2PDJA

Human aldose reductase mutant l300a complexed with idd393.
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
315
structure length
315
Chain Sequence
ASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCAALSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title Merging the binding sites of aldose and aldehyde reductase for detection of inhibitor selectivity-determining features.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 106
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2007-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2pdjA00
2FZBA 1Z8AA 1ZSXA 4ASTA 2IPJA 2F38A 5JH2A 4IJRA 3BV7A 4G5DA 1IEIA 3ONCA 1RY0A 4WDUA 3ERPA 3T42A 2PDXA 2PEVA 3H7UA 4LAUA 3DN5A 3BUVA 3LBOA 4JQ3A 2ACSA 4Q3MA 4WEVX 4GABA 4XZNX 3CV6A 3C3UA 1EXBA 2ALRA 3LQLA 2FVLA 1T41A 3LD5A 2BGQA 3M4HA 1ZGDA 3UZXA 3FX4A 3H4GA 3CMFA 1UR3M 2DUZA 1HW6A 2ISFA 4GACA 1EL3A 2IKJA 2IKIA 4Q7BA 1C9WA 3UFYA 2CLPA 3U2CA 3RX2A 4QBXA 2ACRA 3EAUA 2BP1A 3R7MA 4PRRA 1PZ1A 5LIKX 3RX3A 3V0SA 1A80A 4JTDA 3M64A 3ONBA 3UYIA 2FZ9A 2PZNA 3CAQA 1AH4A 3P2VA 4F40A 3Q65A 2HV5A 4LBRA 5AZ1A 1M9HA 3R58A 4XO7A 3WCZA 1ADSA 2ACUA 1X98A 2HE8A 4JQ2A 3RX4A 1T40A 1MI3A 3LN3A 3R6IA 2PDKA 3BURA 3G1RA 1J96A 1FRBA 4LB3A 3LZ5A 2PDYA 4GIEA 1PZ0A 4JIIX 4QX4A 3UZWA 2HEJA 2IPFA 3H7RA 3KRBA 5DANA 3WBYA 1JEZA 1ZUAX 3UWEA 2FZ8A 4XZIA 5AZ0A 3LENA 4QR6A 4GCAA 5HNUA 3GHTA 5HA7A 4PUUA 2PDBA 3CV7A 4WDTA 2BGSA 4EXBA 4ZFCA 4H8NA 3QKZA 2DUXA 4PRTA 3CAVA 2PDCA 4FA3A 3R94A 4JTCA 1MRQA 1YE4A 4YVXA 3LNMA 4JQAA 3BCJA 1AZ1A 4XVEA 4XZMX 4FAMA 2PDUA 1HQTA 1EKOA 2VDGA 2J8TA 2P5NA 4HMNA 3V0UA 1US0A 1RALA 1OG6A 2NVDA 3V36A 4L1WA 4HBKA 4LB4A 4JIHA 4YS1A 5LIWX 2AGTA 3R43A 2DV0A 4PMJA 4AUBA 1X97A 1XF0A 1AH0A 3EB3A 1YNPA 4QXIA 3N2TA 3V0TA 1S2AA 3MC5A 2R9RA 4YVVA 3LQGA 3N6QA 3LUTA 2I16A 2PDIA 4GQ0A 4NKCA 1VP5A 2C91A 2PD5A 4XVDA 1AFSA 2PD9A 2A79A 1GVEA 2PDHA 3GHSA 4ICCX 4RPQA 4DZ5A 3MB9A 3UP8A 4WDWA 2HVOA 3R8HA 5M2FX 4JQ4A 1LQAA 4WRHA 1MZRA 2R24A 4I5XA 3WG6A 2PDQA 2PDWA 3B3DA 4DBUA 1XGDA 3WBXA 4JIRA 4XAPA 2IS7A 2FGBA 3UZYA 1PWMA 4JTAA 4OTKA 3V35A 5LIUX 2INEA 4XZHA 4YVPA 3UG8A 2PDJA 1YNQA 4H7CA 5C7HA 1QWKA 2IPWA 2WZMA 2IQDA 5KETA 4LBSA 1ZQ5A 1XJBA 2QXWA 2IPGA 3S3GA 3R8GA 3O0KA 1X96A 1YE6A 2ACQA 1PWLA 1AH3A 1AZ2A 3NTYA 3GHUA 3O3RA 3F7JA 2PF8A 4GA8A 3DOPA 2IQ0A 4DBWA 3G5EA 3GHRA 3GUGA 1EF3A 3UZZA 4FALA 2PDFA 1VBJA 2PDPA 4XZLX 1S1PA 1QRQA 3COTA 1Z9AA 1S1RA 4LAZA 3UGRA 2F2KA 2WZTA 1Z3NA 3VXGA 3FJNA 4IJCA 4XK2A 4DBSA 1SM9A 4WGHA 5LIYX 3LEPA 4R9OA 1Q5MA 2IKHA 2HVNA 2PDNA 4GQGA 1LWIA 1R38A 3M0IA 3Q67A 4XO6A 4EXAA 4WDXA 2PDLA 4PUWA 1IHIA 3CASA 3WBWA 4YU1A 4L1XA 2HE5A 1Q13A 3EB4A 2I17A 2FZDA 3LZ3A 2PDMA 2NVCA 4JTRA 2HDJA 4IGSA 4MHBA 1K8CA 1PYFA 3D3FA 1S2CA 4JTQA 4FZIA 5HNTA 4JQ1A 5LIXX 5JH1A 2PFHA 1RY8A 2INZA 1Z89A 4PR4A 2IKGA 2PDGA
chains in the Genus database with same CATH superfamily
1G4SA 2E40A 3WNNA 3RM8A 4BQ5A 1KGUA 2XIMA 1KRBC 2CLFA 2ZZ2A 2WK2A 4L9XA 3S47A 3WENA 5K9DA 1R3WA 3H7UA 4HSHA 1XIFA 4AD3A 1ITUA 5G4WA 3ALGA 4XZNX 1GQKA 3W0KA 3GR8A 1BWLA 4N9EA 1P6CA 3RLHA 3BLIA 5JXQA 4EKJA 4WSHA 2J9XA 3MPGA 2BXYA 4GXWA 4C91A 4EE9A 1XIJA 1T96A 3FKKA 2GJRA 3GDRA 3SN4A 5DT7A 3E0FA 3P82A 2PODA 4A8LA 4Q7BA 4GJJA 2A7RA 3TU9A 5CPNA 2D1ZA 1W3JA 1SYTA 5JBDA 2ACRA 3DC8A 4DO7A 4CNOA 4IPJA 3CLWA 4TU1A 3CZGA 3W23A 4TX9A 1FWWA 3KOYA 4C6QA 1JYXA 1B4EA 1Z42A 3C2YA 2GFTA 1TVLA 3STCA 2CEQA 4UUIA 4DJFC 4H04A 2XVKA 2CC0A 4CD8A 3E02A 4GFSA 4XO7A 3CO8A 3WCZA 4P5UA 2O9TA 1ADSA 4UTHA 3B04A 4LUIA 1XP3A 4WY0A 3CGTA 4OU1A 4JHMA 1KD0A 4W7WA 4CQ8A 1A4MA 2HNHA 4JL2A 4BHYA 2PZ0A 3H2AA 3GM8A 2EG7A 1EB3A 4V1YA 3OYXA 3ARUA 5CZJA 3B97A 3A47A 4DO6A 3C2EA 3JS3A 4BCEA 3WMLA 3SFKA 3TC3A 4QX4A 4GX9A 5DANA 4BWLC 5ABEA 2A3LA 4E38A 1UHVA 1BRLB 2GGIA 1TWDA 4CNTA 4KRTA 3BLEA 3LHUA 4H7VA 2E25A 1SZGA 1CXEA 1R6WA 3HQNA 1OFBA 4KS0A 1MW0A 1W2VA 1G01A 1WUFA 1GVFA 3U2EA 4M29A 1Y0EA 1M53A 1A3XA 3W6MA 5GJNA 3O6CA 1YDYA 1VFSA 2GDUA 1H1ZA 3M0HA 5LHEA 1BVWA 3A9IA 5KZ6A 2V5LA 3AU6A 5AYYA 1LL6A 1G7UA 3SCVA 2QCCA 4O1CA 5T8GA 2DY3A 5HUPA 3KHJA 4XZMX 1HQTA 1EPVA 4NRRA 3BDKA 3N2XA 3ZLGA 4S3DA 4KCUA 2GGJA 3UJFA 3C52A 2VO5A 2OYKA 4J3WA 1DWFM 1GHRA 5AOUA 3EEGA 4N0RA 4O4VA 1KBKA 1SW3A 4PEKA 3G1XA 4HHHA 4HK6A 1TIWA 3KOXA 1P0BA 3R5EA 2R9RA 1ZZMA 3N6QA 4N6EA 3ABXA 3MKVA 3A4WA 8RUCA 2WMIB 5E9AA 1ZS2A 4BQ2A 3F4CA 4NAFA 3E12A 5U4NA 3V3WA 1XKJA 5F4XA 3STGA 1KFCA 3KCLA 1DQXA 1IGWA 3FGCA 2WM1A 3CUHA 1DIOA 3EYPA 5IHRA 3MUIA 4KWVA 2E4TA 4WRHA 3M7SA 2WKGA 4TV6A 2R24A 1PDYA 3FSTA 2PU0A 3QV6A 1IZJA 1PIGA 2Z2AA 3AIVA 1HJUA 4E2BA 3OZYA 4GHRA 4H00A 4S3KA 1RHCA 3WLRA 4DNHA 2DSWA 5I6SA 2OX1A 4XZHA 3NL3A 4GRSA 1EX1A 1RA0A 