2PDHA

Human aldose reductase mutant l300p complexed with uracil-type inhibitor at 1.45 a.
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
315
structure length
315
Chain Sequence
b'ASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCAPLSCTSHKDYPFHEEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title Merging the binding sites of aldose and aldehyde reductase for detection of inhibitor selectivity-determining features.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 103
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2007-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2pdhA00
1VP5A 2ACRA 1S2AA 3UGRA 1HQTA 2PD5A 2PDUA 3R8HA 4RPQA 2QXWA 2HEJA 4GCAA 1AZ1A 2HDJA 3QKZA 3GHTA 4JTQA 4LAZA 3M0IA 3GUGA 1S2CA 1PZ1A 1Q5MA 2IPWA 1ZGDA 5AZ1A 3FX4A 4JQ3A 3COTA 5KETA 2HVNA 2ACUA 4DBUA 2IS7A 2PDLA 3LBOA 3UZWA 1OG6A 4XZHA 4FALA 3Q67A 4JQ1A 4QX4A 1QWKA 1XGDA 1X98A 2F38A 2INZA 3V35A 4XZMX 3R43A 1UR3M 1Q13A 2BP1A 4YVXA 4GACA 3EAUA 3UYIA 5JH1A 3CASA 4IJRA 4YVPA 4YVVA 3MC5A 3WBXA 1R38A 1AFSA 3LNMA 4JQ2A 2FZBA 2IKIA 4WDWA 4JQ4A 3LD5A 1JEZA 1QRQA 1YE6A 3LUTA 2IKGA 2IKHA 1EL3A 3KRBA 3M4HA 1Z3NA 4JTDA 5HNTA 3O0KA 4JTRA 4JIRA 4H8NA 3UP8A 3LQLA 2HVOA 3WG6A 3NTYA 4LB3A 3RX2A 2HE5A 2ACSA 1X97A 2IPGA 3WBWA 3LQGA 4XZNX 1EF3A 2PDQA 4GQGA 4LB4A 1AH3A 2DUZA 1ZQ5A 1EKOA 2IQ0A 4MHBA 4WGHA 2IQDA 4Q7BA 4ASTA 3WBYA 4Q3MA 1ZUAX 3H4GA 1IHIA 2BGQA 5LIKX 3V0UA 3GHUA 1Z8AA 2PDIA 1HW6A 4I5XA 1YNQA 1J96A 3LZ5A 4WDUA 4EXBA 4XZIA 5M2FX 3R6IA 3ERPA 4JIIX 4FZIA 3BUVA 1RY8A 4DZ5A 4G5DA 1RY0A 2F2KA 2PDYA 2P5NA 5LIWX 2IPJA 2PDKA 3BV7A 2PZNA 4XK2A 4IJCA 5AZ0A 1VBJA 1A80A 2FZ8A 1X96A 4GQ0A 2ISFA 1M9HA 1XJBA 3O3RA 4WDTA 1AH4A 3C3UA 4JTAA 1EXBA 2PDXA 2FZDA 3P2VA 3R94A 2ACQA 4GA8A 1PWMA 3CMFA 2PDMA 3RX3A 5LIXX 1K8CA 4ZFCA 4DBSA 4OTKA 3LENA 1ADSA 4XVDA 2WZTA 3FJNA 2DUXA 3BURA 3R8GA 1XF0A 3UG8A 3CV6A 2IKJA 3G5EA 3Q65A 3VXGA 5JH2A 4QXIA 4LBSA 3UZYA 2PDWA 1PZ0A 3T42A 3G1RA 2PD9A 4QR6A 1RALA 4FAMA 2VDGA 2I16A 2FGBA 1MI3A 2R24A 4GIEA 3EB3A 4LAUA 4PRRA 3B3DA 3U2CA 1AH0A 4JQAA 3MB9A 2PEVA 2BGSA 4EXAA 1GVEA 4NKCA 3UWEA 4FA3A 3UZXA 3N2TA 4PRTA 3LEPA 3M64A 2PDBA 4IGSA 2FVLA 2C91A 3N6QA 2J8TA 1LQAA 5LIUX 5DANA 3V36A 3UFYA 3BCJA 2PDGA 2HV5A 4L1WA 3V0TA 4JTCA 4HBKA 2IPFA 3ONBA 2CLPA 1C9WA 4WRHA 3GHRA 4LBRA 2DV0A 1YNPA 2INEA 3D3FA 2HE8A 4L1XA 1T41A 4QBXA 3RX4A 3V0SA 2NVDA 3LN3A 3GHSA 4JIHA 2PFHA 1Z9AA 2PF8A 2ALRA 1S1RA 5LIYX 1AZ2A 1MZRA 1IEIA 4XAPA 2FZ9A 1YE4A 4PR4A 3H7RA 2NVCA 3CAQA 2WZMA 3S3GA 3ONCA 3LZ3A 1PWLA 4PUWA 4H7CA 2PDJA 5C7HA 4F40A 3R7MA 1LWIA 4DBWA 1PYFA 4YS1A 1S1PA 1US0A 2A79A 3WCZA 1Z89A 2I17A 4PUUA 2AGTA 1FRBA 1MRQA 4WEVX 3R58A 4XO7A 4YU1A 1T40A 3UZZA 4WDXA 4XO6A 2PDFA 4GABA 3DOPA 4PMJA 4XZLX 1ZSXA 2R9RA 2PDNA 4AUBA 2PDPA 5HA7A 3CAVA 4HMNA 3DN5A 3EB4A 2PDHA 4XVEA 2PDCA 3F7JA 4R9OA 1SM9A 3CV7A 4ICCX 5HNUA 3H7UA
chains in the Genus database with same CATH superfamily
3NIYA 1K8XA 1FWSA 4J2MA 3IIZA 4QJ3B 1S2AA 1ZJAA 4F3HA 2A6NA 1JCNA 2OQLA 2HXTA 3W27A 1H7NA 2JQXA 5AHEA 1LYXA 3B05A 3M0KA 4LAOA 3CUJA 3C2VA 1E3XA 5C2CA 3SCUA 3SN4A 1I1XA 5G2WA 1FWAC 2RFGA 3COTA 1OCQA 1TYGA 1NELA 3BJTA 2UY5A 3T1GA 2HPIA 5BWFA 3F1QA 3I3DA 1IF2A 1ME7A 1YMYA 1QWKA 4DYEA 5HQMA 4GUGA 3P81A 4NU7A 3EZ4A 3EWBX 3T40A 1H1ZA 1RBOB 5DMLA 1GTHA 2W63A 4RL3A 4K7YA 2JFEX 3BSMA 4B3LA 3R8RA 2ZKMX 3UYIA 3CASA 1CWYA 3CT7A 1GZJA 2TMDA 3SCRA 4YVVA 3TYUA 3L9CA 1EXPA 1VFSA 1ECQA 4QLLA 1VZWA 3KZSA 1HO1A 4WIWA 4KEZA 1E6RA 1DVJA 3G18A 1RJPA 1JAKA 1V02E 2EG8A 3UR7A 1UR2A 4BK9A 3V5FA 1JEZA 1QRQA 1MO0A 5A3HA 2WZEA 2PTYA 2PGWA 1P7TB 5EB8A 2XUCA 4JTDA 3VAVA 3O0KA 2E6FA 4EXQA 2QIIA 3ZWTA 3JZUA 1I2RA 1RP9A 5DXYA 2FFCA 3RX2A 1K9TA 4R27A 7PTDA 1DTUA 1MRAA 1PKNA 1B3VA 4NAEA 3ARSA 1V7AA 4AMAA 2DU2A 2AKMA 4RE3A 3DECA 4MKNA 3UWVA 2MUCA 3K8MA 1OF8A 3II1A 2C14A 2OZ8A 3OIHA 5D2VA 4CVWA 4H6RA 4U31A 2OGJA 3NXFA 4CD5A 3XINA 2WCSA 4ADTA 5E1QA 4MWAB 2QEZA 1L0PA 4ZO8A 3W24A 3U8GA 1TQXA 1UR9A 3M5YA 4QJ5B 7ODCA 5EBUA 3PZMA 1O7AA 5BOFA 1UD4A 1H0GA 4AZIA 4Q8NA 1QOPA 3AC0A 3JZEA 3W74A 2WNWA 1TPWA 4HK5A 3E9AA 1I2PA 1RD6A 3VNZA 2DDXA 4QEHA 4GXPA 4OWGA 3FN9A 1ZBWA 2XN2A 2GQAA 3ZM8A 1XJBA 5I3DA 1XX1A 1FWWA 3VINA 4EACA 4N4PA 1EPXA 4GVGA 1KLZA 3S2CA 4LYKA 4DYKA 2ZVIA 3NEHA 3P2VA 3R12A 5J04A 4IIBA 4I90A 3VGEA 1LLWA 5C70A 3HBLA 2NVAA 5E93A 3U3HA 3RO8A 3G1HA 4Z0JA 5A8MA 4ZCWA 3BAKA 3WQCA 3W28A 4F2TA 2Y8VA 1XDJA 1ADSA 1BWKA 3FV9A 1EYWA 3KWSA 4C90A 3Q94A 2WZTA 3WLNA 4WR3A 1LORA 2CZFA 1H5VA 3AALA 2XHYA 3NZPA 4TX8A 1QWGA 1EDQA 4D6EA 1EIBA 2Z1SA 2KX9A 2Y7DA 3SUWA 1MFUA 5BNKA 3LSCA 3NUKA 3BDKA 4FOJA 3AS1A 2DSVA 4JQAA 3DBPA 1RQHA 1PO9A 1ZNNA 3MW7A 3CH9A 4HHMA 4O15A 4MFEA 3RPTA 4UOZA 3UZXA 2WLYA 1TIMA 2P88A 4O1DA 2PAJA 3EWDA 5BXRA 3RFAA 3T55A 4GUIA 4WLCA 4LNYA 3W1MA 4C1NA 4DN1A 4O19A 2J7GA 2EJAA 1X1ZA 2WSPA 4GISA 2BGNE 4L61A 1BKSA 4JTCA 2GK1A 3NM1A 3E0WA 3N3MA 2OU4A 3KRZA 5A2CA 3SN0A 3SCQA 4DJED 3HZ3A 2Z1BA 3F2CA 3N2BA 1FKXA 5CH9A 2WJZA 1TKKA 3CIVA 2VWSA 3V5OA 2XVNA 1Q2SA 1T41A 3EWZA 4O10A 2YLAA 4UQAA 1J11A 3TOYA 3S1UA 3W26A 4O17A 3OZYA 1NY1A 4R33A 3S5YA 5ABGA 