2PDJA

Human aldose reductase mutant l300a complexed with idd393.
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
315
structure length
315
Chain Sequence
ASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCAALSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Merging the binding sites of aldose and aldehyde reductase for detection of inhibitor selectivity-determining features.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Aldose reductase
total genus 106
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2007-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2pdjA00
1T40A 2ACRA 4JTCA 1PZ0A 1AZ1A 2F38A 1Z9AA 1XJBA 3WCZA 3M4HA 4GIEA 2R24A 3CV6A 4L1WA 3LZ3A 3ONCA 5KETA 4RPQA 1UR3M 2AGTA 5LIWX 4XO7A 3R6IA 1PZ1A 4GABA 3R94A 1AZ2A 2PDMA 1RY8A 3LENA 4HBKA 3UG8A 2PDFA 1RY0A 4EXBA 2J8TA 1X97A 1AH0A 1R38A 5HA7A 2C91A 4JQ3A 2WZTA 3R58A 2PDGA 4XZMX 5C7HA 2IS7A 3U2CA 4LB4A 4MHBA 3M0IA 4NKCA 4WDXA 4DZ5A 2F2KA 3GHSA 1AFSA 3EB4A 5LIKX 4XO6A 3RX3A 1ZGDA 3LBOA 3Q67A 4WGHA 4R9OA 2HVNA 4PRTA 4ZFCA 2IPJA 3B3DA 2IPWA 2PEVA 1AH4A 2PD9A 4JTQA 3UYIA 4PMJA 4XZLX 2I16A 3CV7A 1GVEA 1US0A 4LBSA 2IPFA 4JIRA 1MI3A 4GQGA 4DBWA 2IPGA 3ERPA 4XVEA 2ACSA 3S3GA 3BV7A 3CASA 1YNQA 1PYFA 3V0UA 3UWEA 4YVVA 3BCJA 1AH3A 4H7CA 4WDWA 4LAUA 3LZ5A 3UZYA 2FVLA 2IKIA 3LUTA 3G1RA 4XZIA 2PDHA 2FZ8A 2PDBA 4FAMA 3LQLA 3KRBA 3COTA 2FZ9A 3DOPA 3T42A 4PUUA 4JQ4A 1SM9A 4WEVX 4XZNX 3EB3A 4OTKA 1FRBA 2HDJA 2IKJA 1ADSA 3H7UA 5LIUX 1LWIA 4PR4A 1S1RA 1RALA 2ISFA 2PDYA 3H4GA 3N2TA 1ZSXA 3N6QA 1S2CA 4Q3MA 4FALA 2PZNA 4JQ2A 4AUBA 3R8GA 1Q13A 2IKHA 1S1PA 4FA3A 2HEJA 5DANA 4XK2A 2ALRA 4H8NA 1K8CA 3GHRA 1C9WA 4IGSA 3WBXA 1QRQA 1MZRA 4G5DA 1Z8AA 2PFHA 2HE8A 1Z89A 3M64A 4JTDA 3GUGA 2CLPA 1XF0A 4GACA 2PDNA 2PDIA 3F7JA 4PUWA 2WZMA 2PDLA 2PDUA 2DUZA 2PDKA 4WDTA 2DUXA 4GA8A 1VBJA 4DBSA 4F40A 4GCAA 3NTYA 4DBUA 4GQ0A 3RX2A 4Q7BA 2BGSA 5JH1A 2PDWA 1J96A 1YNPA 2HE5A 2PDQA 2R9RA 1XGDA 3BURA 1EF3A 1MRQA 2PD5A 3CAVA 1PWMA 3V0SA 4LB3A 3O3RA 4JQ1A 1HW6A 2PDJA 3ONBA 3LN3A 4LAZA 3CAQA 2BP1A 3UZWA 2IQ0A 4YU1A 4QR6A 1OG6A 1A80A 4YS1A 1EKOA 4PRRA 1HQTA 3FX4A 4L1XA 3UP8A 2PDPA 1QWKA 3EAUA 4QXIA 3R8HA 4EXAA 3QKZA 1EL3A 2FZDA 1S2AA 2NVDA 2FZBA 3WBYA 4I5XA 4ASTA 4ICCX 1M9HA 3LEPA 5AZ0A 2PF8A 3GHUA 2PDXA 5HNTA 3BUVA 1EXBA 1VP5A 2INEA 2ACQA 3D3FA 1IHIA 2QXWA 2A79A 4QBXA 3FJNA 2NVCA 1ZQ5A 2HV5A 4JIIX 4IJRA 1X98A 1Q5MA 3R7MA 3WG6A 3LD5A 3UZZA 2VDGA 5LIXX 4IJCA 2I17A 3CMFA 3MC5A 1X96A 2FGBA 3R43A 4JTRA 2BGQA 4XAPA 3C3UA 2IQDA 3UFYA 5M2FX 2INZA 3Q65A 2PDCA 4HMNA 1PWLA 3DN5A 1IEIA 3GHTA 2ACUA 3O0KA 4JTAA 3V35A 1YE6A 4QX4A 1T41A 2HVOA 3MB9A 4XZHA 1Z3NA 3H7RA 4JQAA 3LNMA 5JH2A 5HNUA 4JIHA 2DV0A 3WBWA 3P2VA 1YE4A 3V0TA 2IKGA 5LIYX 2P5NA 3VXGA 4YVXA 3UZXA 1LQAA 3G5EA 4XVDA 4YVPA 3UGRA 4FZIA 3V36A 4WRHA 3RX4A 4LBRA 1ZUAX 3LQGA 4WDUA 1JEZA 5AZ1A
chains in the Genus database with same CATH superfamily
1T40A 3GC2A 4Y8EA 4C6BA 3L7RA 4GQQA 5L9FA 4UTFA 1L6YA 3OYZA 2VUYA 2WWCA 3PANA 3E9AA 4DVOA 3SO7A 1XBXA 1P0BA 3MJMA 3RYSA 2AGTA 1OYAA 4R7OA 1ZBCA 4DUWA 4CEXC 3TTSA 3GIYA 1R2SA 3LENA 1DIEA 4HBKA 3UG8A 5DLCA 3BARA 1AQMA 1IXOA 3U57A 3U5UA 1XRSA 3VIPA 3QW3A 1TTPA 3MKCA 5EMMA 4HGXA 4PC8A 1VCFA 1XG4A 3F4NA 3H53A 2QW5A 4FP1A 5LYRA 2O0TA 1ZS2A 2R14A 5CPNA 3R1ZA 1JPHA 2E28A 3WLTA 3GHSA 4L9ZA 3G1AA 1AJ2A 4XO6A 1JQXA 1ZGDA 3M46A 1VRXA 1GVSA 4N9EA 4LAMA 4PTVA 2A3BA 2ZBTA 3K30A 1MEWA 2PGWA 3TA9A 4PUNA 4ATDA 2WHMA 3GNNA 4CQAA 2WANA 4NUWA 2B81A 3S5OA 4MG4A 4Q8QA 3BW4A 2ISSA 2VENA 1H60A 1US0A 1RD6A 3O07A 4HCHA 3C8FA 3B4UA 4GQGA 2QDGA 3RG6A 2ZX6A 2VCBA 3VDCA 3ITGA 4KEMA 1BTCA 2ADAA 3R25A 4HNLA 1T8XA 3W85A 1TWIA 2VUNA 4D6CA 1KC7A 4NP7A 1ISWA 3A4AA 3M5YA 3ITTA 1CB7B 3W1XA 2KAUC 4H7CA 1Y0EA 1YKWA 1YXDA 3KBWA 4QJ4B 4GO8A 3VILA 3WJWA 5ABHA 5B7YA 3G18A 2OJPA 3L23A 2QMJA 1RVKA 3R10A 3WQPA 2G97A 2FZ8A 1W2PA 4O14A 1ESWA 3UZ5A 3KVKA 4H41A 4YHGA 5HMDA 2NX9A 3VUSA 3UWQA 5HNNA 1GPWA 4B4FA 1KCXA 2WBGA 3U2OA 1SO4A 5LIUX 1KXQA 3U4AA 3UCDA 3EA3A 3C56A 4JZ5A 1W56A 4GX9A 1L6WA 3UEQA 1KWKA 3NO3A 1JF6A 3N2TA 3GDKA 1BXBA 5JVLA 1P0DA 4JX6A 4M51A 2Q01A 4QNWA 5K7JA 1J79A 1N7KA 4GISA 4JQ2A 5CPMA 1YHTA 4UFKA 1XCFA 2ZRVA 2ZRZA 3VVGA 3BICA 1O1HA 1MNZA 2RDWA 3LU2A 1HIZA 4JN7A 2J24A 5DANA 1NM9A 3NL3A 1XIEA 2X2GA 1K8CA 1Q2RA 1JDFA 1GZ1A 4KCTA 4JN6A 4FX6M 1JZ7A 1XLLA 4ZQCA 5K9DA 2GOUA 4NYYA 3FKKA 1UPPA 1XF0A 2J78A 2P0OA 1UMLA 1KM2A 3L2IA 5AC8A 2YDRA 3N14A 4REQA 3QOMA 1BGAA 1XLCA 4NXKA 1EO7A 2BY2A 5HATA 4PH6A 3KBNA 1EX1A 4HZMA 5DBUA 3DESA 2Y8KA 4ZSTA 4EANA 4NRRA 5TAOA 3H2NA 3OVGA 3UJEA 1K8ZA 2B0MA 2A1YA 3VD5A 1BWVA 1EDGA 2O9PA 4DNHA 1CI1A 5A94A 1C92A 4JFVA 1NY1A 3CZKA 1J2WA 2WW5A 2BV9A 3QRHA 2XGBA 4PULA 1JAKA 2J7DA 3TC7A 2GLKA 4WKAA 2Z7GA 3NNTA 2BWGA 1ZJIA 4RNIA 4QP0A 2WZIA 2D3LA 1DP0A 2QEZA 4KRTA 4HTYA 3DZ1A 1XKJA 4ALDA 4ZBCA 3VNMA 4HU4A 3WNPA 1RJPA 1UUOA 2X05A 3QKZA 1TMQA 3KL3A 2FZDA 1S2AA 3LV6A 2XVNA 3PB2A 4H8UA 3V18A 1QW7A 2OEKA 4FXRA 1DL3A 1UC5A 4E3VA 4ZO6A 4DJFD 2VXNA 2F2HA 4W7VA 4BY3A 4JKKA 4NIRA 1XYZA 1EJRC 3R0KA 2VZSA 4AAJA 5IBXC 2ACQA 3PSVA 4EE9A 3CV1A 1UQYA 