3H2OA 4IGHA 3PSWA 1E6PA 5KMYA 2WZMA 3E49A 2WCGA 4CEXC 2QXWA 3EPOA 3WF4A 3UY8A 1LORA 4M6QA 1YE6A 2J77A 3WBEA 1VAHA 4QISA 3W82A 4OQVA 3OG3A 1AH3A 1XSJA 3TAOA 3TROA 3N13A 4Q4OA 4OOZA 5FJRA 3KTSA 3AU2A 1L6YA 3VK5A 1K77A 3TTEA 3HGJA 3Q2DA 1TJ1A 3H2MA 1CGYA 2TMDA 2V2CA 1AK5A 3N29A 3NNTA 2EEXA 5KZMA 2TRSA 4LCRA 1DWGM 3WF3A 5LGXA 2VGFA 4FALA 1JNEA 2DDXA 3UETA 1QRQA 2QHAA 1V0MA 5C9ZA 3WBAA 3W1UA 4JIPA 3KVLA 4ZO6A 4MDOA 2VL4A 3WEZA 2GK1B 3NQFA 1LROA 3GNRA 3D47A 4ZEPA 4HPGA 4DVOA 3H6OA 3O63A 4GGHA 3IVUA 4I90A 1V0NA 3NPXA 4KESA 4QP0A 1WKDA 3MDWA 3SIMA 3Q67A 4LH8A 3GTXA 4L9YA 3CXOA 4JBRA 2G96A 2REQA 4G7EA 2XIIA 1OX5A 1CDGA 2BFGA 3R11A 3F4VA 4L1XA 1BG9A 2INFA 4H2HA 2I17A 1KNWA 2B81A 3RLVA 2H8XA 4PSPA 2NT0A 4JTRA 4US6A 2FHFA 3FK4A 1MXDA 4FIRA 1V3KA 5TIMA 1S2WA 3TJXA 4F9JA 1TZ9A 5FAJA 4UB9A 3BOXA 5CZKA 3L65A 3ARWA 1EA0A 3PK7A 1DJGA 2Y24A 2C3ZA 2D0GA 3LCXA 5I00A 4UR7A 3IVTA 2FZBA 3C0QA 4QS5A 1GZGA 2DZSA 1ZSXA 4EAMA 1AVAA 5JH2A 4LANA 3THQA 1OYAA 4H7ZA 4K37A 1DWAM 3NDYA 3WD2A 2OOFA 4UR9A 4NP7A 4BEUA 3NCOA 3KZSA 3BUVA 3PPFA 2G3MA 3CMJA 3GNPA 1DJWA 1GYNA 1A0DA 1DQUA 4P7NA 3OW1A 1K6WA 4DRSA 3M7WA 1A4LA 1K4GA 4WSKA 3TX9A 4GE8A 2NLYA 2G97A 3WD4A 3SGGA 5DRCA 2YBUA 1VKFA 3KBSA 2DUZA 4K1WA 4F0MA 1SFLA 1UCWA 1RK6A 2J75A 3RJYA 3VIHA 2X05A 5DMMA 3WNKA 1OABA 3IIOA 4PSRA 3LYEA 4GYPA 3GU2A 1W9VA 3RX2A 5JMUA 1Q7MA 3GKFA 2PLCA 4IFKA 5FSDC 3IGHX 1M03A 3QXBA 1F9CA 1R86A 5A6AA 3ITGA 1AMKA 2GSJA 2XN2A 3FA3A 3QPZA 4PUKA 3BQ6A 3UG5A 3WQCA 3P3BA 4OUIA 4AHOA 2YA0A 3SCPA 3W7OA 4XZ9A 4AWUA 3QFEA 2HK1A 2XH2A 3KM8A 3R58A 5CEWA 1GQNA 2C16A 2FZMA 1NWSA 5EMYA 4C7GA 3WQWA 4J35A 3HB9A 3STPA 1QTWA 2WOQA 3N2BA 4IM4A 3CU2A 2WWDA 4EIVA 1GVSA 3R6IA 3CQHA 3HBLA 4CLMA 1VBHA 1HN1A 1O95A 3BV4A 3R2GA 1LOLA 4QE4A 1TJPA 4S3FA 3OOQA 4DM1A 2HEJA 4KF1A 1YBQB 3ZJ7A 3CHEA 1VBRA 3R13A 3SY1A 1GHSA 2Q09A 2VZUA 4Y9PA 3Q4DA 1OC6A 1UR1A 4MY1A 3OQ8A 3ZR6A 1J0KA 4ENLA 4H2CA 4LC6A 3DBPA 3KP1A 3IV8A 4DUVA 1UH3A 2WYSA 3WDJA 3QKZA 3ABRA 2DUXA 2EF9A 1XYAA 1H49A 4YNGA 3DIPA 4Q6XA 4AZHA 2QNEA 3LXBA 4JTCA 3T05A 2DZXA 2PTXA 3PZQA 3SUUA 3QR3A 3CQIA 3OYZA 3UERA 1I2QA 1CGVA 4PTWA 3KBVA 3WK3A 4IMCA 1FHVA 2VEKA 1LRQA 4NRSA 3ENLA 4XIMA 1HP4A 5A6TC 2TAAA 3EX3A 5GNZA 2WVUA 3A5FA 4ACYA 2WBGA 1BWKA 4G6CA 2A3EA 3MI3A 1Z69A 2X40A 1REQA 4GQ0A 4QEEA 4YHGA 1VB9A 2WPGA 4PODA 3NQGA 4E4FA 1KFBA 5I3KA 3L0GA 4AWTA 4ICCX 2YA2A 4CVWA 5J5DA 5CPSA 3M0MA 2GJNA 3SUWA 4E5TA 1VD6A 3W1XA 3IEBA 4KEMA 1TUFA 1GPFA 5HANA 3GKAA 4U2YA 3K8LA 1KB3A 2PDWA 1TTIA 2QCFA 4TMCA 3VNLA 3B06A 1XINA 1E0XA 1F4HA 4CN4A 4JTAA 5DELA 5IFTA 3MJMA 3SSJA 3SGUA 2Z6JA 4NNBA 2PDJA 1UR8A 3WQGA 3GTFA 5CJMA 1E6RA 1QWKA 4EF8A 4R88A 5KETA 1ZQ5A 1UA3A 4PCTA 3A3WA 2IPGA 4D6IA 2DFAA 1FFRA 1UZ1A 5AHMA 3GNDA 3WF2A 1NIUA 1J2WA 5EMMA 3B8IA 4QG6A 3DFYA 4C6KA 2VFEA 4OFCA 1TWWA 5LNVA 4JZ5A 4NXSA 3DOPA 1DJNA 3CL8A 3RG6A 1WOAA 3GHRA 3VPLA 1A5MC 3ANUA 4NI8A 4DO5A 1E9IA 1LBLA 4KGJA 3VGGA 2CLLA 1JVNA 3CQKA 4LQ1A 2OYLA 1ZBVA 5FEXA 2VFFA 4BS0A 1G0CA 1AJ2A 4ZCWA 3N34A 5C9RA 2ZRXA 1YPIA 3M5YA 1X6NA 3UY7A 1BD0A 3TLLA 3ARZA 4ERAA 3ZVHB 3RGTA 4IJCA 4R33A 2OB3A 5FD0A 5EMLA 3LG3A 3O2LA 1GQLA 3NZ1A 3CLMA 3N4EA 3CTTA 4AXNA 1VFTA 4XO6A 1ONWA 3VDHA 1S5NA 1W1IE 1UD4A 4AWEA 3WL1A 4BEQA 4D6GA 2AL1A 4QG9A 1VLWA 5FF4A 1TV8A 3AHXA 1FHDA 3GUWA 4OKDA 3T55A 3T8QA 4MHBA 2JGQA 1L6GA 3OLGA 3TVAA 2PWFA 2ZE3A 4H9ZA 2BOGX 3PZGA 3NL6A 4CU8A 4MYAA 4M7TA 2YB1A 4GQRA 1DP0A 2WMJA 4AHQA 2YL6A 3LV5A 2F61A 1MEWA 2AMXA 4PTNA 1ZTVA 4PR4A 4WJEA 1E0WA 3TJLA 3R25A 1P7TB 3VNJA 2OWXA 1XIIA 3IUDA 2E9LA 5REQA 1ECQA 4AU0A 1W54A 1NWRA 5I5RA 2YCIX 1FWTA 4XD4A 2X7VA 4N4PA 3NQCA 2PDXA 1GEHA 1MSSA 2Z7KA 3EZ4A 4L6OA 1ZJBA 3SGZA 2ACSA 2EJ1A 3ZLFA 1P6BA 3R79A 4ICMA 5EBUA 2EG8A 4GUFA 1BQGA 1US3A 3PSVA 1GYLA 3CV1A 2YL8A 3TYEA 3VNYA 2CBVA 3VIJA 4ATWA 3M0KA 1U83A 2OLHA 4INFA 4IOTA 4LVFA 1R3YA 1GWJA 2YYTA 3TYDA 4XAYA 1LQ2A 4E8DA 2W66A 4QQ3A 5BU6A 3KHDA 3U5YA 1XH1A 2MNRA 1RUSA 3DG6A 3B9AA 2VC6A 4A8NA 3UR2A 1UUMA 2Z1XA 3PBYA 4DYKA 2OELA 2HSAA 3QSTA 5FF7A 4HQVA 3O9NA 4AYGA 5FSEC 3DI1A 4GH1A 4GFIA 4TVUA 5BU9A 1D9EA 2FYMA 4Z2HA 1TA3A 5AZ1A 2C0AA 2NQ5A 2J27A 3RM4A 3VOFA 5CPMA 1SUXA 1JDAA 3S2NA 4AVNA 3HPZA 3TQ0A 3LN3A 4LCSA 2A7NA 3VKJA 1VRXA 4BI7A 1ITCA 4GO8A 4QLKA 3GLCA 1UP3A 1JUEA 1XUUA 4H4IA 2HQAA 2W0UA 1JPDX 3M16A 4ACZA 4JYEA 5D32A 4A6GA 3WFLA 1OGBA 2ZRUA 4Q4QA 3WD3A 3SRHA 1T8QA 3WFAA 2J8FA 2IXVA 3G8RA 5CZSA 1PKYA 3TW6A 3SQMA 3FJ6A 1PEZA 2WVVB 4W88A 3O6DA 1C92A 1SFJA 2ESCA 2NQHA 5BWFA 3IUHA 3T2QA 2QIWA 4L4PA 2XYLA 2PS2A 3GYCA 4A3UA 3LM3A 1IWAA 3FA5A 3M0YA 2B7NA 1YNYA 1CGXA 1F8MA 1YE4A 2QPUA 3LNMA 1WCGA 3MYPA 3K1DA 1AZ1A 2D0HA 4FNQA 3LA4A 1CNVA 2WHJA 1WX0A 1FHUA 