  3EEH A;  1XJ2 A;  3F1O B;  2OWJ A;  3A0R A;  1T1B A;  3A0S A;  4EEU A;  1D06 A;  4RQ9 A;  1LSW A;  2P7J A;  3LUQ A;  2VV7 A;  1VB6 A;  2PD7 A;  4K08 A;  2PYR A;  3NOP C;  5HSQ A;  1DP8 A;  3IS2 A;  1V9Y A;  1DP6 A;  5HWV A;  3H82 B;  1EW0 A;  2R78 A;  4NXG A;  3GDI A;  5F68 A;  4BBU A;  1LSV A;  1UGU A;  3B33 A;  4WL9 A;  2BAS A;  1N9L A;  1XJ6 A;  4GS9 B;  2JHE A;  2GJ3 A;  5KIZ A;  1DRM A;  2V1B A;  4I5S A;  2W27 A;  4WF0 A;  3GEC A; 
#chains in the Genus database with same CATH topology
 4ESP A;  2BLS A;  4JGP A;  2JE5 A;  4FH2 A;  3T1Q B;  1YAX A;  3QP5 A;  3ZFZ A;  1YM1 A;  4BLM A;  4EU0 A;  4FH4 A;  3T4T A;  2J3T C;  2B95 A;  1RP5 A;  1Z09 A;  1CEF A;  5CGW A;  2QHK A;  4OOL A;  2W3H A;  4CLC A;  2PU2 A;  3VP1 A;  2ZMV A;  4Y0T A;  1RGY A;  1K25 A;  3NBL A;  4OQI A;  2PBY A;  3SW1 A;  1QMF A;  3NDE A;  2EX6 A;  4GS9 A;  5DTS A;  3V5M A;  4RX3 A;  3QP4 A;  2KOI A;  1CI8 A;  2R9W A;  3EEA A;  2V1A A;  4KQO A;  1M40 A;  5IS1 A;  1OTE A;  4HNB A;  3ZG5 A;  2FH5 A;  3HJK A;  4MBH A;  3CPT B;  4S2N A;  4I3I A;  1S1Z A;  4KZB A;  4HJ3 A;  1E3U A;  3Q81 A;  3G4P A;  3FC7 A;  3T1X A;  1YPR A;  4GNU A;  3UMD A;  2Y59 A;  1LL9 A;  3BFE A;  1FIK A;  2Y55 A;  3RH8 B;  3IH9 A;  4LRY C;  1GHM A;  2Y2M A;  1N9O A;  3WRT A;  5J8X A;  5CHJ A;  3ITB A;  4JPM A;  1S67 L;  2J3T D;  3IXB A;  4UAA A;  1MKI A;  4I38 A;  2QJ5 A;  4WN5 A;  3TSG A;  2M1C A;  3V39 A;  4DE2 A;  3MZE A;  2EXA A;  1WE4 A;  2QWS A;  4PM9 A;  1JNU A;  2OV5 A;  3KSI A;  3LFV A;  3LIC A;  5GHZ A;  3NI9 A;  3K3D A;  2WGW A;  2YKH A;  1YLJ A;  3S1Y A;  3WS0 A;  3DTE A;  3W2Z A;  1CQA A;  5FQI A;  3F1O A;  4ZJ1 A;  3MBZ A;  3NOT C;  1DY6 A;  4E3J A;  2W3G A;  5CED A;  3BY8 A;  3VFH A;  1XA7 A;  1IFQ A;  2VJW A;  3E4P A;  5CGS A;  4M4X A;  3T4O A;  3ZNT A;  1TDL A;  5HAR A;  2D02 A;  4LPZ A;  5G4Y A;  5J4E A;  4ZDX A;  4JLF A;  1HVB A;  4XUZ A;  4Y15 A;  3VOZ A;  2DRW A;  2ZLY A;  5DJT A;  3UDI A;  1MKM A;  3A3E A;  3H82 A;  1ZTU A;  1F98 A;  4WMC A;  3RXX A;  1MPL A;  5TGF A;  1D1J A;  2VZW A;  3QNB A;  5F1F A;  5JYP A;  1W63 Q;  4MLL A;  5EM0 A;  1NWZ A;  1L0F A;  4OQ0 A;  1SZV A;  2GNX A;  1FIL A;  3HUN A;  4EET B;  1DJA A;  5GL9 A;  4Y7P A;  4UA9 A;  5LBR A;  1P9R A;  4G3W A;  2WAE A;  1PW1 A;  4YOF A;  1RCJ A;  3BM6 A;  3W4P A;  1IOU A;  2XR0 A;  1S4S A;  3D4F A;  3LY4 A;  4KZ9 A;  1OJG A;  2XRO A;  3NDG A;  2Z2L B;  3L7H A;  1OPX A;  3O3V A;  2PAV P;  3LEZ A;  5EVI B;  3TJZ C;  1N9N A;  4IBX A;  2Y2P A;  3CZD A;  2LB5 A;  1T19 A;  2ACG A;  5GHY A;  2Q9N A;  5FAS A;  2A49 A;  1FCO A;  1NZU A;  5CHM A;  4S2I A;  1J3W A;  4HJ4 