1EZ2A 1JPKA 3LYEA 4XAGA 3VOCA 1DWHM 3KFTA 2CESA 4GUFA 2VDGA 4D71A 4JTGA 1LDCA 4C6DA 2I17A 2VWTA 3C0LA 4FK9A 4J3WA 2C3ZA 2FGBA 4CU7A 1N2VA 3B04A 3NQEA 2VEKA 4FX8A 1ZY9A 1B30A 3ZT7A 4MWAC 1NF7A 3P82A 4U2ZA 3RITA 1KTBA 1TE6A 4LAOA 4D1IA 2QCMA 1R85A 4DJEC 1CENA 1EC9A 3GXPA 3CLWA 3LPPA 1AW5A 3IUIA 4PTNA 4E2VA 5JXQA 3HQ1A 1QNSA 1BHGA 5F4WA 1GTHA 3N11A 1QXLA 1Z3NA 1HP4A 4HA3A 3W76A 3QHNA 3UPBA 3WBWA 3HFTA 3IVSA 4I90A 3CHFA 1K9EA 3MP3A 1YX1A 4S3EA 2X0YA 2H9AA 3W07A 1TR1A 2OZ3A 2EO7A 2ZUNA 6REQB 1YBQB 2WJFA 1PAMA 2DVXA 3VNYA 3VABA 1EJWC 2VC9A 3TKFA 2FDMA 2OZTA 5LXEA 1UR9A 4U28A 3B40A 4IX0A 1E0VA 4CQDA 4ATWA 4PA8A 3TA6A 4DJDC 4XUGA 4MJMA 1EX5A 4Z1BA 3WCZA 3S47A 5CXPA 1GKRA 4UQEA 2E6DA 4CCEA 1IEWA 1UP0A 3GVRA 3AO0A 2PDMA 4S39A 4I5RA 3OP2A 1VAHA 3AS0A 4A2SA 2PRHA 2JIWA 2GDVA 4KMQA 5CAKA 2WM1A 3MI2A 5H8MA 4G2DA 3R58A 2QUMA 3U5YA 1B3WA 5BXPA 1BSIA 3WDQA 2VVNA 1UD4A 3WLNA 4WDXA 3M5VA 1IEQA 3VGEA 4ICMA 3AIEA 1V0NA 3WJSA 1A5CA 2XWEA 1DOSA 3P0XA 1S39A 4MADA 4C60A 3IJQA 3GDMA 1N82A 4P7OA 1S5NA 3VD3A 1FUYA 2IPWA 1WDRA 3VOFA 1WDDA 4K37A 2QV5A 3UR5A 1NJJA 4CD7A 4NI8A 3AHZA 3NO1A 4UZUA 1QOQA 1XFCA 4CQ8A 4QLJA 1Q8JA 5AOUA 4JKMA 2JQXA 1OCNA 3EXTA 4YIWA 2ACSA 3LLDA 3VDAA 4F0RA 1E6PA 2NQZA 4REQB 3FY1A 4HK7A 1ENUA 5IBXA 5AC4A 3BJFA 3H26A 2E77A 3K4WA 1TR9A 1NDYA 1XISA 3GK0A 4PMYA 4PMOA 1AH3A 1VHNA 4AWUA 4I9MA 5HINA 1K4HA 4FS9A 3WQ8A 5HUPA 4L1GA 2V5KA 4X22A 4NRSA 2PDBA 1WB0A 1VFHA 3GNXA 3MV01 4LJ3A 3E5BA 1A5AA 2DFAA 1WDPA 4TX9A 4WEVX 1U1HA 2V3FA 3W81A 1FRBA 1A3HA 4M6UA 3QQ1A 5IOBA 5LHEA 3PUGA 2TMDA 4BK9A 2O9RA 3E12A 1G5AA 1TO3A 1ZSXA 1EHNA 3DFNA 4E2DA 2ZC1A 2A7NA 1R87A 3ABXA 4Q3MA 3T78A 2A6NA 2QR6A 2WZHA 3MI6A 3PTKA 3UY8A 4D6EA 4EPBC 4AD3A 3T8LA 2XFWA 3HJZA 3S1XA 2V38A 3RU8X 1AMKA 2GWGA 1Z6KA 2DSVA 3GNOA 2X1RA 2BXZA 4P8VA 2XIBA 1KD0A 4M29A 4QRNA 3GHRA 3SZ8A 2GGJA 3PB0A 1TJ0A 1C7SA 3IEBA 4JTDA 2CHRA 4LOCA 2ATMA 4PN2A 2FKPA 5DFAA 3DGBA 2BY3A 4C6JA 2G3JA 1O5XA 1ONEA 9RUBA 3GU9A 2OWCA 1LOLA 1UASA 4GA8A 2WXDM 3HU7A 1MQRA 3UQNA 5EMYA 3MYPA 4NSBA 3VKJA 2DT0A 1UC4A 1TV2A 4ADTA 3HBLA 5A69A 1FWRA 2QPSA 3THUA 4LVAA 1TUXA 4MZ1A 1U1JA 2YCLA 3LLFA 2EBNA 2JALA 3QTPA 2XHYA 3DCPA 3AS2A 4J3UA 4O12A 4DWSD 2CXEA 1G7UA 2QZRA 2PDJA 3W22A 2BOEX 3N3MA 3VA8A 3WFAA 2C1HA 5ABFA 1E1EA 3CS2A 4V27A 5DMYA 4UFIA 2POTA 3NL6A 4LRTA 4AIUA 2JFEX 4LY4A 1DBTA 3W02A 1V93A 1EUAA 1UKQA 3OGVA 3WKZA 5G1TA 5D2VA 3CUXA 3ISIX 2WCAA 3NPXA 3WEMA 3IGHX 3GW0A 4BF9A 4MAZA 1CXKA 1FCUA 3N9RA 4EAYA 5BRPA 2W3ZA 1H0IA 3I65A 3EWZA 2YCIX 3CZEA 3NQ6A 4U5KA 4C7DA 2GJRA 5EKYA 3C3NA 1PYMA 1IEVA 1KKOA 4AHQA 2VQUA 5E09A 5CSUA 2FDSA 5D04C 4M6QA 4RR4A 3VIGA 2EPHA 3GVWA 4TVDA 3M1ZA 2Y8UA 3O0FA 4EF9A 3BZJA 3L2MA 3S8HA 2F7FA 3HG5A 3MY9A 3VZXA 3VNJA 2ODOA 3HFYA 4UXDA 1A0CA 4BHYA 3WQEA 4AX7A 3B97A 2YFNA 3W6LA 2GJPA 1KFLA 1LJYA 1L8PA 3LOTA 2G5WA 1J0JA 1JYNA 4YHEA 1QDSA 2Y63A 2DZWA 5KSWA 4TR9A 3RJXA 3QM3A 1FFQA 4DXKA 3TMQA 1SJAA 3BV4A 3EMQA 3S5SA 3LLXA 4DF0A 3VIHA 4DBEA 4GLEA 3GNDA 2P8CA 4C6CA 5JUVA 2WHJA 2ZXAA 4D9PA 4F0LA 2ZUSA 2J74A 1ZCOA 1XQLA 4L6OA 1ZP4A 3IGXA 5JBEA 1YE4A 2IKGA 4IMFA 3MSGA 1RD5A 1RHCA 3G0SA 3CB8A 5LNUA 2QCHA 1Q6LA 3RILA 3B8TA 5GJNA 4G1NA 2OGJA 4RV8A 4H9TA 3LQGA 4HU3A 1LUCA 3WN6A 2AGKA 4JS3A 1X8CA 1D7FA 1LLOA 2H8ZA 2P10A 1VLIA 3W37A 4AWEA 1AD1A 5EB8A 3H21A 2QIWA 4HMCA 3W72A 3K4AA 3CQHA 2GVGA 4GCXA 3AIRA 1E9YB 4Q22A 3DEQA 1XL9A 4UTTC 5GNZA 4J9JA 5IFTA 4W4QA 3QMRA 1WXZA 3MANA 1S5MA 1KKRA 2MNRA 2DT3A 1DQWA 1ML1A 1R38A 2UWFA 4RXFA 2D22A 4B5NA 2OOFA 1CPUA 3H2AA 2OB3A 2PAJA 1XRFA 1EJXC 3KAOA 5HR6A 4C6QA 3P62A 3OB8A 3LDVA 3DHFA 3K46A 1G67A 1QPKA 1BD0A 1XX1A 3CUIA 3TTQA 1AFSA 1I2RA 2ONEA 3WLHA 1W1YA 3BVJA 4LYRA 4WGHA 3CV2A 1F6PA 3AOFA 4HPGA 4NZ4A 4XZWA 3B3DA 1KRMA 3G1SA 3D0CA 3OO2A 1CWYA 3UXIA 3L5AA 2PD9A 1GOQA 1Z48A 3W7IA 1XIGA 3A13A 3VE9A 3MPGA 4MB4A 1W1IE 1REQA 3DI1A 4FPSA 4D2JA 5CSRA 3WX7A 4C6EA 1RP9A 4MM1A 2FFCA 4NZ3A 3UCCA 1PDZA 3DG7A 2BHZA 2UZ9A 1DPMA 1UWSA 2PP3A 2FYMA 1GQIA 3RXZA 5ABGA 2HCVA 3IV8A 4U33A 1MEHA 1AW2A 4WGXA 3MV11 4YVVA 1YMYA 3LG3A 4IMGA 4FOJA 2CIPA 4C5YA 4LAUA 5HPOA 1MQQA 5JU6A 4MUPA 3NEVA 1G69A 3N2CA 4AVFA 1J93A 2D20A 3UA3A 1KM3A 3VIMA 1OG0A 3I6TA 2BASA 1XUZA 5CG7A 3CU2A 3T42A 1V02A 4Y7EA 4AZ7A 1E70M 4DM1A 3H2MA 3WL0A 2E40A 1ZPTA 2ABAA 1R3QA 2YYTA 3RRXA 3CNYA 1OT1A 3U2EA 1UZ4A 2Q02A 2BFGA 4Y8FA 5A6MA 4ADUA 2D2GA 3UWUA 1E0UA 4RDZA 4XIMA 2PZNA 2RFGA 5E6YA 4O53A 1H5YA 2ZWZA 2AKZA 5I3IA 4AEFA 8RUCA 3TTYA 4GC4A 3R89A 4H7VA 2QCLA 4TV5A 3A22A 3WK1A 4JICA 2BZNA 1H1YA 2ZX5A 1XDJA 3WBXA 1VIWA 2VWSA 2WQDA 2NQ9A 1O7AA 1F3WA 3LRMA 2GGEA 3F2BA 1XLIA 3E02A 3OG3A 3GR4A 4AG0A 1VFLA 1IYXA 3MO7A 3VMPA 3P80A 4EXQA 5HJYA 1JAEA 5HMFA 1PO9A 1Q4NX 3B4YA 4M19A 1TTIA 1W8SA 3KRSA 3TLLA 2IMRA 4PTXA 1VEPA 1H3GA 2VFFA 4PTWA 1OJXA 4HJWA 1EJSC 2CZDA 4R88A 1CLVA 4FXFA 1E6ZA 5CCZA 2OX4A 1GYNA 3TN5A 5A6AA 2WKJA 3HV9A 4GYKA 4IWWA 1J96A 1TRDA 1EF3A 3MVTA 1Q7QA 1AODA 1VFTA 1HW6A 2CBJA 1H7XA 1Z42A 1UP3A 1RZMA 3M0VA 3N4FA 2VFDA 2Q6ZA 4PUJA 1BXCA 4U3AA 4RV3A 1LBMA 1HO4A 3VKCA 3AMDA 3WNKA 4C6LA 2W66A 4F0KA 4DUOA 4AHOA 1B90A 3AAMA 3SDOA 2BGNE 