1S5WA 2GJPA 4OV9A 4XTIA 1G69A 2WBKA 4JHOA 3ITXA 3DFHA 4GX8A 4UTMA 3NZPA 3TYBA 2Q01A 3MHUA 1QCWA 3PVFA 3VOGA 1YNPA 3AROA 3V0TA 3C61A 2QJMA 2UBPC 4RX0A 3C56A 3NQ2A 3SRDA 2HVMA 3APGA 3PFRA 3IJDA 4HZ8A 1AFSA 5LXEA 4XKYA 4UXDA 3A4AA 4C6PA 4OBSA 6CGTA 3N4AA 3HPSA 1AQFA 1WAWA 4IQDA 3UVIA 1P0DA 1CB7B 1VRDA 4OBTA 3RITA 3O07A 3UWWA 5BOFA 3VA8A 4R7WA 3V18A 4G9PA 4EOUA 3BAKA 4JNZA 2V2HA 4H3DA 4S3BA 4JIQA 4MJMA 2OXNA 5K9XA 3NPVA 4GI4A 3MYOA 3V5OA 1OCBA 7REQB 3OHIA 3UEQA 2C8NA 3TTYA 3AMGA 1E0VA 1U33A 4Y9NA 3UWZA 2I5GA 3VD4A 4GH3A 4V15A 1KCXA 2CESA 2FDSA 3I6EA 3UJSA 5FIPA 2I9UA 4QCFA 3ARSA 3WH7A 1DL3A 1TVPA 5BYWA 2XFWA 4UQCA 3G5EA 3M5ZA 3GUGA 3E9AA 4GI9A 7TIMA 5BXTA 1H7RA 3L66A 1XWYA 3R8RA 3BGGA 2VURA 3UF9A 5AYIA 3VDBA 3AHZA 2VDIA 3XIMA 1V51A 1ONXA 2OEJA 1LBMA 2AL2A 4LNYA 2GGHA 1EJ7L 3CWNA 3W1NA 5I3GA 1SM9A 3I7RA 1ZU8A 2DSUA 3VVGA 2OT1A 1XYFA 4LVDA 4M81A 5LA2A 2GVYA 3PNZA 2V5CA 1HT6A 2A4AA 3PZNA 3DECA 4CD5A 4IUOA 2XM1A 3CC1A 4U3AA 4DO4A 5E1QA 3A13A 3VD7A 2R1LA 2BG5A 3U7BA 1TQXA 2H90A 3LHZA 2WNQA 4F2BA 3UJ2A 1IT8A 1DIEA 1DJIA 4H1ZA 4MWAD 1WOBA 1JPHA 4DJFD 4JFTA 4JX6A 2WSQA 3REQA 4KKXA 2ZXQA 4L65A 4HPHA 3JU2A 4FLSA 1IF2A 4HPXA 2WC7A 1S5VA 2GQAA 4D6FA 1KXQA 1KFEA 3EXSA 1RY8A 3EDEA 2YCEA 2E1WA 3LSBA 4JNMA 3AMLA 3R0KA 2IKGA 1ZNNA 4OGZA 1A3WA 1WYIA 1OX4B 1YMYA 5D4YA 1WXYA 5CG7A 4GC4A 1DWIM 1NFPA 2J47A 1KQYA 3VUSA 2X0SA 5A5WA 2AQVA 5AHEA 3BWWA 4IX2A 3IRDA 3GXTA 3LSCA 2DT3A 5AECA 3KFTA 2PTZA 4D1JA 1EA9C 1G4PA 2XIBA 3CZ8A 2FVLA 3XINA 4DJDD 2WC3A 3WNPA 4MZYA 4A35A 1G9HA 4J3SA 1QNQA 5H6HA 1SR9A 4GMEA 4GACA 2D22A 5D8ZA 2IKJA 2CHOA 1OCNA 1J0JA 2IKIA 1Q65A 3UFYA 4F66A 3MVIA 2NXIA 4QBXA 3R7MA 3UPWA 3BK0A 3V75A 2O0TA 1RP9A 3LBMA 5CPQA 4AXKA 3UR7A 5LIKX 4K68A 1UPMB 1A80A 1WV2A 4GLEA 4S2BA 4QNEA 5A1AA 1G94A 3V5FA 3HG5A 9CGTA 1FWBC 5M5DA 4HU0A 3WUGA 2WKJA 1TB3A 3TNBA 1W8SA 5LGZA 4CNSA 1X98A 1A5NC 1BGGA 3VNZA 4ZQMA 3PZUA 1A53A 4Q8VA 3RRAA 1XUZA 9RUBA 3CIWA 1WB0A 2PDKA 5C5YA 2DJLA 1CBGA 4I6VA 5PTDA 3DFNA 2VXNA 5FESA 2VZOA 1JD7A 1WPCA 5F2GA 1UWUA 1UD8A 3MSGA 2ZRVA 1MRAA 2QJNA 2VR4A 3BANA 1Q6RA 3PJXA 2OSXA 2Q02A 2VRKA 3VIPA 3WLTA 2IPFA 1QI0A 2Y6ZA 3VOCA 4C90A 2A5HA 4RCXA 4RZ5A 3ARPA 3GAYA 5I3IA 1OFOA 4N9CA 4I7UA 4Y9MA 4QJ1A 5FJJA 5BW6A 4AY8A 1JZ4A 1ZY9A 4H8UA 4D6CA 5HINA 2PBGA 1A5KC 2VKZG 3NIYA 4FNPA 4WXYA 4KWUA 4P7QA 1H7PA 2BGSA 2GUYA 1EWDA 4B9ZA 4WY0B 2PDCA 5G1YA 3FEMA 4FA3A 2WCAA 1KV5A 3DESA 3ANYA 2FIQA 4I5UA 1CLXA 1J9YA 4YVXA 4EXQA 4IXHA 2ZX8A 4F0LA 3EA3A 4GUHA 1D7FA 2J8TA 2W9MA 3UESA 2YDQA 3QYSA 1BFNA 1OG6A 1SZFA 3CPRA 3S1XA 4L1WA 3CZLA 2GQ9A 4ZL1A 2X1SA 5LIWX 3NDOA 2AGTA 3W87A 5E5CA 2Z1BA 1BAGA 4JTEA 2EPNA 4J2MA 1KV8A 1NJJA 3EB2A 3EKGA 1NSJA 4GZEA 3BAIA 1B57A 3DKJA 5A2AA 5C71A 2R91A 3WLNA 1RH9A 3W71A 1X6UA 1KM6A 1M3UA 1UYQA 3CHVA 1VFOA 2CZVA 1R87A 1QAPA 2VI0A 3C86A 3NXLA 3POCA 1O68A 2CLOA 1ODUA 4RE2A 3LK6A 5FJTA 3L4TA 4DZ5A 1TKKA 3TA6A 4MIMA 1E3XA 1X7FA 3T0TA 3MP3A 2X41A 1CENA 1NQ6A 3T81A 3I65A 3E96A 1UD2A 4I5XA 1JRBA 3K8MA 3VGHA 2ZE0A 4BI6A 1YHTA 3GC2A 2PWHA 5D37A 1OGGA 3VCRA 3H7VA 3QN3A 4OTKA 1WZKA 3C0JA 3M5VA 1EIXA 7TAAA 3AJ7A 3VGDA 1FQ0A 4D72A 4U5IA 4F9DA 5DN1A 1RVKA 2G4JA 5CKSA 2V3DA 2PWEA 3TN3A 3J7HA 4NAFB 3LI0A 1XJBA 4FEZA 1IZKA 3F5JA 3FGCB 2VUYA 3EX1A 3P67A 5F4WA 1DYSA 4I9AA 3TCSA 5CPTA 1FKWA 5D2TA 4WKAA 3GVRA 2W61A 1W1A1 3WEOA 1PX4A 2ZXBA 3PZVA 3G1FA 3C5QA 3GU9A 1YXYA 5A3HA 4XAZA 2O4QA 3MBDA 4H9TA 1Q6DA 2PCEA 1R3RA 3AICA 3QEZA 3FAXA 4JEQA 5E6YA 1QW7A 3KOWA 5D09A 2YZ5A 4J5NA 2GUBA 5AC7A 2QAFA 3HQOA 1S3TC 2Y63A 1L8PA 2HNEA 3T6CA 3S6DA 5DEZA 5IM51 4NJKA 5FCZA 1E40A 3PBUA 4Y7EA 3T8LA 2FQIA 3CUIA 3LMYA 1V6TA 2EO7A 4C6MA 2PDNA 1G1YA 4R85A 2J7GA 4QE5A 4QDWA 3ZSSA 1BPLB 3KTXA 1BRLA 3MCOA 4Y96A 4C7FA 4R5EA 3U48A 3WQDA 3GAKA 3SURA 1S5MA 1BKHA 1UR9A 4PYSA 5HPOA 3NEVA 4MWAA 3GU1A 4HN4A 4LRSA 3SSZA 4DJFA 1W3LA 2D20A 3TQVA 2ZX9A 3DFOA 2QT3A 3GVWA 5D8WA 4FI4A 1I2NA 3T08A 3GSMA 1AW5A 3WL0A 5DX7A 3WYZA 4A3QA 1UD3A 1OCJA 1GONA 2C7FA 3MO7A 2DH3A 4EPBC 4ZODA 4C6OA 1KM2A 4IIGA 5MF5A 1C3FA 3D5HA 2VHLA 2OJPA 4C1LA 2REQB 4AWSA 4NZ1A 4DM2A 3W86A 1OYCA 1EDQA 1U1UA 4K8HA 1RP8A 3M41A 3S5SA 3BVJA 5TBOA 4ZOCA 1ZB5A 4US5D 1ENUA 2FH8A 1ZLPA 1CT5A 2OX4A 5LXXA 3N6JA 4JN6A 4L9ZA 3W1AA 3E74A 3WQEA 4RV8A 3S5YA 1PKMA 1TE1A 2G5WA 1WDSA 4DJDA 4AAJA 1H51A 4GABA 3WD1A 5CSYA 1U30A 4M51A 1GTEA 1UH2A 1H1NA 4QRNA 4XAGA 1HG3A 4YPJA 3A4JA 3HV8A 2YBVA 3VTRA 4DUWA 1OFPA 2ANUA 4GYPC 3DBNA 3GX9A 1YADA 1C9WA 1BF6A 2ZKMX 4JTHA 1TSIA 1JZ3A 1KRAC 1C8VA 1ECEA 3EWZA 3QGVA 3ARTA 5F1UA 4PMQA 1LWJA 2DIEA 4UQ9A 4JICA 1FWHC 4JTDA 4AISA 4DN1A 4X61A 2VENA 2E5BA 3HPXA 4C6CA 3CAQA 3P5YA 4Z08A 4EPDC 2I9EA 4WKHA 3VIFA 3EBVA 4W84A 2R14A 