2AKZA 3QH2A 1EYEA 2PFHA 1HX0A 2PUZA 2QHAA 5FA5A 4AIOA 1E56A 1KXHA 1WZKA 2DH2A 3MKCA 1G1YA 3WLKX 3NPWA 3WQ8A 3H7RA 4I6VA 3E12A 2VD8A 1O66A 3LBMA 2B4GA 2BVWA 3SCSA 1KCLA 4I5RA 1DJHA 3QXBA 3W02A 3BVJA 3WY1A 1Z32X 2BHUA 1AL7A 4JFWA 2O7QA 4CUCA 2BG5A 4MUZA 4DWSC 3DU0A 5I3IA 4XIMA 3NA8A 4O1EA 4XO7A 4LOCA 2ZX6A 1E55A 5CSRA 7TAAA 3HTWA 1XS2A 3FXYA 4GYFA 3N17A 2VDIA 2RGLA 2CLOA 4DM1A 2J4GA 3FSTA 1SR0A 4TV5A 1KNWA 2OQYA 4PTDA 1LL6A 3U9IA 2CBUA 5IBXA 5BZAA 1DTNA 5DMYA 3IK2A 4JS3A 1KO0A 5T91A 3VUPA 4ICCX 1TX2A 1Q8JA 3NVTA 2C8NA 4R7JA 3WLJA 2VEPA 4KW2A 4C1LA 2QCGA 4DJFC 1HKJA 2WANA 1D9EA 1RPXA 1N7KA 1NOFA 1CNVA 3A9IA 3NVDA 3WEZA 4E4FA 3H53A 2ICSA 5CPNA 3UWYA 3V7PA 5KZEA 3GHTA 2Z0IA 1IE7C 3GSMA 1J8VA 3KCOA 5REQB 2BXVA 4JTQA 4IT1A 3BZGA 3HGSA 2BVDA 3OEXA 4S3BA 2A3BA 3WK0A 2Y62A 1LRNA 3E49A 1J9YA 4PTNA 4CCEA 1ITCA 2IS7A 1CXFA 1W2VA 1HN1A 4C6DA 3CEPA 2CC0A 1KR1A 3QLLA 5A8OA 4QX4A 3SY8A 1VS1A 1FWBC 3A9BA 2UWFA 1K77A 3HURA 4LY8A 1HUVA 4GCXA 2E5CA 2F38A 3WJSA 1XV8A 3PR2A 4HNVA 1Q8AA 3DENA 1GJWA 2NLYA 4YVXA 3OLGA 1TWZA 5EMJA 2BY3A 2XVGA 1N8FA 3KLLA 2DY3A 1J18A 4HVXA 3MC5A 4FX8A 3L5MA 2F6UA 1MEHA 4EIVA 3SQLA 4LS2A 3M0XA 2WHJA 3P74A 5LA2A 2ZVRA 4MNKA 4HHPA 1XL9A 2R8WA 2V3FA 1WKDA 2D0GA 3CK5A 2CWNA 1P1MA 1EHNA 3GZ3A 4H8NA 1ZLPA 1FCVA 3L21A 7REQB 4YTSA 4CD7A 5LNRA 1UZ1A 2E8ZA 4NUWA 1OJXA 1J01A 3G0SA 5KMYA 3GIQA 1A5SA 1V4YA 4AIUA 1XH2A 2J9XA 3A12A 1SGJA 3ZJKA 2RGMA 2E28A 5CJMA 3HJZA 4ZENA 3HQOA 4MHBA 4N2YA 1SZFA 3TFXA 5IHSA 1J0KA 4IF2A 1A5CA 4BF9A 1U1HA 4QTGA 3GHUA 4UQCA 1EJWC 4F0KA 1MQRA 4I5XA 9CGTA 3FYYA 1W8GA 3EA1A 2NQ5A 1C9DA 4I6KA 3DHDA 5JBDA 1HJUA 1FH8A 1RY0A 4JKKA 5FIPA 3HPXA 4MPQA 5CBBA 3TR9A 5A6TC 4HOZA 2C1HA 4PEKA 2OG9A 4LQ1A 1R46A 2V9DA 2J27A 1FOBA 2QDHA 8RUCA 3CPUA 3M0MA 5I07A 2QF7A 5FAGA 3UPMA 1AH4A 1EP3A 5BWAA 4GZEA 3FDKA 1EXBA 2W62A 1QK2A 4WX2A 1POKA 4GGHA 3EA3A 1ZPTA 5C5YA 4FHAA 1PWMA 2YGYA 3PS7A 1LLZA 4GYPA 2PWFA 2WJEA 1ZENA 4JHOA 3THDA 1EEXA 4IPJA 5I03A 2Y1HA 4DBSA 2YOCA 5A1AA 3NO1A 3VGFA 5I3FA 4HZMA 5CPLA 1HJWA 5HQLA 4GRSA 4ATDA 1E6PA 3LTYA 4AZCB 1MYRA 2OSWA 1EP2A 1V3MA 5LSMA 2J7BA 8XIMA 1G4TA 3UU0A 1Q6QA 3CUIA 4MLRA 2PMQA 2X0YA 1I4NA 1LT8A 2WCGA 3GG7A 2QUTA 5FEWA 4HZ6A 4UB9A 2GZXA 2CESA 1BYDA 1XYMA 2V5BA 1B0IA 2GL5A 3AROA 2E3ZA 1HVQA 1GVEA 3PZVA 4XSMA 3CHCA 1D7FA 4H8HA 3TONA 4MMWA 1EWDA 1NDYA 2EGZA 2PBOA 3LTPA 4H6QA 4D8AA 3CQHA 4V33A 4WKHA 3EOSA 1AVAA 3AXXA 3BOFA 3CUGA 1P43A 2Y6ZA 1H41A 4OIFA 2EBNA 4FI4A 3KUMA 1FFRA 1E70M 5D37A 2Z27A 2ZA3A 2CLHA 3CT2A 3VM7A 1IR1A 3GU2A 3UJSA 1KBBA 2FDSA 3P8JA 2WB5A 4E4PA 3MBFA 3FEMA 4L4OA 2ABBA 3QLDA 2ATMA 2ONEA 3BLKA 5AYYA 2DV0A 3GXDA 4PH6A 5DX7A 3AU6A 4Y9PA 2J7EA 3V0SA 2ZZ1A 2ZE3A 5F1VA 1GOQA 4DO6A 1MUWA 2R1MA 4BCEA 4EOUA 2H8XA 1GHSA 1TVLA 5LIYX 5DQPA 3MUAA 3ZT5A 1GNXA 3SJNA 3DC0A 1HGWA 1C90A 2JK2A 5CLTA 1YKWA 1G6CA 5A6JA 2NVCA 4JTLA 1TUFA 4FSAA 2B7QA 9XIMA 1WDSA 4V2XA 2NT0A 4YNGA 3SY1A 5CLWA 5I09A 3AYVA 3STEA 2YB1A 3QKEA 1XLEA 5CC5A 1PPIA 1US0A 2OVLA 2I17A 4GE8A 4O50A 3ZXWA 3UPBA 1GQLA 4R5EA 2XFRA 3AXMA 3CWOX 1Q85A 3WQFA 4GVIA 4GUFA 1V51A 4Q22A 4AHQA 5D09A 2Z4GA 2POTA 1GTEA 3V1HA 4AIEA 5CC6A 4LYQA 3LS9A 4PMJA 2VFDA 4XZLX 2X1UA 3LPPA 2R9RA 1B3XA 3C0JA 1WKFA 2Y8KA 1WZMA 1CT5A 3DN5A 4B2DA 2V63A 4UXDA 2OX1A 3CQJA 4O1AA 1J10A 3TTYA 2VTFA 3RYSA 3AXKA 3EKZA 4MB1A 3ZJ6A 5J5RA 3KP0A 3UXKA 3B4YA 4QNEA 3GIYA 4OECA 5CG0A 1N8WA 1SO5A 2OZ3A 3TYDA 3TTQA 3B9AA 1PAMA 3GD6A 1FWJC 5D9OA 4M0XA 4S3EA 1J12A 2PDUA 4W84A 3WLTA 3FKRA 1JL8A 4RPQA 1Q6LA 1FWIC 4CCZA 3M5ZA 4AHPA 1WOAA 2ZX8A 3EEZA 3NQ2A 3FYOA 3M0VA 5F2GA 4E4UA 2PZ0A 1JXJA 3MHGA 4C6QA 5AZ1A 2XWDA 1K70A 7CGTA 3O07A 4G7FA 2WK2A 3P14A 4BF7A 5HMFA 4JQ1A 4K39A 5FOOA 3VD9A 1ZP3A 1TR9A 3W84A 3ZS4A 4X60A 4Z2LA 1Q13A 1AW1A 2EG6A 2DSZA 3LA4A 4S3GA 4B4FA 4UTFA 3WF0A 3GXFA 4CU6A 5AHIA 2CPUA 4KS0A 4B15A 3NGFA 4JIQA 3PUOA 4DWDA 2PTDA 4DJEC 2ZQ0A 1GJPA 3BTNA 3UZ5A 5GQBA 1CYGA 3NFUA 4JQ4A 3VIPA 1NQKA 4RKAA 3KVKA 3CTTA 2IKGA 2P0OA 4XWUA 2F6XA 1DJGA 1P0NA 2VDHA 1FWGC 1CXKA 3AYTA 1JULA 3ZLFA 2W79A 2O4MA 3WG6A 3NTYA 1XLGA 3N6JA 1XH0A 3AIUA 2O9TA 4NI3A 4WF7A 1JZ5A 4DBEA 3SIZA 2AQWA 3W7DA 4F0HA 4IXXA 3THAA 1R3QA 4JKLA 5CZJA 4KERA 1ICQA 1R9YA 4NZ1A 4R3UA 5D9PA 2HISA 1E5NA 4YN5A 1XLIA 2WZIA 3WKZA 5IBXC 5CZTA 1GOKA 3PNUA 2A6LA 1UA3A 3S2NA 3SN1A 3UWWA 4FF5A 1TPEA 3CZJA 4LVBA 2X7VA 4PUEA 1DV7A 3ISIX 1U5JA 3GNOA 4KEUA 4C6OA 4DJDD 3FAWA 3UR2A 2VX4A 2Q02A 1Z8AA 2NUXA 4BFAA 3ITLA 4M3PA 3LZ5A 4ZB0A 1V8EA 3ZJ7A 2O9OA 3LRKA 1TFVA 5GVJA 4LF1A 3FOKA 4H1ZA 1V77A 4G5DA 3UR8A 1QI3A 3ZWSA 1DWJM 3PWIA 2PDYA 4GQQA 2FLIA 1PX8A 4ZZ9A 3W2MA 4LRSA 3QGAC 4LS0A 2E25A 5AZ0A 4ZQPA 1CEOA 3TE9A 4DM2A 1A80A 1TZZA 1R2SA 2ISFA 4DJDA 3SGGA 1ZAHA 3B0YA 4AF0A 1W3KA 2WW5A 3P3BA 3ZT7A 1HVXA 1CCWB 2EEXA 2OT0A 5PTDA 1UWTA 2PDMA 1A5MC 4JHZA 4J3UA 1CBGA 3LXBA 4ZR8A 3WFZA 5J8LA 2H9AB 1CXHA 3LK6A 1TPUA 1GVFA 3MP3A 3VKBA 1LROA 5AKQA 3I65A 4O28A 5HR6A 3HG5A 1BTMA 3LHWA 3G5EA 1KV8A 1BD0A 5CJNA 4Z1AA 2V5JA 1HKVA 3W29A 3KOXA 1EX1A 2J75A 1J2WA 1UP2A 3BLDA 3SEPA 5HXMA 2QCMA 5I23A 1TJ2A 1GORA 3CYJA 2RDWA 3FCPA 4YHEA 1RBLA 2I16A 2QS8A 1O6IA 