2PDHA

Human aldose reductase mutant l300p complexed with uracil-type inhibitor at 1.45 a.
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
315
structure length
315
Chain Sequence
ASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCAPLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title Merging the binding sites of aldose and aldehyde reductase for detection of inhibitor selectivity-determining features.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 103
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2007-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2pdhA00
1RY0A 4PMJA 3LUTA 4EXBA 3WBWA 3GHTA 4JTQA 2PDWA 1X97A 2IKHA 3UYIA 3ERPA 3M64A 4XO7A 3LZ5A 2BGSA 3S3GA 1EXBA 3D3FA 4LBSA 1YNQA 2PDBA 2PDGA 1IEIA 1YNPA 5KETA 2PDPA 4FALA 4JQ2A 4JTRA 3LEPA 5HNTA 3R43A 3LD5A 3ONCA 4YU1A 3FX4A 3COTA 3M0IA 1J96A 1XJBA 2VDGA 4H8NA 4WDTA 2PDQA 4AUBA 2IKIA 4XZHA 3BCJA 4PR4A 2FZ8A 3V0SA 4XZMX 3Q67A 4JQ1A 2ACUA 2IQ0A 1PZ1A 3UP8A 3H7UA 2PDIA 1IHIA 3CAQA 1PWLA 2AGTA 5LIKX 3R8HA 1YE6A 3G1RA 4ASTA 1K8CA 2PD5A 4XK2A 4XZLX 1S1RA 2J8TA 1FRBA 4QBXA 4L1XA 3U2CA 1HW6A 1MI3A 3BURA 4LAUA 4GA8A 4IGSA 2PDMA 4R9OA 2QXWA 1EKOA 1AZ1A 2WZTA 2HE8A 5JH1A 3G5EA 3WBXA 3DN5A 3O0KA 4GQGA 3NTYA 2IS7A 3C3UA 1ADSA 2HVNA 4JQ3A 2HEJA 1T40A 3BV7A 2DUZA 4I5XA 3RX3A 4GACA 3LN3A 4NKCA 4DBUA 4IJCA 2PD9A 4H7CA 1S2CA 4OTKA 5DANA 4L1WA 1ZGDA 3UZXA 3V0TA 2PF8A 3GHRA 3LNMA 2A79A 1PZ0A 2NVDA 3CMFA 1XF0A 1PYFA 1C9WA 2F38A 4GQ0A 3UZYA 4HBKA 4WRHA 2P5NA 3RX2A 1AFSA 3CV6A 1AH3A 3H4GA 2HDJA 5LIXX 3CASA 4HMNA 1X96A 4XZIA 4JQAA 3V35A 2PZNA 3RX4A 3V36A 1PWMA 4PUUA 3LZ3A 3UFYA 3B3DA 1RALA 3WG6A 4WDUA 2DUXA 1S2AA 4XVEA 4XVDA 1OG6A 4LB4A 1QRQA 2NVCA 4YVPA 4Q7BA 3DOPA 3F7JA 3GUGA 4PRRA 4GABA 4WGHA 4ZFCA 2FZ9A 3CAVA 4JQ4A 1MRQA 3O3RA 2IPWA 5C7HA 5LIYX 4JTAA 2PDXA 3EAUA 2HV5A 4GCAA 1Z8AA 4DZ5A 3MB9A 1ZSXA 4Q3MA 2WZMA 3BUVA 1R38A 2PDNA 3UZWA 1MZRA 3UWEA 4F40A 2PDKA 1EF3A 2PFHA 3UGRA 5HNUA 3N2TA 4G5DA 1Z89A 4WEVX 3LENA 1Z3NA 1AZ2A 2R24A 1QWKA 2PDCA 3R6IA 3UZZA 2IPFA 2IKGA 1SM9A 3KRBA 4XZNX 4GIEA 1VP5A 2DV0A 3Q65A 4YS1A 3GHSA 3UG8A 5JH2A 3R94A 2HVOA 4YVVA 4JTCA 5AZ0A 3LQLA 1UR3M 3T42A 4MHBA 3LQGA 2IPGA 3VXGA 4IJRA 4XO6A 1X98A 3P2VA 2R9RA 4XAPA 2IQDA 4RPQA 1T41A 1LWIA 2I17A 1Q13A 1VBJA 2FZBA 2HE5A 3R7MA 4FA3A 2IPJA 4FZIA 2ACQA 4PUWA 2IKJA 3LBOA 4LBRA 1Z9AA 2PDYA 2I16A 3ONBA 2FGBA 3M4HA 3MC5A 1XGDA 4YVXA 2INZA 1GVEA 3EB4A 2PDHA 1AH0A 3R8GA 3QKZA 2PDUA 4EXAA 1HQTA 1US0A 2PEVA 3H7RA 4LAZA 2PDFA 3WCZA 4JTDA 4DBWA 3GHUA 1Q5MA 4JIHA 3FJNA 2C91A 4LB3A 4WDWA 3WBYA 3R58A 5HA7A 1RY8A 4QR6A 3CV7A 4FAMA 2ACSA 4JIRA 1JEZA 4QX4A 2PDLA 2BGQA 5LIUX 1S1PA 1A80A 2ACRA 1YE4A 1ZQ5A 2CLPA 2ISFA 4QXIA 2F2KA 5AZ1A 4ICCX 2BP1A 1LQAA 4PRTA 1AH4A 3N6QA 2PDJA 5M2FX 5LIWX 1ZUAX 1M9HA 4WDXA 2FZDA 2INEA 4JIIX 4DBSA 2ALRA 3EB3A 2FVLA 3V0UA 1EL3A
chains in the Genus database with same CATH superfamily
4AZIA 1UOKA 1GG1A 3GDMA 3SJ3A 4H6RA 2ZA3A 3R11A 3NSNA 1A5NC 5D9OA 4NILA 3SY1A 5XINA 1CB7B 3CUHA 5ENLA 5J04A 2A4AA 4XG1A 4MAVA 4Q8UA 2BOEX 1NOFA 3OLGA 3W72A 1FWRA 1J01A 4BQ5A 2GVLA 4QAIA 4IMGA 2QIIA 2VRQA 5G5IA 4O52A 3WF1A 1WDDA 1XIFA 3S6OA 5BU9A 2ZDSA 1OF6A 1TB3A 3IJ9A 3SFKA 3VOIA 5KINA 3VE9A 2OYLA 1KW1A 3U5UA 1NFBA 4ZR8A 3MUXA 4YHGA 3PG9A 5KZEA 1V3KA 2QPSA 2PDIA 1EJTC 2QEZA 3NZ1A 3OTRA 3VM5A 3MO7A 3GW0A 1JIBA 4JL2A 4H1ZA 3WJWA 4JL1A 4B3ZA 3RO8A 3GVWA 2G3NA 4RZ5A 1W1A1 4GI9A 2WANA 3SURA 4Z2GA 2A6LA 1FWTA 3MKCA 1TTPA 4QEHA 1QI4A 3WQ6A 2YBUA 4OU1A 4O8RA 4V28A 1B4KA 3L65A 3MO4A 3NL2A 1WOBA 3N11A 1XYBA 4AZCB 4D6EA 4NVTA 1PX3A 4GQGA 1P1MA 4IX2A 3VIOA 1XLKA 1X6NA 2HEJA 5DELA 4QM1A 1VYPX 3AYSA 2E9LA 3BV7A 2OYKA 3TFXA 3PJWA 1CLKA 4JDBA 3CS2A 1AQMA 1R30A 3PWIA 4PL1A 3NOYA 3WQWA 3DEQA 3C2YA 1NDZA 4GG9A 4IPJA 3ISIX 5GNXA 5CSUA 4PEKA 1KCKA 2WAGA 2J9XA 2LLEA 4ZL1A 2OLSA 3TV8A 1YRRA 4NT0A 2YYUA 3IAQA 1J10A 1VFHA 1TIMA 4HA4A 5E9XA 2VWTA 3ALGA 5FF0A 1QO5A 2Y7FA 1GHSA 3R0KA 1SFLA 4EAYA 1W3IA 2X2YA 1QOPA 1JCNA 4RE0A 4JKLA 5I3IA 1VLWA 8A3HA 4EX4A 5K4XA 2EKGA 4FIRA 3IUHA 3DX5A 3LZ3A 2QCHA 4HU4A 1LL7A 4M80A 3RLHA 1OC6A 3P5ZA 2QCDA 1QATA 1DQUA 4AWTA 1HJUA 1DJZA 3N4AA 5BRBA 3B06A 1Z69A 3GFYA 5C9WA 5LXEA 2Z27A 3LX9A 5CG0A 3DOPA 2XZ9A 1Z44A 5GVJA 1UYQA 2VD8A 3QN3A 2OT1A 3I6RA 1LWJA 2IPWA 1KBJA 2WSYA 1R2SA 4XAYA 1KM3A 3WQVA 3BQ6A 2XZ7A 3JW7A 1FX6A 4JTKA 3H23A 3CLWA 3ITLA 3EWXA 2P10A 3GR4A 2QCCA 1JGMA 4M6PA 5AN7A 2FVMA 1HGWA 1Z48A 2WXDM 3TYEA 2ZRYA 3B03A 4JN7A 2HPMA 3PHAA 1GZGA 5C7VA 2CU0A 3ZT5A 3B05A 4PTDA 2QKFA 4BY3A 1R3QA 3OHMB 4HB7A 3QF0A 3MA8A 5L9FA 1LROA 1JPMA 3S5OA 2XIOA 3WQ8A 2E3ZA 3E5PA 1CXKA 4I90A 4C6BA 1PKLA 3GLCA 3OZOA 3SZ8A 1HGYA 4NX0A 3KTSA 2DV0A 4CEUC 1K6WA 4CD7A 1TQJA 3T42A 4MHBA 4AHOA 1RJPA 1PDZA 3VXGA 3QHOA 1ADDA 2XSXA 1EP1A 4C1NB 1ZPTA 3PUDA 4C6QA 2V5BA 4XAPA 2IQDA 3DG3A 1BAGA 3HMJG 4B9ZA 2VENA 1YW1A 4J3WA 3UNTA 2GGEA 2ZX6A 4P7LA 2XM2A 1UKSA 1SMAA 3N2BA 3C2FA 1UA7A 4GGHA 4RE2A 3KBWA 1GQIA 2NV1A 5BRPA 3VA8A 3B0XA 4PUWA 1KNWA 1VPYA 5HDRA 2PZ0A 2VFEA 3DFNA 1V02A 4JTLA 2Z1SA 1XGDA 3G1SA 4M81A 4QCEA 3GVVA 1HZYA 3QMTA 1XLDA 5I6SA 