4RK8A 5DT5A 2O9PA 4M3PA 1AJZA 1HUVA 3GB6A 4UOQA 2J6VA 5C7VA 3K30A 3L5AA 1P4CA 3CK5A 3W2NA 4IP4A 3E5PA 1WP6A 3THCA 4JCMA 5I3FA 1C8QA 1T40A 3G24A 7PTDA 2O92A 4HTYA 1EOMA 2Y70A 4JFVA 3G1RA 1YKWA 4G1NA 4CNPA 4LALA 3F1QA 3GDKA 4TX6A 4UTFA 4IFKB 1J8VA 1KLZA 4MOZA 1NTHA 5FAGA 3P62A 4M1RA 2BWGA 1I75A 3PPGA 1TTPA 3UWEA 3B9EA 5E6ZA 4P7RA 2JQXA 3FIGA 4CCCA 3EKLA 3WJSA 4CVUA 4ZXLA 5A8PA 3SEPA 2QJHA 5HNUA 1X39A 2GK1A 1Z7AA 5BCAA 3EA2A 3CV7A 2CWXA 3VKDA 3NM3A 3DHUA 1K6AA 3AUJA 3SUVA 3CH9A 4RE4A 3I7QA 1RSCA 1BTMA 1V3HA 4GNKB 3MW7A 1NF7A 1OZQA 3GVVA 2A6LA 5F4SA 5LA1A 1R3VA 1F7BA 1HZYA 1HO4A 4UNLA 4X63A 3DUGA 3BCJA 2EPKX 4M7SA 4AZBA 3W7KA 4WCJA 2P5NA 1XCXA 5I7GA 3TCEA 3AXIA 3W1LA 2FH6A 4GY7A 3BW2A 4H6KA 1XFBA 2UWFA 3MHFA 3KLLA 3ZJKA 4S23A 2DV0A 4PMVA 3LI1A 1QNVA 2OZ8A 3IAQA 5H8UA 1B31A 4BF5A 3WH6A 5KZDA 1RJRA 5AHNA 1V0LA 6PTDA 4F4RA 3KL3A 1G6CA 1F73A 5MHBA 3W7EA 1RAKA 1ISZA 5EKYA 4AEFA 4W9TA 2DQXA 2OFJA 2PRMA 4ZR8A 2V5DA 4NJJA 4HNUA 5H1WA 2PTWA 1GCYA 5E0KA 3EWDA 1PHQA 3U4FA 8XIAA 3WZ0E 3HJEA 2FB2A 4NYUA 1NM9A 1XRFA 4M6PA 2F7FA 2WLZA 4HZ7A 2BV9A 1FA2A 1E0TA 1YTEA 2IS7A 3DHPA 1E55A 3CM4A 3QQ1A 3DGRA 2B7PA 1UBPC 4JS3A 4GY1A 4EX4A 2ZIDA 2RAGA 4A2SA 3VFCA 2D2OA 1VFFA 5BROA 4YIWA 2E6FA 1REQB 1WZMA 1QOQA 3WH8A 4WSJA 2HBVA 4AD1A 4ZB0A 3S9IA 4MMWA 4OJYA 4PCSA 2BY3A 4NILA 2H3DA 1R2RA 3S3GA 4U5KA 3EOUA 3IPWA 4GZIA 2RDWA 4IPIA 4LJ3A 1PX3A 1UWQA 2CHNA 1EH9A 4REQB 1U5JA 3TA9A 3TWAA 3AI0A 3EOSA 4HCDA 4GZ7A 2RHGA 3BGJA 2V8ZA 1W1TA 4CQAA 2ZRYA 2ALDA 2OVLA 3WUFA 2FPYA 4MPKA 1OFRA 3W2UA 3I3DA 3WMBA 3W70A 1TPVA 4YTQA 2VVSA 1S1RA 1GKQA 4C6DA 2F2KA 3OHMB 3TMQA 3LXCA 4FXJA 1GG1A 2ZUWA 3WLHA 4DBSA 2C6QA 2E7FA 3N2MA 4R9OA 4LU0A 1CGWA 4Q8UA 2J8GA 3LCFA 4ZO7A 4WX2A 4I8YA 1OG0A 1BQCA 4LAKA 2PDLA 3CHDA 4X60A 2VDHA 5DBUA 3OGVA 3CASA 3K2GA 1FUYA 3WBWA 3W2LA 2Y8UA 1OB0A 3AZTA 3B4YA 3WJWA 1B54A 1VR6A 3P6LA 2JBMA 3MI2A 5F1VA 1AMYA 3ZWTA 1GNXA 1X1NA 3PZMA 1R7AA 5FA5A 4XSLA 4LVBA 3URBA 4X22A 4O17A 2HWGA 2IMRA 3SZ8A 3GXNA 1YW1A 3ZO9A 3BAJA 3P14A 1MNZA 5D03A 2XIOA 3CJPA 3PWGA 2E6DA 1V0KA 2B4GA 1D8WA 5JH1A 1PIFA 3TOPA 4LF2A 1B3ZA 3IK4A 2FVKA 1P0KA 3E5BA 4US5A 1SMDA 1WDWA 4OV4A 1O6IA 2HXUA 2HMCA 1LLOA 3F03K 2OG9A 4ASTA 2X1UA 5FL1A 1WXZA 1R8LA 4G5DA 4Q7NA 4WDUA 1QPRA 3NSMA 3EWXA 4ZE5A 3UCQA 1W1ZA 2PEVA 5AVNA 3UD6A 5F2LA 4ZQOA 3UZJA 3GE7A 1HL9A 3B9OA 4DY1A 3E2QA 3MUY1 3T09A 2EKGA 4LUTA 3QQWA 1K7FA 5I03A 1IE7C 1QPQA 3B8UA 5CLWA 2A3BA 5G1MA 4N9DA 4NXKA 1P0NA 3MZ2A 2PF0A 3VDAA 3MZNA 2XU2A 1WO2A 4B5TA 3IJ8A 5REQB 3RO6A 3U2CA 3QHMA 3IJIA 4WK9A 4V28A 1PZ3A 2C14A 1OC7A 2YPIA 1D7KA 4UTLA 1KTBA 1QMLA 2PB1A 1UUOA 4DLMA 4DELA 3F4NA 1VEOA 1BYDA 3H70A 1VCFA 2I1OA 4UOJA 1B3XA 4C5YA 2I14A 3BG3A 5HMEA 2FMNA 3BH4A 3GD6A 1KC7A 2W92A 2XIQA 5HMDA 1UP2A 3WY1A 1EC7A 2ACUA 3DHFA 4IGMA 1A5AA 4ES4A 1QXLA 1JR1A 4EWJA 5A6LA 3I4KA 4Q8NA 3LU2A 4H6RA 4DYJA 5IOBA 4I9MA 4UMCA 1HKIA 2ZUNA 4FNRA 1CXKA 2PP3A 2PDYA 3OJGA 2QVHA 5I23A 3S1VA 3TDFA 2PU1A 3CUGA 1OF6A 4XZIA 3UT0A 3WN6A 4WR3A 1TJ2A 1TA3B 2UZ9A 5L6UA 1XSIA 3GG7A 2V69A 1OT2A 2I56A 3TLQA 2GSEA 1VYPX 3F5LA 5BRQA 3W85A 1ADOA 2ZZ3A 1XRTA 3WH9A 1W9DM 3ZM8A 1EC8A 4A05A 2XN1A 2CLMA 1BXBA 3DDMA 1JIBA 3E1F1 4B5NA 2YB4A 3LERA 3H54A 1FKXA 1TG7A 2BVYA 3LOTA 3VCNA 3AMCA 3UPBA 1VHNA 4FP1A 5A95A 3NQ7A 3UJRA 5TQLA 3VABA 3IIVA 4F0HA 3OZPA 3RU6A 3FA4A 4BF7A 2Z24A 1GKRA 4ACZB 4WUIA 2BSLA 2QGHA 2CU0A 3HM7A 2FGLA 2VFHA 2E28A 4N42A 4M6UA 2NWSA 4C60A 1ZBKA 4Q8MA 3L23A 3NGJA 3GVQA 1Q85A 2PMQA 1QHOA 1W6TA 2DP3A 3QV7A 2ZXDA 3FKRA 4FIQA 2UY4A 5E9XA 1S2AA 1QJWA 3NSNA 3TR2A 1EXPA 3LUTA 1GQJA 1CCWB 2E8YA 4FHAA 4LT9A 3NQMA 4GNVA 2ZICA 3MJYA 1E1CA 3P7YA 5CQ1A 4H19A 3W01A 4LFYA 2GDQA 5GPRA 1E51A 3TN5A 2WXDM 4WDWA 4DF1A 1E6SM 3FN9A 2VCBA 2GJXA 1TCDA 1TV7A 2RFGA 4GUJA 3E38A 3HTWA 4ROPA 3AS3A 4WKFA 1W37A 1LDCA 1UC4A 1IGSA 2P3ZA 1UWIA 2QCHA 2UY3A 3AHYA 2F6UA 2QCEA 2W27A 5HNNA 4NZ4A 2EBNA 1FHLA 2VGGA 1XHGA 4O53A 4NJHA 2QCNA 3CAKA 4XKYB 3KDNA 1RD5A 3RUBL 4MFDA 5FACA 2ZCGA 1UIOA 5C6MA 4KQNA 1HL8A 3H21A 3U6WA 3LPPA 1YDOA 2BTMA 3W1RA 2GVLA 3TE9A 3H2CA 3GH7A 1VBGA 4IPPA 5G2IA 1FBAA 3C6CA 4H9MA 3P0WA 4HP5A 3KOFA 1QI2A 3W6YA 5M3WA 1M6JA 3PUOA 4CQ9A 4DBWA 1XBYA 2PLJA 1IWPA 3TYCA 1VBJA 5CPOA 2PGEA 2AKMA 2OMAA 3BQ5A 1S3HA 1NAL1 4GZJA 3CTLA 2FTPA 3KS6A 3QKEA 1H5YA 1W3IA 1IIGA 3M0LA 2QULA 4GIYA 3FJNA 4PMUA 5HMSA 3OU8A 4WGHA 1I0BA 4I9JA 5AC5A 1GW9A 1S5TA 1DORA 3LMZA 2NZLA 3GG8A 2C79A 4YJ5A 2Q3RA 3ANVA 1O94A 1UWRA 5HULA 3ZJ8A 1V6XA 3IIZA 1MO0A 4A22A 4NAEB 2B7QA 3Q58A 1QATA 5FEPA 1F5ZA 4DB7A 3ZT7A 4HCLA 3UPMA 1HO1A 3S46A 3PTDA 2VEGA 1K1DA 2WNZA 3PBWA 3GTIA 4GG9A 2ZYFA 2WVVA 1AQ0A 2JGYA 3TKFA 1NARA 4X9YA 1W5PA 2AL2B 3O06A 4GC3A 3RU8X 