1I1WA 1MI3A 3BE7A 4IQEA 3EB3A 3TWAA 4H7ZA 3P60A 1WE5A 3LTSA 2OPJA 3WJYA 4JEJA 1A0CA 3GWQA 3ANVA 2VURA 2UV8G 4GUHA 5HPOA 1KTCA 3UESA 2DQXA 3HPZA 4Q4SA 4US5D 1EO5A 4ADSA 1F7BA 1B1YA 1KKOA 1KR0A 2YDRA 4UR9A 3H54A 2FFIA 2WM0A 3PY2A 3CHDA 5C0QA 1QPKA 4MNLA 1AQMA 2A2IA 1WXYA 5AC6A 4A22A 4GYKA 3UY7A 4ZO6A 4U3CA 5D9NA 5IM51 3MBDA 2DW6A 2GJXA 4L5ZA 2UY3A 3UPWA 3GVWA 3POCA 3UJFA 1GG1A 3W1QA 3P82A 1JZ2A 2IUZA 4YWIA 5HMSA 1IV8A 1YNPA 2VENA 2PA6A 3QOMA 1ZBCA 1ZP4A 4I8DA 1GONA 2Z1XA 2H90A 2WSKA 3HFYA 3N04A 2VKZG 1XBZA 3BG3A 1AJZA 5AHLA 4FNTA 4JIHA 1K02A 4TX6A 1M6JA 1L2QA 3WMBA 1PTGA 1TE1A 4O1FA 4PMYA 3LBCA 1E1CB 2V3GA 3H7VA 2FZ9A 4IMFA 2A21A 3MSGA 4GYPC 3CAQA 4JFTA 1UBSA 3NL2A 2FJKA 1AQFA 5I3HA 1GVIA 5LXEA 3GAKA 2QJGA 3A4WA 1JQVA 1G69A 2DJLA 4HN4A 2YL5A 2WMGA 3RLUA 3FXGA 3NURA 5C7HA 1QW8A 3QSRA 2WSRA 3BW2A 4UFKA 5ENLA 4F0SA 2VRJA 1IGSA 3QV8A 4UCFA 1OB0A 1E4IA 2NUWA 9RUBA 4A3HA 4Y8FA 1EPVA 3ARRA 1W91A 3OU8A 3LRMA 3ENLA 4Q4OA 1O94A 5L9FA 3OGSA 4XO6A 1G4SA 2VNCA 1XP3A 1N82A 3JS3A 4L4LA 5EGRA 3WYZA 1CGYA 2NXIA 3BOXA 4KKXA 3FY1A 5HA7A 2YLLA 1J93A 1LOLA 2QQ6A 2PCEA 1OINA 1XLJA 3NAVA 1X1OA 3Q58A 4J28A 4TQTA 5E09A 3OQ8A 1XRTA 2ZZ7A 1MEIA 1Q6GA 4NAEB 3N4AA 3VGHA 3QY7A 3KOYA 3UR5A 1OX5A 2HMCA 4DPQA 4I9JA 2YCIX 5CJ5A 2QXWA 3KZPA 1HIZA 3GC5A 1NDWA 3VFCA 1A3XA 1S2CA 4I5UA 5HPCA 2Z1KA 5D4YA 4AC7C 3HGRA 1LBLA 5HMDA 5KETA 3P80A 4DI9A 2BHYA 4AISA 4OBTA 3OA5A 2Z1WA 4DO7A 3ALGA 1PCKA 4FALA 1PTDA 3MI3A 2QCEA 4RDVA 1Q7QA 1F3TA 1XGDA 1AD4A 4NILA 4G1NA 1DWHM 4GJIA 2INZA 5G4EA 3AUOA 3WDRA 3PTDA 4LAMA 2BB0A 3G6MA 4XV0A 1XGZA 4GACA 3QQ0A 2PS2A 5TIMA 3VCRA 2MANA 3W1XA 4IJRA 1CXLA 3WBXA 3BGJA 2WBGA 3L0NA 1JXKA 4US6A 2BASA 4KT2A 2WVVB 3LRLA 3OB8A 2XIMA 3NL6A 4WDWA 2I56A 4RX0A 2QNEA 1BRLA 4JNMA 3HV9A 4YTRA 2DSKA 4E2VA 3SRKA 4U28A 2WBKA 4C65A 2OEKA 3W9ZA 5KINA 4H00A 4L65A 5A95A 1T0OA 4JY9A 1UWUA 4RNJA 1QCWA 2PE4A 2D2HA 2DH3A 2ISWA 4CU7A 4UFJA 4J40A 1KW1A 5JUVA 1DIKA 1VIWA 2Y7FA 4PCSA 4A2RA 3B06A 5E9XA 2IQ0A 3QHNA 3GC4A 3F5JA 3ARQA 4PA8A 3WBYA 4HT3A 1IWBA 2X0HA 1RCOB 3B0UX 3H4GA 4DPPA 4TUFA 5XIAA 1IHIA 3TWBA 1JFHA 3MCMA 3BARA 1G5AA 1YTKA 3RU8X 4HHHA 3GE7A 1MZHA 1J96A 1WA3A 3MMWA 4WDUA 1EIXA 4H19A 1V6VA 1BVZA 3W37A 3QY8A 2Y89A 2QGHA 4UTKA 4PZVA 1B30A 4QE4A 3VNLA 2E67A 5F7UA 5LIWX 3RILA 2I5IA 5HINA 3T78A 3VDCA 3IGUA 2V69A 3REQB 1VBJA 3W7EA 5AY7A 2P50A 5I06A 4PCFA 5EFDA 2F84A 4LVAA 3TC7A 5C9UA 2P10A 3WX7A 3LG3A 1RQBA 4JTAA 1XRSA 1M01A 3I3EA 2GK1B 2PCQA 4J3SA 2FGZA 4ERAA 3VUSA 1Q6CA 3JUGA 3VIJA 3E6EA 5LIXX 1K8CA 4AD2A 4W8AA 2ZRXA 4RPPA 1VEMA 2NZLA 3QYQA 5KZ6A 1EZ2A 1UZ4A 2OXNA 2HPMA 2XISA 2QVHA 1VCGA 5C9RA 2CHRA 4IPNB 4ES4A 1PKYA 4PB4A 3FA4A 4M5PA 3NWRA 4IUGA 3UZYA 1UR1A 4R7WA 3R2GA 3NNTA 3OJGA 3S0CA 1X7IA 3AS3A 1CI1A 2E1WA 5CBIA 1YNYA 4AVFA 4IGMA 3UJRA 2Y5EA 1JDFA 1AH0A 4NJIA 3HG4A 2OYLA 3AZTA 4IIHA 2QUVA 4GO9A 3M44A 2Z24A 4NKCA 4RE0A 4CD4A 3W76A 2W6RA 4O53A 3SR7A 3EDEA 4DF1A 1S5WA 3S5NA 1SO4A 1ZRQA 2C91A 1BYBA 1IXPA 1EC8A 2YX0A 3M6DA 3STFA 3ECQA 2CLFA 1LL7A 4FLOA 1FA2A 3WK2A 1H49A 4PBFA 3C2OA 1JCJA 1QI2A 1DJWA 1QXLA 3PWGA 4MJZA 2XGBA 2ZADA 4J1OA 4H04A 4OUIA 2DZVA 5DELA 4GVFA 1Y5VA 4WRHA 1E0UA 1GK8A 3M7WA 4LBRA 4F2BA 4ILSA 1B5TA 3THUA 1JDCA 1CGXA 3DGBA 3DUGA 3G1YA 4IIFA 3PZOA 4DJDC 2W61A 4R53A 4A8NA 1XISA 2VEKA 4R9XA 4QCEA 2R94A 3TTOA 1VFFA 1W2PA 3ARXA 1ZFJA 2WQDA 3W3OA 3T4WA 4XBSA 3S3GA 3OGRA 3LHZA 3STCA 2DORA 3W83A 3RJYA 2PGFA 1EDTA 2YBUA 3SQMA 4PGLA 1UH3A 4IZGA 3AIWA 1OFAA 5MF5A 4PYSA 1LWIA 4PL1A 3T09A 4E6MA 1Q65A 4PUUA 6A3HA 4AZHA 1OX4B 1FXQA 4YU1A 1VFHA 5HUOA 1W17A 1ISXA 1JDAA 3GR4A 3TC6A 2VCBA 1C92A 1XLCA 2QAPA 3K1GA 5A2BA 2PDNA 3GNRA 4K6AA 3WO8A 4AX7A 1HGYA 3VU2A 3GVVA 2HK1A 1POJA 4NAFB 4IQJA 2OKTA 3O15A 1SJCA 1FP8A 1DORA 3DERA 2G4FA 1BGGA 4ROPA 4TTUA 2EPMX 3MKVA 5XINA 5KITA 2D0FA 3C61A 3WD4A 2ACRA 1TV5A 3SRFA 2Y88A 4W93A 3T0BA 3GDMA 1JQXA 1NDZA 2HDJA 3BJSA 1UH2A 5B7ZA 2NWSA 4K2SA 3EMQA 4GNKB 1L6YA 3CWHA 1Q5MA 5FJRA 2B81A 1F4HA 4MJ2A 3U0HA 3MQTA 4GWEA 3GFYA 1K7EA 2RUSA 3W7GA 1VPYA 1AMYA 2R1LA 4K68A 3N18A 1T8QA 2EPNA 2H3BA 1Z6KA 4LEFA 1TJRA 4IL0A 2OEMA 5ABFA 1MW1A 1X98A 3EOUA 2P0IA 3PPGA 3R43A 1W5MA 3TEVA 2OT1A 1JNEA 3DX5A 2RDUA 1UOZA 3GDRA 3EAUA 3KEHA 2VC9A 3ZOAA 4B5XA 1KB3A 2EG7A 3GNNA 2ZWZA 4B5UA 4S3FA 2A7RA 2YDQA 2ZUUA 1XSIA 5E0KA 3BH4A 1JUEA 4PUKA 1UC5A 1TV8A 3DFYA 2Y0FA 2XN0A 5CC7A 3KRSA 2QV5A 1UKSA 1JI2A 2D69A 4IIDA 3MV11 2X42A 3TFCA 5LKYA 3PFMA 5HJXA 2YXXA 3N9KA 4FXJA 2NQJA 1OC6A 2HVMA 4UTTC 7A3HA 3H2NA 3M41A 1U30A 2GUUA 1WKYA 1HP4A 3GS6A 4C6EA 2I9EA 3FYPA 4L7ZA 1G9HA 4MADA 1E0VA 3ARVA 1D3GA 4UWMA 4O13A 2NV1A 2VVSA 1ZQ5A 3PTQA 3TLQA 3G8RA 1LDCA 2UZ9A 1OCJA 3E38A 3DHPA 5A94A 4Z1DA 2FQIA 3IGSA 3WQ4A 4NASA 2Y85A 5I79A 5LIKX 3V0UA 4RDZA 1XC4A 4QM1A 2GUYA 1TPH1 3NQ7A 4AXKA 1S2UA 4ZQOA 2QCNA 4EPEC 4LUYA 2FHFA 1EJUC 2VOTA 3W7LA 3ERPA 1GOWA 5H8PA 2YKKA 3LCGA 4CN6A 5K3VA 3S2MA 3VD4A 2YW4A 3BV7A 1K7FA 1XPGA 3TQPA 5EKYA 1OG0A 4JIEA 3CL8A 1S5TA 3NCOA 3V5CA 4HK7A 4GKTA 3TYEA 5DCDA 1MNZA 1DJQA 1UP0A 1ENUA 1J6PA 3S9YA 1EOKA 2JALA 2ACQA 1XG3A 3PBMA 4KWWA 3CMFA 1U5HA 4HMDA 2XINA 1PSCA 1YXDA 