1HL9A 2Y8VA 2FGLA 4AY8A 3URQA 3N04A 4ZO8A 3VYLA 3N6JA 3FV9A 4GNKB 1C29A 3ITTA 2XPKA 5IFTA 3KS5A 2DQXA 1DIKA 5M03A 4GWEA 3W84A 2BSLA 5FJOA 2BVDA 1JAEA 1QPNA 3AYTA 3WH9A 1X8FA 1R3RA 3GAKA 1OM0A 5D4YA 3D0CA 1ZQ5A 4DYJA 3AWOA 5AZ1A 3H24A 3LXCA 2Z1KA 2IQTA 3MYPA 2Y85A 3BLPX 3MWAA 5A6SA 1K4HA 4CNOA 2UBPC 4LNCA 4Z0JA 1OFPA 3DYOA 4WJEA 4HPHA 2PTXA 5D05A 2PWHA 3WMSA 3ITYA 1EL3A 3VABA 4POCA 4OIFA 2YXGA 2WKGA 1XYLA 3VVGA 1S5NA 3ME3A 4PTVA 2PDWA 4EF8A 5IHRA 1EUNA 1GGOA 1WDPA 3MZ2A 2GGIA 2CERA 2Y62A 4LYKA 3W7DA 4C91A 4ILSA 3S83A 1B9ZA 1R5YA 1FHLA 2GPTA 1UKTA 2PDPA 1C93A 2Z26A 1BPLB 3FYYA 2PAJA 2ZXAA 2HQAA 4ZQRA 1EGVA 2FJKA 5DT7A 2G3MA 4F48A 3LXBA 4FB7A 2HTMA 2CLLA 3CV1A 1WKYA 1J96A 3OODA 3B4YA 3QPZA 4AUBA 1GTHA 2BXZA 3GBDA 1IEWA 4I8YA 2Z7KA 3S5SA 2VVNA 2ZZ3A 4XWUA 2CXEA 3E0LA 4LVFA 1G0CA 1M6JA 3WENA 1TWWA 5KZ6A 1OYCA 3CB8A 4Q4OA 3VIMA 2ZQ0A 2X30A 1M03A 4DAIA 1KRCC 1UJPA 2QYGA 5LGXA 3GR7A 3JU2A 4Y6GA 1D2KA 5E5CA 2BVWA 1FP9A 1DBTA 2J47A 4C60A 1NOUA 3H2OA 4Y90A 2NX1A 3MUZ1 3G8RA 3D3AA 3NZRA 4DJDA 4W5ZA 2CLHA 3QR1A 4FR6A 3LRLA 1Q65A 4BI6A 5LHEA 2NWRA 2VL4A 2BWGA 1B3WA 1U1HA 4HVXA 2HE8A 3FVMA 4LFYA 3WQ5A 4H9ZA 3WD3A 1VR6A 3CHVA 3PB2A 1EJVC 2TPSA 3N73A 3W2NA 2ZX5A 1ITUA 3T0CA 3NZPA 3GXDA 1D7FA 2F8QA 1DWIM 2Z1BA 1V6UA 1LRNA 5ABEA 1MDRA 3VOJA 3BZGA 1Z7AA 4LEFA 2P0OA 1L9WA 2CZEA 4O1FA 3NDZA 4BQ4A 3TJXA 1ZCOA 3KEHA 1OINA 3KHDA 2J78A 2NX3A 4DXKA 1RP9A 5LNVA 4N9CA 1P6WA 4WY0F 2VFHA 3UYCA 2VT0A 3FEQA 5I3JA 4HZ7A 1F6KA 2FFIA 2JBMA 3ZYZA 4H8UA 4G9PA 2HSAA 3TJ4A 1VJSA 3CO4A 4KCWA 4MFEA 1JNEA 1T6MA 2QCEA 3F4WA 5KZDA 1EJ7L 5B7YA 3AWNA 2YCEA 4RE4A 5AECA 1AW2A 5C0QA 3VK5A 5DX7A 3CQ0A 3LG3A 3MW7A 4U10A 5CJMA 1YHTA 3N14A 4XVEA 4DM2A 2RGLA 4B16A 3VGFA 1V3IA 4LB4A 3USBA 3W7CA 3ZLFA 3CEUA 1KFEA 1PKYA 4H7VA 1A0DA 2QGYA 3RLUA 5FJRA 4GABA 1PIIA 3LOTA 1K9TA 3WLHA 2X0HA 3W83A 5AHLA 3L5MA 5ABHA 4HSOA 4N9EA 2CEQA 3QZ6A 2QDHA 3MB9A 2XGZA 3UVAA 2YGYA 4KS0A 1TV8A 4KKXA 4FP1A 3ZJ8A 3C56A 3OVPA 4UFHA 1T8XA 3BCDA 2JKEA 2YA2A 1RJRA 4ZQOA 1RLDA 1EEXA 1CYGA 2QDGA 3QLDA 4GH1A 4HNTA 3LTYA 1TCMA 2PI6A 3VNJA 1ISVA 1RCXB 3WKZA 4Q6JA 3FCPA 1WZKA 1KXHA 3W25A 3ZSTA 1W9VA 4ZB2A 4GRSA 2YDQA 1RA5A 1XR2A 3IGUA 1VENA 4XZNX 4AXKA 3TW9A 4FOKA 3URAA 5JH2A 3CWHA 3FK4A 2HVOA 3SRFA 4C6NA 3WFZA 1WKFA 2ANUA 1E56A 4MYAA 4ZODA 1FWHC 2YL9A 3G1XA 3GYCA 1W32A 4UFJA 3TX9A 4F9JA 2OELA 4ZB5A 4ZSTA 1HG3A 1RCOB 1ZBWA 4RPQA 3HURA 3A4AA 4TR9A 4PMUA 4IIDA 2I17A 2PLMA 5A8NA 5C6MA 5I7GA 3UWWA 1XIHA 3R7MA 2I5GA 4DJDC 4AF0B 3CAKA 2J79A 2DZXA 5HUPA 1VBRA 4ACYA 2QIWA 1N2VA 3SQSA 3NG3A 4RDWA 4D6DA 1UZ4A 4GC4A 1US0A 3SJNA 4US5A 1DE5A 2W4XA 2C18A 2JEQA 4NHVA 5DFAA 4RZ6A 4GJIA 4ZTYA 5BU6A 4MJZA 2VZTA 4MJ2A 3GC4A 5HA7A 1IV8A 2Y70A 1JEZA 1QUMA 1DWFM 3PZMA 1UH3A 3LK6A 2O55A 2OQYA 1DOSA 3L4TA 1A5LC 1W1VA 2PCEA 2JKPA 4JYEA 3PAJA 2XH4A 3BARA 4L4MA 2F2KA 3WLPA 4LCRA 4DJFC 4ORMA 4Q4SA 1OK6A 3EX6A 3PZUA 1Z32X 2H3BA 3LCIA 4BS0A 3TN3A 5H8PA 3TNOA 2WBGA 2INEA 3DHUA 4DBSA 3P0WA 1HJXA 4PMNA 1TMLA 4DJEA 1JQVA 4N9DA 2UY3A 1GOKA 4AZ6A 3WQDA 1NARA 2DZUA 2VELA 4WOQA 3WK3A 3HB9A 2V81A 3P81A 4MKVA 1KFCA 3GHTA 3AUOA 1H09A 2P88A 1X97A 5LA2A 5E70A 3ABOA 2CHNA 4NYUA 3W27A 3WK0A 1KGXA 5HANA 3ZO9A 5I78A 4IISA 4QDMA 1GVYA 4OUEA 4BK9A 4AY7A 3C0JA 4S2CA 4HIBA 3F4NA 3G3MA 3TUUA 3CHEA 3IGHX 3JVAA 3JZEA 1JPKA 5EKYA 2WMGA 4YTTA 5FJPA 5C71A 4MOZA 1BRLB 2B0MA 1LLOA 2NSXA 4D6CA 3M5VA 3IRSA 3EDDA 4WY0A 3RYSA 4IPNB 4JX5A 4S3GA 4O4WA 3OYXA 3GKFA 3C0SA 1HL2A 4ZQMA 5JUVA 2VMFA 1I2NA 1D8WA 4IPLA 3R8HA 4OE7A 3W1QA 4N4PA 3NSXA 4DRSA 2J88A 2ISDA 1QMLA 1S1RA 2F7FA 1VHNA 4PUKA 3VNIA 4AY1A 2P8CA 2WC3A 4LAUA 2QJJA 4IGSA 1W5MA 4R9OA 3WQFA 4HQVA 1QK2A 4HSNA 1O66A 1VBGA 2I5QA 4JFTA 3NTYA 3BSHA 3WNKA 1BG9A 1MUMA 4UOZA 2F61A 3GG8A 3W26A 4JGDA 4KESA 1J6PA 1UA3A 4MLJA 1WB0A 3UG3A 4PB3A 4ZE4A 4LS2A 5C55A 1VFMA 1H5VA 1G4SA 4OTKA 4INFA 3J7HA 1KBIA 1K8ZA 4NU7A 3STPA 1WDRA 3V16A 4WSKA 3VE7A 2Z0IA 5C2XA 4H01A 2UV8G 5TBOA 2RGMA 4C6FA 2BY0A 2VRJA 4K7YA 4O1BA 5HMSA 1N8IA 3GNXA 3CPGA 3EZ4A 5F1UA 4JR5A 3SCTA 4UFMA 2Z2AA 1HKWA 3RX2A 1GQNA 5FJIA 3SO7A 1HVXA 1EP3A 5CG7A 3QMSA 4GIYA 4R27A 2NQHA 2NUYA 3MBFA 2CBJA 4GVIA 1XLHA 2CBVA 4J3ZA 3VNMA 3EA2A 4E5TA 4DUWA 3OPSA 1CGXA 4NF7A 3T8LA 2HBVA 3O7UA 2J7HA 2GL5A 1UWSA 1CZ1A 4V1YA 3VGDA 4DJFD 2PURA 3K30A 1UWRA 2O9PA 3O05A 2WW5A 3W7EA 3TKFA 3CYJA 3BMWA 1S2VA 2P3EA 1W31A 5CPMA 1G7VA 1PZ2A 1IXNA 3E2QA 3CIVA 2QNEA 4E8GA 3WO8A 1OCNA 1TTIA 5HJXA 5JQ9A 5F4WA 1CGVA 5J5RA 2QDEA 3QKEA 4Q33A 3GAYA 3VIIA 2RKXA 2QCNA 1EJWC 2VDIA 4P8VA 3K1GA 5EGRA 4UB9A 1R38A 1UR1A 1SUXA 3L2MA 3S1VA 2GSEA 1MDLA 1DKWA 1H7PA 2A3LA 2W27A 1GOOA 1VEPA 3THUA 3OBKA 5DT5A 1FCVA 1M68A 2WNQA 4AISA 2TRSA 3N2TA 3EWUA 1JJKA 3PY2A 3UCCA 2R24A 1NU5A 1FWCC 1Q6DA 3WQEA 4DF2A 2IKGA 3WUGA 5EBUA 2BHZA 2VXNA 1HJSA 2VOTA 1ENUA 1HFBA 1RK5A 1TRIA 1LQ2A 4EP8C 4K6AA 1TPH1 3LQGA 4LF2A 1A5BA 3CWOX 3CQHA 4UTFA 4IJRA 3VX1A 3WQOA 4GX8A 3O16A 2Z1XA 1ZJAA 3IGSA 1OX6A 5AHMA 1THFD 1QHPA 5GJMA 3SI9A 1UD2A 2WJFA 4GMEA 1ZCCA 2H9AA 1XRTA 4HNCA 1OIFA 3OGSA 4ERAA 2X1TA 3KVMA 2FHBA 3TWAA 1ZAIA 3T8QA 4Q4MA 5PTDA 3GYEA 2ODOA 3TC6A 