3SAZA 1RCXB 1G5AA 3BLLA 4XISA 1LF1A 3D3FA 2VP8A 4G7FA 3MV01 1DJHA 3CO4A 5HK4A 1M5WA 4FZIA 3BO9A 2QV5A 1R3TA 2UY2A 3RPMA 1E6ZA 1TYGA 2NV9A 4RDVA 3QZEA 4ZA0A 4AY1A 2Y8VA 4GBDA 3DYMA 4DAFA 4UBPC 3FXYA 2YCKX 1XC6A 2GL5A 1E9ZB 1ZP3A 4GYFA 4XSMA 2UY5A 1U5VA 3W24A 3LGEA 3T42A 5AC8A 3DN5A 1TV4A 2W91A 3QJAA 3IIPA 4ZTXA 4FF7A 1TV5A 1LT8A 2DIJA 1DIKA 2BDQA 3P5ZA 1A5SA 4OUEA 5BOEA 1RD6A 1EUNA 5CBBA 1VGAA 3M4HA 1J5TA 3OB8A 3ZJ6A 2OZTA 4JKMA 3TYUA 2WJZA 2FGZA 2ZC1A 5D05A 3AOFA 1T5AA 4FB7A 4J7RA 4PL2A 2C13A 5ENLA 5FJPA 2G8ZA 5DY2A 4PTXA 4JY8A 3EPNA 3SW6A 1HXJA 2V6AA 1WA3A 5A8OA 5EYWA 3GW0A 1KR0A 3C2OA 3DFPA 3ABOA 1DJZA 1XLEA 2EG6A 5HWMA 3T1GA 3PB0A 3WKZA 1XW8A 2G3JA 1J0HA 1W3HA 4UQBA 4HHPA 3H4WA 1N8FA 2GOUA 4LS1A 4GWEA 4PCNA 1DOSA 3ITVA 1NQKA 3NZGA 1CXLA 1QNPA 2HE8A 4G8TA 2PBOA 1Q3NA 5D9PA 3VMOA 3BMVA 1J12A 1E9LA 3LTSA 5HUOA 3AMKA 4O54A 1TV2A 3AYSA 3SB0A 3MWCA 1DWJM 3AYRA 4I7VA 3ABZA 4UC5A 3N25A 4TMBA 4AIEA 3LZ5A 3RLUA 1CYGA 3VE9A 1JI2A 4DZAA 2DVTA 4ONVA 3A22A 4N4QA 4RKAA 3UBPC 1CXHA 2BS9A 1MYRA 5SWUA 3UWQA 1KM1A 4CU6A 3BE7A 3AS1A 3LPOA 2J78A 4J28A 4XUGA 1W0MA 4AZIA 3NOEA 1GZ1A 1TWZA 2YW4A 2PA6A 5TAOA 1TREA 4LYPA 1K7XA 4WDTA 2GDVA 2NT1A 4B3KA 4YMZA 1NU5A 4HU3A 4LWWA 4O28A 2ZA1A 5HBFA 1E15A 1BSIA 1SO6A 1R3SA 3F2BA 2VFGA 2WSKA 1SSDA 2YL9A 3IANA 3ARQA 4Q8PA 1F3EA 1YDVA 2BOFX 4XVEA 1V7AA 4K6AA 1Q6OA 3TC6A 2Y1HA 4PB5A 4ATLA 4AEOA 2PPGA 3F4DA 1UZ4A 3KS5A 2FFCA 1G4TA 3OVQA 3HGRA 4FX7A 4ZB2A 4AUBA 4NJGA 1X97A 3B8WA 4RJEA 3BLOA 1UH4A 1SO3A 1OCQA 1ELSA 1XG3A 2XSBA 4KH2A 4QXIA 3MC5A 1V5XA 3GG0A 3HQ1A 3I6TA 4UTTA 1UIPA 4GVIA 1EP1A 1FXPA 4FLQA 3QYQA 4AYSA 5IDIA 5LZLA 1OGSA 4ZTYA 3WUEA 3TYAA 4JNYA 3EMZA 3VDCA 3ARVA 1XIMA 1ZRQA 2E68A 2VJXA 5ECUA 5IFPA 4D6HA 3A5VA 4LX4A 4WF7A 1W9BM 1KM3A 3G0SA 3KVJA 4WVXA 1WDRA 2WMKA 3ZT5A 2WHKA 2R1NA 3KDOA 4AVOA 3FHQA 4X9SA 3WDRA 1EGZA 1KKRA 2P10A 4GCXA 4HA3A 3MKCA 4B4FA 3KVKA 1B9ZA 3E0LA 4IG2B 4GXMA 5AKQA 4MJZA 1F6PA 5BOOA 1CLVA 3O6YX 3S9YA 4JEJA 2Z25A 2QQ6A 1WKEA 1PL9A 4PMNA 3NTYA 3KEHA 3GZ3A 3OZOA 2D3NA 3BARA 3PJUA 4MB1A 1GOWA 1VS1A 3MMUA 3EOLA 1OFDA 3SUTA 4R9XA 1K9FA 3SCTA 2F2HA 3DG3A 1XLLA 1EF3A 4QJ3B 1ME8A 3GFYA 3CZEA 4HA4A 5EMUA 3PNUA 4XD3A 3NL2A 4DIAA 1XLGA 1W9UA 4KETA 4K39A 2E9MA 2Q3OA 3HF3A 3SCQA 2PURA 2X42A 3W7NA 4J3XA 2GUUA 3ITCA 3TSBA 3G0UA 3LEPA 3UXLA 2JF7A 1Q5MA 2VD8A 4HKPA 3NO3A 1BVZA 3B9DA 4I8DA 1R38A 4LUSA 3T0AA 4RE0A 3IVSA 2TSYA 1W1VA 4IMDA 4JR5A 4MWAC 2XFRA 2HE5A 1GOQA 3BGAA 4ML9A 3BMWA 3W7DA 4H6EA 4TIMA 1SMAA 1BYAA 2XGZA 2NQJA 1V6VA 4J2PA 4YTSA 3HA1A 5BXPA 4MPQA 4XIAA 3T2OA 3P61A 2GZXA 5GNYA 3CT2A 3QZAA 2WQPA 3P81A 1KXTA 1BLIA 2BOEX 1KXHA 1PSCA 1ZAIA 2WNNA 3QV8A 2YA1A 4QROA 5GJMA 2Y8KA 4LXFA 3CQJA 2WAGA 4JPGA 3L0NA 3NPWA 2F38A 3P8JA 3PTMA 1JXJA 1S38A 1PDZA 1HKMA 4MWAB 2RJHA 5CZTA 1Q6LA 1QNRA 4LVGA 2YFOA 4C1KA 4DJDC 2ADAA 3RAOA 2G3NA 5I06A 4RL3A 3TMLA 1EEXA 2HISA 2XM2A 4Q3MA 5DXXA 1TWIA 1PUDA 4PC8A 4WEVX 3NURA 1TV3A 4I3GA 3EMCA 4MUZA 3JZEA 1EYEA 1I2RA 3QR0A 4R7JA 2YKKA 2GSHA 1P5BA 2Y85A 3LD5A 2J9ZA 3UZXA 4DWSD 1X8FA 4GJIA 3IIXA 1GOXA 2PGFA 1UR3M 3HJZA 1HW6A 4FLRA 2ISFA 5I24A 3GK0A 2ZBTA 3EDKA 4KCTA 4HIBA 4OZOA 4YXGA 1KFJA 2JALA 4V27A 3VINA 2BP1A 3POHA 4G2DA 3RK8A 2PWVA 4IISA 1BYCA 1KR1A 4AZ7A 4MNLA 1KXVA 1JD9A 4Z0SA 2BVTA 4ZO9A 2CETA 4RXGA 3P2VA 4K36A 4F40A 2VNCA 1RZMA 2A3AA 7A3HA 2VCAA 1VJIA 4JGDA 5CSSA 5HJXA 4LYQA 3RN6A 1VFLA 2Q8ZA 3GR4A 4MY9A 4M8UA 4FXSA 3GQYA 3VD5A 4NNAA 4JTFA 5KTLA 4XZBA 3L9CA 3NOYA 3W7HA 2OWWA 2W4XA 2ZZ5A 4KEUA 4DEFA 3USBA 4M80A 2CLIA 2XDFA 1XCWA 5D2XA 1W5OA 4WXZA 3QOMA 3CL7A 1PTDA 1J0YA 1V6WA 3W28A 3TZNA 1QDSA 3NQ8A 2XH4A 2W62A 3N1AA 5DCDA 4F0KA 1XYLA 1GOOA 5FF2A 2O56A 2PGWA 4WLCA 4W86A 3L4WA 4DYEA 3KBJA 1XYMA 4S3GA 4PRWA 2YLAA 3NPUA 2GPTA 3TW9A 1GJWA 3CL6A 3CIXA 4CCEA 3L4VA 5EMJA 1F74A 4ZSUA 3PFMA 3UJEA 5A6SA 1O5KA 1D3GA 5AYZA 4B16A 4PB3A 3EGJA 4L64A 1ESWA 3SCUA 3SRFA 1K9DA 3ELFA 3R4IA 3A24A 3PAOA 2QJIA 1XLHA 4E8CA 1Q6GA 2NSXA 2H9AB 1BF2A 3EWBX 4EWND 2KAUC 1EKOA 4HMNA 1W8GA 1LT7A 3E0VA 1IXPA 5TNVA 1QI4A 2NVDA 3UXKA 3B0VC 3GXDA 1IXOA 3N12A 4HBKA 4GUIA 1I9CB 5DO8A 4IMEA 4TTUA 2W79A 2J66A 4LAMA 3QC3A 1KCZA 4HMCA 5CJNA 3DZ1A 1DQWA 2F6XA 1GYMA 2O9RA 2BNJA 3LS9A 4UCGA 2QR6A 2CFFA 1QW9A 3E0WA 4TX8A 3SN0A 1NY1A 3TEVA 3MHGA 2ZX5A 1V3LA 1JCJA 2POTA 5A6KA 5C0QA 1XIDA 2BVDA 4Z17A 1H7NA 4DPQA 1EWEA 4JXCA 2X2YA 3PPCA 1WDDA 3VGBA 4GGBA 4RUBA 3TONA 1EGMA 2G4FA 4J40A 4RDWA 4XAPA 2J4GA 3UXDA 4C6JA 4TUFA 2QS8A 4KPLA 4O1AA 1HJQA 4PUNA 1P43A 3HG3A 4FX8A 4L4LA 4RLIA 2X09A 4LBUA 3NO1A 4H7CA 3QF0A 3WQ4A 4WY0F 1H4PA 1F3XA 1JFXA 1CZ1A 3PTQA 4GJ1A 4GI6A 4JTJA 2A1YA 1C93A 5G4HC 4IP5A 4JAWA 5T9CE 1X96A 3WDIA 1CI1A 4KEZA 2OO0A 