A;  4FUW A;  4C6Y A;  1JWP A;  4Y13 A;  4P6Z M;  1MWR A;  1XGI A;  5CEC A;  4B4Z A;  4JGQ A;  1FSW A;  2PHY A;  4E3M A;  3EQV A;  2EX9 A;  4ME4 A;  1S1Y A;  2XF3 A;  3SS4 A;  3CHW P;  5FAO A;  4Q8I A;  3EWK A;  2B5R A;  3C38 A;  4FCF A;  4GDN A;  3JPU A;  1QME A;  1KGF A;  3O5Y A;  1JVJ A;  5DFY A;  2PYP A;  1HZO A;  2B02 A;  5TR7 A;  4MMN A;  2V0U A;  4WBG A;  2EX8 A;  4KQR A;  4N9K A;  3NY4 A;  4GN2 A;  2ZM0 A;  2Y2G A;  2E8J A;  3NC8 A;  4E04 A;  5DTK A;  4X69 A;  3C4O A;  3WS1 A;  1IYQ A;  4OLG A;  2HP6 A;  4L9G A;  4OON A;  3IQA A;  2HF6 A;  4HEF A;  4Y0U A;  4JKT A;  3CAX A;  2VLG A;  4M3K A;  4CLC C;  3UE1 A;  4WEL A;  1OT9 A;  2ZL1 A;  4OQG A;  4U0X A;  5HFO A;  5HWW A;  3OZH A;  2ZQ8 A;  1OTD A;  4O0P A;  1H8Z A;  3KYE A;  1MC0 A;  2FZ0 A;  2Z6D A;  2A3U A;  5AQ9 A;  5F1G A;  2K2N A;  4YNR A;  4S2N C;  1SHV A;  4EW7 A;  2W1T B;  2VKS A;  5HDC A;  2PDR A;  1UWN X;  3N8S A;  5HZH A;  5FQM A;  3KYZ A;  3PTE A;  3Q7V A;  2Q0O A;  4ID4 A;  5HDS A;  3VE3 A;  1TS6 A;  3G30 A;  4K91 A;  4BMW A;  2W3D A;  3G31 A;  1W5D A;  1BLP A;  4KZ3 A;  3N6I A;  4S2L A;  1MBL A;  4JF5 A;  3MKE A;  4ZJ3 A;  5AQA A;  3IF6 A;  3T4Q A;  1G6A A;  2OWJ A;  4NET A;  2DCF A;  1S6R A;  1T1B A;  1BUL A;  5KSH A;  1YLY A;  4DMZ A;  4CLC D;  3EGX C;  5EV0 A;  4IHQ A;  3VP0 A;  5KZH A;  2Z2M B;  2HPB A;  3D3O A;  4GB7 A;  4KEN B;  3O88 A;  1XGJ A;  4O01 A;  1DP6 A;  4OH0 A;  2ZQA A;  4DDS A;  2R78 A;  3BEC A;  3GDI A;  5DTT A;  1FR6 A;  4LCL A;  3MMH A;  3BYD A;  1N9L A;  1XJ6 A;  1EI5 A;  1LI0 A;  1VET A;  2GJ3 A;  4JXG A;  1DRM A;  3QHY A;  2P9V B;  4LV2 A;  5FAQ A;  2WZZ A;  2C6W B;  2HZ5 A;  1NLY A;  5FI7 A;  5HX9 A;  1TS0 A;  2PR6 A;  2MJ6 A;  4XT2 B;  1XX2 A;  3F1P B;  3HRE A;  4WEK A;  5E2E A;  1H8Y A;  2VGJ A;  3QP8 A;  3S7O A;  1MWS A;  2L4R A;  3AGE A;  3OCN A;  2W3E A;  1YLP A;  4NKP A;  4NK3 A;  1LI9 A;  1KGE A;  3MXR A;  1RGZ A;  3P01 A;  3KSH A;  1CJF A;  3UB7 A;  5HAI A;  1LL8 A;  1ERM A;  1HLU P;  3F1N B;  4R23 A;  4LFU A;  2PBD P;  4BBT A;  2HDS A;  3P98 A;  1N9B A;  1D7E A;  4XUX A;  4EXO A;  4IJG A;  2ZM8 A;  4EBP A;  1XA1 A;  4HP4 A;  3IF5 A;  4DN0 A;  2Y2H A;  3ZG0 A;  3FYZ A;  4DE1 A;  1NRJ A;  1T1A A;  3T4J A;  1Z6F A;  3PAE A;  2NUT C;  2J9P A;  4S2K A;  5EE8 A;  2VGL S;  1ONG A;  1UWP X;  1IYP A;  2K31 A;  4NXF A;  3NJA A;  2CC1 A;  1FCN A;  5IHV A;  5TBM A;  2J3W A;  4E3L A;  2H28 A;  2EFX A;  1G68 A;  4GW9 A;  4OP5 A;  3HLD A;  3ZGA B;  3PXP A;  1FCM A;  5HWT A;  3C7U A;  4DXC A;  4UA7 A;  4K0X A;  3W4Q A;  1IEM A;  5L07 A;  5GLA A;  2OAQ 1;  3MQ0 A;  4HES A;  4MNR A;  1OT6 A;  