1V3LA 2J77A 4H4IA 4HJWA 3BCFA 4G9PA 2CBVA 1PIIA 5G2IA 1JR1A 4HCDA 4CD8A 4ZOBA 4FLSA 3R8GA 4LUSA 1JF5A 4HA1A 3TN3A 3SSJA 5DCBA 3LHVA 1A5OC 2FKPA 1KM4A 4DBDA 4QXIA 3K8LA 3UCDA 3AQUA 3F2DA 4NYYA 2PLCA 3WNOA 1M7OA 1PZ0A 3P5ZA 3UF9A 3TLLA 1C8YA 1HKKA 4QR6A 2VDGA 3W7JA 2FGBA 1Q4NX 2VR5A 1XIEA 4Z08A 2QDEA 5HWJA 2G50A 3HF3A 2XIIA 1IT8A 1UR8A 3E2SA 3VNJA 3W2LA 3CUHA 3VO0A 4QISA 2BDQA 3D46A 1H3GA 3APGA 1Q7ZA 1L8NA 3KP1A 4AD3A 2FVLA 3OLDA 1VLWA 4J4KA 4K3ZA 4LU0A 3CZLA 2XFFA 1K9EA 3L0KA 2J8TA 3W87A 4MZYA 4RCXA 4HU4A 1QASA 4A3RA 2FTPA 1R9XA 3C0QA 4QP0A 1GKPA 3BPWA 3NQEA 2DFAA 5K9CA 4D72A 3VIIA 2I9UA 3DEQA 4GPNA 5LHFA 2VX6A 4I7UA 2E7FA 3GHRA 1W1IE 3N25A 5CPTA 1XLFA 1NF0A 4OQVA 4GFIA 4YCOA 2DW7A 3QHOA 3M5XA 3AZSA 4W9TA 4LSBA 1W3IA 2WVUA 4NT0A 1C8XA 4PB5A 3C52A 2NVDA 1J0HA 2OOGA 2QJMA 3HGJA 1R6WA 3SCNA 3UNTA 4F0LA 1ADOA 1U33A 3FNDA 4N02A 1Z9AA 3HMCA 3VDAA 1AZ2A 1ICPA 3WNKA 4A2SA 1RJQA 1NVMA 1KRMA 1GVSA 2I57A 4W86A 1BXNA 4MIMA 2CERA 3GG8A 2DUAA 2WJDA 3AOFA 4XKMA 4HHLA 3IUDA 4DLMA 3IJDA 1NH6A 3RPDA 1TV3A 1ZTVA 4PL2A 5K7JA 1OC5A 4F66A 1FDYA 2VM8A 1PVNA 4IP4A 1VBGA 3HB9A 1WUFA 3AHXA 1FH9A 4HYRA 5H91A 4NJHA 4LC6A 1JPIA 2DVTA 3DFHA 3AJ7A 3W23A 5DRCA 2R1NA 4DZIA 3HPSA 1H63A 2D23A 3F4CA 4AVNA 2PDFA 1WYIA 5CSYA 1EJRC 3S1XA 1QDSA 4X9SA 3MVTA 1UOKA 1GW9A 4JN6A 5FL1A 1UD8A 4XVEA 1VAHA 1I9CB 1UHVA 3S83A 4KF1A 3CV7A 3U2EA 4B92A 3AO0A 1AQ0A 1QPRA 3FK4A 3BW4A 1KM5A 3PZUA 1EQCA 5HNUA 2FIQA 5A6KA 4PUDA 3IACA 2WVTA 1E6XM 1VFMA 1SW3A 1YPFA 3EX2A 3UGRA 1SPQA 5TF0A 1P0BA 3A47A 2V2HA 3WMCA 1SJAA 4JD4A 1CENA 1AZ1A 3VGGA 3AMGA 4WUIA 1ONRA 4JTFA 1IT0A 3H26A 1XLMA 4AX6A 2ACUA 3B0PA 3TW9A 2PDLA 1BXBA 1E5JA 3QEZA 1VYSX 1L9WA 4GIAA 5D02A 3VDHA 3Q67A 1A5BA 4UFLA 2ISDA 2G37A 4FF7A 3DG6A 3KE0A 1TPC1 3LOTA 2DIEA 2OLHA 2YJQA 2JF6A 3V35A 3N73A 3QYSA 6ALDA 1WKEA 4Q8TA 2NV2A 1P4CA 2X41A 3M1ZA 1VB9A 5CQ1A 1LQ0A 4LUIA 1WAUA 3WDJA 1NSJA 1OEPA 4JFUA 3RM8A 1AD1A 1TUXA 3T0DA 3RLHA 2HWGA 1K1DA 2ZOXA 4IMCA 3TQKA 1P0EA 3TXVA 1XDLA 4AZBA 4Z1CA 3V16A 1CXIA 1YE6A 3TYBA 3L4XA 5LYRA 5C71A 4UC5A 3S5OA 1Z3NA 4IP5A 4IPPA 4AF0B 2SFPA 4H3DA 3KCLA 3BLFA 4C6PA 3IEBA 3NQMA 4YLWA 1EA0A 3T6CA 3MA8A 4CNPA 4ACYA 1YBQA 4HOWA 2W92A 2XH4A 3BCDA 4H9TA 4WGHA 4PMUA 5BXTA 2CKSA 4ZO7A 1EBGA 2VI0A 1VBRA 3CBWA 1SQ7A 3O63A 1WQ5A 2XSBA 3PSWA 4FLRA 4DEFA 4W8BA 1CDGA 3QJAA 1K4GA 3BLPX 5F2IA 1DEDA 3URQA 4L4MA 3T9PA 3FAXA 4QG9A 1DBTA 3GDTA 2V2DA 1TVNA 1WDWA 4FZIA 4GYJA 1CLVA 3BGAA 2EPKX 4Y8EA 4YCPA 1IZKA 3O6CA 1HFBA 1T99A 3HG2A 3EX1A 2PZNA 4XK2A 4NJKA 4NZJA 2J7FA 1IEVA 3EWXA 2WHMA 3EGJA 1RZMA 1MVYA 1E0TA 3O2LA 1Q2RA 2GJXB 2HSAA 2ZXAA 4O12A 2GLKA 4U10A 4KCWA 4FXSA 2EO7A 4FXRA 4BJHA 3GBDA 4JHMA 1BGAA 1E4LA 4NNAA 4FIQA 3E96A 2J7HA 4YIWA 3HOJA 1S5MA 2A3AA 4Z1YA 3OTRA 3PN8A 3L2IA 1UWIA 3KL3A 3MUY1 5JMUA 1LM1A 2QKFA 3MO4A 5G1YA 2E6AA 1E4NA 2WMJA 2DZBA 3RITA 4ZTXA 4JCMA 3SECA 2ESCA 4RW5A 1PX3A 3GO2A 4ZSUA 5JIPA 3G1RA 1N55A 1XUZA 5AB3A 5LA1A 5CZSA 1TCDA 2PP0A 5KSWA 1ZU8A 3L2LA 1W9UA 3S47A 4QG8A 3KW3A 3GM8A 2VZTA 4IG2B 5LA0A 3UGVA 1A0EA 2G5WA 1KXTA 3FGCA 4MJMA 1NAL1 1SZEA 2J7CA 1DXFA 2BFGA 3UWZA 4NVTA 1TMQA 2C16A 3FFSA 4A8RA 5EMUA 4JR5A 3AXHA 4LY4A 5IRPA 5HBFA 1BFNA 3S1VA 1FDJA 2E9MA 3CO8A 1V02A 4QDPA 1F74A 3Q45A 3R1ZA 2WWDA 2Q3RA 1E51A 4JOMA 1GW1A 1L6GA 1NFPA 3FVMA 3PF3A 3MZ2A 1UQZA 3DG3A 2FH6A 3DFPA 3OZPA 3T2QA 3LI1A 2BSLA 2B31A 4UOJA 2RJGA 5CPQA 2ISSA 3NPXA 2INEA 2PRLA 2V3DA 1H2JA 4YTUA 4WSKA 1TTPA 3TYAA 4AZ5A 2GVJA 1HG3A 1PL9A 1SZGA 4F48A 4EKJA 2AAAA 2V3EA 3ZLGA 4IGNA 3M16A 2H6RA 1O5KA 3DFSA 3E2VA 2LLEA 1P6BA 3AWNA 1TTIA 4AIBA 3ZSSA 4ZQCA 1FY6A 3TAKA 4RNIA 2AL2A 5BOEA 1S5NA 4WSHA 3FJLA 3ARTA 1C8VA 1DWIM 3GKFA 2KZHA 2WHLA 3KBSA 4R85A 2QUUA 1BF2A 5FL0A 3UW6A 1OYCA 3DH7A 3U57A 2G3IA 5B7YA 4C91A 2G41A 1VLIA 1F8MA 5FJIA 1KTNA 4D71A 3CQ0A 4Z42C 2J13A 3LCHA 1B90A 3VOJA 1VJIA 4N7QA 3N2XA 2CLEA 1H09A 1W0MA 1XQLA 2VFFA 1MWOA 4KRUA 1LJYA 4KWUA 1KWGA 3CO4A 4HSNA 1P48A 3QF0A 3G3DA 4IFKA 2Y63A 2FTYA 2BLEA 1K4HA 1NEYA 3BOLA 3K13A 5CSSA 1NJJA 3KTSA 2YCJA 5CPOA 2E4TA 1XDMA 1JRBA 3N2CA 2GVLA 4QDMA 3GZAA 3STGA 1WOBA 1IT7A 2Q3OA 3MSRA 2PGRA 4ZB2A 4DZAA 4MJ4A 4M6QA 5AOUA 2C13A 2HEJA 4WKAA 4U33A 1NOUA 2QMKA 1BXCA 4ORMA 5HULA 1KTBA 4J3VA 4K37A 3UQNA 2PSNA 3GH5A 1QI0A 2WYSA 1LUCB 2YXGA 3C8FA 4JQ3A 1JZ8A 2BTMA 3CYVA 3LGGA 1XYAA 5C9ZA 3R0UA 2ZTKA 1SZRA 4UFMA 4FLQA 3WJWA 5JU6A 1QJWA 4GIRA 1NP0A 1U1UA 4D6GA 4DWSD 4U5KA 5FJPA 3C5QA 1UD2A 4TIMA 4IXHA 3WELA 4A8LA 1XYFA 2GQ3A 2E6YA 3LERA 3EWYA 1OGGA 1XGEA 3H2CA 1JUBA 2J8FA 4QAWA 4GNJA 3CQKA 1CB7B 4DUWA 1J4EA 2ZZ4A 3ITTA 1Z44A 5T9CE 5LNVA 3LNPA 4DIAA 3VYLA 4CVUA 4R7OA 4JBRA 3TR2A 3N2MA 4WOZA 3U48A 3VX0A 2B7PA 2D1ZA 2NQ9A 1MXGA 4O0ZA 3K5XA 3EMZA 3BJFA 4DJFD 3F5LA 3PUEA 1REQA 1OIFA 1N2VA 1DJXA 4XZNX 3KVJA 4J3TA 1AH3A 1E43A 2OYKA 2GVEA 2J25A 4GI8A 4DAFA 1RH9A 2FMNA 1XLHA 3JR2A 4F79A 5C9WA 3CIXA 4RZ4A 3RAOA 1IEXA 4AY7A 3V4BA 3WQGA 3NG3A 4AZ6A 1JAEA 2CWXA 3N4FA 2ZRVA 1IGWA 4GO8A 5KZMA 3GW0A 3Q37A 4BEUA 3I68A 5FJUA 3ZFHA 1OY0A 2XGZA 3WF4A 4JIIX 3FVDA 5BMXA 3HQPA 1BVWA 1S2WA 1YLVA 4XZ9A 1DQUA 1VEPA 2E8YA 5K9XA 3SCVA 1QUMA 