3LRMA 4PTVA 1YQ2A 3AS2A 3E6EA 2LLEA 4A3YA 1AZ2A 3MANA 2J62A 3XISA 3L2MA 3WLIA 2PP0A 1TUXA 3WJXA 2CZFA 2IQ0A 5DCEA 1C29A 3PJTA 1CX9A 2QCDA 3RF9A 2V5KA 2V0TA 2E6YA 4MFEA 1AODA 4MGGA 1EIBA 4HYWA 1T8XA 1LL7A 2IUZA 2DGAA 2OGJA 3M44A 4Z2KA 1HNYA 3R1ZA 2J74A 4MNJA 2VELA 4HU8A 1UD5A 2WZTA 1CIUA 4WD0A 2G37A 2O55A 3T0BA 1TMLA 1A47A 1FWEC 1AQMA 1JPMA 3WLPA 3HMJG 4HT3A 1EO7A 5FKYA 4WDXA 2VOMA 2AGKA 3VU2A 5BZAA 2E5DA 3LHVA 4R34A 1ZJHA 2OQYA 4L6DA 4IQEA 1SZNA 1M04A 1DHPA 5M17A 4JFWA 4RV3A 1L6SA 2QEZA 4L1GA 1W1B1 1OD0A 3OBAA 3QRHA 1TPH1 2PSNA 3CPGA 4DUOA 1VENA 3O15A 3TTQA 7ENLA 3U8GA 4BI5A 4EP8C 2J88A 5CC6A 4H41A 2WKLA 1PE1A 3FVMA 1FWAC 1TPUA 1MEHA 3MQTA 5D2WA 1TZ7A 4DI9A 3DYPA 2E3ZA 4QAIA 3K4AA 2INZA 1IXQA 1IEXA 1J2BA 1KGWA 3UWUA 5G5IA 3EMQA 1JDDA 1GW1A 3ZVIA 1NP2A 4NVTA 4C6BA 2QUMA 3AJXA 5AN7A 3KWSA 4DHGA 3L21A 4PZVA 4HD5A 4D9PA 5FJIA 2JFEX 2P3EA 1FOBA 4JCLA 4NUWA 4HVXA 2VEMA 3A3XA 3QW4B 1CW2A 2X1TA 4UNIA 4ZQNA 4LW7A 4EK7A 4IHCA 4HTBA 4DWSA 2PRLA 4AF0A 4PA8A 1IEQA 4UTWA 1G67A 2ZDSA 3BZJA 5C2GA 2NV2A 2OCZA 2YYUA 4GY0A 4DJED 2PLMA 1J93A 3CIVA 2WJDA 1O1HA 1V6UA 1DIDA 2VFDA 4IPNB 1MFVA 1TELA 4QS6A 2X8RA 4ZE4A 1VPYA 1RPXA 4B3ZA 3RO8A 2RH9A 5D04C 3E2SA 3UW6A 1UKOA 4LGXA 3BAWA 5C9WA 2EPMX 4UMBA 4JTKA 1AL8A 4Q32A 3W00A 3LRKA 4QFUA 1PJ9A 4POCA 2KX9A 1TRDA 1KTCA 1ZPTA 1ICPA 1W3KA 2HV5A 4JYFA 2Q6ZA 4LUTB 3UYCA 3VAVA 1XLCA 1M9HA 3APTA 4CNUA 4D71A 4LSBA 1H60A 4Q8OA 3DERA 3FOKA 3T2PA 1XIGA 1C91A 5CBIA 5EMKA 4CU7A 2E6AA 3RX4A 4G1KA 1J0ZA 3HPAA 3W7LA 1OM0A 1W3TA 3UA3A 1MW1A 3AIRA 9XIMA 1J96A 1FWSA 4REQA 4CEUC 2NWRA 3CNYA 4GIEA 1RVGA 8XIMA 3M9YA 1JYVA 4W93A 3FW6A 1CGUA 4ADUA 2XHYA 4O16A 3WBYA 4P8XA 3N6HA 2FFIA 1R7OA 2OO6A 3M5XA 3TQKA 3O6AA 4MZ1A 4Z42C 3DFSA 4D2JA 1XS2A 5A8GA 4ZMGA 2PDBA 4JX5A 1AG1O 4EXBA 3ITYA 2XFYA 4D8ZA 4PRTA 1CXIA 2NSOA 2HK0A 4C1NB 3O7UA 1QOXA 4PTDA 1E6XM 2QUVA 3DU0A 2YDAA 1QT1A 2BX7A 2CKSA 4TTGA 2QPSA 1TTJA 4MLRA 3RDKA 5G4EA 4RZBA 3P60A 3A9BA 3W2JA 1HKKA 1I8JA 1B3OA 2CKRA 1XH0A 3ITTA 3S6OA 1JCLA 5HJLA 4U3CA 1H3GA 1TE6A 1Q63A 2YCLB 1JNDA 4DF2A 4EPKA 2ZUMA 4M0XA 2P0IA 1RPKA 4KWOA 5CBJA 2XWDA 1IEVA 5JQ9A 2WVSA 2FHCA 3LCLA 4AEEA 3OP2A 3PG9A 2CW6A 1OIMA 1OT1A 5A2CA 5T91A 1HKWA 3IJQA 4PBGA 1F6KA 4QEHA 4HJWA 5EL1A 2WSRA 1YXCA 2V68A 1F61A 2VD9A 6ENLA 2YW3A 1P0EA 3WG6A 3WLQA 3PUEA 1K8XA 2Y89A 3LGGA 4Q4SA 3FY1A 2ZTKA 4JIEA 1LZOA 1OX6A 3PWIA 3H8AA 4E2OA 1J18A 4C5ZA 4IQLA 3UG8A 4YVPA 2Z7GA 1Z6KA 4LS0A 3JR2A 5IHSA 2WPBA 4GO9A 2R1PA 2IQDA 2OR2A 1PIIA 1ZJAA 3WF0A 4Q33A 3U7VA 1E1CB 3TJIA 2XIJA 4O0QA 1B3YA 8TIMA 4BFAA 1MVYA 2WV8A 4QDMA 3N17A 2GJXB 3BLKA 4O4WA 2OZ0A 3KRSA 4FPSA 3VZYA 4MB3A 2O4MA 4YTTA 4HCHA 2QIIA 3Q45A 4NZJA 3GDBA 2GWNA 3SO7A 3MMWA 3N9SA 3UNDA 1JXKA 3KTCA 1UKPA 3TXVA 4RNHA 4H9VA 4MNKA 3ME3A 3UVAA 2JKPA 4HNNA 3GTHA 1UPPA 1FCQA 1CXFA 2E8ZA 3R10A 1L6WA 3GNNA 3C8NA 3RNDA 1XDLA 2WZIA 2JIEA 2Z1SA 3NFUA 1F6YA 4MLJA 2NX1A 3I68A 2CNCA 3FCPA 1A0CA 3F5KA 3T07A 3H12A 4TXEA 3AYVA 1K8ZA 4YTRA 5A69A 2VX5A 3H23A 1TR1A 3CH0A 4PMXA 2YDSA 1E3ZA 5I78A 1FY6A 4GQGA 2AAAA 4AD5A 1LWIA 2BASA 3KAOA 1KBBA 3A4XA 2AAMA 4ZFMA 2HTMA 2PGRA 3EEZA 3GDMA 3G8EA 3CAWA 2PDMA 3BAXA 2BZNA 2V2DA 4W89A 3L0KA 1JGIA 2C1GA 4IT1A 1ICSA 2NUXA 1B3WA 1RCQA 4RZ4A 2QW5A 2A0NA 3DAQA 3MDUA 3OEXA 5H91A 2ATSA 2R1MA 4FOJA 3MO4A 3W83A 1FH7A 2ODOA 3WNOA 3W84A 5BMWA 1GVIA 4XWUA 4MY8A 4MVAA 1UKTA 3IJ7A 1PX8A 2WANA 4PULA 4K7YA 1XYCA 3S42A 1MUCA 5C70A 1OYBA 2G41A 4NL1A 4F8XA 1HVQA 4DAIA 4NF7A 3F4WA 1KW1A 3NXFA 4IUGA 3L4YA 4CCDA 1LP6A 4LF1A 2HBXA 3NQAA 5K2ZA 1BWVA 1S2VA 3N9KA 4DJEA 3RCNA 3HG2A 2VEPA 3IARA 5HPCA 2RKXA 3W29A 4E3VA 1XLAA 4MWAE 4DF0A 3CWOX 1YDNA 3NQ6A 3W1PA 2VX7A 2DZBA 2I5IA 2YLLA 4M24A 2JK2A 3PWAA 4AZ6A 1A3HA 1ZENA 2OQLA 2ZDRA 1SFSA 4M56A 2WNWA 2EQDA 1Y65A 1JZ7A 3G1DA 9XIAA 4NSBA 1QVBA 2J7BA 2WHMA 4PRRA 5K4XA 4E8GA 4BA0A 2Y5JA 1OEPA 4N6FA 2VZVA 3BCDA 5FL0A 3H2EA 2QVNA 1WNOA 4YYFA 1PCKA 1LBFA 1HF6A 4Y9AA 4ERGA 1W5QA 3OVRA 5CGQA 1WDPA 3ID7A 1Q7QA 2BHYA 3ABQA 1OFAA 3LPFA 4JQ2A 5B7ZA 3C0LA 4KW2A 4NI3A 1QPOA 4YCOA 1MDLA 3M6YA 4YWIA 3CQ0A 1LYXA 2D23A 4LNCA 4H9YA 1FDYA 1UASA 3FS2A 4Y2WA 2YFNA 3BW4A 1VJZA 1X8CA 2FDMA 1ICQA 2BODX 5E70A 3STEA 2DORA 3EX2A 1V6YA 3EDFA 1ZUAX 3ZR5A 1LCOA 2FKPA 1TZZA 4CN1A 3AXKA 5G2WA 1W3NA 4QR6A 3QH2A 3UWYA 1QI5A 2J25A 3C8FA 3H24A 3WLLA 3UXIA 5DBTA 1ZALA 1I4NA 1UR0A 2OZ3A 3UQNA 1FCVA 4QG8A 1W5NA 1V08A 3R94A 1A0EA 4NIRA 3AWOA 4GOAA 1V77A 4JQAA 2W3ZA 5CPLA 5IDZA 3WLOA 4NAEA 4J3TA 1A5OC 3RIKA 1R85A 1RALA 4X2PA 2D2HA 3O1NA 3V36A 3C3NA 1M7PA 4JTUA 2P1FA 2D24A 3PM6A 2J13A 3QZ6A 1J10A 3RFAA 5I3DA 3PG8A 1XGEA 1QW8A 4HGXA 1W32A 4IGNA 4UTTC 2QYGA 3OLIA 2J6XA 3PAJA 5ECVA 5LNSA 4MSSA 3U0HA 1I60A 