3ARSA 3VMPA 5HQEA 3MI2A 3P60A 4KT2A 4DBDA 3VIFA 1IEVA 3VNDA 3TYDA 1J12A 2YKKA 4RDZA 2WHKA 3OA5A 4PMQA 3Q4DA 3VDHA 2FB3A 2ZX7A 3R8GA 4Q32A 3V3WA 4WR3A 1JDFA 2PEVA 4QLKA 2ZUWA 2WMKA 2VHLA 3AHTA 1RJQA 4DNMA 4JFSA 3H2EA 2X42A 4RNIA 1KFJA 5HUOA 4C5ZA 3TCSA 3PUOA 1BXBA 2BDQA 4Q8TA 4LAMA 1QCWA 4O14A 4DNHA 4ZENA 3AIRA 3N2XA 3PTMA 2FGZA 4ADUA 1CLVA 2B7NA 3UR2A 3UWVA 3KL3A 2CLIA 3WLNA 2R14A 2CLFA 2XN2A 1J4EA 1ZP4A 2QMJA 3NDOA 4LTSA 1TMQA 4XBKA 4QNEA 4D71A 4R53A 4UTIA 3N6QA 3OZMA 2H3DA 1H61A 3IACA 3WFAA 3SN4A 1R3WA 1BGAA 3PNZA 3W28A 4S1FA 3RJXA 3U3HA 3M0MA 3HJEA 1S3TC 1C90A 1JG9A 4FPSA 4W9TA 2ZZ2A 3N2OA 4HA3A 5M17A 3CLMA 3LUTA 4DVOA 1JZ5A 1JCTA 1UP3A 4PCNA 4OV4A 2V82A 5CZJA 3QFWA 2YCJA 1H7NA 3SQMA 4DPQA 3RMJA 4LUTA 2ZRVA 3LCWA 1GT8A 4LBSA 4Z1BA 3EX4A 3DHPA 3GDKA 4G7EB 2V5DA 4F2BA 4OZOA 2PU0A 1JCJA 1LG2A 3MCNA 4AVOA 3CPRA 4IOTA 1W3JA 2C1HA 2DGAA 3R43A 3SCNA 4GYJA 3PTQA 3RRXA 1XFBA 5I24A 1QBAA 3IPWA 3C2EA 2QVNA 4RXGA 3W2MA 3U4AA 1TVPA 1AW1A 4JZ5A 4WDTA 4ADSA 4MFDA 4HOXA 5K7JA 2BODX 2V5CA 2J77A 3UD6A 3BCJA 2POZA 4JTEA 1VRXA 2ICSA 4IHCA 5D02A 1F2JA 4NNBA 2ACUA 4JDYA 1O7AA 5FL1A 3B0PA 5C9RA 3AICA 3MS8A 1D3HA 1W5NA 5AYZA 1JYWA 3ZMRA 2GQ8A 5EMLA 2WVVB 4ATDA 4LEQA 3IJIA 5FOOA 4XAZA 2JK2A 1J0HA 1V77A 3S5YA 1Q4WA 2UWFA 1HW6A 3VU2A 3GIQA 3W7JA 4B3KA 1DORA 4DZIA 3FDKA 4XSLA 3G1HA 4N7QA 3DFPA 5I02A 3Q58A 3W7PA 2RDWA 4NAFA 2BGNE 4EKJA 1A47A 1B1YA 1T40A 4KWVA 2Y7DA 1KWKA 3NQ7A 4IZGA 1V3MA 4S38A 2OGYA 1ME7A 4PB4A 1L6WA 4HHMA 1SR0A 4XV0A 2RH9A 2CLKA 4JTUA 5DANA 4L1WA 3PZVA 2E5CA 2DU2A 1K1DA 3APYA 1W1PA 1PX4A 1E6NA 1OCJA 5HMEA 4OVXA 1VKFA 2E1DA 2XJ7A 3Q45A 1RQBA 3FAXA 2EXOA 5D2WA 3N15A 1XBVA 4JKKA 4W84A 4BHYA 3B04A 3FS2A 3HG2A 3S8HA 4LY8A 4HYVA 2Y2WA 3CV6A 3B8IA 1XS2A 4H9YA 3F5JA 4CD6A 3HFTA 1TTQA 5BOOA 1K9DA 3H7VA 2WV8A 3EWZA 3RPTA 2VM8A 3W74A 5D9MA 2Y88A 4I6KA 1PAMA 1HKVA 4AX7A 2DUXA 1I1XA 4XVDA 1QNQA 4HN4A 2G41A 3P5YA 3S9YA 1LM1A 3K2GA 3PBGA 3MTWA 4CU8A 1FDZA 1JGIA 2GWNA 3IJQA 2VZUA 3GU9A 1OC5A 1ZFJA 3LI0A 3PWAA 4ZE5A 1GEHA 4JTAA 3A13A 3ECQA 4DZ5A 3WDPP 4Q3MA 2HWGA 4A8NA 1JI2A 2FTPA 4NNCA 4K38A 3SSJA 3BUVA 3WLQA 4C1KA 3GTXA 1GCYA 3NEHA 5CQ1A 2YIHA 3H55A 5DCDA 4FX8A 3PZ9A 3AALA 1B31A 2NXHA 1H60A 2V3EA 1UG6A 1XLJA 2CWXA 2JGYA 4KRUA 3K46A 1W5QA 1TELA 1UHVA 1DWHM 3UGRA 4YTQA 3IIXA 3QMRA 4PC8A 1E72M 2J24A 1Z89A 3H12A 3B9DA 4QNWA 1K9FA 1KXQA 1XUZA 1JR1A 3GO2A 1JULA 3KBVA 1Z3NA 1KFLA 3LCGA 5AFDA 1Q6OA 3B8SA 2ZA2A 3MYOA 4C5YA 3KRBA 3UGVA 1MFVA 2DUAA 3TQPA 1EDQA 4UFLA 1Q8JA 1LDCA 2E09A 3BAWA 1UH2A 4EVZA 4NJJA 2WMFA 4CQDA 2YPIA 3PBVA 3A24A 1HO4A 2ZRWA 1OZMA 2JALA 5J5DA 1T41A 1WXYA 2W66A 2AL2A 1FXQA 1MEWA 1VCVA 4K39A 2L5HA 3CL6A 3WLIA 2I9EA 5CSSA 3UR8A 4FZIA 1I2OA 1ODUA 4MNLA 3W6YA 1I2PA 1XCWA 1OSEA 3A3HA 3H6OA 3SN1A 2NZLA 2ZZ1A 3C8NA 3CAWA 4J3TA 1HJWA 3P80A 4TUFA 4XB3A 1GPFA 1GVEA 1A5MC 3KM8A 5D04C 1H49A 1YX1A 4TVCA 1A0CA 3CPUA 3OP2A 1GW1A 1Q63A 2XSAA 1HN1A 2C1GA 3IVUA 1XSKA 3L67A 1JPDX 1S5MA 1E6RA 1WV2A 3OU8A 3W9ZA 1QI5A 1RY8A 1V0KA 4Z2KA 4FAMA 5BOFA 4GUGA 3SAZA 4JIRA 3GIPA 3UXIA 4C6DA 3PTDA 2P53A 3NYDA 3HG4A 1B30A 1RVGA 1O5KA 2QVHA 2ACRA 1O5QA 1KR0A 1Y7VA 1PIFA 5H91A 3PZIA 4RDYA 4D1IA 2OZ0A 4E3TA 3SUTA 2BP1A 1LLWA 3MMWA 4HD5A 5EYWA 1FP8A 3A23A 3U2OA 1S5VA 3N19B 4B91A 2MANA 3W3OA 4F2UA 2WMHA 4ZO6A 3UXDA 3F4DA 1FY6A 3CZEA 4WUIA 1KA9F 4H9XA 4NZ5A 1PB0A 2O9TA 5AC6A 5AC8A 1KTCA 3ARVA 3G0UA 4ZMGA 2RJGA 3KS6A 3WEZA 3LYEA 3SGGA 3PZGA 3W1TA 1XC6A 3H2NA 4ACZB 3ERPA 4HKPA 2VR4A 3C86A 1ZY9A 1DJYA 1TMHA 3L4XA 3LZ5A 5CXPA 4BQ3A 5I09A 3MV11 1EXBA 4LVBA 2JF6A 1K77A 4RXFA 1REQA 1G1YA 4GY7A 2CZFA 1MMFA 5KETA 4TX9A 3GK0A 3W22A 3LEPA 1K6AA 2DT0A 1NELA 1QOQA 2RDXA 4WSHA 4C6IA 4M3PA 3FX4A 5DRCA 5HK4A 3ARPA 1UR8A 4DWSA 5AYIA 4CD8A 3D46A 2OZ8A 1PTDA 1ME9A 4BCEA 3PULA 3EMCA 1YIXA 4NXKA 1Q4NX 1U2YA 2EF9A 1KQYA 3Q67A 5HWJA 1DPMA 2YDRA 3MY9A 3H7UA 3M7WA 2DZSA 2PCQA 4UMCA 5D30A 3BOXA 2X1IA 1YDVA 5G2IA 1FH9A 4S3EA 3E2RA 3KL0A 1PWLA 4W5UA 1OGBA 4BF9A 2Y61A 3BMVA 1X6UA 1CXFA 4WJXA 2ZZ6A 1VFSA 2FMNA 3L5AA 2D2OA 2Y8KA 4JD4A 2PD5A 3UG4A 1JZ4A 3N3TA 3RITA 4A8RA 2PF0A 4L1XA 4DB7A 3RJYA 1W1ZA 2MUCA 4GH3A 2PDMA 4C6LA 1REQB 2EHHA 4U33A 5JH1A 1OFDA 1BYDA 3IIZA 2X7WA 1CXLA 3LA4A 4I9AA 4O54A 5ABFB 3VDCA 1GOWA 1G67A 1W9UA 4AC1X 4JAWA 4NKCA 1FFRA 4DWSB 3W6LA 1XW8A 3TN4A 4MLRA 4F0LA 5FEWA 2ASHA 4JN8A 3KL5A 1XYAA 2H6RA 2FVKA 4RJEA 5KSWA 2Y6ZA 3PPGA 4M56A 3CL8A 2V30A 3W86A 4MNKA 1ITCA 1EO5A 2YA1A 1CPUA 1QPOA 3JUGA 3QV7A 2YXOA 2XG9A 2V67A 4AMCA 3GIYA 5E6ZA 3VIJA 5M3WA 4ORIA 3OZYA 3VI2A 4IGHA 2ZX9A 1B9BA 1XLIA 5CLWA 2A21A 2TODA 3DG7A 2Y89A 4CQ9A 3DFTA 3GKAA 3WZ0E 3TYCA 3QTPA 5D32A 1OG0A 1PKMA 1XCXA 2PZNA 3RX4A 3V36A 3EKZA 1XICA 1J2BA 1NAL1 2FFCA 1RALA 2DT3A 3M41A 1KGUA 2D73A 3CHCA 4YLWA 1MXSA 3JZUA 4UNIA 3WNLA 3RCYA 1MW1A 1QFEA 1XBZA 3AS3A 1B4EA 1PKNA 4NP7A 2NVCA 5G1YA 3FFSA 4ZVJA 4PFMA 5HMFA 3GUGA 1FCUA 3KVKA 4WGHA 4DXVA 1JZ6A 4GZ7A 1R8LA 3MDUA 1ICSA 3EAUA 1RSCA 4ZXLA 1QO2A 4B9YA 3NVDA 2Q3RA 1ZSXA 1SFJA 2WZMA 1H1YA 3HV8A 4XKYB 2Z4GA 1AJ0A 3ZLHA 3ATZA 2Q8LA 2G3JA 3CUZA 2R94A 3VIHA 2O92A 4KWOA 1UPPA 3RMEA 4U3CA 1JDDA 