3ANUA 1EQPA 1JYVA 3KDOA 5CGMA 2YCEA 1O60A 1OX6A 4OT7A 3SSZA 4I3GA 3U5UA 3LCIA 4QIUA 2PRMA 1XRVA 1KFJA 2ZIDA 4U5IA 3GNDA 3SDOA 1F8IA 1R3TA 3SADA 3GDLA 2WMIA 3R94A 2Z25A 1GQNA 3IAQA 4GA8A 3VNKA 2RHGA 1QNOA 2RDTA 3H6OA 2XFWA 4C7FA 1JPDX 1XIGA 2VOMA 5A6BA 2PTZA 5A8GA 1PBGA 3M7SA 5I0DA 1G4EA 3S1GA 2OSYA 2PC4A 4PMXA 4OGZA 1BHGA 1TRIA 4MDOA 1BVNP 3EWWA 3KL0A 1QTWA 3VXGA 4BQ4A 1EJVC 3DXIA 3HPAA 4NNCA 3KFTA 4LH8A 3GXPA 2FPYA 3P5YA 3QQ1A 3L0GA 4NJJA 2V0TA 4ML9A 2PEVA 1PDZA 2BGSA 3MI6A 2ZZ2A 2VR2A 5BOOA 4KETA 3A4JA 3GYCA 2PWVA 3WBAA 4ICNA 4GZ7A 2VYOA 1KBJA 3W86A 4W85A 4LEQA 1TWWA 3KOZA 2VFHA 4GZIA 1B4KA 1R85A 4M1BA 5EL1A 3ZVHA 2Y2WA 2VC7A 1FXPA 3UXDA 1TG7A 1W3NA 4ACZA 5LIUX 5DANA 1ZJHA 1JFXA 3E1F1 2ZXDA 1HTIA 3OG2A 1F6YA 5BYWA 2IPFA 3QC0A 3H8AA 2CLPA 3GR8A 3AS0A 1QW7A 4MKVA 4Q4PA 1JIBA 1WBHA 3T7VA 3E5BA 5DCEA 1OZQA 3POHA 2Z2BA 2VFGA 4QRNA 1YHTA 4QLKA 3MPGA 4Y90A 4B5NA 1A3HA 1DYSA 4YMZA 4O0KA 2IXUA 2QAFA 2YDAA 4CQ8A 3WF1A 4V1YA 2ZRZA 3DI1A 4O4WA 5DF0A 2CZVA 3W00A 1TPFA 1X6NA 2QCLA 4IISA 1Q63A 3ITGA 1W32A 2WMHA 4ZA0A 5TD4A 2YL6A 4NHVA 8CGTA 4HGXA 4JTSA 2OB3A 2DGAA 5JIWA 4AFYA 3ZIZA 3ZMRA 5LNUA 1B31A 3RIKA 1XCFA 2BV9A 2FB2A 1UKOA 3F4VA 3K1DA 4W4QA 2G3NA 4MWAA 4HQVA 3APYA 2V2CA 2GGIA 3R58A 3LSBA 3L2MA 2VZVA 5EA9A 1H61A 1ODUA 4O16A 1FCBA 1X38A 1J2BA 2OWXA 2DP3A 1VPXA 3V3WA 3Q2DA 1YADA 2W66A 4CCDA 3TAOA 3LM7A 3H70A 4LTSA 5FJOA 2D3LA 2VJXA 4NXSA 2A1YA 3W7RA 1PKLA 1V03A 5IOBA 2Z1VA 3JVAA 3MO7A 4A6GA 2GJPA 1TB3A 3VIOA 1UD5A 1EZWA 4UTHA 1I2OA 1PTAA 3L68A 3WENA 1V7YA 4XZBA 5K2ZA 2ATSA 4MAVA 1LLOA 1RJRA 1C3FA 1E4MM 4LVDA 2BBFA 3SUUA 2Q01A 3AMDA 3PHAA 1Y65A 1A53A 4N0RA 1QATA 4K38A 1ISWA 1US2A 1KKRA 1FCUA 4MOZA 1JG9A 1V6YA 3GDKA 2PI6A 1UUQA 3KBVA 4M6UA 4AD5A 5JQ9A 2PB1A 4M7SA 1TELA 4WHBA 3GTXA 5CXPA 4LS1A 1E9YB 1DWGM 2BX7A 3PJXA 1UMYA 4KCTA 1UUMA 3AISA 3QTGA 1UIPA 2FGLA 4X22A 3WEOA 4XZMX 3TCEA 1W1TA 1CPUA 1FFQA 4TVDA 2POZA 4MSSA 3WL1A 5FJTA 3P61A 3PNZA 2QDDA 1GUVA 5F4WA 3M07A 4WQ6A 3BAWA 4H83A 5HAOA 3E0FA 3LD5A 3O0FA 4XB3A 1UBPC 3EXRA 3IRSA 3N9SA 3MY9A 1GOXA 4IMEA 2ZC1A 5CAHA 3MJYA 2QJIA 3ME3A 1SW7A 1Q66A 2Z00A 3UXIA 3W72A 4L9ZA 3LQGA 4Z2GA 2OMAA 2PDQA 1F73A 3VC5A 1DIOA 4OHQA 3GXIA 4AAJA 1F3XA 3LY0A 5EMYA 2NX9A 4LUSB 3WMSA 4S23A 2WQPA 2OQHA 3G8EA 3EX4A 2ZUMA 1DJNA 5CGQA 3IARA 1W1B1 3MU7A 4HNNA 3L5LA 2PC8A 1UB3A 1PJ9A 4DNMA 3TN4A 4KFOA 3B8IA 3WLIA 3CS2A 1H60A 4POCA 4BEQA 3VZXA 3NDYA 4QE5A 2D3NA 3WFAA 3RPMA 2H8ZA 4TO8A 3UYCA 3WIJA 4HOXA 3ICJA 4JL1A 2P76A 4E5TA 1E6SM 2PGEA 4H9MA 3T05A 3W7PA 3TJLA 3UVAA 3WDQA 2CYGA 3CM4A 3ZLHA 1B4EA 4FR6A 3DGRA 3TW7A 3ORWA 1IYXA 1GEHA 1W5PA 1WUEA 2YZRA 3B8WA 3OOQA 1J5TA 4LUJA 3MS8A 3KHJA 2W9MA 3P62A 4GI6A 4RE4A 4S3CA 3WLRA 1OHLA 3EXSA 4LAKA 2PDXA 4AWSA 3R79A 4I9MA 1XIHA 3PBYA 3MUCA 4UMCA 3T4CA 4FNUA 3RX3A 3CZKA 3QY6A 4PE8A 5D05A 1LTDA 1UKQA 4XVDA 3ES8A 3PAJA 3MKKA 3BL3A 4K8EA 1W1VA 4HTBA 1F3WA 4P8WA 1KFWA 4GBUA 2BY0A 3OHMB 3WLHA 1HL9A 1TQJA 3M5VA 1JZ4A 2L5HA 1QO5A 2PD9A 2V30A 2XJ7A 2XN1A 2Q8LA 1HO4A 3XIMA 2R24A 2NLIA 3FJ4A 2Y61A 3JRKA 4N9DA 3QSTA 2QJNA 3INPA 2OX4A 4LVFA 1XIDA 1UZDA 3B40A 3WL0A 1V0KA 3A4XA 4PCTA 5I24A 3TYCA 4WK9A 1H62A 1OWQA 3N2TA 5BMWA 4W89A 1VCVA 4QROA 3M64A 1CECA 3URBA 1V3HA 4IUOA 1WAWA 4UTIA 4J3WA 5ECVA 4J2PA 3THCA 1EGZA 4JY8A 3GG1A 1LRQA 1MDLA 1ME9A 3ABQA 5CPMA 3WH7A 1ODZA 2ZA2A 1QW9A 4HBKA 4AZ7A 1R3RA 1BAGA 3H21A 4RZ6A 1QNPA 1IXOA 1C9WA 1DOSA 3E0VA 4RNHA 4MAZA 3S6DA 3MDUA 2PTXA 4XKYA 1DP0A 5HATA 3TZNA 4QBXA 1IR2A 1XKJA 4MB3A 2XU2A 3UEQA 3GHSA 2AOSA 4LCSA 1CGUA 2INFA 4HN8A 1EC7A 2XVLA 1G01A 3VE9A 4GQRA 2GVYA 3IUIA 4M19A 2YL8A 4MNJA 1JRCA 2WPGA 1I75A 3MMTA 5TBOA 4ROQA 3PAOA 3APTA 1M3UA 1PWLA 4F2UA 4IWWA 5LNWA 2YBTA 4JN7A 2PBGA 3F4WA 5C55A 5ABEA 4JL2A 2R1KA 1VRXA 2J88A 4MY9A 4YS1A 4AD4A 1K8ZA 2NV9A 3S42A 2DT3A 4U2ZA 3GR7A 1YYAA 1KM0A 3NPUA 5A5WA 4JYFA 1AA1B 4V1XA 2XH7A 1TCMA 3I6EA 2VUNA 3SY5A 1TTQA 2J7DA 4W88A 4TVCA 2OLAA 1F4AA 3QGVA 3LX9A 4NZFA 1Y8BA 2GJNA 3LPGA 1M04A 1W6TA 4IX2A 3RDKA 3WH8A 4NX5A 4HMNA 4MZ1A 4PSRA 3EB4A 4ZXLA 2QCHA 3VOCA 3MYOA 3PZNA 2E77A 3S5SA 1JGMA 4W7WA 4GD0A 4P7LA 2I14A 3MP5A 4GJ1A 3IJ7A 3C56A 2YYTA 1O1ZA 4RK8A 1DE5A 3S2LA 2ALDA 3TZFA 3BLEA 3GG0A 2BZNA 4HNUA 1YBQB 1PEZA 1UP3A 3EA2A 4BS0A 3A21A 2X09A 3MUZ1 5EMKA 1RV8A 4DELA 3BWWA 5I2UA 2DZSA 2DEPA 1H51A 2IPWA 2J66A 3RUBL 2PTWA 2VMFA 2PWUA 1XG4A 5BXPA 4MWAE 4QG6A 4AZCA 3MJMA 4LT9A 3M0ZA 4XZHA 2I1OA 1L2UA 3QZ6A 1XLAA 3IPWA 2FPTA 3NYDA 2VQTA 1DWAM 3NGJA 3FKKA 2JIWA 3N9RA 2G3JA 1G7UA 1D8CA 3WFLA 2P1FA 3KAOA 1RR2A 1XBYA 1E0XA 2ZA1A 3FW6A 4QLJA 4D9PA 5JH1A 2HXUA 1TX0A 3VCCA 1AK5A 1P1XA 1UMLA 4JCLA 3LNMA 1UWSA 2WKLA 4NRSA 1ZCOA 4H6EA 2IKIA 4M8UA 2YA2A 3RCNA 1XFBA 4C7GA 1FWTA 3AFBA 2WLZA 4TVUA 3L4VA 4HCHA 2Q8ZA 4HNCA 4BZYA 3EPOA 3ITYA 3L4YA 4YPJA 3GKAA 4Y9AA 3L23A 3TH6A 1KM6A 2Z2UA 2OGYA 3N3TA 3QTPA 4QJ1A 4LX4A 5I00A 4H9YA 2YPIA 3PG8A 4NX0A 1OC7A 4Q32A 1OD0A 1Q4WA 1KQYA 2QUNA 1NQ6A 1VYPX 3MI2A 2HTMA 2OO0A 4HYVA 1UG6A 2J8GA 5AHNA 4HPNA 3TMLA 2YYUA 3WLPA 4AXNA 2E40A 5EFFA 3NSMA 4FP1A 3G1DA 1QT1A 3CH0A 4AHOA 5EYWA 4KGJA 2BGQA 3KTCA 3OIXA 4LYRA 4JZ5A 1E15A 