4WOQA 4EPEC 3HFTA 3W38A 2I16A 2WCSA 1VP5A 3OO2A 3AQUA 1H09A 2DPEA 3CZKA 1K8YA 4GIAA 2PDHA 2R82A 2ZTJA 2VR2A 3G1AA 1XDMA 1UJPA 1SW0A 1TPB1 3WLJA 4IXXA 1L8NA 1F05A 4PUJA 5M03A 4A29A 1PPIA 1ITXA 1S2TA 1R30A 1I2OA 3FDGA 2ZUUA 1UG6A 3IJ6A 5EB8A 3GIPA 2CBIA 2V81A 3PN8A 4PE8A 3ITOA 3RMJA 1EYWA 3WDQA 4O1DA 2H6RA 1HJVA 1HJXA 5D2YA 3CYJA 4J4KA 1C7SA 3NYDA 1IR1A 3QOKA 2OPJA 3BC9A 4BQ3A 1IT0A 5AHLA 1OINA 2OYMA 4BF9A 2HJPA 4JTSA 2GGEA 2X0HA 4LC8A 3CMGA 4GVFA 1PVNA 2ZUVA 3WQOA 3NO5A 2WLYA 1BXCA 3MUAA 1DVJA 2OKOA 5FEWA 3SBFA 1C8YA 1Z44A 2DZPA 4AIUA 4CKQA 5LNWA 1SW7A 1WAUA 3DG7A 1SZRA 1UZDA 4AHPA 3AC0A 4AQLA 5CC3A 2RDXA 1PCWA 5C8BB 3CHCA 6TAAA 1K7EA 4JN8A 1AW2A 1A5BA 4RR4A 2QJGA 4ALDA 2YXGA 4R7OA 3W73A 3KRZA 3WD0A 3H22A 2NV1A 1U2YA 1XRVA 3IK2A 1Z9AA 4FS9A 3ISIX 1XIEA 1KQZA 4DBDA 2WB5A 4LYRA 2A7PA 4HOZA 1Z3NA 3GWQA 2PE4A 1GJUA 1B9BA 3HGOA 2HVNA 4O11A 3MT1A 2X2GA 4Q7IA 3GZAA 3MCNA 5J8LA 1QWGA 3VOHA 4HU4A 1JRCA 4KRZA 3G6MA 1GOMA 1WKFA 1UP0A 1GOIA 4YU1A 1VQTA 1GUVA 1R2TA 4GISA 4NJIA 3BXWA 1PV8A 2OSWA 2FTWA 1RJQA 3LZ3A 2YR1A 4ZENA 2ZOXA 2ZFAA 4W8BA 2WMFA 5D9NA 2V63A 5F2MA 4OBRA 1LUCA 3GXFA 4QITA 2A85A 3TW7A 4B2DD 5HWNA 4QJ5B 2X1IA 5AYXA 3HN3A 4ZVJA 4A4AA 3OGSA 3PTKA 3VMPA 4Y9OA 4K1GA 1M7XA 1V79A 4NZCA 3UR8A 3DHDA 4PN2A 3INPA 4JQ1A 1GGOA 1S2UA 4NX0A 4LUSB 3WO8A 3B8TA 3ITLA 3MUXA 1O5XA 2UV8G 1UMYA 4YL2A 2V5BA 4OOUA 5C9UA 2IPJA 3K46A 4KFNA 2W6RA 4ROQA 5ABFA 4C6NA 4GXPA 1EDGA 1G4EA 6ALDA 5AVHA 1UA7A 3PZIA 1XLDA 3LBOA 4CQCA 3UNTA 3VKAA 4HPJA 3WUBA 4A8RA 1LQ0A 1KBJA 4RE3A 1QBBA 4CD6A 5MKGB 3UG3A 3G22A 2HS6A 2OGYA 3ZFHA 5A8QA 5C2XA 4C65A 3L5MA 3I3BA 1LWHA 2Y7GA 2DU2A 1UROA 3CMFA 3QMTA 4W7UA 3W53A 4Z1DA 1JDCA 3RPTA 1EL3A 1T99A 2DEPA 3SQLA 4F0RA 1A5CA 1KO0A 1LOQA 1THFD 2G95A 3GH4A 5U7SA 1PHWA 3VIOA 3EAUA 1E72M 1OQFA 3I7SA 4Z1AA 1E71M 3CUJA 4J3ZA 1PZ1A 1WBHA 3JW7A 3DGBA 3QTPA 3OIXA 3B8SA 4CUCA 4UCFA 2VGIA 4KIEA 4XTDA 1B90A 1KTNA 6A3HA 3NDZA 2BHUA 4IG2A 1DXIA 2VVNA 5EBAA 2V38A 1MNSA 2XN0A 2XISA 4S39A 4O12A 3QGKC 4V33A 3ABSA 4OHQA 1HJWA 2DVXA 2P50A 4F48A 3OGRA 4AD4A 1JYWA 3HMCA 1FRBA 4LB3A 3LM7A 2ABAA 3R0DA 2V5JA 4K38A 3RMEA 4RNFA 3BL3A 3H7RA 1VFUA 3KRBA 3MP4A 2B31A 3W75A 1HVXA 2NQLA 5JBEA 3W74A 5IXEA 3T40A 4FMVA 4E4PA 4F0SA 3HZ3A 4AMCA 1S46A 3HIJA 3EOOA 3R12A 4YCPA 1IQ8A 1E9YB 1JZ5A 2Z00A 4JHZA 1HKJA 4DXKA 5CGMA 4AC1X 3FLUA 1H2JA 1L6FA 4TO8A 1PKNA 2XGBA 2HCVA 3LHTA 1D3HA 2QCMA 1K03A 1WZLA 3M6DA 4MKSA 3NWRA 4Q8QA 2PWDA 3GC5A 4RDYA 3KLKA 1B0IA 3PZOA 2XFFA 3MA8A 1XISA 3QLLA 3E3HA 4WGXA 2QUNA 3R43A 2VRQA 2WZHA 3LXAA 3G3DA 2ZZ7A 5A8NA 1KBIA 2X7WA 3TYZA 3PPHA 3FVDA 4I7WA 4Q4KA 4PMJA 3W02A 3NGFA 1QNSA 1R9XA 3WQ5A 1MDRA 4HK7A 2VEIA 4I6KA 1QI3A 2D0FA 3THDA 3MMDA 1ISWA 1ONRA 3SCOA 5FI8A 1VEMA 1W9XA 1RQBA 3OIHA 1OY0A 3W81A 3W2KA 3QY7A 3V7PA 3MTWA 1KM4A 1F4AA 4S3AA 1TVNA 1QOPA 3L4UA 4O1EA 1YTKA 4J3UA 4PBEA 4AX7A 2GWGA 3WNMA 1EZWA 1M01A 5HDRA 3ARXA 2QCLA 3WBXA 2ZZ6A 4HSNA 2OT0A 5FF3A 4UQDA 2ATMA 1UJQA 4WQ6A 2QAPA 1E1FA 5AC4A 4JY9A 1RR2A 1SVDA 2I7GA 4RNIA 3S2MA 3PF3A 1UBSA 1VZWA 2VQUA 2DT2A 5I3HA 1I45A 1D2KA 4F79A 2YXXA 2VC9A 1EJVC 1O5QA 2ZXAA 2YXOA 4XG1A 5HQLA 4QSHA 3QMSA 3AMDA 3CUFA 2AMGA 2C1IA 4ZSTA 5T9BG 3FEQA 3VOJA 3S1WA 1AW1A 2FPTA 3GHUA 3F7JA 1X1ZA 2V3EA 1JG9A 1JL8A 4P8WA 3TFXA 3UR5A 4M1BA 4Z2LA 1GVRA 1SJBA 4HSOA 4B91A 3UZZA 1KGXA 2R94A 2BXZA 4A2RA 1DJQA 4XZLX 2F6KA 4UZUA 2ZADA 1AA1B 1R46A 2BVWA 2RGMA 3WK0A 2WJFA 3FYYA 2ZZ4A 1QPKA 1FCUA 1L0PA 3W7JA 3MP5A 3BJTA 3FHAA 2XG9A 3EXRA 1ZHAA 3FJ4A 3CBWA 1F3WA 3VXGA 1VCGA 2ISSA 2CITA 2WW5A 1RXOB 1JPIA 2PC8A 4NNCA 1ITQA 3AHTA 1W1YA 3GY1A 4O0ZA 2Y5EA 1PTGA 4H9UA 3GC4A 3QV9A 1X1OA 2DUAA 2RJGA 3T9PA 3ZXWA 1OJXA 8CGTA 4P7LA 5DY3A 1V4YA 4HNLA 1GT8A 2QCDB 1EF2A 1VPXA 3EB4A 1XRSA 3MI6A 3BOLA 2V3GA 2OWCA 3T0DA 1JULA 5LA0A 2ISVA 4B2DA 1MQRA 1MZHA 2OOGA 1OADA 3TJ4A 2HRWA 2WQDA 3SM0A 3OZMA 4URIA 3N4FA 2ZZ1A 1PYFA 3AYTA 1H11A 5A94A 1JF5A 4HNVA 1H0IA 4BR1A 1KM5A 2C15A 4EAYA 4F2TA 3SQSA 2Z6IA 1YIXA 3GS6A 3VOIA 1AQHA 3RYSA 2QF8A 2BXVA 4RNJA 1EQCA 3OBKA 2H9AA 3VNMA 3C2RA 3H2FA 1X7IA 3S6TA 3MBFA 3AUOA 2HS8A 4AFYA 3TZFA 4IMGA 4UNKA 1DE6A 4CQBA 3P74A 2AKZA 5DXYA 3S9ZA 3ZYZA 1G7VA 1VYSX 1JQVA 2FJUB 4PL1A 4DLFA 2Y7DA 5GNXA 4AH7A 1RBOB 3N04A 2GVEA 4AY7A 3O16A 2Z28A 1T0OA 4DWSC 1BG4A 2HPIA 4UTWC 2L5HA 2YJQA 3PULA 4H01A 4B5UA 2TYSA 4TOQA 3G6LA 3BTNA 2BGQA 5HATA 1YXDA 4Q4MA 1OWQA 1FVPA 3LRLA 3H4GA 3B0YA 3TTSA 4AZ5A 1I6NA 1CECA 1T6MA 2FJKA 1P1MA 2O7QA 4O15A 5A6BD 1D3CA 1NOFA 1PS9A 5EA9A 4N2YA 1RK5A 4S2CA 3VIIA 6REQA 1SJAA 4IP7A 3BICA 5CXPA 3PUGA 3VZXA 1KLYA 3GIYA 3D46A 1KFWA 2FHBA 3CWHA 3GDTA 5JVLA 4DWSB 5IRPA 1IZCA 4AF0B 3QY8A 5J5RA 3NG3A 3D6NA 2VCCA 2E5CA 2Z29A 4O18A 