1XLJA 3E0IA 3M7SA 2EGZA 3RR1A 3MP4A 1B9BA 5EFFA 4RNFA 2Z1SA 2WC3A 4J28A 3WL1A 3EWCA 4E2BA 3ZSSA 4K7YA 1PB0A 3APTA 3EPMA 4IPNB 2D3NA 2BLEA 5I0DA 3NXLA 1ZALA 4DQWA 3E2RA 4L4MA 3NPUA 4IFKB 3UY7A 4E0CA 5TD4A 1I6NA 2P8BA 4HIBA 2FZNA 4RNHA 3A3HA 3SCUA 2O7SA 2PI6A 4JHZA 1S3HA 4OFCA 4AU0A 2ZKMX 4MY9A 5EBAA 1J8VA 4PUMA 4N9CA 3RK8A 5EL1A 2ZQ0A 1OC7A 3UFYA 1E0WA 1SR9A 3UWYA 3Q65A 2NXHA 1H7RA 2OOGA 3GNRA 3QOKA 3M44A 2QPXA 2OT0A 4IL2A 4X9YA 2P53A 1TVPA 2ACUA 2EPLX 4UMBA 4F2TA 3V35A 1YE6A 3P93A 4DBDA 4QX4A 4YTSA 1NF0A 3TQPA 2ZE3A 4J4KA 1TV3A 3PP7A 1GW1A 1XLBA 4S3DA 1EQCA 5C55A 1EWDA 1GVFA 4AY8A 4NYUA 3GH5A 4FXSA 2DV0A 3NQ7A 5FSEC 2D69A 3A4JA 3PVFA 1UZ1A 1Q45A 3SUUA 4RCXA 1A4MA 4IIFA 1OFOA 1YXCA 2CHOA 1U5VA 4YVXA 4NX5A 2HQAA 5TQLA 1PS9A 2E5CA 3I3DA 3VX1A 1D3CA 1Y5WA 2AOSA 4DYKA 3CB3A 5DY2A 5TBOA 4AEEA 1UIOA 1PKMA 4KFOA 1VC4A 2WVSA 3IJ6A 4BWLC 2JEPA 3W1MA 4K2SA 4BR1A 3PWIA 1CGXA 1Q6CA 4GUJA 1A49A 3A6OA 3CL8A 3IACA 2E6AA 4ZODA 1UG6A 2OODA 1AVAA 3BAWA 1OGGA 1C9DA 3WQWA 4HNTA 4L1WA 4XISA 2I14A 4DF2A 1KBKA 2UBPC 3AIWA 5KETA 3C0JA 1PSCA 3S46A 1JI2A 3N9SA 2DVUA 4GABA 3TJXA 1TV4A 1QOXA 2WC4A 5BXTA 1TELA 4IH3A 3N34A 2R91A 3L4VA 2QVHA 2OWWA 2X7VA 3WLIA 3UYCA 1CXLA 3ICJA 3CT7A 3O6CA 3RJYA 4NKCA 3S1UA 3NUKA 4XKMA 4PTDA 1VH7A 3GDTA 1R2RA 2GQAA 1LBLA 3H2FA 3B9OA 1ME8A 3I10A 3PWGA 3A5FA 4A8RA 2BTMA 4QSFA 1I60A 4UR8A 2EXOA 1QMLA 2J25A 4ZB0A 2YW4A 3KP1A 3APYA 3WLKX 1BYDA 3WLQA 2YB1A 2WJEA 3FDKA 4QNEA 4UWMA 3WUBA 3S3GA 2DSKA 3BV7A 1C3FA 3BGJA 4JFTA 1JXJA 3A5VA 3DENA 4A21A 5JBFA 3UVAA 1PYFA 2W27A 4MUZA 3BXWA 3RFAA 1W3LA 2EG7A 4F8XA 1JFHA 1AG1O 5ABTA 1QHZA 1B31A 4XAFA 3UU0A 4NILA 3GD6A 4GZIA 3S5YA 1A0EA 3YPIA 1RK5A 5CPSA 1I2OA 2QCEA 1OZMA 1TPH1 1A50A 3EWYA 2FZ9A 4O13A 1TPVA 4JQ4A 1KFCA 5A6JA 6TAAA 3H7UA 3W28A 1MNSA 3OU8A 1UKOA 4Z0SA 1R3TA 3T0TA 3SCPA 3DHDA 1QCWA 1EJVC 2F84A 1O95A 2PBGA 3PBGA 3UNDA 2PLMA 3W1NA 3TC3A 3V5OA 4DX3A 4Z1AA 4IPLA 5DCDA 3I4KA 3W88A 3TYEA 4CU8A 3TN4A 2OPJA 4ZA0A 1U30A 4GHRA 1QRQA 4I8DA 4NVTA 3EWUA 4H19A 3SADA 3GUGA 3TOPA 4K6AA 3VGDA 2GGHA 5CC6A 5AECA 1QBBA 2HJPA 1X38A 3L4TA 3F7JA 5GJMA 4DWSB 5HDRA 1UPMB 3W24A 1F8MA 1QPNA 4TU1A 3LTPA 5DCEA 4BI5A 3T2PA 1XGEA 4A3RA 4GCAA 4MY1A 1U22A 3A12A 5I3GA 3GR7A 3VGBA 2NWRA 3WK3A 3G1DA 5HPCA 3TWAA 1PHWA 4JIPA 2NUWA 4W86A 4Q32A 3U6WA 2QNEA 1LWJA 3GTNA 1SZNA 1RP8A 3ONBA 5BOOA 1IQ8A 2O9TA 4ORIA 5CZ0A 1FWBC 1MFVA 2W6RA 4P7QA 5LNSA 1KR0A 4QTGA 1LL4A 4C6MA 4C6KA 1XYFA 3MBDA 4JTLA 1KR1A 1D8WA 1NFBA 1RBLA 3G3MA 2NW0A 2CBIA 4O18A 4I9JA 1TWZA 3Q58A 3BK0A 4J5NA 2Z27A 4S2BA 3DERA 2UY3A 4ZQMA 1SSGA 1CYGA 1WX0A 1ZP3A 3BJSA 3U4FA 3CO8A 4MZYA 1BKSA 3L21A 1EC8A 4J3ZA 2HV5A 1P48A 1EC7A 3N73A 3R8RA 2VEGA 3WD1A 1XG3A 2Z00A 5MF5A 1HNYA 5FOOA 2VURA 4H6QA 4XV0A 2PWHA 4F0HA 3FYYA 2DZTA 4UOJA 2ZIDA 1K7XA 3MZNA 3OVPA 4KGLA 1XRVA 2J47A 3TOYA 3DX5A 4PCPA 3M0YA 2DZSA 3S4TA 4IUOA 3UPWA 2GJLA 1TV8A 4LRSA 3KZSA 3CL7A 8TIMA 3C3UA 4XB3A 4UQ9A 1R3RA 3MYOA 5DCBA 1ZBWA 4LS0A 3DN5A 3LBMA 5FIPA 1G01A 1KRBC 3GKFA 4OZOA 4FLQA 1RPXA 4JTAA 4G1KA 4UB9A 3T0AA 1I2PA 3QR0A 3PZTA 1KXHA 3CMJA 3CQKA 1IF2A 4FLSA 4LVBA 3FGCB 3POCA 5C7VA 3DG6A 4RUBA 1QW8A 4E3TA 5BU9A 1S2WA 1DJYA 3B8SA 3VOJA 5LNRA 1C93A 2Q8LA 3E0WA 2E0PA 1W31A 2WBKA 4MWAD 3KTXA 3ZM8A 1B9ZA 2OYLA 4GVFA 3PPCA 1WXJA 3T08A 4AXKA 5B80A 2R1NA 1CGUA 3E5PA 4L4LA 4WDUA 3POHA 5AC7A 3HIJA 1O6IA 1UQZA 3L4YA 3MMTA 1TMLA 3SCSA 1PZ0A 2X0SA 3HGRA 5JIPA 4ACYA 3PUEA 5CC7A 3BOFA 3CV6A 2HRWA 3UPMA 4I7WA 2PLCA 4RPQA 3TNOA 2FPTA 3ES7A 1M7XA 4QQUA 1CIUA 1FTXA 2A4AA 4M1BA 4R27A 1F5ZA 4PSPA 3U3HA 4HTBA 3SUSA 3H54A 4WF7A 1W32A 1A5KC 4O54A 1UA3A 4C6FA 1FVPA 3VKBA 3WIJA 1FP9A 2GYIA 1UWQA 1QHOA 3D5HA 1XSJA 4JFWA 1H0GA 2O7QA 1GOKA 2QT3A 2WK2A 4O1FA 1IWPA 3ZJ8A 3T0BA 3WNMA 3AYTA 2CZVA 1MYRA 4XZBA 2RDUA 4DZHA 4HPHA 5C5YA 2I5QA 2W67A 1I2NA 4MAVA 3S2MA 1CLKA 4NJGA 4C6OA 4ACZA 3ITCA 3E49A 2W61A 3ZR4A 4UTKA 1K7EA 4HNOA 4HVXA 2EPNA 4LGXA 1H5VA 1NWTA 4JPGA 2YFOA 2DY3A 3WQVA 4IMCA 5MHBA 1OWQA 4PCTA 1M53A 3OLIA 1H11A 1LP6A 1I0DA 5EYWA 4DWSA 3HG2A 1B3YA 5DXYA 4NAFB 4QCFA 1E43A 1JUBA 3B9AA 4UTTA 3SECA 2XPKA 2ZZ3A 1WKDA 2GJNA 1JCNA 5D9MA 2Y5SA 4NY2A 2Q3OA 4FNSA 1OHLA 4X0VA 3BL3A 4M82A 1S2TA 4OUEA 3W1LA 2WKGA 3LUTA 4O1EA 3NQBA 3AZRA 3STPA 1X6NA 5BRBA 3CH0A 1OYBA 2QJNA 1VS1A 1SFLA 3EX3A 4PUUA 3EWXA 4XZNX 3EB3A 3M16A 1JPIA 2YW3A 4INFA 2PUZA 4NL1A 1R7OA 2F61A 3DXIA 4IUGA 3L0KA 4ZXLA 5LSMA 3VOIA 1SR0A 3CZGA 1SYTA 3IAPA 2Y5JA 1V03A 1U5HA 3VU2A 3WMCA 1E51A 2BODX 1EO5A 4JTUA 5D30A 3CT2A 3UJFA 4OJYA 5FEXA 4F0SA 1PJ9A 4Q6XA 2VL4A 1FWDC 5T26A 2CC0A 2C1GA 1T6MA 1XS2A 4ZENA 3VPLA 1R47A 3LMYA 2O4QA 4R7JA 5KZDA 3C4UA 2NUXA 3KOWA 1UROA 1JDCA 1F2JA 1Z8AA 4IQDA 3QEZA 3TWBA 1ITCA 1SO6A 3AALA 3RHGA 1FWWA 2WC7A 2BVWA 2OWXA 3APGA 4JTEA 1Q8AA 4KWOA 3W38A 4PUWA 1FCVA 5FL0A 5J04A 2B4GA 1NWRA 1YEYA 4FO4A 3PF3A 1M03A 4M6PA 4F40A 3NTYA 3UCQA 4D8AA 3QN3A 1DWJM 4P5UA 3LTSA 3C2FA 4KFNA 2D0GA 4AISA 4FIQA 5FESA 3P61A 4IISA 3EEGA 1QPOA 1XIFA 1GNXA 4KIEA 4DEFA 3C61A 1YNPA 1OCQA 1WKFA 5LA0A 1HUVA 3O8AA 1MRQA 1WUEA 3C8NA 1T0OA 2AMGA 3PBWA 3O3RA 4Z42C 4U10A 1TQXA 4LNYA 4PE8A 2J9ZA 