4OU1A 3AYSA 3RMJA 1EBHA 1EUAA 1G4PA 1TZ9A 1HW6A 1FWFC 1GHRA 1TJ0A 3WJXA 1YTEA 1CB2A 4BHYA 1FUYA 4EXBA 3H22A 2GWGA 2QCDA 1HKIA 5D8ZA 3ZJ8A 1A5KC 5J5DA 3CLMA 3GW3A 3FGCB 3TJ4A 3PZGA 3NQGA 4DZ5A 5L6UA 4AH7A 3LGDA 1JCLA 2IPJA 2Y70A 2PDKA 4RV3A 4KEMA 4GXMA 1LZOA 3OG3A 4IX0A 2Y8UA 5G4HC 4C5YA 5FEPA 1BWVA 4LUTB 4M51A 4YL2A 1RBAA 2FZ8A 3W1PA 3N6HA 3EPNA 1P6WA 3IJ6A 4GQ0A 4ZGYA 5F4SA 1JYWA 3AZRA 3O6AA 4TOQA 4D8ZA 2TSYA 2FZDA 2P8CA 1RAKA 1UYQA 4IGHA 4UNKA 2O4QA 1YX1A 3NZGA 2X1TA 3KVLA 1VCFA 4GY7A 4PCPA 1XCWA 4LC8A 1QO2A 3KXQA 4EPBC 3W7NA 3VOFA 4B2DD 1UUOA 2DUXA 1XF0A 1VBUA 3CUFA 1VJZA 2WKJA 1HZYA 1W9XA 1WP6A 4ORIA 4UMAA 1K9FA 1QPNA 4LBSA 4B5WA 3OZMA 1OSEA 3WMLA 2RKXA 1W56A 3RG6A 1K6AA 4FAMA 4O1CA 1LP6A 4GIEA 1OT2A 4UR8A 2AL2B 3KDNA 3WLOA 1K3UA 2FHBA 1V0NA 4KRZA 1F61A 2EAWA 1IXNA 3D0CA 4YJ5A 3K30A 5C2XA 1K03A 3RM9A 3TQVA 3UY8A 4GIYA 4FK9A 3AAMA 4MZ8A 4PTWA 5E0FA 5A6AA 3CIWA 4NIRA 4CQCA 4JICA 1XCXA 3MZNA 3S6TA 3FA3A 3E3HA 3C2EA 1WB0A 2PU1A 5CC3A 3FS2A 1GVYA 3SFKA 1W1YA 3GVGA 4JAWA 4GMEA 2QLYA 5FF4A 2V38A 3N6QA 1NWTA 4BY3A 5E6ZA 4JTGA 1EJSC 3O6YX 5DRIA 1M03A 1WPCA 4O57A 3UCQA 1M5WA 4XQ6A 3WLMA 4L1WA 3V0TA 4O1BA 5AYXA 1WDPA 4HPGA 2CIPA 4IFKB 2CLIA 4M1RA 1CZ1A 3UVIA 4ECLA 1PE1A 1PHQA 4MB5A 1E72M 3EMCA 1R30A 4HA4A 1JYXA 1OYBA 3FLUA 1PZ2A 5BROA 2RAGA 3I6TA 3CZEA 1B2YA 1FTXA 3W2JA 4O52A 3F4DA 4QDWA 3L67A 2O9PA 3PULA 1V3KA 2ZC8A 3LU2A 4IPLA 4FNRA 4XAPA 2AMXA 1W9DM 3NQDA 3VILA 4LCQA 4UZUA 2Z6JA 3BMXA 2F61A 4S38A 4MLJA 4QNWA 3A24A 3W88A 1YPIA 3QFEA 3KX6A 2A3HA 2NXGA 1IQ8A 1KCKA 3RN6A 3TP4A 4NZCA 3VIFA 2ZTJA 3PPCA 2CBJA 3U4FA 4CU8A 1JCTA 1ECEA 2CHOA 1R3WA 1MRQA 4WEVX 5AC4A 2W27A 4RDWA 4IP7A 1XXXA 2Z26A 4Q4MA 3LMYA 4JTIA 3WLSA 3U2ZA 3CJPA 4NZ5A 1H7OA 2BODX 3DOPA 3S5ZA 3I7SA 4AEOA 3PWAA 3AHTA 2V67A 4ZODA 2PDPA 2XGIA 4HU0A 1XLBA 3ES7A 1DHKA 3KM8A 1M53A 1F6PA 3VMOA 4Y7EA 4B5VA 3I4EA 4H8UA 4R9OA 3SRHA 4EVZA 1BYAA 2GFTA 4JYDA 2NT1A 3H7UA 2HRWA 4DWSB 4RXFA 4MY8A 1REQB 2NXHA 4GVHA 1SFLA 1J0JA 1HQTA 2BWGA 3B9NA 4TTGA 1QHPA 1AODA 4NSBA 3TA6A 3DAQA 3M0IA 4Y2WA 3GUGA 5I77A 5RUBA 2VL4A 3FX4A 4EF9A 3PJUA 4REQB 1DE6A 2FVMA 5HJYA 1RP8A 3FJ6A 4PB3A 3C0LA 4ZFMA 3F4NA 1P0KA 1OGBA 3WUEA 2R82A 4PMVA 3ZQ9A 4TU1A 1TA3A 2QR6A 4PMDA 4ZXOA 4L80A 2VR4A 4XD6A 3B03A 2WC4A 2O56A 3LHYA 4C6NA 1NM9A 1C7SA 4GI4A 2PWGA 4WY0A 3MCOA 1IEWA 2ZE0A 3BLLA 4YXGA 2CBIA 2X1RA 1F07A 1U5VA 3P7YA 1VRDA 1W1ZA 4E2DA 2QGYA 3DFNA 3SGZA 1I2QA 2PWEA 1DXIA 5DMNA 4UTUA 2UBPC 3N2OA 1ISVA 1VFOA 3HV8A 3W7OA 3GH7A 3HQ1A 2WMIB 2FJUB 3G1AA 1A4LA 3IIPA 1KRBC 3H23A 4S3JA 2EXOA 1OFBA 2BNJA 4QQUA 8XIAA 2HE5A 1H7PA 2CLLA 1XIMA 2ACSA 2VVNA 4E2OA 3TNOA 3OLIA 1G7VA 2AMGA 1PXGA 3W1RA 4UUIA 2PP3A 3AXIA 1DWFM 4UQBA 4O14A 2WOQA 3BMVA 1B3YA 1W8SA 1HNYA 4PUNA 1XYCA 3LV6A 1YEYA 3W53A 3UBPC 5H8MA 3FDGA 4LBUA 1QBBA 4AWEA 2AGKA 4HPXA 4JXCA 1SO6A 2A4AA 4UZSA 2E5DA 5ABHA 2OKOA 3C8NA 1QI5A 4EF8A 4A4AA 1DQWA 3IUHA 3W07A 1RVGA 1Q6FA 1FWEC 1W3TA 3G77A 4YTTA 1E1CA 1F5ZA 1FX6A 1GPFA 3W75A 3EB2A 1XSJA 2NX3A 3ZVHB 8A3HA 2B0MA 2F2HA 3G2GA 3VA8A 4X3ZA 4C5ZA 1XIJA 1P6CA 4ACZB 1WV2A 4C6JA 5T9BG 2D2JA 4Z2IA 2GJLA 2E0PA 2DPEA 3A4AA 1Z7AA 3DIPA 3VKCA 2HNHA 2BXYA 2XDFA 3T8QA 3UWUA 3QPZA 5DT5A 1KFBA 4J9JA 1C8QA 3HFTA 4C7DA 4UMBA 3MMDA 1QPQA 4D6IA 4G1KA 4BR1A 2A85A 3DDMA 4O4VA 3UG8A 2YFNA 4LXFA 4CEXC 4Y6GA 4INFA 3B8TA 3VFLA 3WJZA 1KFKA 1XIIA 1RALA 4RE2A 1PZ3A 1TPDA 2TAAA 4D6HA 4D1JA 4LAUA 1EGMA 4A8IA 1GOOA 4NP7A 4CCCA 2XH2A 5M3WA 3W1AA 3VOGA 4DXXA 4PTVA 3B0VC 5IDZA 1JD9A 4TX9A 3ZSTA 4MVAA 4NXKA 5CSUA 4IICA 2EKCA 4NZ4A 1XC6A 4F0RA 3K8KA 3SBFA 3NL3A 2PU0A 3GNXA 4GBDA 3WNPA 3RF9A 3PJTA 3VMPA 3O16A 3URNA 2VELA 1DJIA 2DT2A 1OF6A 2XH0A 3WUBA 1M1BA 4P2VA 4JNZA 4GKLA 3TN6A 2VGGA 2QJJA 3SGUA 5F1UA 4K8HA 4L9XA 1KCZA 1WDRA 1J79A 1UWQA 1QAPA 2WVVA 3DKLA 1Z41A 2P8BA 1I60A 3D3FA 3NQ6A 3BG9A 4MDPA 5FD0A 3LPFA 3RX4A 1SU5A 4A29A 1MXSA 1I0DA 3TJXA 1PKMA 2JBMA 5FF7A 3ABOA 4TV6A 4L6HA 2YL9A 4UNLA 2F8QA 5BXSA 3WQOA 2XZ9A 1UWAA 4IL2A 4FNQA 3NYZA 4S3DA 5FEXA 1UKTA 3WDIA 3J7HA 3USBA 1XKYA 3GYEA 2QW5A 5HDRA 3AMLA 4J3ZA 2PF0A 3C2FA 2QULA 1XWYA 2X1SA 1CIUA 3KBJA 2W67A 3L7RA 1GZ1A 4WXYA 5D2WA 3OVPA 2FYMA 1NWUA 2AGTA 2WKGA 1EO7A 1XLDA 1KA9F 1L6WA 3G22A 5M17A 1XQKA 4FMVA 4MKSA 1VQTA 2C1GA 1MQPA 4GABA 1WO2A 5D8WA 5DN1A 1LQ2A 3IGHX 4IPIA 1WNOA 2VEMA 2XIJA 1KV5A 4KWVA 4ZVJA 1RCQA 1W31A 5T26A 1AW5A 1GZGA 3REQA 2VFEA 4I9TA 4HA3A 2YBVA 5FAJA 1XIFA 2DIJA 2H3DA 3SFWA 2QDGA 3U5YA 1RLCL 3OPSA 4LYPA 3B8UA 5K9DA 4AWUA 1NU5A 1XLLA 2ZRYA 4WGXA 5I02A 3H2EA 4E0CA 3WBEA 3TQ0A 3GRIA 5DT7A 4PODA 3QKZA 1UWRA 4XZWA 2NQZA 2HBVA 4LAZA 2W0UA 4TR9A 1JZ6A 1PZ1A 4B16A 3WQEA 2Z2AA 2ZUNA 4Q8QA 3O05A 2PURA 4KIEA 3UD6A 3LGEA 3OODA 3KWXA 2XVKA 4EWJA 2VZOA 1OG6A 1VIZA 3B8VA 4J5NA 1SSGA 1MNSA 4LPCA 1W9BM 3S2JA 2GWNA 1UD3A 4C1NB 4FS9A 3CMGA 2TRSA 1UR3M 2BY2A 1XYZA 3WQDA 3B8DA 3N29A 1NFGA 4XSLA 3AHVA 2BP1A 5FF2A 4BQ2A 3PPHA 4LNCA 3A64A 3CWNA 4NF7A 1OADA 5JXQA 2FZMA 4DJEA 4JTKA 2J47A 2GOUA 1BSIA 5D32A 3N4EA 2UY4A 4J35A 4NRRA 2QPSA 1X39A 4BKNA 3MDWA 3C2RA 3FEQA 3P67A 1CX9A 4GOAA 1OK6A 1H50A 5LGXA 2Q09A 1W1PA 1TWIA 1Y0EA 