3G35 A;  4WUJ A;  3S7N A;  1KOU A;  2WUQ A;  5AVE A;  3JVU A;  2QYB A;  1YQS A;  3UO9 A;  5G18 A;  4YFM A;  4HP9 A;  3PR6 A;  1SKO A;  3R4K A;  3G6O A;  4ZRR A;  4BBV A;  3S4X A;  4PM5 A;  3E98 A;  4MBF A;  3C4P A;  2Y2N A;  2ZQD A;  4PMA A;  4L9F A;  2V0W A;  3DWZ A;  4IUK A;  2VV8 A;  1E25 A;  5FQQ A;  4U0T A;  1K57 A;  3HUO A;  2PD8 A;  2WK0 A;  3A3F A;  1Y4O A;  5KSC A;  3IT9 A;  2EX2 A;  4R3B A;  2HP5 A;  5EVI D;  2QPN A;  3RXW A;  4JF6 A;  2OLV A;  1IKI A;  3IXG A;  4C75 A;  2H0Y A;  2G2W A;  2B18 A;  1U60 A;  3KYQ A;  4ZTK A;  5A91 A;  4WYY A;  4LRZ E;  1G5U A;  5L09 A;  2RL3 A;  3A3J A;  5EEC A;  3ISG A;  1OME A;  3IF6 C;  1S0W A;  4ARZ B;  1W7F A;  3DTK A;  1W79 A;  3IS2 B;  5CRF A;  1PW8 A;  5FEF A;  3WS5 A;  4FSF A;  1ERO A;  3LR5 A;  1BZA A;  5EFW A;  2OLU A;  2EFU A;  3T50 A;  2Y79 A;  1W63 M;  3ZG9 B;  1K56 D;  4EBN A;  5DVA A;  2DMW A;  5CXW A;  3PBO A;  1TD5 A;  3OOV A;  4DE3 A;  4P85 A;  3O87 A;  1PZP A;  2DNS A;  1EWZ A;  1LSX A;  3UE0 A;  3CPT A;  3W4O A;  3NEC A;  5K5B A;  1KE0 A;  5EOE A;  2QJ7 A;  2GX5 A;  3E4O A;  3M2K A;  4O7D A;  4CPK A;  3C8C A;  3CWF A;  5CTM A;  4UQI S;  1YMX A;  4N1H A;  3WS2 A;  5CTN A;  4ARZ A;  3CIT A;  2V1Z A;  2WKP A;  3FKV A;  3ZNY A;  4GKU A;  3ZCZ A;  3HUM A;  4E3I A;  3K3C A;  1ODV A;  2VEA A;  2CMN A;  4X68 A;  4HY8 A;  4MCW A;  1MWT A;  3IXD A;  2J7V A;  4EES A;  2XFS A;  2WKR A;  1S66 L;  3DW0 A;  2VX8 A;  2L1M A;  3UB5 P;  3HLG A;  4KG5 A;  2HDR A;  4GHI B;  5FQJ A;  3G34 A;  4I39 A;  2YKF A;  1DJB A;  3BJN A;  4N1X A;  3HLF A;  3A3D A;  3HCY A;  2W1R A;  4HH3 A;  4DXB A;  4BWI A;  2V8F A;  5F5Y A;  4LLO B;  1N4O A;  1TVF A;  2XLN A;  2WKQ A;  3LIB A;  3NHQ A;  5G4Z A;  1NZO A;  3T1R A;  4ZBE A;  2UWX A;  1PIO A;  5I94 A;  4PAU A;  3VFF A;  2HJE A;  1BT5 A;  1XP4 A;  1STZ A;  4FOF A;  4R6L A;  3DTM A;  3TW8 A;  3IH8 A;  1M6K A;  3SS5 A;  2XD1 A;  2XSS A;  3O86 A;  4AFI A;  4JXS A;  4KUO A;  3V67 A;  5A8B A;  3G32 A;  2M7V A;  4WEJ A;  5FL3 A;  5A93 A;  3EEH A;  2AVX A;  1XJ2 A;  5CER A;  2ZMA A;  4LV3 A;  2X02 A;  3SH8 A;  4EEU A;  2ZJ9 A;  3G2Z A;  5DF7 A;  4Y3I A;  1LSW A;  1NJ4 A;  2P7J A;  4L0L A;  3LUQ A;  3U2A A;  2QMI A;  4WZ5 A;  1NRF A;  1VQQ A;  3ZDJ A;  2VV7 A;  1SDN A;  4K08 A;  4UA6 A;  2JBF A;  5EVI A;  3NOP C;  1ACF A;  4QU3 A;  4BL3 A;  3D9Y A;  1DP8 A;  4ZJ2 A;  3E2K A;  3GRJ A;  3MS6 A;  3RFB A;  3EQU A;  1ES3 A;  1HD8 A;  1GA9 A;  4R0Q A;  4YIN A;  1ES5 A;  2XRN A;  3BFC A;  4OPZ A;  2HDQ A;  4BBU A;  2WKH A;  1VEU B;  1ZC2 A;  3ZG7 B;  2XH9 A;  3R7W B;  4ETX A;  4X25 A;  1K57 C;  3PBR A;  3KO6 A;  4I5S