3AC0A 4LAZA 3P8IA 5G4HC 3TC6A 1K1DA 2BP1A 1H4PA 4P8WA 1RBOB 3S0CA 1JZ4A 3F2CA 1DJHA 1XH2A 2QJHA 4Z2KA 3PUDA 2VI0A 4HHHA 4AD2A 3STCA 4MB3A 3NQ8A 1XD0A 3T2QA 1SW0A 5HBFA 1XYBA 2Y2WA 4IG2A 1XD1A 2WZEA 2QF8A 3T81A 3UT0A 3R4IA 3AMKA 1OK6A 4ICCX 1VBUA 1BLIA 1OIMA 2JBMA 3V4BA 4J1OA 1YNYA 3MSYA 4W5UA 5EMJA 3UD6A 3AIVA 1J11A 5D05A 4M81A 4O1DA 3ITOA 3QV6A 3SM0A 4AIBA 1H7NA 1WZMA 3NQGA 3KL0A 1YDVA 3HMCA 3WQCA 5D2YA 4YTUA 2FJUB 3V16A 3FKRA 4K8HA 1ODZA 2ICSA 1O4UA 4HA4A 3IIVA 5D2WA 4MNLA 3FXGA 3B0UX 1MW0A 1UBPC 4A3UA 4CN1A 1FWGC 5C54A 1LF1A 1IWBA 3DHUA 4W7WA 3MKKA 6CGTA 1AQHA 3VNKA 4Q8VA 5F2MA 1UH2A 3CC1A 2YB4A 4OVXA 1E6SM 2J75A 1F74A 3KBSA 3ALGA 4MVAA 4KBXA 3P81A 1L6SA 1RBAA 4HCLA 3CZJA 3G77A 1PWLA 4WY0F 2YSWA 3T9PA 1GVIA 4C1LA 4ADSA 3OLEA 4W84A 3H2CA 3WLSA 4TIMA 4OWGA 2R94A 5C2GA 3L4XA 3Q45A 7REQA 3SAZA 8XIMA 2Z6JA 2P5NA 5C2XA 4KEVA 1E15A 5CBJA 1XRTA 1DWGM 1PDYA 4DLMA 1KM6A 5E5CA 4C6PA 4GO9A 3C0SA 3T1GA 4NZCA 4NF7A 2A5HA 4WY0B 2XSXA 3W9ZA 3V36A 4ZOCA 1RCOB 2Y7EA 4N6EA 4NJIA 2CYGA 3RU6A 3SW6A 2BVYA 4W89A 3VGGA 4DJED 2V81A 1W5NA 1LOQA 3E2QA 3ABQA 3ES8A 2A7RA 1IGSA 1IR1A 1AZ1A 1GOXA 1JD9A 1U5JA 2OYMA 2OLAA 3RLUA 1X6UA 3LZ3A 3STFA 2RAGA 5AHEA 5PTDA 4GYPA 4E4UA 2CWNA 5F2IA 3LHYA 4AVOA 4MLJA 3L12A 1PZ1A 2J6VA 4O50A 3LGEA 1JQVA 2WMIB 5DQPA 3W1UA 6A3HA 1BTMA 1XKYA 1IT8A 4WCJA 3STGA 1ZRQA 4IIGA 4RW3A 1FXQA 2J8FA 3DC8A 1ISVA 2XGZA 1FDYA 2IS7A 4XQ6A 4O4VA 4MHBA 3BE7A 1T5AA 3NIYA 1KRAC 3QFWA 1L0PA 1JFXA 3RX3A 1DIOA 3VC6A 1Y5XA 1DVJA 3IIPA 3OLDA 3OHMB 2HVNA 1XH1A 2EKCA 1BWKA 1K9TA 2A85A 4B15A 2PEVA 3N2XA 3PZOA 2ABBA 4EWND 3EX6A 2VEMA 1KV8A 4XTDA 1E6XM 1G4TA 4Q6JA 1R7AA 2I16A 3RM9A 5KTLA 1I0BA 1XV8A 1VFFA 2GJXA 3QBUA 1OFQA 2W91A 5GNXA 4DBWA 5FI8A 3WUFA 1J0ZA 4G9PA 3ITXA 1SJBA 3WMBA 5HJXA 1V6XA 1F3EA 3S5NA 3B0PA 5ABEA 4HNVA 2XSBA 5C9ZA 4LUJA 2YYUA 1TCDA 4HHLA 2I5IA 3DH7A 2H3BA 2UY4A 1KB3A 1Q66A 4NX0A 5REQA 3QSTA 1FFRA 4D6DA 3VD7A 4ORMA 4MF4A 1I2QA 3EEZA 4O4WA 3ANUA 3SRDA 2OQLA 3NYZA 3GYCA 1R9YA 4GIRA 4IIHA 2XFYA 1JUKA 4OV4A 3WQ6A 4RE4A 4M0XA 5CPLA 1GTEA 5JQ9A 1B5TA 4AZCA 4AUBA 1FHDA 2F6XA 3R8GA 4MYAA 1OX4B 4LVFA 4GI9A 5CJMA 5CC3A 4W8AA 4QDMA 4J3VA 2GOKA 4DNMA 4XK2A 3PZ9A 1TZ9A 4ZCWA 3ZVHB 5FEPA 2QCNA 4HA0A 3WLLA 3TJLA 3KL5A 1OD8A 1OGSA 4MYXA 1V5XA 5C6MA 3G1VA 1N8WA 4QGCA 4NU7A 3AWOA 1I4NA 3GKAA 2B31A 3AHYA 4LWWA 4WSJA 1XC4A 3WUGA 3SFKA 3V7PA 4Y9PA 4R53A 4GNKB 2V5CA 2D73A 2IXVA 4YTRA 3ZSTA 1KM0A 4C91A 2A3CA 2NXIA 1CTNA 4KEUA 3RX2A 2HBVA 4CNOA 4H2HA 3GXMA 5C9UA 4QS6A 4QE5A 4GJIA 4UNIA 4Q8OA 3GY1A 4ZE5A 1D2KA 1QK2A 1YPXA 1L2UA 2VYOA 3WBEA 1GOOA 3TN3A 4GFSA 1A3XA 3T55A 3JU2A 2H8XA 3W74A 5A5WA 1OD0A 4XWUA 3BGGA 4PRRA 3WQFA 4J3SA 2ZXQA 1P0EA 3KW3A 4QE4A 3IAQA 2J9YA 3CPGA 4IF2A 4HNNA 4WSHA 4XD6A 5HANA 1WPCA 1EH9A 4WHBA 3KX6A 1V6YA 2B7QA 5BNKA 1OK4A 1PX3A 4MWAE 1VZWA 4Z2GA 4QDPA 3ID7A 1M9HA 4Z2LA 3GVVA 3BZGA 4PYSA 1S5WA 2I1OA 2ZA3A 4JY9A 3ITLA 2PF8A 3RPMA 1UWUA 3NL2A 1XIMA 1OFAA 4I5UA 1UYQA 3ZLHA 2FHFA 3MQTA 1HT6A 2C1IA 1HGYA 1ZQ5A 4DXXA 1UA7A 3UWWA 4CQBA 4P8UA 4JL2A 3E96A 1Q5MA 5XINA 3PJUA 7TIMA 2VCCA 3VIKA 3CMFA 4ZQPA 3AMLA 3G0UA 5IHRA 5EGRA 4DO7A 3V3WA 3OBEA 3QLLA 1GYLA 3BSHA 3LSCA 4L56A 4YYFA 1PVNA 1UD3A 4C6IA 3W7QA 2GFTA 4JBRA 3W75A 3KCLA 2OQHA 4YLWA 1ZCCA 3GDBA 4L5ZA 1J10A 3HB9A 3N2MA 4UQDA 4H1ZA 3MTWA 4MDPA 5HR7A 3LNMA 2Y5EA 3OEXA 5AKQA 1FWNA 2QUTA 4WOZA 2FFIA 3EX1A 2CKSA 3WH6A 3BLIA 3CZLA 2OO0A 1EGMA 1GVQA 1WAWA 3E2VA 4QJ3B 3VXGA 4C7FA 3G5EA 4XVDA 1ME7A 3C2RA 3LCFA 4TMCA 4J3TA 3THDA 2D1ZA 2CZ5A 4LNCA 3K8LA 3ANVA 2WSKA 2XDFA 3TONA 3TIMA 2E7FA 1KGXA 1XP3A 4ILSA 1R2TA 5BRQA 1JEZA 3K2GA 5E9AA 1S2UA 3S1GA 5BCAA 1UP2A 4MSSA 2FB3A 4GINA 1Z9AA 5KITA 2HBXA 1XJBA 2GVEA 7ENLA 3FA5A 3M4HA 3O06A 1NP0A 2HS6A 3P8JA 2HMCA 3B8IA 4MOZA 4IXXA 3R94A 3RLGA 4RDYA 3K4DA 1GEHA 2X30A 1N8FA 4HZ7A 2O4MA 2B7PA 3M5ZA 5CZJA 5A6TC 1UMYA 3E38A 3BLKA 1YLVA 4RZ6A 5F1UA 4B5WA 3MVIA 3S83A 4M5PA 2E68A 3VFCA 2GVYA 2F2KA 3RLHA 1NQ6A 3EB4A 1ZAJA 3LNPA 1VD6A 1E0XA 3FFSA 1JVNA 1XYMA 4LW7A 3T0CA 4R9OA 2Z1VA 1OCJA 3BSGA 4LT9A 3ARTA 4GH1A 4ZXOA 1BVNP 1SW3A 4POCA 1OT2A 3DKJA 5LXXA 3VDHA 3PPHA 3ZR5A 3B0VC 4DAFA 1XIIA 3L2LA 2CLIA 4I6KA 1YPFA 1OADA 1BFNA 1CXIA 2G41A 3NG3A 3WQ5A 3ERPA 3ARYA 3W1AA 4F9DA 2F9RA 2NV1A 3OBAA 2YJQA 5AY7A 2YIHA 4LUSB 5I02A 1FH8A 1EBGA 1XCXA 3M5XA 5GPRA 1Q85A 1UR0A 3GQYA 3GBDA 1T8QA 2QHAA 1FWHC 2PBOA 1M01A 2A21A 4I8YA 3MKVA 4TTGA 3ITYA 1MFUA 3MO4A 2Z26A 3DAQA 2XIIA 3WELA 3CUFA 2IKIA 4XSMA 5D32A 3RPDA 2HNEA 1WO2A 4HP5A 4D6FA 1E1CA 4JY8A 1OB0A 3RN6A 3QXBA 3H4XA 3PBMA 1JCXA 1SO5A 1CNVA 3W2JA 4E8GA 3ARXA 4U31A 2PPGA 2BG5A 4EVZA 4I9TA 4ZL1A 3H2OA 4NI3A 5G5IA 3I7QA 4LF2A 3A47A 1OIFA 3LI0A 2E8ZA 4UUIA 3LCXA 2ZVRA 1FY6A 1O68A 5E9XA 4H8VA 5CC5A 1NP2A 4O1BA 1RV8A 1BEUA 2CLMA 2ZDSA 1KCZA 3KCOA 4LSBA 2OKOA 4QITA 1F4AA 4JTFA 2J77A 1F6KA 4HN4A 2ZA2A 5IHSA 4JDBA 4QAWA 3E74A 3QC0A 2E4TA 3UR7A 4HHMA 2ZX7A 5DRCA 3PR2A 4IGNA 1MZRA 4IL0A 4YWIA 2OVLA 2VEFA 3UERA 1TWWA 3LERA 4BA0A 1Q6QA 1Z69A 3S5ZA 1NH6A 1JJKA 4RK8A 2Y1HA 4PL1A 3WEZA 3W53A 1LORA 2PDNA 3BOXA 3BG5A 2O56A 3QYQA 5A8OA 3VD9A 3KS5A 4RPPA 2WM0A 