2ZUVA 3UP8A 1HL2A 4O0QA 3VZZA 1KWKA 2HVOA 3RR4A 1GPWA 1BWLA 4AZGA 2G8ZA 5C54A 1ZB5A 3W7KA 4ZOCA 1YPXA 3TTEA 3DHFA 1WDQA 3SCWA 5HNNA 1F2JA 1H7XA 2OO6A 4CKQA 2XTKA 1JGIA 5I3GA 1FWHC 5TAOA 3RLVA 4ASTA 3IVTA 1KLYA 4GUJA 4V28A 4DF0A 4Q3MA 1ZALA 1PCWA 3STPA 3VC6A 3IJ8A 1W37A 1FHUA 3L65A 3CEUA 5FI8A 3UT0A 1QHOA 4KWOA 3H12A 1PX4A 3WQVA 1H1YA 1TJPA 2E5BA 3WLQA 2J24A 2R14A 2JGYA 3CC1A 4B4HA 4WSJA 1OCNA 2Z7KA 1GJUA 2O9RA 4YHGA 3DHUA 3VDBA 1I0BA 4D8LA 2WXDM 5AYIA 1DXEA 2E6DA 5CZKA 4A3QA 4ZQNA 3B8SA 1E6ZA 1NIUA 1AW2A 3EDDA 3CV2A 3EXTA 1WCGA 3IIVA 2E68A 3SCPA 4PMZA 4R34A 1RPKA 1OX4A 1AL8A 4XTIA 3WF2A 1HJQA 5F2LA 2NWRA 3LLXA 3BQ6A 3UA4A 3DC8A 1VKFA 1QOXA 2OELA 2CEQA 1R7AA 1E6NA 4FEZA 1C29A 5AN7A 3QGKC 4RZ5A 4XKYB 4XISA 4NAFA 3B9EA 3IJ9A 1V6UA 3WH5A 1JZ3A 2XZ7A 1M7XA 1F3EA 1GWJA 2WWCA 3SJ3A 4IFRA 3GB6A 3ALFA 3URAA 3MUXA 5BRPA 1IIHA 3ZO9A 5FJJA 4FOKA 2BMBA 4HCLA 3G0XA 4QAIA 4C6KA 4KGLA 1VJSA 3ZVIA 4HKPA 1SSDA 2OR2A 3MV01 3AMCA 3H55A 4PRRA 3D5HA 3U2CA 3VMNA 1UR0A 2QCFA 1MDRA 1VF8A 3LLFA 5BU9A 3QV6A 1J0YA 2VGBA 2EQDA 3QHMA 5G2HA 9XIAA 1ALDA 4PRTA 4B91A 1SYTA 4B9ZA 2VX5A 2XSXA 1QHZA 4QE1A 1YW1A 5D03A 3DESA 1ZY9A 5IXEA 5A2AA 5CCZA 4IMGA 1JZ7A 2VFIA 5FF0A 3ABSA 1O12A 3KS5A 1G0CA 3BO9A 1OGSA 1VEOA 2HS8A 5DY2A 5EMMA 5G1TA 1GCYA 3H4WA 3A6OA 4HTYA 3BG5A 3W7QA 5M03A 5G5IA 3ONBA 2QUMA 2FPVA 3AS2A 5GNXA 3BAJA 5AVNA 4FR1A 4GQBA 1GG0A 3W4RA 1R9ZA 2A7PA 4X2PA 3EEGA 1SMDA 1R3VA 1XHGA 2AQVA 2DZUA 1UCWA 2OLSA 4G8TA 1WXJA 3UXLA 1ZJBA 2X2YA 1HJXA 2X30A 1XYBA 3IJLA 3R11A 4H8VA 2PF8A 2WAGA 1EH9A 1OFDA 2AQOA 1EA9C 2J9ZA 5FF3A 4LJ3A 4GY1A 4CNOA 1IEIA 4IQDA 3GAYA 2WZMA 4JEQA 4IFOA 3EDKA 3ONCA 2P53A 4JNYA 1DQXA 2G3MA 2OSXA 4AY1A 4EE9A 4UTMA 1A0DA 1LCOA 1EHAA 3NOEA 5HANA 4F40A 4UTWA 4AEFA 1VR6A 3V1PA 3GXNA 1TO3A 3W22A 4CN4A 3U4AA 1PIFA 4U3AA 3T0AA 1WXZA 2W91A 1NARA 3IRDA 2A7NA 3HA1A 1KM3A 3GIPA 1PDYA 2FHCA 3UZZA 1JYNA 3GTNA 2TODA 4GG9A 1KC7A 1Y5WA 4PEEA 3GC2A 4E38A 1QNQA 3ZR5A 3VNMA 5H6HA 4OZOA 3VNYA 1T7LA 1KRCC 4AEEA 4WY0F 4PBGA 4UQ9A 4LALA 1Y7VA 2YCLA 3O6DA 5BRBA 4H9ZA 3F7JA 1L6SA 1H5YA 1KQZA 3CPGA 4FB7A 4KQNA 1FHVA 1M65A 4LFYA 3W1NA 4Q8MA 1ISZA 5EU9A 4Z2KA 4H2HA 1OFEA 4J3XA 2E9BA 4XUGA 1ZHAA 3KS6A 2PLKA 4AD0A 3W2UA 1A49A 4ZOAA 4UBPC 3FIGA 1RA0A 3NSNA 3THQA 2X05A 2GSHA 3OGVA 1S2VA 1H7RA 3KTXA 1ZGDA 2OZ0A 4IH3A 3VGDA 3P0XA 3UZWA 1W54A 1D3HA 3QMTA 5GNYA 3T44A 5CBJA 3TVAA 3PBWA 3TXZA 1SMAA 4XD5A 5E6YA 3W6LA 1NP2A 4UTLA 3WH9A 5DO8A 1RSCA 5EMLA 4TXEA 2QCDB 2VRQA 3NZQA 3MWCA 3BGGA 4TMCA 3GTFA 2Q8XA 5BCAA 3RGTA 5HR7A 4WJEA 3VKAA 2WCAA 3ZR4A 5EY5A 5E0CA 4QJ4B 3VK5A 3NR0A 2F9RA 3QC3A 1E9ZB 2VQUA 4O8AA 4UCGA 1S46A 2IKHA 2ZDSA 4ERIA 1FHLA 3KRBA 2ZUSA 4MF4A 4IQLA 3B04A 2B7NA 1NWRA 1V3IA 3CMJA 4Q7NA 1JCYA 3T81A 3EKGA 4LB3A 4S1FA 4A35A 4W8LA 4KH2A 3C2YA 2O7SA 4H9VA 4NJGA 1HJVA 2WSYA 4LB4A 3W7MA 1CXEA 3KL5A 4U4MA 1A4MA 3OYZA 3EOOA 3EOLA 4Q8VA 3GUWA 3R13A 2ZZ5A 1W3JA 4UOQA 2A3LA 3PZTA 3W2KA 1I8JA 1KM1A 4AYSA 2BOEX 4ZE4A 3S4TA 2MNRA 2QIWA 3I10A 2C19A 2GUBA 6REQA 5CGTA 4HPJA 4GY0A 1SFJA 3VPLA 1QU4A 1BG9A 4MM1A 3NSXA 4UR7A 1QBAA 3UJ2A 1LL4A 1X6UA 4JKMA 4MYXA 1TSIA 1ME8A 4XZIA 1I6NA 1ELSA 2X7WA 2EF9A 3R6IA 5D04C 2EHHA 3WF3A 3PTMA 3PC0A 4M82A 1XD1A 2Z28A 4S3KA 3PFRA 3W2NA 2BOFX 1LBMA 3ITCA 2XIBA 2V5KA 3CB8A 4PC8A 2CLKA 2JKPA 5DEZA 2VZSA 4M7TA 1M9HA 2YA1A 2QF8A 3UG5A 3L4UA 3BK0A 4QFUA 2A3CA 3C3UA 3H4XA 4M29A 3MANA 3DKJA 3VOIA 5AFDA 2D0HA 1Q6EA 1R3YA 2VWTA 2FDMA 3RJXA 2C15A 3MVIA 1V08A 3RM4A 3SIMA 1SUXA 1Q6OA 4BF5A 3VNDA 1TPB1 5EBAA 4MYAA 4DRSA 4MG4A 5AYBA 3L12A 3GVQA 1GVRA 3PSVA 4KPLA 3G0UA 4BQ5A 3W81A 3N19B 2C71A 2CZ5A 3TDFA 4G7EA 4OV9A 4LV4A 5D38A 3CUXA 4NYUA 3WNNA 2DZPA 4B5SA 3I7QA 1NTHA 3WQ6A 6ENLA 1O4UA 2X2GA 1SZNA 1A5UA 8TIMA 1CGWA 1U83A 3BAYA 2D73A 2OZTA 1W1A1 5GJPA 4ONVA 2D22A 1SJDA 5AYZA 4F9DA 4HD5A 1UASA 2C3ZA 2A5HA 1RK5A 3DCPA 1K7XA 1Q45A 3D3AA 3VD5A 4FA3A 3Q4DA 2VHLA 4IGSA 1R5YA 1XD0A 3R0KA 5G1MA 2JKEA 2QYGA 4AW7A 4JIPA 3LI0A 4MPKA 4AMCA 4DVOA 2D2GA 2NUYA 1H11A 3GTHA 4CQDA 1Q3NA 4DUXA 1ICSA 4OVXA 1NWSA 2G3FA 4F0MA 4DB7A 4GX8A 1XR2A 3H2FA 1LOSA 4HK6A 4XBJA 2GGHA 4Y9NA 1IZJA 3SQSA 1FH7A 4O11A 2HE8A 3QR1A 5M1TA 2D24A 3JW7A 2BOGX 3M43A 1US3A 4ATWA 4ZL1A 2ABAA 3HO8A 2IQTA 3S9ZA 4ZB5A 3MSDA 3PJWA 2VP8A 1TVPA 4TMBA 1V6TA 1RD5A 2QMJA 2PODA 2V8ZA 3LZ3A 3WDPP 4A05A 2O0TA 1EGVA 3WD2A 4O54A 2Z7GA 3UWQA 4M80A 1W9PA 4N42A 2QPXA 5CEWA 3AIEA 5DMMA 4Q8OA 3JU2A 1O5RA 4YTQA 1S2TA 3WCZA 4HB7A 2G0WA 4M56A 1TA3B 3WQWA 2VEGA 2ZRUA 5D2YA 3D6NA 4GC3A 4QCFA 4WOQA 2FB3A 1T40A 3WUGA 1DJYA 2J6VA 4WY0B 2XSAA 1TPVA 2J6XA 2VEIA 3VIMA 4DO4A 1OQFA 2X8RA 1NOWA 2ZZ3A 3CAVA 2R6OA 1I45A 2VGIA 1QVBA 1VFLA 4AYGA 4Q4RA 4XAGA 3UETA 4HSHA 4D2JA 3NOYA 1XLKA 2J79A 1U1JA 1IZCA 3FHAA 2ON3A 1CGVA 1D8WA 4MB4A 4J27A 1VP5A 2P3ZA 3H24A 3A23A 2VX7A 1UR4A 2PRHA 4DUOA 5CG7A 2PD5A 3R89A 3GVRA 4UQEA 2YDSA 4CD6A 5BRQA 1DJZA 4QHRA 1FP9A 3TSBA 3BXWA 4XUYA 1KCXA 2GVGA 4US5A 3N34A 3VIGA 1ADDA 1F76A 4O8RA 2PPGA 4RNFA 1TR1A 3EKLA 3BSHA 3I7RA 3WLLA 2CNCA 3T2PA 3LM3A 2BY1A 1JI1A 3WNLA 2FMOA 4QS6A 3KBMA 4BA0A 4B5TA 1XFCA 4JTTA 1S3HA 2Y5SA 4WXZA 1WBJA 3NEVA 