A;  1NXY A;  4WM9 A;  2G2U A;  4Q0J A;  3N7W A;  4BD1 A;  4S2J A;  3GEC A;  4MDZ A;  4P87 A;  1FQG A;  5TFQ A;  1K56 A;  3ICY A;  4QB8 A;  4X56 A;  5GLB A;  5E2H A;  2JKT M;  4KZ4 A;  1PWG A;  1XJ3 A;  4EQ1 A;  4OPR A;  2ZC6 B;  4F94 A;  1NYY A;  4GOG A;  1KVL A;  4S2M A;  5EM1 A;  1G6O A;  1Y28 A;  4OOY A;  4EBL A;  4DF6 A;  3UE3 A;  1T1C A;  5A90 A;  4BD0 A;  4G3V A;  5A92 A;  3CUE A;  3BLM A;  3FV7 A;  2VGK A;  2Y2I A;  3EGD C;  3OPR A;  2INW A;  1CI9 A;  3LIF A;  4LV0 A;  1F5M A;  4DJ2 A;  2WZX A;  2WAD A;  4K0W A;  1KVM A;  2KX6 A;  1PRQ A;  2OOL A;  4KZA A;  1OTB A;  3KSG A;  1ALQ A;  3LYX A;  2J9O A;  2P08 A;  1L2S A;  3CG5 A;  3MXQ A;  4G3K A;  3BFG A;  4R3J A;  2W1T A;  5M18 A;  1L3L A;  2ZC7 A;  1KE4 A;  3CMZ A;  1BYW A;  3OC2 A;  3T4L A;  3NUL A;  2ZQC A;  3UB8 A;  1LL5 A;  3AGF A;  5EUA A;  3A0V A;  3C7V A;  4EEP A;  2VK3 A;  3LIA A;  4JBF A;  3B42 A;  2E8I A;  3BFD A;  4H6J B;  5IT5 A;  2V8C A;  1PNE A;  4OKP A;  3LCE A;  1DJC A;  3PBS A;  4NG2 A;  1PFL A;  1JTD A;  4MBK A;  3OLO A;  1J9M A;  3VP2 A;  4PPR A;  5AQB A;  2OAP 1;  3IBR A;  4U3T A;  4EQI A;  3N8L A;  1K55 A;  3QP6 A;  5FI6 A;  3GVB A;  3MKF A;  1WYB A;  3V3R A;  4WLA A;  3UNW A;  4C3Q A;  5IU1 A;  1IYO A;  2ZM2 A;  1MZU A;  4YWZ A;  5DFX A;  4HQA A;  5HAP A;  3MZD A;  1SDE A;  3MSH A;  4HOI A;  3VV4 A;  3LI8 A;  3LY3 A;  3ZHH A;  3GSG A;  3SH9 A;  2GDN A;  3UE6 A;  3IWO A;  4P6B A;  4KZ5 A;  4X55 A;  2JKT I;  4E3O A;  4PHT A;  3UME A;  1PI5 A;  3C30 A;  4LEN A;  1H3Q A;  4B88 A;  4P0M A;  5HPI A;  3LR4 A;  3IHB A;  4IUH A;  4QD4 A;  4QJG A;  1YKD A;  4Y5F A;  2P9V A;  4BQM A;  1PI4 A;  3N4I A;  5E43 A;  3QNC A;  5GLC A;  1JWZ A;  4XT2 A;  1X0O A;  3F1P A;  5L2F A;  2IWB A;  4OOM A;  4R70 A;  2WAF A;  3GV9 A;  4UHU A;  1K4F A;  2PU4 A;  5EPH A;  3M6B A;  1L0G A;  2M7U A;  2JKR M;  4NEE D;  4NXE A;  5AQ7 A;  2ZQ9 A;  4WZ5 C;  2JC7 A;  5EVI C;  1KE3 A;  4JGR A;  2UV0 E;  3SH7 A;  5FDS A;  3T12 B;  1H8M A;  1XJ4 A;  2ZBB A;  2H10 A;  2JKF A;  3F1N A;  5DKK A;  1K6S A;  2XDM A;  3BWL A;  5F83 A;  2WGI A;  2XGN A;  5GLD A;  3TG9 A;  3V3S A;  3TOI A;  2G7U A;  5CHU A;  3PYP A;  1BSG A;  4GCZ A;  3V50 A;  4GDB A;  4E3N A;  5GHX A;  4GD6 A;  1TS7 A;  3H9W A;  4Z9Q A;  1K38 A;  2WKE A;  2Y4A A;  3IHA A;  3HLW A;  1XPB A;  3Q1F A;  2X01 A;  3WRZ A;  2ZC3 B;  4WZ4 A;  2J8Y A;  3TRC A;  1SKF A;  4CLC B;  1LT0 A;  2ZD8 A;  3NIA A;  5FQK A;  4KQQ A;  1GSX A;  3LGO A;  4R4R A;  3L9K A;  1GA0 A;  5I5L A;  3G2Y A;  1S4R A;  2ZC5 B;  4PM6 A;  3MFX A;  4FD8 A;  1T18 A;  5F6A A;  3BRM A;  4JF4 A;  3IX3 A;  4F3L B;  4CJN A;  