2G37A 3QV7A 2J7GA 3ZWSA 3HQPA 1GQJA 3TN6A 3WEOA 2ZWYA 4NHVA 4N02A 1L9WA 2W4XA 2X1UA 1XPYA 4OU1A 2V5DA 3SIMA 1NOUA 2XWDA 1POKA 2VZVA 4LC8A 4L6HA 4QROA 1EWEA 4P7RA 4RZBA 2DZBA 3BURA 2DQWA 3H8AA 2V67A 3I3BA 1B3ZA 3GXTA 2FHBA 4LB3A 3N15A 4AMCA 2WJDA 3WLPA 2TYSA 3LN3A 5FAJA 3CAQA 3AHXA 3FAXA 1Y8BA 4JTTA 3NCOA 1AQ0A 1QNVA 4F9JA 4E38A 3L65A 2B7OA 1IT0A 3BO9A 2VZUA 4IHCA 1UD5A 2VP8A 1H51A 4PCFA 1NOFA 4JDYA 4RKAA 4V33A 5F1VA 2H90A 3NEHA 3OA5A 4OUIA 2PDPA 3BAXA 1SFSA 1IZCA 4TXEA 1K9FA 3MWAA 2QKFA 4CN6A 2XUCA 2BHYA 2FTPA 4AWSA 3GZAA 4ML9A 4ZGYA 4I5XA 2IUZA 1F73A 1JYWA 4S2CA 5FJOA 5A2CA 3LCGA 2VGBA 4GYFA 3AYRA 1XR2A 1W1VA 3SQLA 2QCDB 5ABFB 1PIFA 4A6GA 4LYQA 4NAEA 2PDXA 2INEA 4Y9MA 2ASHA 3URQA 2HPIA 3D3FA 1IHIA 3H4WA 4H7ZA 3CJPA 4JIIX 2CWXA 1EYWA 3QPZA 4H9YA 1XPGA 1HL8A 4AD5A 1OVDA 3OG2A 4IJCA 1WOBA 2Y85A 3DFQA 3MHFA 4RDWA 2GDUA 1TPFA 2XZ9A 5A8QA 4HA1A 1UH3A 5HQLA 3XIMA 3R43A 5FKYA 3SURA 3G22A 3FJ4A 2XH7A 2VRKA 3B0YA 1XDMA 3OPSA 3D3AA 4XAPA 3WENA 3TXVA 1HKJA 4D1JA 1KRCC 3OJGA 1SQ7A 1UBSA 4H6KA 3W7JA 3P6LA 3VNZA 3T09A 4MFDA 4AXNA 1RPKA 1SU5A 1JZ5A 3O6YX 1IV8A 2QAPA 4QIUA 3WNLA 3N18A 3CL6A 3JZEA 2CNCA 3O05A 3ABZA 2ESCA 1LG1A 3H7RA 4QLLA 5AHIA 3P3BA 2A3LA 1JIBA 2BB0A 4ZFMA 2I7GA 1E6QM 4TO8A 4JIHA 2V3DA 4B16A 3BAJA 2BY1A 1BVZA 4R33A 5LIYX 3QFEA 1GHSA 1WYIA 2FJKA 3E0FA 4I3GA 2X1IA 1LQAA 3CWOX 5A2BA 3NSMA 1VCVA 4MWAB 2QUUA 4JKLA 2HTMA 4O0KA 3N3TA 4W85A 2PTXA 3K8KA 2GVJA 2PLJA 1H63A 1KGUA 5KMYA 1K03A 3O9NA 5BXSA 3KRUA 4G6CA 4MNJA 5AZ1A 4KQNA 3AYSA 3EA1A 1KXVA 2ACRA 3N4AA 3TQ0A 1P7TA 2CFFA 3SCRA 2VX7A 4HU8A 4C1NB 3GLCA 5EY5A 4MLRA 4PBEA 3S2CA 4NNAA 2D24A 1M1BA 2DIKA 4OE7A 2Y88A 2H3DA 3GSMA 4DO5A 5D33A 2Q71A 9XIAA 1IXPA 2PA6A 2GUYA 4S38A 5LA1A 4Q4OA 1AH0A 4O19A 2A3AA 4J2MA 3ZLGA 3LS9A 4AF0B 2DU2A 3ZJ6A 4JQ3A 3VOHA 4NASA 4I9AA 1KW1A 1E73M 1PL9A 1YPIA 1ECEA 4KWVA 2Y7GA 4URIA 3WQ4A 4R34A 2ZUUA 1EIXA 1MW2A 1SVDA 3WNNA 4I6VA 3KP0A 7PTDA 2DSZA 1MEIA 1X1ZA 3QGKC 2XINA 2J9XA 2EF9A 2WHKA 4MKVA 3CHVA 2OSXA 4FF7A 3W3OA 4RDVA 4GKLA 3EOOA 4XZLX 4LUYA 3CV7A 3W7EA 2R1LA 4QHRA 4L65A 4IPPA 1RQBA 2QJJA 2XVGA 4A3YA 3TYCA 3DECA 4GZ7A 4S3JA 2VC7A 1O66A 3SSJA 1W1TA 4MMWA 4QG8A 1RCXB 1W9UA 4US6A 3FYOA 3KS6A 1NDWA 2D23A 2E8YA 3VIJA 3GU1A 3ZOAA 1IWAA 1YNQA 2OT1A 8A3HA 1BWLA 1XINA 1VYPX 4JD4A 4R9XA 5F2GA 4EWJA 2V63A 4AZCB 4IMAA 3ARUA 4ECLA 2KZHA 3HGSA 5H6HA 3C86A 4H04A 4DZAA 3SCWA 3HG3A 4HKPA 3R5EA 4PMZA 2WSPA 5D8WA 3AS1A 3N12A 3COTA 3DBPA 3EXRA 4QEEA 2VJXA 1M65A 3LA4A 1DE5A 3L5MA 1B3XA 4GKTA 4JYEA 2NVAA 2PDYA 5CAHA 1QJWA 2ZZ2A 4S3FA 1KFKA 4IIBA 1JD7A 4OBTA 4X9SA 4FALA 3EGJA 1SW7A 1UUQA 2IXUA 1ITUA 2INFA 5D09A 3RM8A 3TYAA 4ZQOA 3PS7A 1VLWA 2XH2A 2HZGA 1AJ0A 4TMBA 3PY2A 4B5TA 2LLEA 3URAA 2QMKA 1UZDA 3AI0A 2HK1A 1TE1A 4PODA 5K9CA 4FOUA 1ADOA 5IRPA 5E1QA 4IP4A 4KKXA 4O0ZA 3WLOA 1PXGA 1HL9A 2PDIA 2JIEA 1SSDA 3EMZA 3GC4A 4GD0A 4RL3A 5D03A 2VTFA 1LG2A 1GKPA 1T96A 3PFRA 5T9CE 2J66A 3DDMA 2F6KA 2P88A 2A3EA 4GQ0A 3B8WA 3RGTA 4A8NA 1PKLA 5C8BB 1KLZA 1C7TA 3L4WA 2QV4A 3TJ4A 1TJRA 3TX9A 3GTIA 2ZZ1A 4ERAA 2XJ7A 1PWMA 4GG9A 3V0SA 1UD8A 4Q8UA 1OM0A 4JQ1A 4HZ6A 1Q7ZA 2DEPA 4KGJA 4J27A 1EOKA 3RM4A 1VFSA 1V6VA 3N17A 3VOGA 3P7YA 4YU1A 5AFDA 1XUUA 4J2PA 2YZ5A 5K2ZA 2ALDA 2BX7A 3OODA 5I78A 4NG3A 2YLAA 5D8ZA 1G6CA 1W9BM 2DZPA 3LX9A 3IVUA 2WSRA 2PGEA 3WJZA 4IFKA 1V77A 1EJTC 3EAUA 1BKHA 2OKTA 3D6NA 3OIXA 3NSNA 4CLMA 4Y9NA 3E2SA 4WKHA 4GE8A 2FZBA 1PCKA 3NQCA 3ZR6A 4L6DA 4FOKA 1PEZA 2J6XA 1DHPA 3CPUA 3EMCA 5G4EA 2YX0A 2ZX9A 3DC0A 3MMUA 3FW6A 3BDKA 1ITXA 3WZ0E 2SFPA 5AYZA 3ZJ7A 1OQFA 2X16A 3GYEA 2NT0A 5FF4A 1M7OA 1CZ1A 4LUTB 2ZADA 1MQPA 1OCBA 4M3PA 3MDUA 3PG8A 3MUCA 3VNIA 3OGSA 3WG6A 5LIXX 4FR1A 3OGRA 3NJ3A 3OOQA 3WJYA 2YXXA 1NTHA 5FAGA 3VDBA 1OFDA 3W25A 3ARWA 4Q8TA 1XFBA 2J79A 4X3ZA 2PGFA 3FK4A 4XSLA 4UOZA 5BZAA 3B05A 1TFVA 2INZA 3CLMA 3W73A 2CETA 1DXFA 1UOZA 3SEPA 1VEOA 3Q94A 2VQTA 1GHRA 1WE5A 4PBGA 2QIIA 4Z2IA 1HFBA 1J6PA 3PZGA 5GNYA 4AZGA 2ON3A 4HT3A 5XIAA 4O52A 1H7PA 2G3IA 2C8NA 4DXVA 4M80A 3F4CA 3QGVA 4HOXA 1C90A 2ATSA 2QVNA 4Y90A 3N04A 3I7SA 3OZMA 2W62A 3H22A 5CEWA 3F5JA 3BLLA 2HSAA 1H2JA 3AXIA 1RCQA 4WRHA 2DPEA 4UTWA 1AUSL 1XYLA 5FA5A 1X7FA 3TYZA 2XISA 3VUPA 2VT0A 4M56A 1W2VA 4O11A 1UD6A 1TJ1A 2GSJA 2QJIA 5LA2A 3ZFHA 4AWTA 3ZIZA 3MHUA 3KE0A 3M0HA 3ONCA 3NQAA 1GJUA 2FGLA 1UR3M 3U9IA 1JZ8A 5KZ6A 2VFEA 4X2RA 3MBFA 1JCYA 1LLZA 1Q6FA 1ZAIA 3UA4A 2OO6A 1QAPA 3VIFA 2W92A 2PSNA 2AQWA 1ICPA 1VB9A 4CNPA 2ZA1A 3IPWA 4AYSA 2C0AA 2BXYA 2JF7A 1LWHA 1MZHA 2DSUA 3ZZ1A 4GOAA 1OY0A 3B9NA 4NAFA 2NQHA 1VF8A 3OTRA 5HNRA 4Q4KA 1OFPA 4NNCA 3TNBA 1EOMA 2X0HA 1VHCA 5EMUA 1Z32X 3U7VA 5G2HA 1X8FA 3B9DA 3H7VA 5BMXA 3ARPA 1TSIA 1TYGA 3QJAA 6TIMA 1FBAA 1K70A 4FNPA 1XIBA 1A47A 3IGSA 3W7NA 5E93A 4JTQA 4PMJA 4WLCA 3TLQA 1E0TA 1GVEA 4MJ4A 4O17A 1PZ3A 1G9HA 2Z1XA 1MI3A 3NGFA 3BG9A 4AFYA 4V2XA 2WMKA 2YBUA 2HWGA 4BS0A 5LZLA 5I3KA 2C18A 1MWOA 1WDSA 3M07A 3AICA 2WNQA 3KOYA 4G8TA 1FH7A 1Q6GA 1ADDA 2WLZA 1JULA 3PULA 4DJDA 2Y7FA 1E56A 1UJPA 2FHCA 2Y70A 3A64A 3V0UA 4GQRA 4FNQA 3UWEA 2H9AB 3AXMA 3LZ5A 1F07A 1NOWA 1EGVA 3G1RA 4DM2A 1W0MA 3ATZA 