2E6YA 3P93A 1L6YA 1M65A 1G5AA 3AROA 1M7XA 2VEPA 2PA6A 3VIKA 4MNMA 3BICA 4AHQA 1NOWA 2P0IA 3UCDA 3KCJA 2VWSA 3OEXA 4QQUA 4MYXA 3GE7A 4LVGA 2NT1A 3RPMA 1FFQA 2ZA1A 2JFEX 1JRCA 4DY1A 2OJPA 3HTWA 1EGMA 1ONEA 2A3EA 3VDBA 3TXVA 2Q3OA 1L6SA 3KTCA 1QNPA 1X38A 3A5FA 4HZ6A 3FW6A 1WDSA 1NJJA 3TR2A 4WKHA 4DWSC 2A85A 1VP5A 1UPMB 3FGCB 2ZE3A 4YVVA 1TZ7A 1VZWA 2Y5EA 2E6DA 4R7WA 2YR1A 2GLKA 7PTDA 3ABXA 5AVNA 2HK0A 3DYPA 1YADA 3GR8A 6TAAA 4B5SA 1MQQA 3TQ0A 2XVPA 4JHMA 4YYFA 2BMBA 2WC4A 3MWCA 1JYNA 1OB0A 4IQEA 5A8OA 3QM3A 4JPGA 1OF8A 3WUBA 2X05A 4ZQPA 3ZWSA 5ABTA 3AMLA 1PXGA 1S39A 5AKQA 1OFRA 3LV6A 2D3LA 5T9BG 5BRQA 2EPMX 5D03A 3W82A 3FKRA 2E77A 2VFGA 1EP2A 3NVTA 4R85A 5I06A 1IGWA 5HQLA 8TIMA 1O60A 1K7EA 3TC7A 1F3TA 3VNKA 1WBJA 1GWJA 5CCZA 4OBSA 1HQTA 3BAKA 3SIZA 4QTGA 1N82A 1ZU8A 1QBBA 4XIMA 4J9JA 1V7YA 4YYCA 2YFOA 4TQTA 3O06A 2QV5A 2Y8UA 3QEZA 1EBGA 5FL0A 4ECLA 4QR6A 4CNPA 2Y4SA 4AWUA 1UD8A 1W3TA 3WD4A 4DXXA 4LS0A 3WF4A 1RBAA 4P2VA 1EOMA 2OWWA 4D2JA 1GZ1A 5JU6A 1NDVA 3VM7A 5I79A 2E0PA 2V38A 1RVKA 2EG8A 3AIQA 3L0GA 1XLFA 3EA1A 1H7WA 4PTMA 3GC5A 1RUSA 4LAOA 3TK7A 4L4OA 1NY1A 2HNEA 3T7VA 3VCRA 1HP4A 3EB3A 3WD1A 4LUIA 3FKKA 5JIPA 6A3HA 4PMJA 2Y5SA 3W87A 4UTUA 3HIJA 1W56A 2BFGA 2IKHA 3EPOA 5JBEA 4AYSA 1AD4A 3T05A 3D6NA 4XBJA 1S5TA 3C6CA 3PPCA 1BWVA 3AXHA 3CJPA 4J2MA 4JNYA 5LKYA 3T1GA 1W2PA 3OVGA 4IGMA 3KOXA 4AH7A 1YNPA 4L6HA 5CJ5A 2FLIA 3A4XA 3BLLA 4JTRA 5HINA 4XTIA 1K8YA 2XU2A 3H8AA 3IVTA 2BTMA 1EO7A 3SCWA 3FIGA 1R47A 5D09A 1T5AA 3AJ7A 3VX0A 1VFUA 3WYZA 1MW3A 2IXUA 4Q8PA 4PE8A 2EPOA 3NQDA 3ARYA 3SCVA 2EPHA 2G3FA 4M6QA 5U4NA 2R8WA 3N13A 4UZSA 3VKKA 4RW3A 1E70M 1EEPA 3GBEA 3EXTA 1EC8A 3UXKA 4GISA 1X7IA 3NCOA 4W87A 2DT2A 3VD3A 1K8CA 5AHEA 3L66A 4UUIA 4DWSD 1FBAA 3DZ1A 1K7FA 4MAZA 2P8BA 1OK4A 4LXFA 1ODZA 2PGRA 4HHPA 3FY1A 5D2VA 2D2HA 3WMBA 2QXWA 1EKOA 4PUNA 4ICMA 1NQKA 3G5EA 2DDXA 4ZOAA 3DN5A 4PGLA 3MSYA 1P0KA 3VKBA 1GOQA 7REQB 1H50A 2VEKA 1XX1A 4P7OA 1GVSA 3GZ3A 5IXEA 3DFHA 3W01A 1KCLA 4IFKA 3W29A 4IMEA 2DZBA 3NAVA 3RAOA 3QLLA 3HOJA 2NT0A 1FA2A 1QNRA 1A0EA 4CCDA 1IIHA 1XM3A 1F4AA 4FNSA 4GZIA 4DHGA 3V0TA 1GOXA 3OBAA 6XIAA 1O5RA 4NNAA 5C54A 4L80A 7ENLA 4QGCA 2XIIA 2PLKA 3L21A 1U1UA 1I45A 3C61A 5IFPA 3XISA 5K9XA 3EOOA 4WGXA 1NIUA 3QC0A 2GGHA 3MT1A 3GH4A 5HPCA 2DH2A 5A8MA 1YPIA 3CQIA 4ML4A 1TVLA 2NUXA 1OVDA 3EGJA 3TNBA 1TUXA 1XBXA 5MKGA 2NW0A 1YBQB 1YTEA 1X96A 4JQAA 1FTXA 4A3YA 1EX5A 4E8DA 2QUUA 1G01A 4CCEA 3R0DA 4LX4A 4UQBA 4QDWA 3T55A 4UXDA 2BXYA 3BW2A 3GH5A 4KMQA 1PTAA 4IGNA 1MW2A 2PRMA 3BGAA 2QQ6A 3UT0A 4KWUA 4MF4A 3RGTA 3T2OA 1FCBA 4KGLA 1E4LA 1BG4A 4PRRA 3W24A 1TE6A 3ZJ7A 3ZR5A 6TIMA 2ISWA 1CLXA 2D0GA 3MI6A 4DN1A 2ADAA 2YDAA 1POKA 3EA3A 4Y9MA 3TTSA 1KRMA 3LCXA 1L6GA 4U5KA 1F07A 5FEZA 1ESWA 3V75A 2OVLA 2PRHA 1TPB1 1XG3A 1SSGA 4GNJA 4P8WA 8CGTA 2QGHA 3N4FA 1SPQA 3AHVA 1BSIA 3N9RA 1Q6CA 4DELA 2WQPA 3BW4A 2PFHA 4M19A 3PJTA 2AKMA 3WBAA 4G5DA 2FKPA 8RUCA 4DX3A 2BLEA 1C92A 2C19A 2QPXA 3PBYA 2IPFA 1Q6FA 4OOZA 2TYSA 3GTNA 1K03A 4F0MA 1A5OC 4HT3A 2RDTA 2ATMA 3S2JA 4FR1A 1AW5A 3KRUA 1AMKA 4PBFA 3WELA 3THDA 1Y65A 1CX9A 2CBUA 2ATSA 2QHAA 3SECA 2WMIA 4UBPC 3N1AA 1JD9A 4NJKA 4C6KA 3OLDA 3QHNA 4ZEPA 5E6YA 2GUYA 1R6WA 1VBJA 5FACA 3WJXA 3FHQA 2FZBA 5F4XA 2OR2A 4MADA 3BWWA 5MF5A 1QWGA 3A6OA 3K4AA 3LM7A 1EZWA 2DT1A 5DMLA 4PL2A 2G96A 2C14A 3O63A 3QQWA 3KDOA 2R82A 2OKOA 1MUWA 4YVXA 3THQA 1EPXA 2WVTA 3W71A 2DVUA 3ES8A 3AIVA 1B3ZA 3W88A 3H7RA 1E0WA 3KOFA 1UIOA 2QJNA 3WK1A 4XAFA 4QRNA 1FUYA 4E2VA 5GNYA 1ONXA 4HPXA 4TXEA 2GFTA 4RZ4A 4AEFA 3CK5A 3PJXA 4B2DD 4JYDA 2KZHA 2OYMA 1YQ2A 3L12A 1RBLA 3OHIA 2PDLA 4P7RA 2XIMA 4URIA 5CC7A 1S1PA 3GDRA 4PCSA 5AY7A 4XTDA 2ZVRA 3UXAA 4I5UA 1QTWA 2X8RA 1UBSA 2XYLA 3U0HA 2CHOA 3GDTA 4ZOCA 5G2WA 4WDXA 2WLYA 1KXTA 4GYPA 5I07A 5CAKA 3RO6A 3P0XA 3CZKA 3TEVA 4YMZA 2Z2UA 2Z25A 1J93A 5CJNA 4IPPA 5EFFA 5D2TA 1CT5A 3PNUA 4XO7A 5HNNA 3WJYA 1WPCA 4QP0A 2QUMA 3IS4A 2V5LA 1E0UA 1J0ZA 3IUIA 2ZBTA 4AWEA 4X0VA 3N6HA 2GUUA 4FALA 2DSZA 3ATYA 3BJTA 3M16A 3QGVA 4FSAA 4B90A 3F1QA 5A2CA 2QS8A 4GY1A 4KCUA 2HCVA 2OG9A 2VYOA 3WD0A 4PR4A 1XLEA 4HMCA 2J6VA 3BAYA 1AD1A 2G95A 2V2CA 1RP8A 6ENLA 2XUCA 3WNPA 4P8XA 4FOUA 5FESA 1ZJHA 2ZC1A 3G22A 2AMXA 1OYAA 3EXSA 2ZXBA 3E2SA 1Q3NA 3CAQA 2FPYA 4E2BA 1W54A 4Y2WA 4UQCA 4OECA 1WKEA 3GNPA 3B9OA 3ZJ6A 1LL4A 5EFDA 7CGTA 1XD1A 3N2MA 1HJQA 4L5ZA 4S23A 2QUTA 3ZVHB 5A8QA 1Q8AA 4M7SA 2F6UA 3G1VA 2PWEA 3M7SA 1P6CA 2XIQA 4AYGA 4FNRA 3OG2A 2DW7A 1CDGA 4PODA 3HQ1A 4UTWA 2R91A 4Q22A 4YTUA 3GXIA 4PMZA 2IUZA 4US6A 2OQLA 5TIMA 1F61A 4NL1A 3IRDA 4NJGA 2EJAA 4GYKA 3ZIZA 1KTNA 3QW3A 4JEJA 2Z28A 5D38A 4Z1DA 3QZAA 3QH2A 3TW6A 3UY8A 4TMCA 1O1ZA 3C5QA 4REQB 2OODA 4A6GA 3E0VA 2XFFA 4HHHA 3L2LA 3N12A 3RM8A 1M3UA 3GQYA 1LYXA 2Q8XA 4MDOA 1QR7A 1EC9A 4UZUA 4TOQA 2VR5A 3QOMA 3S2MA 4DIAA 1R9XA 3LM3A 1UWUA 2QPUA 3AI0A 3A9IA 4XSMA 3STEA 5M5DA 3V1HA 4Q7IA 1GYNA 1BVNP 1Q6LA 3UPBA 2A3HA 4HBKA 1W5PA 1OFBA 4KQNA 1XGZA 1KRAC 2PU1A 3NPWA 1UWAA 2FTWA 4GFIA 1RPKA 3TFCA 1IR1A 3GTIA 3R0UA 4QJ3B 4CD5A 4XUGA 4RZBA 1TTJA 4IL0A 4UQ9A 4JS3A 2ZTJA 1SO5A 4HU3A 3EKGA 3LGDA 5D8ZA 2W62A 