4H8R A;  4KZ6 A;  4LRX C;  1Q2P A;  1BLH A;  4P6Z S;  4MN5 A;  3CUE C;  4B4X A;  3MQO A;  3P09 A;  3CJM A;  2IWD A;  4KQD A;  3CLO A;  4PKY A;  5FEG A;  3DAV A;  1VHM A;  1XXM A;  4UEY A;  1A0K A;  5FQ9 A;  4PM7 A;  2L0W A;  3OPL A;  1ES4 A;  1MXO A;  1GHP A;  2WYX A;  5L10 A;  3HLC A;  4LV1 A;  2PR5 A;  2D01 A;  4F3L A;  2JKG A;  1L0D A;  3IX4 A;  5U47 A;  5D3O A;  3BLS A;  2WGW B;  1Q2Q A;  2ZC4 B;  4D2O A;  4EUV A;  1JTG A;  2I9V A;  2JKR I;  2XEP A;  3F1O B;  3HLB A;  3ZVW A;  2IWC A;  3OCL A;  4CQH A;  4ZAM A;  3A0R A;  4E6X A;  3A0S A;  3FZC A;  4QPR A;  5FA7 A;  4RQ9 A;  5M19 A;  1YT4 A;  4FTX A;  3QP2 A;  1TEM A;  4KG2 A;  1VB6 A;  2PD7 A;  1JWV A;  4IVI A;  5BOH A;  1K55 C;  3BW6 A;  3IS2 A;  2O9B A;  4OPQ A;  2XA7 M;  3S7P A;  3VMA A;  1CK3 A;  3JYI A;  3NCK A;  4KG6 A;  5HWV A;  3H82 B;  3A3I A;  1EW0 A;  4GD8 A;  4N9L A;  1P9W A;  5FDH A;  5HAQ A;  4E3K A;  1IEL A;  1LSV A;  5L8M A;  3DTI A;  4Y2F A;  2P04 A;  1ZG4 A;  2A2L A;  4QY6 A;  3B33 A;  3BEB A;  4WL9 A;  2BAS A;  5EVL A;  2JHE A;  1HTZ A;  4RA7 A;  3T4S A;  2Y8H A;  1YSQ A;  2VGL M;  3C5A A;  2O9C A;  3GTC A;  1K54 A;  3MXS A;  3IXH A;  2W27 A;  3UN7 A;  4WF0 A;  1YLT A;  1XFQ A;  4BEN A;  3P7N A;  4X1M A;  2H0T A;  4DE0 A;  1ONH A;  3VE4 A;  4HJ6 A;  3FPW A;  2FFY A;  4B9O A;  1GSV A;  1FSY A;  1TF1 A;  3GQZ A;  4HBT A;  5F82 A;  4B93 A;  1IKG A;  4OQH A;  3HJI A;  1OTA A;  1TDG A;  3IWI A;  5CX7 A;  2V2F F;  3FPV A;  4DKI A;  1E4D A;  2Q9M A;  3KX0 X;  5HW3 A;  2PT7 A;  2C5W B;  4GHI A;  3ZG8 B;  3Q07 A;  1XKZ A;  3Q7Z A;  3VP3 A;  1BUE A;  2W0N A;  3ZYT A;  3DBA A;  4IBR A;  2EXB A;  1WYC A;  3LEQ A;  3FG8 A;  4CLC E;  4EER A;  4OVD A;  4I3J A;  3UDF A;  3ZQ5 A;  5CEB A;  5HDD A;  3GMW A;  4L9E A;  4MN7 A;  3VOL A;  2XQZ A;  2I72 A;  4PKY G;  3RTY A;  4HHD A;  4S2P A;  2GZA A;  1DP9 A;  2ZOI A;  4S2O A;  3RJU A;  3ZVT A;  3HVF A;  4OP8 A;  2O9A A;  2A24 B;  2KLI A;  2J80 A;  4R38 A;  2HJ9 C;  1MY8 A;  3H7W B;  2EA9 A;  3LI9 A;  5KMW A;  4QWO A;  4NXB A;  2ZL1 B;  2V9A A;  4Q0H A;  2VV6 A;  3FKW A;  3UB6 A;  3NOU C;  2JCH A;  2VA0 A;  2X71 A;  4R4S A;  1ZG6 A;  1I2S A;  4DDY A;  3BQ8 A;  3BFF A;  5HD5 A;  1ES2 A;  3UPP A;  2JN7 A;  2HGV A;  1IYS A;  1OTI A;  2K7S A;  3SOI A;  4O8G A;  2HV1 A;  4R3A A;  1KDW A;  4GLQ A;  5E2G A;  3WWX A;  5HD3 A;  2BG1 A;  1NY0 A;  5HL1 A;  3EOI A;  4DJ3 A;  1KDS A;  3Q7V B;  2V20 A;  3PBT A;  5FSR A;  2A24 A;  2Y91 A;  5F69 A;  1CEG A;  1GSW A;  1MWU A;  3H7W A;  1H0M A;  3ULF A;  3UPN A;  3LR3 A;  2ZQ7 A;  2Y2O A;  3OBF A;  1VEU A;  3IX8 A;  1VM1 A;  4UQI M;  1I5Q A;  2XD5 A;  