1CGWA 5CPOA 4ZQRA 3CYJA 1WXYA 2AKMA 1E72M 1X1NA 3SJ3A 4HSOA 5BXRA 2QDHA 4L4OA 1AQFA 3VDGA 4OTKA 2C6QA 3I7RA 1QOPA 1FA2A 4US5A 1LWIA 4GUGA 5I2UA 4KETA 5C71A 2VC5A 1S1RA 2WPBA 4I7UA 1PIGA 4RZ4A 5A6LA 4GZJA 3NOEA 5HWJA 4Q33A 3PNZA 4CD8A 2OZ0A 2RGMA 4GZEA 4OECA 3LHWA 1V3HA 4H9UA 2WMJA 2PWUA 1NWSA 1PTGA 4H9XA 4FA3A 3NWRA 3SSZA 4GY1A 1EA0A 4GRSA 3IJ8A 3WLRA 4CCZA 3JS3A 4XD4A 1S5TA 2GQ9A 2RJHA 4DJFA 1RSCA 1ZFJA 3PJTA 1Q2SA 1RAKA 1GK8A 4E5TA 1YRRA 3W2MA 4ZO9A 2PFHA 5K9XA 3BMVA 2V9DA 3M64A 1ZHAA 3TW9A 2NQ5A 2FQIA 1V0LA 2YDAA 3T6CA 4DB7A 2PP0A 1W1ZA 3NM1A 4JN8A 1TUFA 1A5MC 4C7GA 2OTDA 4A29A 3KEHA 1OX4A 2EG8A 3PZNA 4S3GA 3EOLA 4R5EA 2RDTA 3RPTA 2E6YA 4JFUA 3VI2A 1S5VA 1IEXA 5A6BD 3IIOA 5F4SA 4QEHA 2GGGA 1T7LA 1P5BA 3HJEA 4H2CA 3AUJA 4AZBA 4AZ5A 2VX4A 3QTGA 3HPFA 2R9RA 4MGGA 4ZVJA 2Q8XA 2YLLA 3CAVA 2WCSA 4LS2A 2PMQA 3E6EA 3FSUA 2C13A 3A24A 4LV9A 2BDQA 2L5HA 1O5QA 2X09A 3SUWA 3KLKA 1DIKA 3UZWA 3SQSA 1NAL1 2IQ0A 2XH0A 1TIMA 2VGGA 4MJZA 2DH3A 3A3WA 3FHQA 2Y89A 4ML4A 1VFOA 5C9RA 3L66A 2H6RA 2YR1A 4LH8A 1NELA 3SGGA 1A4LA 1I1WA 1OF6A 5IDIA 1GVRA 3A9BA 4OBRA 4XD5A 1QWKA 3DFSA 5U4NA 2GVLA 1EL3A 4ZEPA 1Q3NA 2Z7KA 3MSRA 1K6AA 3C2VA 3CQIA 5E0CA 2PS2A 1PTDA 1MDLA 1TPWA 4GI8A 4PZVA 4ONVA 4KRZA 2XZ7A 1H1NA 4DWSC 4WVXA 1V6WA 1F4HA 5IM51 3UWVA 4GMEA 4B5SA 5E6ZA 1THFD 1R3VA 2VOMA 3AYVA 1FDJA 4GGHA 1QFEA 3H12A 1TV7A 3SGUA 1IT7A 3OVRA 4K39A 1D8CA 2WPGA 3C2EA 5KZMA 1J12A 2XSAA 3L5LA 4GY0A 4HB7A 3LD5A 1JYXA 2Q8ZA 1LBFA 4Q7IA 3W00A 5ECVA 4YCOA 2BGQA 2C0HA 4F48A 1FHUA 1ZLPA 3GW3A 1BYBA 5A2AA 3RCYA 3AMGA 5LGXA 3STEA 2IQDA 2AAMA 3W83A 1FKXA 4GVIA 4TUFA 4MTVA 4UTHA 3TTEA 3W71A 2VMFA 3M0JA 3IJDA 1VJZA 3KBMA 4HYRA 3KDNA 5C70A 2VX6A 1YQ2A 1BYAA 3VKDA 1JZ2A 1K8XA 3VC5A 4WZHA 1FHVA 1FCBA 3U2ZA 5LKYA 3TP4A 2QLYA 3EKZA 1SZEA 4JFSA 2O55A 1SJDA 3N19B 2E09A 4AZ6A 2JEQA 1AA1B 1E9IA 3CIWA 5T91A 4D72A 1P0KA 3WD3A 1VBRA 4HSHA 2F38A 1TVNA 2HXUA 3UWZA 1I9CB 4IIDA 3FAWA 2E6FA 4MNMA 2NUYA 2Z0IA 1GJWA 1QW9A 1VJSA 2A6LA 1JRBA 1E1CB 3AROA 3R6IA 2YKKA 2TRSA 1WAUA 4LPCA 1V3IA 1OC5A 3SRKA 4EPDC 3B8VA 3EYPA 3LXAA 3IJ9A 3N13A 3H70A 3TR9A 5CBIA 2BSLA 1TV5A 1QI2A 4ZTXA 1L6GA 3SIZA 1ME9A 3BLFA 2XIOA 2FTWA 3DYOA 3UR2A 1YIXA 2YBVA 2OSYA 2V69A 3MMDA 4FLOA 3EA2A 4KPLA 4XX6A 4B90A 1QPQA 2E1DA 1W9VA 1ECQA 3QR3A 1TJ2A 4TVUA 5H2ZA 5BW6A 3LPFA 4Y2WA 3WQDA 3SGZA 4Z1DA 2V2HA 3MI3A 4CVWA 1RH9A 4QAIA 1JNEA 1IZKA 1L2QA 4O1AA 1W5QA 3VIOA 4DAIA 1CECA 1WUFA 3WDPP 4MY8A 1CGYA 1M6JA 2IQTA 1K6WA 5I00A 3BH4A 1GT8A 3CASA 1R3SA 4H83A 4S3KA 3A3XA 2PWGA 3HPXA 2J7HA 2NXGA 4XZ9A 4EIVA 4UC5A 4UTIA 4NT0A 4BQ3A 1EP2A 4AEOA 3UZYA 2P76A 4IMEA 5DRIA 5C9XA 4Z17A 1QR7A 2A2IA 1GJPA 1NDVA 3OBKA 4QE1A 4BI6A 1UCWA 3EDDA 3G6MA 3N4EA 1O60A 1I45A 1R5YA 1SM9A 1M7JA 2R1PA 3O15A 3R0UA 3OIHA 4UQCA 5L6UA 4JIQA 2GPTA 3VTRA 3FA3A 1OABA 4QJ1A 4KWSA 3LRKA 3VIIA 2XN2A 4WK9A 3W7LA 4CNTA 3WO8A 4AC1X 1JCLA 1EUNA 5HWNA 3UR8A 1RVGA 1VKFA 3MZ2A 3H24A 4LVDA 4KH2A 1SZFA 1Q13A 3ABSA 3ME3A 4BQ4A 1W9XA 1V79A 1W3TA 1C29A 3M43A 3K1DA 3NL5A 3OYXA 2GQ3A 1W1A1 2DIJA 4L61A 4LCRA 1E4IA 4H8NA 1QASA 5I7GA 3P74A 4N6FA 1FWAC 4L4PA 3OHIA 4QG9A 4PB4A 4S23A 4EAMA 1V0MA 1GZJA 2QCDA 1Z89A 2XTKA 4UMCA 4ZE4A 3VO0A 4HYVA 4MIMA 1OEPA 1B3OA 4JTHA 2E3ZA 1RA5A 3WK2A 3S9ZA 3D46A 3MUXA 4DELA 4R3UA 2DUZA 3K5XA 4PUKA 3DU0A 5SWUA 4UFMA 5CKSA 3UF9A 2VEIA 4UBPC 2ZUVA 2NV2A 5CQ1A 5DXXA 5FJUA 3S6DA 1HX0A 1A5BA 3PJWA 1S2VA 4U4MA 1GQNA 1REQB 4IM4A 3G24A 1WZLA 6ALDA 1NARA 2PDQA 1LT7A 1XGDA 1P1MA 3W7MA 4HNUA 2ZICA 1KCLA 3OQ8A 2GGIA 4KEZA 4NNBA 3NYDA 4KWUA 4UFLA 1TZ7A 4PMDA 4TX8A 5M1TA 2CLOA 1F6YA 1JNDA 3HTWA 4MDOA 3J7HA 4FXJA 1MUWA 3MDWA 3HG4A 3MA8A 4P7NA 3SCTA 1HJWA 4GNJA 3NA8A 3AU6A 1GVYA 3UP8A 4QXIA 1MW3A 3G1HA 3FJLA 3CEPA 1XH0A 1W17A 2X1SA 3BQ5A 4YXGA 2QQ6A 1LRTA 1FH9A 3GHUA 4DLFA 1V7AA 4LBUA 5F4XA 2OCZA 1P4CA 4OHQA 1QO5A 1GZGA 5AN7A 1DEDA 1HXJA 1QI0A 2NVCA 1KFJA 1HJXA 3HQNA 4IJRA 3GG0A 1X98A 4N4QA 1OF8A 2RGLA 1GVOA 4CNSA 2R6OA 4JAWA 2EAWA 1QI3A 4IIEA 3U7BA 3AFBA 1DYSA 2IW0A 2TAAA 3MC5A 3AHTA 1FWJC 1X96A 5GVJA 5CGTA 3ELFA 2OX1A 1XQKA 4AD1A 2C16A 3XISA 2DZAA 5I3FA 2V3GA 5M2FX 1DJIA 1LTDA 2CHNA 4WJEA 1BQGA 4XTIA 5CG0A 2WHLA 3TDFA 1WCGA 3W7PA 2A3HA 2O9OA 3WD2A 3F4VA 1F7BA 5TNVA 1LROA 4HZ8A 3WJXA 2WMHA 3T4WA 2E25A 2HVOA 4JXCA 1W5PA 3CHCA 3ALFA 3CWHA 3GWQA 1XXXA 1AJZA 3PPGA 1LM1A 3S9IA 5ENLA 4XKYA 3CUGA 5DO8A 3UZXA 5FCZA 1C8QA 3I4EA 4YVPA 5DF0A 2PCEA 2D0FA 1MW1A 4GQBA 4HHPA 3V1HA 1PCWA 4PTMA 1HVXA 2Y7DA 1RUSA 2YL6A 5I3DA 2G95A 3QY6A 3BCFA 1K8YA 2JE8A 5CSYA 3UXLA 2PRMA 2I9UA 3R13A 3FEMA 4B5XA 1B54A 2PTDA 4N7QA 1RR2A 1XSIA 4JNYA 3GIQA 2ZC8A 1PKYA 2OU4A 1V6TA 5RUBA 4J40A 4UTWC 5HUOA 1OC6A 4XBSA 1DWIM 3IGUA 2Y62A 4XO7A 5BOFA 3I3EA 1VPXA 3LRLA 3W1TA 2G3MA 1EIBA 3E3HA 2BOFX 1KFBA 3EOSA 2PDFA 3VCCA 3SN1A 4MZ8A 4PUEA 4GPNA 4RW5A 1F76A 1FHLA 3LM7A 2OSWA 1V51A 2GZXA 4BEUA 3CIVA 3R12A 3BCDA 1QI4A 3P5YA 1P7TB 2G4JA 3PSWA 4WKFA 4QJ5B 4AQLA 4C1KA 1A5OC 2QUVA 3H23A 2Z1KA 4LB4A 2G0WA 4D6JA 2G96A 1V7YA 1DQUA 3VGFA 3HZ3A 3DFHA 3F03K 4MPKA 2EKGA 1GOIA 1ZU8A 5HMSA 4FMVA 4Q8PA 2C71A 1YYAA 1LYXA 4AIOA 2WMIA 3GTFA 1DJNA 