3W1PA 4IXXA 3ABSA 3UQNA 2NLYA 2ZRUA 5AVHA 4RV8A 1LOQA 3S2NA 4AIBA 4I5RA 5HJYA 2VQTA 5IBXC 1QRQA 2ZRZA 1GTEA 4Q7BA 3HGJA 1SR9A 4P61A 3I4KA 1YXCA 1MXDA 3LV5A 2J9ZA 4GYPC 3KVLA 1DIDA 5LA1A 3CQJA 4KFPA 4TV6A 4ZA0A 2R1KA 5MHBA 3EWCA 3RIKA 4W8LA 4QAWA 3QTGA 1R3VA 1PYMA 3DFYA 5DCBA 1A4LA 1FOBA 4RNFA 4J3VA 2G5WA 5G4WA 3ARRA 4IP7A 2E67A 3Q37A 5A6AA 4S3BA 1GKPA 1TPC1 2D23A 3PUEA 3C0QA 4I8DA 3EWBX 2VGFA 1RPXA 2WSRA 1N7KA 4IH3A 3GNRA 4JTCA 1UR3M 5EMYA 1QNOA 1NWUA 4AIOA 1XLLA 2ZRXA 2XFYA 5LNWA 4YCOA 3SSZA 5GQBA 1J9YA 2Z00A 4S3JA 4WIWA 3PFRA 4DYEA 1R87A 1XLAA 3PJUA 4L56A 3O6AA 1WYIA 4A3QA 5RUBA 3STGA 3CT7A 7TIMA 1KFBA 1JPIA 2YL8A 4Z1AA 1FWWA 5C8BB 4XISA 2ZUTA 1FWGC 2ACQA 3AZSA 5FJUA 1AK5A 2EJ1A 5A6BA 1VC4A 4BJHA 5LHFA 2QUVA 1EX1A 1MO0A 1DJHA 2PDYA 4UTWC 3S46A 2I16A 3ARUA 3E2VA 3MC5A 1MNZA 3DC0A 5F4SA 1M7PA 2NUWA 4K68A 3DFOA 3F4VA 1R3YA 1AQ0A 1H63A 3AIWA 4WSJA 1E15A 5JBFA 3UJSA 4ONVA 3KP0A 1IWPA 4DLFA 4S2BA 2A3CA 3IJ6A 3AHZA 1EFZA 3W7LA 4U4MA 4UOJA 2DW6A 3N4EA 1V02E 1ZJBA 3LSCA 3PC0A 3DHDA 3MUCA 4JFUA 2AKZA 1C91A 1R7AA 4YHEA 3UETA 4C7GA 1UKOA 4OBTA 3VD5A 4J3XA 4UQAA 3CMGA 3I4EA 3NQEA 4F0HA 4F0KA 2PTWA 4DF0A 4YTRA 3O6DA 4W8AA 1PV8A 5KEZA 1RA0A 4U2YA 1J18A 3CUGA 3ES7A 1TV4A 4GBUA 3UG5A 1G94A 1ECQA 3GFZA 3HFYA 3K4WA 3M64A 4YIWA 1SMDA 1IT8A 3VKAA 4KF1A 5CC3A 2B7OA 3MDWA 3UPWA 3RPDA 1WBHA 1C8XA 2RAGA 4IMDA 4E4PA 3QGAC 2WHJA 1LZOA 3TZNA 4JYFA 1M53A 5HNTA 1Y0EA 1VJIA 3RM4A 3SCRA 2ZFAA 1H2JA 3ID7A 1JDEA 4D8LA 4I3GA 4MMWA 4H9UA 3W7OA 3WLTA 5LYRA 3U6WA 1HUVA 1HKMA 1LT7A 1B5TA 1KQZA 3PS7A 3BMXA 2X41A 2XVGA 1XLBA 1XXXA 1NVMA 4D1JA 3TQKA 3QY6A 4AHPA 3I6EA 3GG7A 4KGJA 1X1ZA 2ZWZA 1SO6A 5D8WA 2JF7A 2OSXA 1ZZMA 4IQDA 3TTQA 4QS5A 3NQCA 1X1NA 4XD3A 2DY3A 4NQ1A 3NQAA 2B4GA 4AG0A 1OFQA 2YL5A 3EX2A 1ZB5A 3MU7A 3DXIA 1GJUA 1POJA 4GZJA 1W3LA 1X8CA 2O9OA 3G6LA 3VO0A 3KOZA 4MM1A 4GUJA 2OOGA 4J2PA 4LSBA 2WOQA 4Q4KA 4J4KA 4PSPA 2G97A 4YCPA 4JTHA 1ADSA 4Z2LA 3DUGA 2PBGA 3W76A 4AIUA 1V51A 1KO0A 1CXHA 2PD9A 1QVBA 2VX7A 4E4FA 1OZQA 3ZR6A 1EWDA 1DQWA 3W2LA 2E7FA 2VGIA 1J5TA 1WZAA 1PCKA 3IGXA 1QT1A 3L23A 5AOUA 2QCDB 2YBVA 3ORWA 2GK1A 3KRSA 4LYQA 3REQA 1E6XM 4CEXC 2B81A 3R89A 2VGBA 4UR8A 1JFXA 1WXJA 3SUSA 3AOFA 3LNPA 2XN0A 2QCLA 1D8CA 2WPGA 1EXPA 1FXPA 2OMAA 1V6VA 2CYGA 2VNCA 4IMFA 1M04A 4OBRA 2YW4A 2YX0A 4HMNA 3HU7A 4X2RA 5CBBA 2VC6A 1KV5A 4H4IA 1EH9A 1PWMA 4NZ4A 3GU1A 5I00A 3GD6A 4GX9A 5EMMA 2Y5JA 1L2QA 1JCMP 3QV6A 3QBUA 4A21A 1US2A 3C2VA 1CI1A 2AQOA 4A4AA 4YVPA 3AMCA 3AXMA 2DVXA 3PPHA 1ZHAA 3U2EA 4TIMA 5B7ZA 4O50A 4EANA 3NSMA 3ZLGA 4JQ4A 1OX5A 2E25A 3BANA 4L4LA 5C7HA 5HPOA 5I23A 4PEEA 3HV9A 1RH9A 4AB4A 1RHCA 1AMYA 1GNXA 3CBWA 2NV2A 3MMTA 1E51A 1I0DA 4HPJA 2V0TA 4GINA 4IJBA 4O0QA 3AMGA 4M24A 4Q8WA 1T7LA 2R1MA 1DV7A 4IFOA 3CTLA 5JBDA 4HP5A 5AYXA 4M51A 1S2TA 1TV3A 4XUYA 1CNVA 1DJXA 4TV5A 2J7EA 3KOYA 1TFVA 4NAEA 3NPUA 3AZRA 5CGTA 4FF5A 4LUYA 2JIEA 1ZBKA 1JUKA 3TSDA 3RF9A 1FWJC 2CIPA 2DIJA 2WWCA 2QUNA 5H2ZA 2CPUA 4RW5A 2PRLA 1AL7A 1JVNA 3M0HA 1W9DM 4JN6A 2Y63A 3R79A 1PVNA 1NM9A 2X0YA 4B5VA 3TWBA 5IRPA 2G3IA 2WQDA 1X98A 3P2VA 1WZMA 3HA1A 3UWUA 3SN0A 2ZCGA 1WAWA 4HA1A 1YDOA 1LL6A 1UASA 5AYBA 1KFWA 1YKWA 4JTIA 2ZC8A 5HMDA 1PS9A 3UXLA 2PP1A 2P3ZA 4KFNA 2HE5A 4ENLA 4F2TA 3UW6A 3EDEA 4ALDA 3I68A 3NEVA 3P62A 2O56A 4UCGA 3LBOA 4CN6A 3SBFA 2I57A 1E9IA 4HTYA 1BLIA 3OB8A 5BNKA 2WVSA 1BGGA 2ZADA 1QHOA 3BLKA 3LU2A 3GX9A 2WWDA 3PANA 2W0UA 4D6IA 4N02A 1XRSA 3GM8A 3ARQA 2NQZA 3AXKA 1XI3A 3ABRA 1H7OA 3M0ZA 1XIIA 3E38A 1XH0A 3T81A 3W1AA 2P50A 4QSHA 3EDJA 4ZSUA 2C71A 3FJ6A 1VH7A 3R58A 4IIEA 1BXNA 4O11A 3KUMA 3GVGA 3NXLA 1W6TA 4JY9A 1R7OA 4LAKA 4W7WA 1B3YA 4HNVA 1VBUA 1E4IA 3LBCA 4ROQA 2YFNA 1AH4A 1HT6A 1KKOA 2R1PA 1GQJA 1SGJA 3WJSA 2ZUMA 3PPFA 1E6QM 3F5KA 4GCXA 4AWSA 2DSWA 4MIMA 3BCFA 3WF3A 2GJRA 4W4QA 4ICNA 5H1WA 4EXBA 3BW3A 3TP4A 1BHGA 3EBVA 5I5RA 1LJYA 2DIKA 3AC0A 1GOIA 2QW5A 4DLMA 2W92A 4W85A 2INFA 4WCJA 4JXCA 2BG5A 2BGSA 4C7DA 5EA9A 4EF9A 3MMUA 3FHAA 6ALDA 4MZ1A 2PDGA 2BY1A 1VFLA 4G6CA 2A2IA 1F9CA 3NGJA 1P0DA 1P48A 1A5AA 4CD4A 3DU0A 3COTA 2OX4A 5H8MA 4GO8A 1OHLA 2J75A 4JEQA 4E4UA 3CHFA 1TX2A 1NTHA 4EPEC 3RCNA 3HN3A 3O1NA 1BQGA 4MJMA 1IIGA 5A6KA 4QE4A 4C6OA 3TQVA 1QNSA 2BOGX 2FZ8A 2A7RA 3OQ8A 1BVZA 3E49A 4IUOA 1KM1A 5H6HA 1TA3A 7XIMA 2B31A 5DXXA 6XIMA 3DECA 1XFCA 5A94A 1JZ7A 1B57A 3ARTA 4LT9A 3RG6A 1JI1A 3BG5A 1MW0A 3KBMA 3RNDA 4B5XA 1TG7A 1DP0A 3TAKA 4D6HA 1E4MM 2VP8A 3H4WA 4PSRA 3APGA 4GIAA 1XIBA 4KFOA 3O0KA 1CWYA 3CXOA 2NWSA 3U48A 4DPPA 1TZ9A 1B0IA 4H83A 4I5XA 1S38A 3CH9A 3INPA 4B5NA 2E9MA 4UWMA 1WP6A 4Q6XA 2YLLA 4DUVA 3C8FA 1UD6A 2PGEA 3UEQA 3BSMA 4PUDA 3DKJA 4FO4A 1ZGDA 1RZMA 4X2PA 3TYBA 1Q2RA 2QZRA 5T91A 3GW3A 3AISA 1UUQA 3VNZA 3BVJA 4MNJA 4N0RA 1AODA 1JCYA 3WFLA 1F6PA 2WJEA 1XF0A 1GEQA 2O7QA 3GUWA 1EJUC 3IAPA 1J0IA 4JHOA 1W8GA 4FLRA 4X60A 3ICJA 2FYMA 2ISVA 3WNOA 3I3BA 3CZGA 4ZO7A 4D9PA 2ZICA 1FWNA 2VZSA 2GDVA 3PSVA 4FNQA 4JIQA 1EUAA 5BXRA 1TO3A 4K1WA 1H1ZA 1FQ0A 2H90A 4GXWA 1E71M 2XISA 3TSMA 3KBJA 5E0FA 3STFA 4GI8A 5FF4A 1WZLA 3LPPA 3VKCA 4BR1A 3GU2A 1IT7A 2Q71A 1VGAA 1W0MA 4R9XA 1DL3A 3AJXA 