3IF6 B;  4N92 A;  3R7W A;  3B47 A;  4LGW A;  3UDX A;  2ZOH A;  3UB9 A;  1NLZ A;  3LO7 A;  4JGO A;  5DKL A;  2RCX A;  3OPP A;  4MEZ A;  3E0Y A;  3LR0 A;  4EV4 A;  4E6W A;  1TS8 A;  2IA2 A;  4BL2 A;  3HBR A;  2FFF B;  4II7 A;  1BLC A;  3OPH A;  3VOY A;  3CI6 A;  5DF9 A;  2BTF P;  2H5S A;  1CF0 A;  4I3A A;  4MN6 A;  4JXV A;  2QZ6 A;  4EWF A;  4Q0I A;  5J3W A;  1PWC A;  3W8K A;  2Y2J A;  5DF8 A;  2EWW A;  4EUZ A;  4QHC A;  5MC7 A;  4HI4 A;  5FI2 A;  1K6R A;  1F2K A;  1VET B;  4BJP A;  3PHY A;  4X1L A;  2HP9 A;  3MQQ A;  3MR0 A;  1LLB A;  1AWI A;  3PBQ A;  3VP4 A;  5HL6 A;  2WGV A;  3B3X A;  1ZKJ A;  4Y17 A;  4LCM A;  3UPO A;  2OWH A;  2XK1 A;  2Z6C A;  3T1S A;  2EWV A;  3DWK A;  5CGX A;  4DRT A;  1K54 C;  3KSF A;  3WS4 A;  1ESI A;  1W8Q A;  2QKP A;  3SZT A;  3U4L P;  5AVF A;  2WKI A;  3MJQ A;  5EOO A;  3MFD A;  4D60 A;  2XFT A;  2OSU A;  1E3U D;  3PBN A;  1WA9 A;  1NYM A;  2KDK A;  4IED A;  3SS3 A;  4HIA A;  4HH2 A;  1V9Z A;  2P74 A;  4H6J A;  1GHI A;  1YLW A;  3BQA A;  3BY9 A;  3HLE A;  4QY5 A;  3M2J A;  3E2L A;  4X6T A;  2Y2K A;  1I2W A;  5M1A A;  3E4Q A;  4HBU A;  4Y0O A;  3S22 A;  1YLZ A;  5AJG A;  4JXW A;  3D72 A;  4OPY A;  1PZO A;  1ESU A;  4GJ4 A;  5J7E A;  3HL9 A;  4R1G A;  5DJU A;  1OJ5 A;  5C5K A;  3LID A;  3FWL A;  3LIE A;  1P97 A;  1C3B A;  3IWQ A;  3VSK A;  1P0Z A;  2Y2Q A;  3AGD A;  4KUK A;  3ITA A;  1PYY A;  5TBM B;  4ETZ A;  3Q82 A;  1G28 A;  3PAG A;  1O07 A;  4OLD A;  2R9X A;  4GZB A;  5EVE A;  1K4E A;  2XA7 S;  1AXB A;  1YMS A;  3K2N A;  3M6H A;  4RYE A;  5TJJ A;  1YSP A;  1KGG A;  3N8R A;  1F9I A;  5FAP A;  3C2W A;  4KZ7 A;  3IBJ A;  1H5X A;  3T4K A;  1O7E A;  3GR2 A;  1XFN A;  1L0E A;  1Y54 A;  1ERQ A;  5HPF A;  1SKO B;  4RVA A;  1LHY A;  2O0Y A;  1BLS A;  2W3F A;  1BTL A;  4KZ8 A;  4WMC D;  1D06 A;  1FOF A;  3I7J A;  2NUP C;  1GCE A;  2PYR A;  3VSL A;  5E2F A;  4A5R A;  4X53 A;  4PM8 A;  2O99 A;  3JVV A;  5HSQ A;  3UY6 A;  1V9Y A;  2LB9 A;  1K0K A;  3QP1 A;  4RX2 A;  4NXG A;  3S7Q A;  3TE8 A;  5F68 A;  4Z1W A;  1FR1 A;  1UGU A;  2ZMF A;  1SCW A;  3MF0 A;  1W8Y A;  4GS9 B;  5FAT A;  4IVK A;  5JYO A;  2HDU A;  5KIZ A;  1PWD A;  2V1B A;  2Y2L A;  2PRF A;  1ZHH B;  3MZF A;  4XXR A; 
#chains in the Genus database with same CATH homology