3YPIA 1W5NA 1A47A 1TTJA 3WQ5A 3W82A 1P0DA 2REQA 3W38A 2NSXA 4QSFA 1UPMB 3WH6A 3S6OA 1OFRA 4F4RA 2GJRA 4AG0A 4UTWC 3QMRA 4IG2A 3TIMA 1TIWA 3TW6A 1ZCCA 3ZT6A 4BI6A 1ZAJA 2ZX7A 5DBTA 4V27A 1GGOA 1E9IA 4LVGA 5HNTA 1GOIA 3K2GA 1IWPA 1MFVA 1KRAC 3LQLA 4UTTA 1VFUA 1F6KA 4EAMA 1OVDA 4B9YA 1OFOA 3SRDA 1UJPA 1M41A 4OJYA 3WZ0E 1EF3A 1CLXA 4HU8A 3C4UA 1M7JA 3LYEA 4ZMGA 2V5LA 2Q71A 2C0AA 2V5DA 3MP4A 4E3TA 5GPRA 1EKOA 4FOUA 2HBXA 3TA9A 1VH7A 7TIMA 3AJXA 5DFAA 1AMKA 2CKRA 4QS5A 2YB4A 2OFJA 1GKQA 4H9UA 4N6FA 1NF7A 1ZUAX 3DYOA 5GJMA 2OODA 3IVSA 5MKGA 3EX3A 1IWAA 1BG4A 3KVMA 2VZUA 3U7VA 1IEQA 2AL1A 4KMQA 5SWUA 3CHEA 2PDIA 3EDFA 3N14A 1Z69A 4K1WA 3B4UA 1KFLA 1GKRA 3SURA 4LCRA 1B9ZA 2DQWA 1M7PA 1B9BA 4Q6XA 3BUVA 3GU9A 1RY8A 4KFPA 1HXJA 4K36A 3TSMA 4JGDA 3T08A 1JJKA 5K4XA 3QVQA 5DY3A 5I3JA 4L1GA 4IJCA 3W0KA 3AHYA 1BYCA 3SUSA 3VCNA 2OJPA 1JNDA 4Q8WA 2ZUWA 5FSDC 3MMUA 3ABXA 1PUDA 1EF2A 3O3RA 1HKMA 4DO5A 1E71M 4LW7A 5CPSA 3CQIA 2VGFA 3N11A 3PANA 2OYMA 1OK4A 2YZ5A 4GC4A 4OV4A 3K46A 4S3AA 3VDGA 1THFD 3HGOA 3LENA 2G96A 1FBAA 2VXNA 1R0MA 4KCVA 4R88A 2XWEA 2GSJA 3MHFA 1KM2A 5I7GA 2CFFA 2BS9A 3NQBA 2D20A 3I4KA 2C7FA 2HK0A 2IKJA 3L4ZA 1E6QM 1T96A 1EEPA 5JH2A 2DZWA 3GFZA 4A3UA 4GZJA 4MGGA 2HS6A 4KCUA 2W5FA 4DNHA 2ODOA 2EKGA 3O06A 1TJ1A 3ARUA 2V81A 3IGXA 4DAIA 1ONXA 2JGQA 3F2BA 1OM0A 3QFWA 4CLMA 2CETA 2C1IA 3N1AA 3WUFA 3ATYA 3LHTA 4EXAA 4PMOA 4RDYA 2VCCA 1L6FA 3UWEA 1E3ZA 1LUCA 5IFTA 5A6SA 4N4QA 5GJNA 1KFCA 1PYMA 3LEPA 1BRLB 3L5AA 4PTXA 1IXQA 5I6SA 4MY1A 3BQ5A 3WD3A 3CNYA 1UH4A 1OT1A 2QCCA 3K4AA 4HNLA 3W7HA 2RH9A 3LCWA 3T0TA 1BSLA 3UFYA 3L66A 2PDGA 4Q4KA 3CUZA 2C79A 1TV4A 1UQYA 1HT6A 1JCXA 2YFOA 3E5PA 3IWPA 3I3BA 3SUTA 1T6MA 2BVYA 3IJIA 3OVRA 3L4TA 4ZEPA 4JX6A 4OFCA 3QV7A 1WZLA 2Q6ZA 3QPEA 2DZXA 2VEFA 3NO3A 1V5XA 1LT7A 3P0WA 2ZRWA 3KOWA 4HYWA 3WK1A 4NNBA 1XINA 4AD1A 3FHQA 2WPBA 3CTLA 4E8DA 5HUPA 4PR4A 1X6LA 3TUUA 1JD7A 1HJSA 1C91A 1JUKA 3VZYA 3SI9A 3RHGA 5AC7A 1EJTC 1UIOA 3G1FA 4AY8A 2PDJA 4PMRA 3VNIA 3TKFA 4FX7A 4BI7A 3HN3A 1XH1A 2PP1A 4Z2HA 2FVKA 4UFHA 4D6CA 4AQLA 2CXGA 1MSSA 1R86A 2GDQA 1K6WA 4GLEA 3KBNA 1G94A 4FXFA 1VGAA 4XG1A 4DHGA 5H1WA 3TU9A 2XPKA 4Z2JA 3AIRA 1V0LA 2ASHA 2BXZA 3GBEA 3UA3A 3GQYA 1ZSXA 1R87A 1EP1A 2ANUA 3QRHA 1WZAA 5HWNA 5DXXA 3N13A 5I3KA 2XM1A 4ZOEA 4P61A 4DYJA 1RLDA 2WNZA 1SM9A 3R5EA 2FTWA 3FA5A 3M47A 1ITQA 3GH4A 1BPLB 3ITVA 4MNMA 3TK7A 4K8GA 3R10A 3NZRA 1TMLA 4IM4A 4N9EA 5DLCA 1EX5A 3RMEA 5KTLA 3LCLA 3NPVA 4HP5A 3R8HA 3EWCA 4P8UA 1VYRA 3IV8A 1VENA 4UQDA 5U4NA 4PBEA 5TNVA 4ZSTA 4D6JA 3VOHA 1BEUA 4N9CA 2QT3A 2GSEA 1W3LA 3W1TA 3IVUA 3EBVA 1AQHA 5A6BD 1N8IA 3OVGA 2XG9A 5CKSA 3OQEA 1W5QA 4FO4A 3S1WA 3V75A 3RK8A 2GQ8A 3ZZ1A 2NW0A 3N12A 4KIRA 3CHVA 4FIRA 1JPHA 3RNDA 3WDHA 1GOMA 1RVKA 1KXVA 5A6LA 4C1KA 3QZAA 3MT1A 4CN1A 5D9MA 3OYXA 1HP5A 1ITXA 4GXWA 3TNBA 4PRWA 1Y5XA 1R38A 5BW6A 3P8IA 4BQ3A 1D2KA 1ZZMA 4KWSA 1C93A 2FZBA 5F2MA 2JEPA 1QMLA 4GFSA 5C7VA 2G97A 4A3YA 3ABRA 3CV1A 1XI3A 4X9YA 1PB0A 7XIMA 3OO2A 2DT0A 1R2TA 4JTRA 1E1FA 3NL5A 1YDOA 3PTKA 2ZWYA 3BAIA 5ECUA 4KRTA 2CZEA 4EWND 5I78A 4W7VA 4XD4A 1X97A 1GQIA 2WO5A 3LCFA 1WDDA 5IHRA 4DZHA 5K4ZA 2Y7EA 4KESA 4GNVA 1PS9A 3A22A 4JN8A 3BZJA 4HU3A 3CU2A 1CGTA 4DXVA 3LCXA 1OYAA 1A5AA 4Z0SA 1EJ7L 3T0CA 1VD6A 4CNNA 3M0YA 1U2YA 1CTNA 1R8LA 3GY1A 4C6MA 1T8XA 2FH8A 4QITA 2WV8A 2XYLA 1BTCA 3SUVA 3RRAA 1VBHA 2RDXA 5FESA 1FHDA 3RCYA 2PWHA 1XM3A 2O92A 1ONWA 1KFEA 5M2FX 3BSGA 1BKHA 4ZTYA 4M24A 2DIKA 2JIEA 3CHFA 5C8BB 2Z6IA 1KXQA 1LRTA 3LV5A 1FQ0A 1QFEA 3PZIA 4FPSA 3TSDA 1SO3A 4HMCA 3PBGA 4MWAD 1FWCC 4LRTA 1P7TA 4RXGA 4CQBA 2GQ9A 5D30A 1S5VA 1UKPA 2F7FA 1VHCA 1P5BA 1QNRA 3U7BA 1E1EA 1B3OA 3ATZA 3DI0A 2XIOA 4ZQRA 3R0DA 1JCMP 5D2TA 2TYSA 1VC4A 2ZZ6A 4Q6JA 4OTKA 2ZXQA 1ZS2A 4X61A 4LWWA 3ARWA 4PUMA 2C0HA 2DJXA 3UG4A 1X7FA 4IIGA 3EYPA 4H6KA 3CV6A 4AB4A 2XIQA 1YQ2A 5AC5A 3LDVA 4X0NA 3OW1A 3AYRA 5ABFB 2V6AA 1EC9A 1HL8A 4KFNA 3GU1A 1SR9A 2ZFAA 3M0HA 3B3DA 3WNMA 2JF7A 3ITOA 3MB9A 2QV4A 3W7IA 3LXCA 1VPQA 3S8HA 3VABA 3ZYZA 3HQNA 4C6FA 2ZYFA 4P7NA 6TAAA 3CPRA 1EDGA 4Y96A 4CNTA 3O1NA 3SAZA 3EOEA 2OWWA 1ZL1A 1OIMA 3RCMA 3NXLA 4H7VA 1LQAA 3V36A 3W85A 3UXAA 1XBVA 2DSWA 4HZ8A 2YR1A 2HV5A 3B97A 3MUIA 3LHUA 3PK7A 4ENLA 2Y5JA 4WKFA 3V18A 3SCOA 2YCLB 1YDVA 4PTMA 1H0IA 3TC3A 4GH3A 2JKAA 5GNZA 3RXZA 5HWMA 1V3JA 3G6LA 3QM3A 5HNRA 5DBUA 1YXYA 1QI4A 4CGTA 4OBRA 3NQ8A 1OFQA 5JVLA 2XVPA 2YCKX 1EUNA 3AICA 4LGXA 4WD0A 1XW8A 2W4XA 2EPLX 1LBFA 4QSHA 1TV7A 4XTDA 5KEZA 1XYLA 2CITA 4JPGA 1ZBVA 4D1IA 3HPFA 4IOTA 3MCNA 4PUWA 3MTWA 3W70A 1D3CA 4ATLA 1YXCA 3OVQA 4BWLA 3P84A 4KEVA 2OEJA 1PYFA 1FCQA 4X0VA 3QBUA 2OWCA 3TMQA 1Z89A 3VIKA 1FDZA 4H41A 5HK4A 4Z1BA 4B3KA 4RLIA 1EB3A 1XBXA 2YA0A 1J6OA 3KCJA 3QZEA 4ICMA 3GXTA 3RLGA 3XISA 3PB2A 4UNIA 4P8XA 4L64A 3ZR6A 4WCJA 4C6IA 4CQ9A 1GVQA 2YXOA 2ADAA 2A0NA 5A8PA 4HPHA 2PDHA 4OUEA 1F9CA 1Z48A 3HM7A 3HG3A 1GYNA 4K7VA 5HOSA 1K9DA 3ARPA 3W6MA 3OP2A 4W87A 4PN2A 4YYCA 3ELFA 4JFSA 3RRXA 3OLEA 3OA3A 2TPSA 4IIEA 3ID7A 3O8AA 2PLJA 1LWHA 1ML1A 4ERGA 4U2YA 4PMNA 1YDYA 2R91A 1MEWA 2RJHA 1UPPA 6REQB 2XM2A 3SW6A 2G95A 4LF2A 4V15A <