3P82A 1GJPA 1TKKA 3U9IA 3PFMA 4MY9A 3K1DA 1FVPA 3WDIA 2PLCA 5A1AA 4MZYA 4AAJA 2XH2A 4NZJA 3NZQA 1OT1A 3IIVA 4CNUA 3URBA 3F7JA 5C9UA 1JRBA 2Y0FA 4PMYA 3LLFA 3V5FA 3MJYA 4IP4A 4IMAA 3M6YA 4JCLA 1XKJA 4D6JA 1JXJA 1P43A 4MB3A 1MZHA 1UR4A 2G37A 3LGGA 1A5CA 3N3MA 4RK8A 3NXFA 3RFAA 4RNJA 4O18A 1R3SA 2G50A 3PSWA 1SW0A 2X1RA 1IZKA 4GBDA 4UCFA 4J40A 3SUUA 5I3FA 2QAFA 1C3FA 2PPGA 3TVAA 3ZSSA 3N25A 1JZ3A 1TZZA 3MZNA 3MSGA 3VDAA 4Z2JA 1UR2A 1XIGA 1YMYA 4L9YA 1QI2A 2OZ3A 4WEVX 2YW3A 4IX0A 3H2AA 1BYBA 4W7UA 1QWKA 2YOCA 4Y8EA 4BZYA 1T8QA 2P76A 3S6TA 1NP2A 2CXGA 3POCA 1SM9A 3S2LA 4MB4A 1V3LA 2FJUB 4IMCA 4YS1A 1XDJA 3R94A 5BW6A 4IFRA 5AZ0A 1LWHA 2HISA 4FXFA 4PCFA 4WK9A 3BQ5A 1Y8BA 4K3ZA 3F5LA 2VCBA 2VC5A 1JCXA 1JYXA 3XINA 3BH4A 3IIOA 3T78A 1GVIA 1QXLA 2Z24A 5EMKA 3BO9A 5E09A 3CQKA 3QZEA 1Q2SA 1WCGA 3MV01 3G1AA 2ZZ7A 3UWYA 2Q09A 1RK6A 1JYVA 1IR2A 1OGSA 1FWAC 5CPTA 1H51A 3AIUA 4UTJA 4C7FA 4Z2IA 3CZLA 2QDDA 1TIWA 2VCCA 3T0AA 3S42A 4PMOA 3G8EA 4GQBA 3WEOA 3FJ4A 4KETA 3SQLA 4E0CA 1YEYA 2INZA 2WKLA 3H22A 3KOWA 1XSIA 4RX0A 1TPVA 2OKTA 2GGGA 2ZUNA 3WQPA 1AUSL 4A2SA 1XYZA 1A4MA 1XRFA 3B8TA 1I9CB 4MVAA 3V1PA 3WBYA 2GQ3A 1S3HA 2XINA 4GKLA 3C52A 1SJCA 2WCAA 4PUJA 1PZ3A 3R25A 4O1AA 4QX4A 1E4NA 3DBPA 4X0NA 4HYWA 1SFTA 3W1LA 9XIMA 1A80A 1HP5A 2OB3A 3MHFA 4GKTA 3UJFA 2CLPA 4FF7A 1UP2A 2C8NA 3QSTA 3QJAA 3MI3A 4QEEA 5BXSA 1ONWA 3ZR4A 1R2TA 1LQAA 4IIBA 4XKMA 2W91A 4U2ZA 2VKZG 1OCQA 2PDJA 3BOFA 3I3EA 3M44A 4WOZA 4TVUA 4HJFA 4JFVA 3JR2A 4K8HA 3QW4B 4G7FA 1RY0A 4DJDD 4WY0B 5DMYA 3WBWA 4JTQA 4KERA 3W02A 2C0HA 1C8YA 1KCXA 4XD5A 3K8LA 4DWDA 2XWEA 2NQ9A 4A8IA 3N34A 3D3FA 3MUIA 3CTTA 1L6FA 3O15A 2DSKA 4LS1A 1JDAA 4EPBC 1UBPC 4PMDA 1ADOA 3LD5A 2NVAA 3LY0A 2UY2A 3DI1A 1ZS2A 2ISSA 4HHLA 1F3EA 3DCPA 4UTHA 3W7GA 1NEYA 4TU1A 3TN5A 3S1GA 2PDQA 1UOZA 2PUZA 3N9KA 1J0YA 4J3UA 3QOKA 3TIMA 2PC4A 3WSUA 2YYTA 3V0SA 3VTRA 4KIRA 2Z7GA 2IQ0A 1QU4A 1D3GA 1LLZA 4FLSA 3R1ZA 4NY2A 2AL1A 5BOEA 5F2GA 1EBHA 2SFPA 4L61A 4Y8FA 3LBMA 4D72A 3G1RA 1S5WA 2WHMA 1QK0A 3B0VC 3S47A 4DO4A 3LCHA 2WSQA 4WHBA 3H2FA 2V68A 4IQJA 4DJEC 1D7KA 1GJWA 3MP5A 3LLXA 1UZDA 1OFOA 4MTVA 1EJXC 1XH2A 1AZ1A 1KTBA 3WBXA 3P8JA 2VRKA 4KEZA 4V2XA 1EC7A 1C8VA 2F9RA 1O4UA 2HVNA 3V18A 3G0XA 1E5JA 3RX3A 2ZX8A 2J4GA 4ZQNA 3WH5A 2TSYA 1MEHA 1UZHA 5CEWA 1J0KA 5SWUA 2QLYA 1W3NA 1LT8A 2KX9A 4GNVA 3TTYA 3UZXA 3GHRA 3LNMA 3PTKA 3PZTA 3R12A 4WQ6A 1PZ0A 5CPQA 1R3TA 1YTKA 2WO5A 3CGTA 3LGEA 2RHGA 1AJ2A 1G4TA 1VPXA 5HAOA 4PA8A 4AZCA 5G2HA 2NX9A 3RN6A 3TYZA 2BV9A 1PIGA 1A5UA 4HSHA 2CESA 2P5NA 4TO8A 1G69A 1XG4A 2G4JA 4UQEA 1I75A 2G0WA 4J7RA 4IICA 3SR7A 3OBEA 2A3AA 5TAOA 1UCWA 4IUGA 4A3HA 4H8HA 5HOSA 3EOUA 1BKHA 2PWUA 2F6KA 1LRTA 4U28A 3LSBA 3A4JA 3EMZA 1VF8A 1YPFA 2QCMA 4HPGA 3G1DA 3QPYA 5FF2A 4LBUA 3U4FA 2FPTA 1DTNA 2ON3A 1O94A 3ZVIA 3QY8A 1H7XA 1F6YA 4HOWA 4OUIA 1TRDA 1KFKA 3UR7A 5I3GA 1OIMA 4HNNA 4HNLA 1TPDA 3UCQA 4IM4A 1MXGA 4ZFCA 4QLLA 4UNLA 1YPXA 4M6VA 4GCAA 1A53A 4IT1A 3T40A 3FAWA 2PBOA 1PPIA 3LTSA 1W9BM 3OA3A 1R0MA 3WMLA 2FH6A 2Y1HA 1CIUA 2DVTA 3BXWA 4IG2A 4PFHA 3NJ3A 3LS9A 2I56A 2NSOA 2H9AB 4IL2A 3E0IA 4NXSA 2CLOA 4KEUA 3S5ZA 2OT0A 4US5D 3WN6A 4KCVA 4E3VA 3P67A 3IJ7A 1E73M 4XIAA 3A9BA 1DEDA 2WMJA 1W3KA 4H7ZA 3KWSA 5K9CA 1RD5A 4JFWA 1E40A 3MSDA 1OC7A 4EWJA 2VEIA 4X22A 3NM3A 1QAPA 1GW9A 2WLZA 4LH8A 4UR9A 5CC5A 1XKYA 3I6TA 1WNOA 2HRWA 3VAVA 2FHCA 4C6JA 2E6FA 1OBAA 4NUWA 3RHGA 2IMRA 2OLAA 4AZGA 2JQXA 3NGFA 3CL7A 3WEMA 3E3HA 2X1SA 1LWIA 1UR9A 2FHFA 4DJED 4P8UA 4OOUA 2BB0A 1O1HA 4FA3A 1VIZA 2J8GA 1H0GA 5T9CE 1LBFA 4TVDA 4IG2B 1XDMA 3EDKA 1WKDA 3M4HA 4MUPA 3EB4A 2GQ9A 1AH0A 1I2RA 2WZEA 1UMYA 1FWEC 1VYSX 4N9BA 1H41A 4XZ9A 4C1LA 4Z1YA 2WJDA 4AZHA 1DXFA 4C1NA 5LGZA 5FF7A 4GLEA 1K3UA 1WUFA 4H2HA 2CC0A 1UWIA 5IDIA 4EAMA 4BWLA 4CQCA 2I5IA 4AVNA 1I8JA 3CYVA 1TVNA 2DZVA 2XVNA 3RUBL 3WNMA 3ZOAA 2H8XA 1UW9A 2OEJA 4LUTB 4YTSA 4K36A 2BASA 1XWYA 2CNCA 2ISFA 1KR1A 4CNTA 2Q6ZA 2HVMA 3KTXA 2FZNA 4R34A 1FWSA 2ZUUA 1LORA 5HJLA 2WNWA 3KCLA 4JIIX 3T07A 4O19A 4LC8A 3IJ8A 3QHMA 4MDPA 3EPNA 3UVIA 1ISZA 2HZGA 1CCWB 1AQFA 3AIEA 4HK6A 3TA6A 1E6SM 3HGSA 5DN1A 4NYYA 2YA0A 2VZVA 1TJ2A 4WLCA 1G7UA 4DI9A 5I0DA 4J3SA 4LOCA 1F8IA 9CGTA 2KAUC 4B5UA 4MZ8A 3NWRA 5AC7A 2W61A 3KCOA 1E6ZA 2GDQA 1W2VA 4D8ZA 4JQ2A 2O4MA 1QI0A 4GUIA 2Z1VA 3L9CA 5K4ZA 4QLJA 3ONCA 1ZL1A 3WDJA 1E3XA 1ZJIA 4O4VA 1VYRA 1GONA 4LRTA 3FYOA 1W3HA 2D2JA 1JQXA 3B0UX 3BLEA 1EQPA 5CZSA 3LPOA 4IIGA 3VFCA 3HBLA 4K8EA 1ICQA 3V5OA 4NAFB 3W07A 1VJZA 2RJHA 1WUEA 4DUOA 2TAAA 3F4CA 5BYWA 3VOFA 1E1FA 1IWAA 1Q7ZA 4KBXA 2PWVA 1W9XA 4IQLA 5AC4A 4D6FA 1PE1A 3ABZA 4MJ4A 4F9DA 1ME8A 4XK2A 5A8PA 3LMZA 4PMRA 4NZFA 1H1NA 1SJBA 3BJSA 4C6CA 4FNUA 2OU4A 1TREA 3U2CA 1W8SA 4MPKA 1N55A 4M82A 3RU8X 3K13A 4GJ1A 4GA8A 1PSCA 1DYSA 3F03K 3CMJA 3POHA 2V8ZA 2C6QA 3DYMA 1ZP3A 4HCLA 3WH6A 4GY0A 3DESA 4QFUA 5HNRA 3BG9A 4ZCWA 4HTBA 3T0TA 1NF0A 4XBSA 3WK2A 2DZWA 2ZE0A 3AHYA 1MEIA 1FWBC 1PDYA 1G4EA 3UJEA 3O07A 1SQ7A 3MCMA 4H7CA 1TV2A 1OQFA 3NO3A 1VB9A 3BOLA 3VD9A 1GQLA 3KP1A 3FA5A 2PF8A 5EU9A 2A5HA 2Z1WA 3SB0A 5F2LA 3W7KA 2CKRA 3R13A 4Q8NA 2D1ZA 4FHAA 3SCQA 1H5YA 