4R85A 1DXIA 2YBTA 1AH4A 3WK0A 1E3XA 3UYIA 1Q6OA 1J01A 2FPYA 2NV9A 1XLAA 4O1CA 5FJRA 3M0KA 1H7OA 3W7HA 1BF6A 1E71M 1DV7A 2QGHA 3B9EA 1VPQA 4O0QA 4A4AA 1L8NA 3HMJG 1TG7A 4HJFA 4N4PA 4JCMA 2J62A 1MRAA 2OR2A 1V3KA 2AL2B 5J5RA 2RUSA 5HWMA 3LPOA 3IS4A 3S6OA 3JRKA 3R0DA 4W8BA 3BCJA 3KDOA 3EOUA 5D2XA 1VFUA 1GOMA 4TQTA 3CHEA 4QCEA 4QFUA 3ITVA 2I9EA 1Q6DA 1F8IA 4L64A 1QVBA 4NJJA 1KBBA 2YA0A 3D47A 4AZIA 2J4GA 4ZO7A 1KLYA 1SZGA 1EA9C 3M9YA 1HN1A 3ARRA 4E2OA 2XIQA 2PB1A 2V2DA 3A23A 3W7DA 3WF4A 2VFGA 4BQ5A 1HVQA 1VRDA 2FH6A 4GI4A 3P0WA 7CGTA 3VZZA 4EX4A 1R3YA 2BVTA 2OLHA 2DVTA 4H6EA 1GWJA 5A6KA 3E0LA 3NZQA 2V2CA 5FJJA 3NXFA 2GWNA 3CAWA 2ISVA 1RXOB 1J9YA 4DI8A 2P0IA 3P5ZA 1IXQA 1EGZA 3PG9A 3UJ2A 5CBBA 2ALRA 4FLRA 1E9ZB 3WFZA 4MKNA 4XAZA 5DT7A 1X1OA 2HE8A 2JK2A 3THAA 2CLPA 4IP5A 5J8LA 1BQCA 2D0HA 2YCJA 2PTZA 3WH5A 1WQ5A 1XLMA 4GACA 1D9EA 1HKVA 5H8PA 1XLDA 1TRIA 3MHGA 1Q6EA 3PZMA 1POJA 2OEJA 4GC3A 5CH9A 4JHOA 3N9KA 1B1YA 4JTIA 1AW1A 4IQEA 2RDXA 4Y9OA 4TV6A 2FTYA 4M24A 4DIAA 2XU2A 5I6SA 3M41A 3GIPA 5CZTA 3FEQA 3WH7A 1MO0A 3BSMA 2GJXB 2HISA 4MB5A 2PD5A 1TMHA 4XKYB 3OQEA 4W93A 1E6RA 1QI5A 4Z1YA 3LTYA 5HK4A 5F7UA 4D6HA 1HKIA 3SR7A 1XI3A 3I6EA 4HOWA 4WXYA 3E0VA 4ZOBA 1PV8A 3M0XA 1A80A 2Z1WA 1JGMA 6XIMA 2VEPA 3NPVA 1V02E 1WA3A 4L1XA 4OBSA 1RA0A 4WD0A 3U0HA 4WIWA 3NQVA 4GJ1A 3URNA 2YPIA 4WXZA 1W54A 2P3EA 4W87A 3R8HA 5D9PA 3DIPA 3W6MA 4NQ1A 3K1GA 1SMDA 4ZOAA 1Q4WA 1DTNA 3AZSA 3CMGA 2NVDA 4GYJA 1UR8A 1KA9F 4ASTA 4JX5A 1TZZA 3RMJA 4Z1CA 1LQ0A 4V15A 1E4LA 1LRNA 2NX1A 5M03A 3EXSA 1EZWA 3W7OA 4EP8C 4JR5A 3PFMA 1P43A 1JDDA 4UQBA 3GVGA 4QBXA 1HJUA 4H4IA 2TSYA 1SFJA 3EX2A 1E3ZA 2I5GA 1UWTA 8XIAA 3PC0A 1KGWA 1TB3A 3GG7A 2YA2A 2PRLA 4N2YA 3NQ2A 5FD0A 3REQA 4L9XA 4KFPA 3PPFA 4IFRA 1EJUC 4E6MA 3O2LA 4QSHA 4ZZ9A 2W9MA 3Q37A 3LHZA 4JTRA 4ZQNA 4MFEA 3CZ8A 2EQDA 4F66A 1OFRA 1IIHA 1R30A 3GG1A 2XGIA 3M7WA 5D4YA 2J7EA 4HMNA 2YXOA 3EPOA 4Z2JA 3TQKA 3N2BA 4ICNA 3UXAA 3PTMA 4D6GA 5EPDA 4KERA 2VFHA 3TAKA 2ZUMA 4KESA 3G3DA 1K9DA 2XN1A 3C0QA 3IK4A 2GSEA 4JQAA 4JX4A 3MMWA 2CITA 5JH2A 1GKQA 1ICQA 3MCMA 3WDHA 1BSLA 4L9YA 1TPB1 4K1GA 5FF7A 2EEXA 3KRZA 3UGRA 3NQDA 1NU5A 5FJTA 3TW6A 2GDQA 2WYSA 1XLHA 2OLSA 4LBRA 1IIGA 1HL2A 2NLIA 3FN9A 4P2VA 1HTIA 1F9CA 1W8GA 4LEFA 1LOSA 4HCDA 3WYZA 3AJXA 3NDOA 1B3VA 1UKSA 3H55A 2Z24A 3TVAA 2WV8A 4ROQA 3CAKA 3WDRA 3RNDA 4L7ZA 2E5BA 4AY1A 4IGHA 5LIWX 4GXPA 3IJIA 5CPQA 1AZ2A 3QMSA 4JTJA 3F4WA 1JZ6A 1QO2A 4GGBA 5EU9A 2TPSA 2DSWA 2YCLB 3S42A 3HOJA 1KQYA 1RQEA 1YW1A 3P67A 4RE2A 4QG6A 1HP5A 1TWDA 4WY0A 2WQPA 2Z25A 3FOKA 3EWBX 3VGHA 2WZTA 3RO8A 4XZMX 4JGDA 3P60A 1QNOA 3MCOA 3WDJA 1EJ7L 2Z2UA 3U2CA 1KV5A 3RMEA 5C0QA 3M0IA 2OGYA 1UHVA 4YL2A 5BWAA 2WNNA 4RE0A 3PZVA 5I09A 5AC5A 3KXQA 3Q67A 1R86A 1CGVA 4ZR8A 4PRTA 4OT7A 4N9DA 1GGOA 4N9BA 1V8EA 5CGMA 1DXEA 2FB2A 5JIWA 3QKEA 3GZ3A 1GORA 5A1AA 4DO4A 4H3DA 4R7WA 3CUJA 1H1ZA 2YDQA 4CD4A 4L80A 1GW9A 3L4ZA 4A8LA 4HPJA 3GC5A 3RIKA 4XIAA 3ZJKA 3BMXA 4DUXA 2W5FA 1DQXA 2VVSA 2F8QA 2Q09A 2F6UA 3SI9A 4JTKA 3UXDA 2V68A 1FX6A 3DGRA 4YWSA 3T07A 4QQ3A 3GB6A 1X39A 1D7KA 3CWNA 4X61A 3SCQA 3SN0A 3OVQA 1MXSA 4AZHA 3PZIA 3W7CA 1PTAA 4XZIA 3WY1A 2WB5A 4LUIA 3UG3A 2DGAA 3QSRA 1HKKA 3BTNA 3LQLA 3KRBA 4B5UA 4CVUA 5DT5A 4DHGA 3HPSA 1OX5A 1JZ3A 3TV8A 3S6TA 1XSKA 3FGCA 1SFTA 1R0MA 5I07A 4PR4A 3NZGA 3W6YA 2P3ZA 3LGGA 1UWRA 1RALA 1WBHA 1HJVA 4NJHA 3UJRA 3H4GA 9CGTA 1H62A 1M7PA 3W7RA 3URBA 2GQ8A 3W2NA 2XG9A 2JKAA 2Y0FA 2OMAA 3T40A 1A5SA 4LANA 1DWFM 4O57A 2HPMA 1JXKA 4D6IA 4DO6A 1PIIA 1PE1A 2XYLA 4K1WA 4UNLA 3CUHA 2EJ1A 2DT1A 2VD9A 5G2WA 2UV8G 3LCIA 4W9TA 2WNWA 4YMZA 1B4EA 4UCFA 3GXIA 4PMXA 3CTLA 3RO6A 3S2LA 1OFEA 4WX2A 3XINA 1HZYA 4Q4RA 1F3TA 3DFYA 4W5ZA 2WAGA 5C2CA 3N29A 4ZMGA 2PDLA 1EHAA 1K77A 1XLEA 1TQJA 4H9VA 4A3QA 4LUSA 2JKPA 4WDTA 1NIUA 1M3UA 1HKWA 1VBJA 4DBSA 3W84A 3AXXA 1UUMA 3VNDA 2I57A 2VR2A 1BG9A 4Q7BA 3KBVA 1CT5A 5JH1A 1WZKA 1N8IA 3SB0A 4LEQA 3TMLA 1XIJA 1TVLA 3GAKA 4C65A 4ZB2A 5D9OA 1MSSA 3EZ4A 4GVGA 1MXGA 1FOBA 2JF6A 5REQB 4FX7A 3W1RA 3O6AA 3FSTA 2W79A 3UNTA 3FV9A 1C8VA 4PEEA 5H8UA 3MCNA 3TYBA 2XFFA 1H50A 3OZPA 4LYPA 2AAAA 1VENA 5H91A 3LMZA 4PCSA 1S38A 3QY8A 2OZ8A 2QDEA 1CXFA 2RKXA 2V8ZA 4G7FA 5FL1A 1JDEA 1WOAA 2V5BA 4K36A 2E9MA 1U2YA 3WF2A 1HGWA 3UW6A 3MS8A 1G0CA 3KOZA 4GYPC 2WMGA 1EKOA 1ISZA 5I3HA 3IUDA 2NSXA 3W2UA 3SUTA 3FHAA 4BEQA 3GXDA 4AY7A 1W91A 1G94A 4IPJA 4EXAA 3T8QA 1W1PA 5E70A 1TPDA 3C52A 2YCKX 2BXVA 1B0IA 3DI0A 5HXMA 4IX2A 4LTSA 1C8YA 3F1QA 4TOQA 3ARZA 4PMQA 3IJ7A 3W01A 4BCEA 5LNWA 1TTJA 3BUVA 1VP5A 3S1VA 4GY7A 2QXWA 4K8EA 2EPMX 2A79A 3LHVA 3MSDA 3A21A 3HM7A 3HF3A 3SQMA 3OA3A 3LHTA 1K3UA 4PMRA 3B8UA 4K68A 1BRLA 3A9IA 3TSDA 3WD0A 2QJGA 3W0KA 1J2BA 5HJLA 4BJHA 5AHMA 2X2YA 3C6CA 5E0FA 4FB7A 1TA3B 3NM3A 2GUUA 1XWYA 5FJIA 3ZS4A 1NVMA 2VDHA 4QISA 1ODUA 3NOYA 5MKGB 5A3HA 1WV2A 3HV8A 7A3HA 3LXCA 4IGMA 5FEZA 5D9NA 3WQOA 3TUUA 2OELA 1SMAA 4JYDA 4XZHA 5I06A 5CSSA 2YL9A 2B7NA 3RCNA 4PCNA 5HAOA 3M6DA 2YL5A 5AHLA 3ARSA 1J0YA 3CXOA 4HYWA 5A8NA 1E9LA 5CLWA 1MUMA 7XIMA 2DZUA 4JYFA 3PNUA 3GNPA 5KINA 3TROA 5B7ZA 2HS8A 2VC6A 5DX7A 4IG2B 4OV9A 