 4MDZ A;  3P7N A;  1TS0 A;  2PR6 A;  4JGP A;  2MJ6 A;  4XT2 B;  3ICY A;  3F1P B;  3VE4 A;  2JKT M;  4WEK A;  1YAX A;  4HJ6 A;  3FPW A;  4EU0 A;  3T4T A;  1XJ3 A;  2J3T C;  4EQ1 A;  3S7O A;  4B9O A;  1GSV A;  2L4R A;  4B93 A;  1TF1 A;  3OCN A;  2W3E A;  2QHK A;  4NKP A;  4OOL A;  2W3H A;  4CLC A;  1G6O A;  1Y28 A;  3HJI A;  1OTA A;  5CX7 A;  2ZMV A;  3FPV A;  3UE3 A;  1T1C A;  3P01 A;  3SW1 A;  3KSH A;  3KX0 X;  3UB7 A;  4G3V A;  4GS9 A;  3CUE A;  1LL8 A;  2KOI A;  3EGD C;  2PT7 A;  3F1N B;  3EEA A;  2V1A A;  4GHI A;  4KQO A;  2INW A;  5IS1 A;  1OTE A;  4HNB A;  4BBT A;  2FH5 A;  3LIF A;  1F5M A;  3HJK A;  1D7E A;  4DJ2 A;  4EXO A;  4IJG A;  4I3I A;  2KX6 A;  1S1Z A;  4HP4 A;  4DN0 A;  2W0N A;  4HJ3 A;  3ZYT A;  2OOL A;  3DBA A;  1NRJ A;  1T1A A;  3T4J A;  1OTB A;  3KSG A;  2NUT C;  3FC7 A;  3LYX A;  3FG8 A;  4CLC E;  2P08 A;  4EER A;  4I3J A;  2VGL S;  3ZQ5 A;  3UMD A;  3MXQ A;  1UWP X;  4G3K A;  5HDD A;  4L9E A;  2K31 A;  4NXF A;  4MN7 A;  2W1T A;  3VOL A;  3NJA A;  1BYW A;  3RH8 B;  3OC2 A;  5TBM A;  2J3W A;  4LRY C;  3T4L A;  4PKY G;  2H28 A;  1N9O A;  4GW9 A;  3UB8 A;  3PXP A;  3RTY A;  4EEP A;  3A0V A;  4HHD A;  3LIA A;  5HWT A;  3B42 A;  2GZA A;  1DP9 A;  2ZOI A;  1S67 L;  2J3T D;  4I38 A;  4H6J B;  2QJ5 A;  5IT5 A;  2O9A A;  2OAQ 1;  4WN5 A;  2A24 B;  2KLI A;  2J80 A;  4R38 A;  3MQ0 A;  1OT6 A;  2HJ9 C;  2M1C A;  3PBS A;  4WUJ A;  3S7N A;  3H7W B;  2EA9 A;  3LI9 A;  2QWS A;  1KOU A;  4NXB A;  1JNU A;  2V9A A;  3KSI A;  3OLO A;  3LFV A;  5AVE A;  3LIC A;  2VV6 A;  3JVU A;  4Q0H A;  3UB6 A;  3K3D A;  2YKH A;  2QYB A;  3NOU C;  2OAP 1;  3IBR A;  3W2Z A;  4HP9 A;  3PR6 A;  3F1O A;  2VA0 A;  3NOT C;  3R4K A;  3G6O A;  4WLA A;  4ZRR A;  3BQ8 A;  5HD5 A;  4BBV A;  2W3G A;  2JN7 A;  3E98 A;  2HGV A;  5IU1 A;  1MZU A;  3BY8 A;  4YWZ A;  5DFX A;  4HQA A;  1OTI A;  2K7S A;  1IFQ A;  4O8G A;  2HV1 A;  4R3A A;  2VJW A;  3E4P A;  4GLQ A;  4M4X A;  3T4O A;  4L9F A;  5HD3 A;  2D02 A;  2V0W A;  4LPZ A;  5G4Y A;  5J4E A;  4IUK A;  4HOI A;  3VV4 A;  3LI8 A;  2VV8 A;  3EOI A;  4DJ3 A;  3PBT A;  5DJT A;  2A24 A;  3UE6 A;  1MKM A;  5F69 A;  2PD8 A;  3H82 A;  1GSW A;  1ZTU A;  1F98 A;  3H7W A;  3ULF A;  2JKT I;  2VZW A;  4PHT A;  3UME A;  1W63 Q;  3LR3 A;  1NWZ A;  3C30 A;  3OBF A;  1H3Q A;  4UQI M;  5HPI A;  3R7W A;  2GNX A;  2B18 A;  3LR4 A;  3B47 A;  4EET B;  2ZOH A;  4IUH A;  3UB9 A;  3KYQ A;  5LBR A;  1P9R A;  4G3W A;  1YKD A;  4Y5F A;  1NLZ A;  4JGO A;  4LRZ E;  5DKL A;  4YOF A;  1IOU A;  1S4S A;  1OJG A;  2XRO A;  3E0Y A;  3LR0 A;  4XT2 A;  1TS8 A;  1OPX A;  2IA2 A;  1X0O A;  3F1P A;  3TJZ C;  1N9N A;  4OOM A;  4R70 A;  2LB5 A;  4II7 A;  4ARZ B;  1T19 A;  3CI6 A;  3IS2 B;  5DF9 A;  2M7U A;  4FSF A;  2JKR M;  3LR5 A;  5EFW A;  4NEE D;  4NXE A;  4I3A A;  3T50 A;  4MN6 A;  2Y79 A;  1W63 M;  4Q0I A;  5J3W A;  4HJ4 A;  2DMW A;  3PBO A;  1TD5 A;  3OOV A;  4JGR A;  4P6Z M;  2EWW A;  5MC7 A;  4JGQ A;  4HI4 A;  1H8M A;  2PHY A;  