1GPWA 2W6RA 1E9YB 2PC8A 3MJMA 3MSRA 4WXYA 1LUCA 4BI7A 2X16A 1UQZA 5AC5A 3CM4A 3LXAA 2WJZA 3BL3A 3T0DA 2DQWA 3TMQA 1Z41A 1LRQA 3GDLA 4EACA 3PZNA 2E4TA 1AH3A 3KZSA 3VUPA 3V5CA 4AEEA 4HU0A 2HROA 3CASA 1BTMA 5ECVA 3BLOA 1UZ1A 2J25A 4I7VA 4BWLC 4PBEA 1FH7A 2DSVA 1UQYA 4WKFA 4WJ8A 2UY4A 3KAOA 3NNTA 4G8TA 1QOXA 1T99A 4H00A 4DYKA 2GVYA 4HJWA 4HZ8A 1LOLA 2A1YA 4GUFA 1HIZA 4LYPA 4F66A 1EDTA 2BHUA 3VNLA 1TJ1A 1EDGA 3H2MA 3RRAA 5I3HA 3OLIA 4XD6A 4I9TA 1EZ2A 4LGXA 4U5IA 4YNGA 3CT2A 5TF0A 3CUIA 2A6NA 3CC1A 1TPEA 3RDKA 5A8GA 1I1WA 3EMQA 4QITA 4RR4A 5HXMA 1JPHA 2RDUA 1V79A 4A2RA 1LUCB 1TQXA 5G1MA 3NQ2A 3DH7A 1P0NA 4A8LA 3VMNA 2VFIA 2W5FA 5TNVA 1C7TA 2EPLX 3UZWA 5BWAA 1MZRA 5FCZA 1XC4A 4BA0A 4O10A 3IWPA 3B97A 2VQUA 3SDOA 3GG1A 1DE6A 5KZMA 3USZA 2AL2B 3OYZA 4L4PA 5I3DA 1E6PA 2PODA 5JIWA 3KLKA 4Z42C 2HXUA 3U8GA 1M7JA 2BHYA 1DHPA 3R6IA 3U7BA 5CC6A 3UZZA 1ZBVA 2VC7A 4FXSA 4NJIA 4PCTA 4XQ6A 4O12A 3GHSA 3W0KA 4DJFA 1SW7A 2DFAA 2AQWA 1L2UA 3LCLA 2GJPA 2BBFA 4K1GA 3L4UA 3TR9A 2O0TA 3PBWA 3TXZA 3NO5A 1XP3A 4CNNA 2E6AA 2XWDA 6REQA 2VDHA 1EYWA 2R9RA 2VX5A 3AXIA 2YCIX 2CFFA 4ROPA 1J0JA 4LWWA 1PBGA 2WYSA 1WX0A 2AGKA 4QISA 3KZPA 4H3DA 2CLMA 3P84A 3ZT7A 2YSWA 3G0SA 4C65A 1LBLA 4OT7A 3RM9A 4NRRA 3W7QA 2BNJA 5A2BA 3LPFA 1L8NA 2XGBA 4LBRA 1WDWA 4PZVA 3VGBA 4V15A 4BF7A 2YZ5A 5CSYA 4U3AA 1KBLA 3TZFA 3PUGA 4UC5A 1XD0A 2X1UA 3ABQA 3WDQA 3HO8A 3H53A 1F5ZA 1TJRA 4HK5A 5J8LA 1Q5MA 3DFQA 1W1TA 4YN5A 3PR2A 4HOZA 2UY5A 4LB3A 1VFFA 2FIQA 3FJLA 3TA9A 1RAKA 3GY1A 1EGZA 2ACSA 2E8YA 2B7PA 2PS2A 4B92A 1W1IE 3A4WA 4AF0A 6REQB 2WK2A 3M9YA 3M07A 5DQPA 4GD0A 4AZ5A 3IANA 2E1WA 3K8MA 2ONEA 3ARZA 3W53A 4HCDA 3VGGA 3DDMA 3L4VA 5LIWX 1M9HA 5A3HA 3T08A 4J35A 3IEBA 4GC3A 1U83A 3CO8A 2FVLA 3V0UA 5CBIA 1TUFA 3B8DA 1TWZA 2XM1A 1DJWA 1EF2A 5DMMA 1O6IA 3HQOA 4UFKA 3PBMA 5A2AA 4CU6A 1EA9C 3GFXA 1HKJA 2ZOXA 3QV8A 1IEQA 3H70A 4AIEA 4HN8A 1JCLA 2VGGA 1IQ8A 4LY4A 5D2YA 1HKKA 2HS8A 4S3KA 2PDBA 3WF0A 4B15A 3W1RA 1R2RA 1IEIA 3O6YX 5BZAA 1LCOA 3PG8A 2WPBA 2OWXA 2ZXQA 3XIMA 1IXQA 1RLCL 2GJNA 3SGUA 2BOFX 1DWJM 1UKPA 3R8RA 4ADTA 4QG6A 3TOPA 4H9MA 3TU9A 1GVOA 5JXQA 1VPQA 1D9EA 2QF7A 3IVSA 1J8VA 4DZHA 2Q02A 3LPGA 3BAJA 3S1WA 3BGGA 5JMUA 1DXIA 1Q6GA 3ALFA 1KKRA 1Q7MA 3GXMA 1VQTA 1G6CA 4K37A 2VO5A 1BTCA 3I7RA 4LVAA 4C6PA 4XZMX 2E5DA 4I7UA 3G18A 1IWBA 5GJPA 4Y9NA 4CNSA 1JNDA 3HPXA 3T6CA 3CHDA 4CCCA 4U31A 1DJGA 3U57A 1JF6A 2D24A 1YE6A 1UD4A 4JTGA 2G4FA 1XLGA 2J9YA 3EB2A 4A3UA 5LA0A 2DZPA 2OO6A 3FXYA 3VZYA 2C15A 1BRLA 3BURA 1SJDA 1BVWA 1QW7A 4AXNA 2G8ZA 1VIWA 3KBSA 3L68A 4CGTA 4AD4A 1IXOA 3RILA 4GQQA 1W17A 4AZ7A 4HMDA 2WCGA 3G24A 2VEMA 3L5LA 3G77A 3HF3A 1AJZA 4R3UA 4J28A 4L9XA 2GSHA 3QR0A 4DBUA 1TSIA 1F74A 4GI6A 3FOKA 1K8XA 4H19A 1CECA 3B0YA 2JE8A 2PTDA 2CW6A 4HYRA 3MKKA 3UERA 1E5NA 3L2IA 1OFAA 3B9AA 2WCSA 1KM0A 1HXJA 3C4UA 5C9XA 1PYFA 1R85A 1O95A 1VAHA 1SZRA 4LV9A 4UFIA 1S2WA 3S9IA 4GZEA 2J13A 1UC5A 2CITA 4O1CA 2QR6A 1KBKA 3WUEA 3NM1A 3VUSA 3PZQA 3LRKA 1TCDA 4R7OA 4QE1A 3CZ8A 4A35A 4L6DA 1V0NA 4LV4A 3AIBA 4NJHA 1I60A 1GVQA 1KB3A 4TX8A 3B3DA 4O1EA 3WG6A 4QG9A 3MVTA 3PM6A 4AQLA 1UD5A 4C6MA 1V3HA 2Y24A 1TR9A 1US3A 1V8EA 1TE1A 3OW1A 3M6DA 4RDVA 3TSBA 5DMNA 3EWYA 3DERA 2EO7A 2ABBA 2D69A 3MP4A 5EB8A 3PK7A 2Z2BA 3UWZA 1VD6A 2V69A 4Y9OA 4RV3A 1YNYA 1IZJA 3P74A 2PDXA 3ANUA 4Q4QA 3SW6A 4W8BA 4E38A 5HR6A 4FIQA 3E96A 1IXPA 1KM2A 1XDLA 1SSDA 3IJDA 5G4EA 2VFFA 1U33A 1Q7QA 2V2HA 5F2IA 2EPNA 4OKDA 1XH1A 5E93A 5A6MA 4A05A 3FA3A 1LP6A 4Q4RA 4NX5A 2CWNA 2W9MA 3FEMA 4LCSA 2VEGA 4F4RA 3A22A 2O9RA 3CB3A 2REQA 5DEZA 3NA8A 4PTNA 5AHNA 5HR7A 3UJ2A 4G1NA 5K2ZA 4PMXA 1HNYA 3ZS4A 4IP5A 3UG8A 3T4WA 4XX6A 4YXGA 2FZMA 2JGQA 3LQLA 3ZFHA 4GFSA 3GNOA 4GPNA 1ZLPA 3MP3A 2DZTA 3KVJA 3KE0A 4CN1A 4PULA 5TD4A 4AD2A 3PWGA 1SYTA 1V6WA 3FA4A 3KRZA 2FQIA 5CGQA 3P61A 1IT0A 3M0VA 4PRWA 4DF1A 1UJQA 4H41A 1NWSA 3HQNA 5EBAA 1LG1A 2OFJA 3WLKX 3H21A 4W89A 2GQAA 2VR2A 1BF2A 3CIXA 3M0JA 5AHIA 2WBKA 3S2CA 2D22A 3I3DA 3MANA 5E0KA 2QAPA 3U7VA 3WLMA 3CEPA 3UZ5A 5CBJA 2VCAA 3ONBA 2FGBA 1Y5VA 1Q6EA 2IW0A 4Q8QA 1VBHA 2REQB 2WSPA 1E55A 4MWAE 2XH0A 1F4HA 3B4UA 2GYIA 5FKYA 1XPGA 4NZ3A 4W93A 4TX6A 3GHUA 4DBWA 4GI4A 4JIHA 3QRHA 4WVXA 3AZTA 2AOSA 3NQ6A 4YL2A 4A3RA 2AMGA 3NL3A 2D0HA 3NQGA 4V1XA 3ZT6A 3BAXA 4N4QA 4FLQA 5GJNA 4Z17A 4AD1A 5CPLA 2GVEA 1AG1O 4B3LA 1EIBA 1ITQA 4M6UA 1TWDA 1XBYA 3H2CA 4Z1CA 1OWQA 4M5PA 2E5BA 4ERIA 2XH7A 4L7ZA 2NQLA 2CHRA 4S3CA 1XYFA 3SCUA 2VUYA 4PCPA 3SIMA 4OJYA 4DO5A 1TWIA 2YJQA 1XIMA 1Z42A 2Y7EA 1W5OA 3TOYA 4PH6A 4EK7A 1ZTVA 1V03A 4B5TA 1JUEA 3QQ1A 2C91A 3VOGA 4OV9A 3HPFA 3PN8A 5FEPA 1DWGM 1E3ZA 1KXVA 4LF1A 5F2MA 3UYIA 2P1FA 1F76A 2GZXA 3M5YA 2PGFA 2QULA 3AYVA 4NZCA 1ONRA 3M1ZA 2ZIDA 3K5XA 4LU0A 3UPMA 3LCFA 3U2ZA 3DAQA 3ITGA 4JNMA 5ECUA 2DP3A 3R5EA 3L4WA 4JX6A 1TPWA 3NQVA 4GE8A 3CNYA 2FMOA 3ARXA 1BF6A 3OVRA 2X7VA 4QROA 3TN6A 2XFRA 3LTPA 4YU1A 1UROA 2V3FA 3BLIA 5HATA 2ZVIA 4UOQA 3NL6A 2ESCA 1M01A 2VDGA 2J8FA 5GNZA 4LPCA 5L6UA 4XZBA 2GJXA 3E5BA 4WD0A 1OEPA 3MUY1 2RFGA 1TWSA 1DJQA 4H8VA 3VD4A 3NPXA 4NSBA 5FAJA 1ICPA 1VCFA 1PZ1A 4CCZA 5H8UA 3SRDA 4IFKB 5C70A 