4B5VA 1WDQA 2Z4GA 1A5LC 3O6DA 3SJNA 3BAIA 3T7VA 4IXHA 3VM7A 4AHPA 2QF7A 2E5DA 2AQOA 1QWGA 2MUCA 1XBZA 1VGAA 2ZUTA 3RDKA 2DIEA 5T9BG 5A6BA 4NXSA 4GIEA 4AIEA 2X8RA 4FNRA 4KF1A 4X0NA 4FI4A 3L68A 3K13A 5DY3A 4V1YA 1EXPA 3MWCA 3VD4A 4OOZA 1XYAA 6REQA 4ZSUA 4DRSA 5EFDA 1EPXA 5CPTA 1YTKA 3IARA 1KTNA 5HA7A 1I1XA 3FIGA 5KZEA 3WDIA 2YCEA 5BROA 3G1YA 1HJSA 5LHFA 2DH2A 7TAAA 3M47A 1EEPA 3KTCA 3NZRA 1DJGA 4DZ5A 2BMBA 1P6WA 2QYGA 1E4MM 2YZRA 1J5SA 4IMDA 2DW7A 4PMVA 1PUDA 3KWSA 3SY8A 3UZJA 1NDZA 5DMMA 2DJXA 4ZFCA 4IT1A 3QV8A 1TCMA 3DYMA 1V6UA 5BU6A 3CQ0A 1ZBKA 3ECQA 2PWFA 2WLYA 5CZKA 4DI9A 1S46A 3QQ0A 2IPFA 3AU2A 3WLMA 4ATLA 2REQB 2ZZ4A 3JZUA 1NEYA 2GUBA 2WSQA 4DF1A 3QLDA 1YDYA 5D02A 4XVEA 2E9BA 3FLUA 2WVTA 3ZWTA 3QH2A 4MKSA 3DBNA 4A2RA 4F0MA 5FF0A 5A8PA 4JCLA 4ENLA 1OZQA 1H7WA 3PBVA 4BKNA 4Z08A 1QNPA 1B4KA 1DJWA 3WLJA 1EF2A 3KCJA 3SFWA 4RE3A 1C8XA 1FWIC 1QNRA 5CJ5A 2FVLA 3REQB 1WZAA 2CKRA 3GM8A 2ZRUA 3SRFA 3TSBA 5AVNA 4B2DD 4K38A 1MXDA 2YXGA 4FAMA 5CGQA 3WSUA 4P8XA 1QATA 3DOPA 2PP1A 1F61A 1UWIA 3CEUA 3TAOA 3DKLA 1GG0A 1FQ0A 4AF0A 4ROPA 1B57A 4GNVA 4ERIA 4LC6A 4GX8A 2BOGX 5DN1A 4S3AA 1DHKA 1P0NA 4HMDA 4HU0A 3FS2A 4PMNA 3VE7A 1VYSX 4W88A 1DJZA 1S2CA 2GSHA 2V5LA 3L0GA 2X41A 2PGRA 1W9PA 2ZTKA 1ITQA 7REQB 5H1WA 3PJXA 4NZFA 4CEUC 2HEJA 2E1WA 2XFRA 3VCNA 4B3KA 1O1ZA 3WH8A 4KT2A 5HOSA 2EPKX 2Y8VA 1C9WA 3GUWA 4TX6A 4EK7A 4ACZB 4DWDA 1FWTA 2VCAA 1DE6A 4BF5A 4U2YA 3QPYA 3FVMA 2EG6A 3FYPA 3V5CA 4FNTA 2RH9A 4LVGA 5EBUA 3T05A 2QCCA 2J27A 2ZXBA 4O28A 3QMTA 4HK6A 2DUXA 2EHHA 1JCMP 3OZYA 3Q4DA 3F2DA 2ZZ5A 3MU7A 4O16A 2ZRXA 3IK2A 2ZRWA 3V75A 4UTLA 1O5KA 2QJMA 4YN5A 1ZTVA 3QZAA 4BFAA 1W9DM 4O8AA 1JDAA 5D37A 4X60A 5FEWA 4J35A 5U7SA 4PRWA 3PTDA 3UESA 4CGTA 2ZTJA 3T2OA 1EBHA 1PPIA 5IDZA 3AS3A 3GU2A 3F5LA 4B92A 2YGYA 2ANUA 1KM4A 1W6TA 3FDGA 1OG6A 1FKWA 1TX0A 4DN1A 2CPUA 1LL6A 3M0LA 1QNQA 3LY0A 1RK6A 1BAGA 1QPRA 4IJBA 2CU0A 4ZO8A 1HQTA 1TPC1 3AWNA 2E9LA 3GFZA 2KX9A 2HVMA 4Q7NA 3N6HA 4CKQA 2ISDA 2Z1BA 3LK6A 4JNZA 3F5KA 3TH6A 2PCQA 5HMEA 3PK7A 4XUYA 2HROA 2ISWA 3C2YA 2VZTA 3KHJA 2CEQA 4RJEA 4F4RA 2G3NA 3W7GA 4JEQA 4AYGA 4A8IA 3GG8A 5HNTA 1SJCA 3GH4A 1V3MA 1EXBA 4Q4QA 3DFPA 1PX4A 2EJAA 4YNGA 3NGJA 3FJNA 3EDFA 3G8EA 1V0KA 3TEVA 1M41A 1BG4A 4PB3A 3CQJA 2REQA 3EWDA 3BG3A 5D38A 1LL7A 4CU6A 4B9YA 1VCGA 3VNLA 5AYYA 4AVNA 3NURA 1IR2A 1DJXA 2PWVA 2DQXA 1Z41A 3EKGA 2ZRYA 4CNUA 1D3HA 2VR4A 1JRCA 3GHTA 2VDIA 1TPEA 1US3A 4DZIA 5KEZA 4S3BA 1N55A 4WOQA 3ENLA 1TJPA 1X7IA 2VRJA 4Y96A 4DYEA 1TIWA 3W1QA 3ZVIA 4RX0A 3LCWA 1CEOA 1KBJA 3RF9A 3VCRA 4Q8NA 1FXPA 3NSXA 4DPPA 1SZRA 5M3WA 1IGWA 1CGTA 3KVMA 4UTMA 2NQJA 3W86A 4GBDA 3NDZA 4FZIA 4S3CA 4HNCA 2BS9A 4JIEA 2NQLA 4KWWA 1EB3A 3VKKA 2XIJA 3QC3A 3WF0A 1XM3A 4PL2A 2XH4A 3VFLA 1P1XA 4JTCA 3HA1A 4H9ZA 1EEXA 4UFJA 5AYIA 1BGGA 2V6AA 4CN4A 2R24A 1HF6A 1EQPA 3F4DA 5HULA 2FMOA 1FDZA 3RAOA 3ZMRA 3TR2A 4KCVA 3LHUA 2X40A 3BLEA 2NX3A 4GUIA 4RXGA 3S2NA 1V08A 3IRDA 4H01A 4RNJA 1DWAM 5CLTA 2QULA 1E5NA 1XIHA 1OYCA 4A3HA 5G2IA 2BNJA 1Y65A 5I03A 2JKEA 2XVPA 1ZL1A 2A0NA 4AX6A 1RLDA 1EP1A 2VNCA 4C90A 3PBUA 1PHQA 3LBCA 2FLIA 3M0ZA 3M6YA 3A4XA 4Z2HA 1GOWA 4EACA 3ZVHA 3N2OA 3ZLFA 5G1YA 3AIUA 4Q4PA 4P7LA 4UR9A 1P6BA 5CZSA 3TCEA 3QW4B 1KM5A 3TXZA 5J5DA 2PC4A 4EPKA 5EMKA 1M5WA 2GL5A 4LBSA 1VR6A 3CK5A 4XBJA 1VBHA 4QM1A 3TYUA 2IPGA 2WO5A 1UD2A 3TU9A 3CBWA 5BMWA 1XHGA 5DEZA 4UR7A 1QT1A 1CW2A 1YADA 6ENLA 3CUZA 4DJEA 1JF5A 3EDEA 1UR2A 3RRAA 3H2EA 1UZHA 3HGJA 3GH7A 3BLOA 2PLKA 4WUIA 3G2GA 3R79A 4RZ5A 5M17A 1FWFC 2PDHA 1DIDA 1LCOA 5A6SA 1UW9A 3EBVA 1KBLA 2CLEA 1QTWA 4A05A 4E4PA 1B2YA 4AW7A 3L0NA 2A7PA 4BI7A 2VGIA 1TTQA 1CB2A 1VBGA 2BVDA 3QYSA 1ELSA 2XN0A 3CPRA 3RR4A 2PTWA 3WNOA 3TJIA 2NWSA 3N6QA 3GRIA 3GR8A 1QUMA 3GFXA 2EPOA 2WKLA 2VO5A 2PE4A 2V3EA 2C79A 1A0DA 3T44A 4B91A 3NR0A 2IKHA 3BANA 4AD0A 3LM3A 4AB4A 4MNKA 2Z28A 2G4FA 5G4WA 1YXYA 6XIAA 1T99A 2RHGA 3RUBL 4Y9AA 1JG9A 2NZLA 1ZNNA 3OLGA 3QHOA 1XCWA 1NFGA 1GEQA 4GXWA 3W23A 1JR1A 3IVTA 2QAFA 2QCGA 2VM8A 3GO2A 1A53A 3FVDA 2CZEA 4Q4SA 4JL1A 4GUHA 1W37A 4V1XA 1ONWA 1YTDA 3HURA 4C1NA 4QS5A 4NZJA 2D2OA 5DMLA 5IXEA 1IZJA 5T8GA 3UVIA 3AIQA 5BOEA 2BGSA 2ZXDA 1Z44A 1WP6A 2PDWA 3GDLA 3NO5A 1FCQA 1M04A 3GDRA 3MUY1 1J18A 4DY1A 5MKGA 1TWSA 3U48A 5AB3A 3LSBA 1DORA 1M68A 3AISA 2XVLA 1DTUA 1HO1A 2NSOA 1WKEA 2CCRA 4D8ZA 1LT8A 1NWUA 1OFBA 3KBJA 3EB2A 3LGDA 4LYKA 2WVVA 4DPQA 4M6VA 4YPJA 2CLFA 2CBUA 4PEKA 1YDOA 3UG4A 3AMCA 1JYVA 4PGLA 3LI1A 2VOTA 4HN8A 1GCYA 1W3NA 1PKNA 2DT2A 4LCQA 1LRQA 3PN8A 1XDLA 3S1WA 4I7VA 3B8DA 2D2HA 1UOKA 3VMNA 1A5UA 1HJQA 4BQ2A 1Z7AA 2FH8A 1U1UA 3NQFA 1I75A 2P1FA 2X42A 4AH7A 3I6RA 1E55A 3SBFA 2MANA 4ZB5A 5AYXA 4UNKA 1MMFA 3ARVA 1AK5A 1ZAHA 3NZPA 3OW1A 3SY5A 2C19A 2HNHA 2Z2AA 4X63A 1J0IA 4B3ZA 3AXHA 4GWEA 1OX6A 3VM5A 1WBJA 3FCPA 2DUAA 3C2OA 1ZJHA 3MP5A 4WJ8A 2W0UA 4OGZA 4F79A 1FP8A 3KLLA 4LU0A 1SPQA 3M0MA 4HPNA 3THCA 4G7EA 4LY8A 3IRSA 1MVYA 2AMXA 1U33A 5HQMA 3LCHA 3OZOA 4A22A 4DJFC 1OGBA 1GYMA 4LCSA 4YYCA 1D3GA 3G6LA 3JUGA 1O5RA 2DORA 2HXTA 2ZVIA 2NLYA 2YA1A 5K4XA 1ZZMA 2VRQA 3RCMA 1MUCA 4LUTA 1UH4A 3BC9A 1G4PA 3HN3A 2XVKA </