1XJ4 A;  2ZBB A;  3EQV A;  4BJP A;  3F1N A;  4ME4 A;  1S1Y A;  5DKK A;  3PHY A;  3EWK A;  3BWL A;  1LSX A;  3C38 A;  3MQQ A;  3MR0 A;  5K5B A;  2QJ7 A;  2GX5 A;  3PBQ A;  3E4O A;  2G7U A;  3C8C A;  3CWF A;  3O5Y A;  3PYP A;  4GCZ A;  5HL6 A;  5DFY A;  4UQI S;  2PYP A;  1TS7 A;  3H9W A;  2B02 A;  4ARZ A;  2OWH A;  2Z6C A;  3CIT A;  2WKP A;  2EWV A;  4MMN A;  2V0U A;  3KSF A;  3K3C A;  1ODV A;  2QKP A;  2VEA A;  2CMN A;  5AVF A;  3MJQ A;  4HY8 A;  3TRC A;  4MCW A;  4CLC B;  1LT0 A;  4EES A;  4E04 A;  2WKR A;  1GSX A;  3PBN A;  1WA9 A;  4L9G A;  5I5L A;  1S66 L;  1S4R A;  2KDK A;  2HF6 A;  2VX8 A;  2L1M A;  4HIA A;  4HH2 A;  1V9Z A;  4H6J A;  4GHI B;  3MFX A;  5F6A A;  1T18 A;  3CAX A;  2VLG A;  3BQA A;  3BY9 A;  4F3L B;  4CLC C;  4WEL A;  4I39 A;  2YKF A;  1OT9 A;  3BJN A;  3E4Q A;  5HWW A;  4LRX C;  5AJG A;  1OTD A;  4P6Z S;  4O0P A;  4MN5 A;  3HCY A;  3CUE C;  2W1R A;  1XFQ A;  1MC0 A;  2FZ0 A;  4HH3 A;  4BWI A;  3D72 A;  5F5Y A;  2Z6D A;  3MQO A;  4GJ4 A;  5J7E A;  4KQD A;  2K2N A;  3CLO A;  4LLO B;  1OJ5 A;  4PKY A;  3LID A;  5DJU A;  1VHM A;  3LIE A;  5C5K A;  1P97 A;  4UEY A;  4YNR A;  1P0Z A;  4EW7 A;  2L0W A;  2WKQ A;  2W1T B;  2VKS A;  4KUK A;  3LIB A;  3NHQ A;  5G4Z A;  5TBM B;  5HDC A;  4ETZ A;  2PDR A;  1UWN X;  1G28 A;  5HZH A;  3KYZ A;  4PAU A;  2HJE A;  1STZ A;  4FOF A;  4R6L A;  2PR5 A;  3TW8 A;  2XA7 S;  2D01 A;  3K2N A;  5TJJ A;  5HDS A;  4F3L A;  1YSP A;  3VE3 A;  2XSS A;  1TS6 A;  4AFI A;  1F9I A;  4BMW A;  4KUO A;  2W3D A;  3C2W A;  3IBJ A;  3T4K A;  3V67 A;  5A8B A;  1XFN A;  2M7V A;  4WEJ A;  5FL3 A;  5HPF A;  4EUV A;  3T4Q A;  2I9V A;  2JKR I;  3EEH A;  1XJ2 A;  3F1O B;  2O0Y A;  2OWJ A;  3OCL A;  4CQH A;  2W3F A;  3A0R A;  1T1B A;  3A0S A;  4EEU A;  5KSH A;  4QPR A;  1D06 A;  4RQ9 A;  4Y3I A;  4DMZ A;  1LSW A;  4CLC D;  3EGX C;  2P7J A;  4L0L A;  3LUQ A;  4IHQ A;  3U2A A;  2VV7 A;  1VB6 A;  2PD7 A;  2NUP C;  4K08 A;  2PYR A;  3D3O A;  3NOP C;  3BW6 A;  2O99 A;  3JVV A;  5HSQ A;  1DP8 A;  3IS2 A;  2O9B A;  1V9Y A;  2XA7 M;  3S7P A;  4O01 A;  1DP6 A;  3RFB A;  3EQU A;  5HWV A;  2LB9 A;  3H82 B;  1EW0 A;  2R78 A;  1P9W A;  2XRN A;  4NXG A;  3S7Q A;  3TE8 A;  3GDI A;  5F68 A;  4Z1W A;  4BBU A;  1LSV A;  5L8M A;  1UGU A;  2P04 A;  4Y2F A;  2ZMF A;  3MMH A;  2A2L A;  3B33 A;  3MF0 A;  4WL9 A;  2BAS A;  1N9L A;  1XJ6 A;  4GS9 B;  3R7W B;  2JHE A;  4ETX A;  2GJ3 A;  3T4S A;  2Y8H A;  1DRM A;  1YSQ A;  2VGL M;  3PBR A;  5KIZ A;  2O9C A;  2V1B A;  3KO6 A;  4I5S A;  1ZHH B;  4Q0J A;  2W27 A;  1NLY A;  4WF0 A;  3GEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...