2AGTA 3W2KA 1IF2A 3HZ3A 4RL3A 4G7EA 3ENLA 3KW3A 4AD3A 4P7NA 3TAOA 4ASTA 1PO9A 3ITXA 4JBRA 4XZLX 4JKMA 3A21A 1JF5A 4H2CA 1FRBA 5E1QA 5IOBA 3FDGA 2WNNA 3WX7A 3G6MA 3M0KA 1QPQA 3SCSA 1E43A 3A64A 7TAAA 2YCLA 2C79A 3VGHA 3PBUA 1J11A 4CUCA 9XIAA 4O0ZA 2V9DA 3DKLA 3WLLA 3WUFA 3F2CA 5MKGB 2D0FA 3A12A 1IYXA 4GACA 4IJCA 5HULA 1Z6KA 3JRKA 1EA0A 2R1LA 1S2CA 3I65A 2A0NA 4LC6A 2GJXB 2WVVA 2CKSA 1WE5A 2BY3A 4O1DA 3M0YA 3LB0A 3M43A 1SZFA 4K7VA 1Q66A 1H3GA 3E12A 1VHCA 1MYRA 4LVDA 4E6MA 1O68A 3B40A 4OGZA 3RXZA 3FLUA 3CMFA 4AZBA 1MQRA 4DO6A 5BMWA 1OD8A 1OX4A 5FI8A 3AYRA 4MB1A 2ZUSA 4YWIA 1G4PA 1N8WA 4AD0A 2WB5A 1M5WA 1AFSA 2DJLA 2ZDRA 5DBUA 4C90A 2DSUA 2HDJA 3KDNA 1F3XA 3M0LA 2FH8A 4CKQA 2BZNA 3KX6A 8XIAA 4MWAA 4RUBA 2YCLB 1E0TA 1C7SA 4KWSA 3FNDA 3QY7A 5BMXA 1TPUA 3EX3A 4KH2A 5KITA 3UFYA 1GVFA 5FAGA 4WDUA 1B3OA 1NDWA 3UBPC 3HQPA 3MBDA 3NIYA 3WBEA 4RLIA 4Z2HA 3I7QA 3GB6A 3DGBA 1FKXA 3ANVA 4J5NA 4DZAA 4ERGA 5I77A 2W79A 4MY8A 1XL9A 3OIHA 4L64A 1U5JA 3E6EA 3N17A 4HCHA 5T8GA 3TH6A 2HV5A 2J6XA 2OEKA 4X63A 3W7MA 3N29A 3W37A 2GOUA 3IUDA 3VPLA 1KWGA 1DQXA 1OX4B 3BLDA 4JCMA 4H6KA 2PDNA 3UWQA 4L6OA 2B7QA 1UIPA 1F7BA 1WQ5A 3WQCA 3Q2DA 3UESA 1V6TA 2WMIB 2BVTA 2PDKA 1I0BA 1WA3A 2CCRA 4MWAB 5HNUA 2YL6A 4Q8OA 1B3XA 2JKAA 3BAIA 3OGVA 3E02A 4H6QA 1UR0A 1DXEA 3AS0A 1K4GA 3CWNA 2GVGA 1GVRA 1CW2A 1UKQA 2QCFA 1UUMA 3I10A 4LJ3A 3GSMA 3WQ4A 1QW9A 2C0AA 5U7SA 1P5BA 1R46A 4S39A 1K02A 1MWOA 1RBOB 1XQLA 2J27A 4XZWA 5D2XA 1SVDA 4MGGA 4BEQA 1F8MA 4L1GA 1FWFC 4O17A 4PUEA 4ZOEA 2YB1A 2HJPA 3MUAA 2WZIA 2AAAA 4OQVA 1S2UA 5FEXA 1R9YA 1VRDA 1V6YA 3B9NA 3LHUA 1BQCA 5CZ0A 2W67A 1TYGA 1H62A 2VVSA 5F7UA 1CBGA 3E1F1 4JNZA 1ISYA 1EWEA 4X9SA 3T2PA 1UD3A 2C3ZA 1ZALA 3VGEA 2NLIA 4W86A 3UA3A 3N2CA 1UC4A 2PE4A 3NQ8A 4ATLA 2Y7GA 2X0SA 2VJXA 3W1MA 2V3DA 4YJ5A 2VURA 4O53A 4QS6A 2HS6A 1UWQA 3SCPA 3W4RA 4OFCA 5T26A 2EEXA 3BV4A 3PP7A 4WZHA 2POTA 1E0XA 1M1BA 4LAZA 1DVJA 2PDFA 4QHRA 3WCZA 1ISWA 1C8QA 3TYAA 5I3KA 3PZOA 3FJNA 2YZRA 2PP0A 5AYYA 1HJVA 5A6LA 1TJ0A 3R2GA 3M5XA 2MNRA 1VEOA 1JL8A 3P14A 3LRMA 2CZ5A 2ZWYA 5LIUX 2WVUA 3II1A 4ZGYA 3SM0A 1EOKA 2PTZA 3GXTA 4Q8VA 1XQKA 4PUMA 3WDRA 5DY2A 4IIFA 3PVFA 4ICCX 2Z29A 1GG0A 3CU2A 4XD4A 4HGXA 1WXZA 4O15A 3EOSA 4Y96A 4GQRA 4AU0A 4UTTA 3EWDA 1ZUAX 1TR1A 3WL0A 3P3BA 4GXMA 3STCA 2OO0A 4MY1A 4GK8A 4IXHA 1XV8A 4N42A 2ZUVA 1KLYA 1L0PA 4MWAC 3T44A 2ZTKA 2CBIA 2TMDA 4H6EA 3MKVA 3W1XA 1QW8A 3UNDA 1GYLA 1YTDA 1PEZA 1YNQA 4AVFA 1FWDC 2I14A 1HVQA 2JIWA 2QMKA 4EIVA 1EIXA 1M41A 2GJLA 5D33A 3GG0A 3ZM8A 2PB1A 4J1OA 2DEPA 3ZWTA 4V27A 1P6BA 1TV7A 5EMJA 4H8NA 1CTNA 4PTXA 3GXPA 1PX8A 1V0LA 3AXXA 4H9VA 2NQJA 3WDHA 1BYAA 4ZXOA 4ZB0A 5XIAA 1U22A 5CAHA 3BDKA 4HK7A 4ACZA 1RCQA 3EEGA 1A3XA 3VDGA 1E0VA 4F8XA 2QJHA 5FIPA 4P7QA 3AU2A 2FDSA 3IIPA 2O7SA 1PJ9A 1OABA 1V93A 5DY3A 4QBXA 8XIMA 1MI3A 4N6EA 1UH4A 3K8KA 5HBFA 3GNDA 4MSSA 3B9EA 4O8AA 3NFUA 4NI3A 2D3NA 3BPWA 3V4BA 1YXDA 4ES4A 3CV2A 1PCWA 1FHVA 4JQ3A 1P1XA 1E9LA 1TJPA 1AQHA 2DUZA 1P7TA 1ZAJA 2DORA 4UQDA 1JZ2A 1TV5A 5A6TC 3WLOA 1UWTA 2HBXA 2NXGA 4YPJA 4QDPA 3LERA 4UMBA 4WKAA 3M0XA 2A79A 3AMDA 3WF2A 2VUNA 3NZGA 2E40A 1E9ZB 2ABAA 4FLOA 1XSJA 1BKSA 4QG8A 3FXGA 2J7FA 2GGJA 3SRKA 3HJZA 2HMCA 3ARWA 2ZXDA 3SFWA 1G9HA 1Q45A 1QI3A 3SADA 3UZYA 1CGYA 4CLMA 3CUFA 3WMCA 2AAMA 4NIRA 3VNYA 1GHRA 3HGRA 1RV8A 5ABFA 3UA4A 3W2UA 3O8AA 1JDCA 2E9BA 1UUOA 3V35A 3W1UA 1PUDA 3WQGA 2V2DA 1MUCA 3F2DA 4WX2A 4PUUA 3TLLA 4WF7A 3L4ZA 4EWND 3WH8A 5A6JA 1KD0A 2J7CA 2QV4A 5BXTA 1P7TB 5FJJA 1OG6A 4JHZA 1OADA 3VFLA 3A47A 4KW2A 3G1FA 1KM6A 2EGZA 2YLAA 4WXZA 3TW7A 2H8ZA 3IJLA 4UTTC 2OX1A 3GWQA 2A3BA 3SY8A 1ISXA 3CAVA 1XRVA 4MWAD 1EPVA 1V5XA 5LIYX 3QQ0A 3K4DA 2PWGA 5LNRA 3WNNA 1RR2A 3QFEA 1Z8AA 3BJFA 5AHFA 4R7JA 5HWNA 5ABGA 2XTKA 4LANA 3W7NA 3GTHA 5IHSA 3ITVA 2QJIA 4DUXA 5DF0A 1BSLA 3W81A 1ALDA 4M1BA 3RK8A 1EB3A 4TTGA 1BYCA 2QF8A 1QNVA 3UWEA 1M7OA 1EF3A 1NWTA 3C3NA 4HMEA 2PWDA 1U1JA 2ZKMX 1W37A 1DHKA 3BSGA 3E74A 1YDYA 1SZNA 1XLMA 3AUJA 3GVQA 1LTDA 2F2HA 2OXNA 3W85A 2VX4A 3IV8A 3S1UA 3Q65A 4ZOBA 4NRSA 3ZZ1A 4XKYA 1UMLA 4GXPA 2Q01A 1P0EA 4GO9A 3CUXA 3W00A 1ZRQA 4UTKA 1SJAA 1F05A 4EOUA 1KCZA 3S6DA 3EDFA 5C2CA 3EPMA 7ODCA 4ZTXA 2PTYA 4QIUA 4HPNA 1GYMA 4KEVA 3W23A 3TJIA 1OD0A 2GVJA 4B4FA 3EXRA 3L0KA 3QXBA 3LHTA 2VC9A 3W6MA 3OQEA 3DC8A 2QCGA 4YWSA 3HM7A 3W75A 4GJJA 3FGCA 1WAUA 4A22A 1KC7A 5CPNA 3EYPA 3RLVA 2ZZ5A 4O16A 4AMAA 2CLEA 3QKZA 4LUSA 4EXAA 1T96A 2E68A 4KIEA 4FNTA 4LRSA 2O4QA 4G2DA 2X40A 4X3ZA 3QSRA 4FX7A 1GZJA 4ZBCA 1Q6QA 5FJTA 2Z6JA 3EOEA 3W73A 1RQHA 2BXVA 3EEZA 3NL5A 4WDWA 4L65A 4PMVA 4HU8A 1BWLA 3A5VA 1DTUA 1OT2A 4IIHA 5FD0A 4QJ4B 3KXQA 4JY8A 3KFTA 4R88A 1RQEA 2BGQA 1H4PA 3ANYA 3HG5A 1WDQA 3LDVA 4MB5A 1YE4A 1A3HA 3VOCA 4QXIA 1RXOB 1FCQA 3TMLA 4KRTA 3PB0A 4FNPA 3W7RA 5M2FX 1EJSC 1GK8A 2WZHA 3H54A 3S0CA 1WO2A 4I7WA 3P7YA 1KM4A 2NXIA 3VZXA 1B54A 4HNOA 1CGUA 5DRIA 2YDSA 3BLFA 3R4IA 1XPYA 3AMKA 3RLGA 4D6GA 2BVYA 2OPJA 4Q4PA 1KBBA 1K9EA 4LUSB 4FMVA 4NZ1A 3SY5A 1H11A 3N9SA 2QJMA 2VFDA 4G1KA 1W1B1 3CIWA 3OOQA 4CQ8A 1KRBC 1SU5A 3SGZA 2WC7A 3VIGA 4CQBA 2CETA 1E1CA 6CGTA 1J6OA 2VD9A