3WJYA 1Q6FA 2I57A 3TNOA 3VE7A 3RCMA 3N19B 1QPNA 3K1GA 4PUDA 4PEEA 1EO5A 1W56A 1R0MA 1TJ0A 1J0IA 3BJFA 4QLLA 3KBNA 4Y90A 3K4WA 5DFAA 1Q66A 2Z26A 3V16A 1PYMA 3NQDA 3W2MA 1W9PA 3MSDA 2QF7A 3BLPX 1VJSA 5I0DA 1WKYA 2BGNE 1R47A 2B0MA 4J9JA 4JIIX 1EGVA 4MJ4A 3GXPA 5AYBA 1BTCA 4LEFA 3N9RA 1BSLA 2QDDA 3EOEA 3G18A 3TWBA 4MNMA 5BXRA 3I3EA 3HOJA 3LENA 2VRJA 4AD2A 4IICA 1Q6QA 3KCJA 3PANA 3AIEA 3WLSA 1XYBA 4NZFA 3QY6A 4GCAA 3GHTA 4FR1A 2Z1VA 3WFZA 3RXZA 3T0CA 3QMRA 3HO8A 1QASA 1XGZA 1LLWA 2ZRZA 3PZTA 1RA5A 1E4IA 3L7RA 3B8VA 1SJDA 5LNRA 1XX1A 3WQ6A 1JF6A 1YTDA 2RGLA 1UOKA 3HU7A 5KZEA 4J1OA 3KBWA 4OVXA 1EBGA 2D73A 4KWSA 1US0A 1W5MA 5H8MA 4U2ZA 1D8CA 4ERIA 1XD0A 4MDPA 4Z1YA 4HA0A 1QO5A 1KWGA 4KGLA 3R0UA 3D3AA 3KCOA 1Y5XA 2WWCA 3KL0A 1Z48A 3NA8A 5FF0A 4DI8A 4YVVA 2ZVRA 3LHWA 5K7JA 1KRCC 3LQGA 1JCMP 4D6EA 4QM1A 2YX0A 1QR7A 4NKCA 1UR2A 4KEVA 2PD5A 2WO5A 1VPQA 2VWSA 5D33A 1GVEA 3B40A 4RPQA 5JU6A 3WK2A 4UTIA 4J27A 3TSMA 2YSWA 1V02E 3MB9A 3VGFA 4MTVA 1XI3A 4IFRA 3QHNA 2XVLA 3R8HA 3SCRA 3UU0A 1ZJIA 3LHYA 3TC7A 5M2FX 1TPC1 3S2JA 3NQVA 1K70A 1EQPA 5BMXA 4PMDA 3GDLA 3NUKA 1KFLA 3AIBA 5ABTA 4MAVA 3BLDA 1LRNA 3OA5A 1OHLA 2P8BA 3ZZ1A 3AS0A 3JVAA 1Q4WA 2CPUA 2KZHA 3CV2A 2VT0A 3AXXA 1PBGA 1R5YA 3OTRA 1E4MM 5H2ZA 4KCVA 2X30A 1ISYA 4U33A 1GVOA 5LYRA 1E0UA 2GYIA 2PI6A 3U2ZA 5HR7A 5I79A 1M41A 1N8IA 5L9FA 3PS7A 2ONEA 1F07A 5DCBA 4QGCA 3FFSA 4HB7A 3S5OA 3WX7A 4MJ2A 3EWUA 4K3ZA 3Q37A 3W1MA 2PF8A 3WK1A 1R9YA 1IIHA 1TPEA 3QHOA 3VKCA 3QGAC 4W5ZA 5B7YA 5LHFA 1AUSL 4CD7A 4GQQA 2NLIA 2C19A 3VKBA 5TD4A 3T4CA 3WQFA 3EKZA 1M7JA 2Y2WA 5FEZA 4PMOA 2YBTA 5EY5A 1POJA 3QM3A 4FLOA 1XIBA 1XQLA 2BMBA 1VFHA 3GG1A 1XFCA 1EJRC 4X0NA 4DWDA 4HK5A 1EJXC 5JUVA 3GXMA 5A6MA 4MF4A 4E3TA 1ZCOA 1XLBA 5G1TA 4NQ1A 5CG0A 1VEPA 3N18A 2MANA 3T44A 1E1EA 3LGDA 3LY0A 5E09A 4M5PA 4EXAA 1N55A 3SY5A 3KVMA 1LLZA 1AD1A 3VM7A 2B7OA 4S1FA 2X16A 2CCRA 4MKVA 3QC0A 4FOKA 1Q13A 5AY7A 4D8LA 4KRUA 4W8LA 1ZP4A 3N14A 4UTUA 3I4EA 3KOZA 4QTGA 2WMHA 4IIFA 1ZL1A 2NUWA 3M1ZA 2PUZA 3UCCA 4O13A 1UUQA 4XBSA 3GRIA 4BK9A 4C1NA 3KXQA 2D2JA 1S2CA 3BSMA 4R53A 3T78A 1BYBA 4KFOA 2YOCA 2QJJA 4JTQA 5GQBA 5B80A 1WDQA 4KERA 1XV8A 1VH7A 3S2LA 1Q7ZA 1XPYA 4DZHA 1PB0A 1VYRA 1FFQA 3LCIA 2QDEA 2E1DA 1WBJA 3DI0A 3L68A 2J7DA 2G0WA 3W9ZA 1N7KA 1Q4NX 1K4HA 3GXIA 3FDKA 1NDWA 3W25A 1Z41A 1JCTA 1CEOA 2NQZA 3NZQA 2YCLA 3BV7A 1DXFA 1IEIA 3UWVA 3MCMA 4NY2A 4AZCA 2VOTA 3G1YA 1VIWA 3GW3A 1J11A 4DJEC 3URQA 4O1FA 1NELA 5BXSA 2OEMA 3AIUA 2Y5SA 4NYYA 5JBFA 2JIWA 3C3UA 1NOUA 2ALRA 2Y88A 3WDPP 1RBAA 4P8UA 3W7MA 3SFWA 1GPWA 4ZBCA 4GNJA 4MKNA 1RQEA 3LCWA 2NXHA 3VGEA 4CD4A 1E6QM 1O7AA 5A6BA 2C1HA 1Y5VA 1SQ7A 3K5XA 4K7VA 1TWSA 3RM9A 2EPLX 3CYVA 1TMHA 2E0PA 3EPMA 3OQEA 3P8IA 4LTSA 2Y61A 1F76A 4CQDA 2CYGA 4HZMA 5BRPA 1K3UA 5H8PA 1OSEA 3IRSA 4DX3A 3OVGA 3THUA 5CH9A 2XPKA 3RILA 3S5NA 3A3HA 1JYNA 1IWBA 4BJHA 3VD9A 3M64A 2FB3A 3ONBA 1UQZA 3APYA 3UYIA 4O8AA 3B9NA 4WZHA 3WLMA 4G56A 5K4ZA 3Q65A 5C9XA 3AFBA 1QBAA 6XIMA 4Y6GA 1AL7A 1ZAHA 2ZUTA 2FPVA 4JKLA 2BHZA 1X6LA 2F9RA 2CZEA 3KRUA 3U4AA 1E4NA 1XXXA 1DTUA 2QDGA 4B15A 1H61A 4F2UA 3B0PA 2WM0A 1RV8A 3BG9A 3U9IA 2XJ7A 1UKQA 4FK9A 3IGUA 1BVNP 4YWSA 3CT7A 3PHAA 3EA1A 1FDJA 2QUUA 1XBVA 5D9MA 1IR2A 1BGAA 3LPGA 4C6IA 2EXOA 2VC5A 4P2VA 1OK6A 4ZXOA 1J4EA 1TPDA 1HL2A 3VX1A 2JF6A 5EGRA 5CAHA 1I0DA 4S3CA 5AZ0A 3CUZA 4RXFA 3CB8A 3C4UA 4KT2A 3W6LA 4CNNA 4EF9A 2VM8A 1SO4A 4IF2A 4O10A 3GIQA 3BSHA 3CEPA 3OBEA 1PKLA 4ZFCA 3BMXA 4IQJA 3WELA 3A6OA 1MQQA 4K8EA 3VDGA 2ISDA 1J01A 3GH5A 4HNCA 2R6OA 1MRQA 4ML4A 1M68A 1MUMA 4ICNA 4ZGYA 2GVJA 4XD5A 1UQYA 5I02A 1MXGA 2C0HA 2VDGA 3AISA 3V0UA 3URNA 2AQOA 2X0YA 3LCHA 3ZR4A 1O60A 2AOSA 1VLIA 4UOZA 2WSYA 4AVFA 4LB4A 2WC4A 5E0FA 3GO2A 3QPEA 4UZSA 8A3HA 3WIJA 2VZSA 3S0CA 3KUMA 4AIOA 4DNMA 4QE1A 1AH0A 1B4KA 1TPFA 3EB3A 3P84A 1RLDA 3W88A 3NL5A 1TTQA 3VILA 4N7QA 1CPUA 1HIZA 4NZ3A 2PDIA 5IBXA 1ME9A 4LV4A 2BY2A 2RDTA 3A12A 3QW3A 4UFMA 3VC5A 2R8WA 4AB4A 1KKOA 1TRIA 2NUYA 2PD9A 2A79A 3GHSA 3T7VA 1OFQA 3BCFA 3UP8A 3DFQA 4JFUA 3K4DA 1TIMA 4JQ4A 1MZRA 5C55A 2E9BA 4YTUA 3ALFA 2OODA 4JIRA 3NVTA 2FVMA 2DVUA 2FGBA 1NDVA 3UZYA 3SR7A 4AC7C 1PZ2A 1PWMA 3TH6A 3AHVA 1NVMA 4DZIA 4H6QA 5HMFA 5XIAA 4FXFA 2OLAA 4OECA 1Q6EA 4LOCA 4MAZA 2ZA3A 4IIBA 3AZRA 1FX6A 3ZSTA 1KCKA 4TV5A 4PMYA 4KCWA 3W27A 2GQ8A 4HJFA 4UTKA 2XZ9A 3O05A 3O0KA 3M46A 1VFMA 2QKFA 3TN6A 1Q8JA 1O4UA 4OE7A 4XBJA 4UTJA 3KL5A 3W1QA 1ADDA 4NHVA 1XH2A 1TX0A 1CWYA 3N15A 3D0CA 1HX0A 1FH9A 1K9EA 1A49A 3TK7A 1GEQA 3LDVA 3GBEA 3GYEA 1KFKA 4PB4A 4A21A 4BY3A 4E2DA 1S39A 3W7GA 2PDPA 2A3CA 2W63A 2Q8LA 4H83A 4E2VA 1R2SA 2XINA 1DHKA 4O50A 1V3MA 3W7RA 4H9XA 1M7OA 4LV9A 4U4MA 1KWKA 2XH7A 7ODCA 3NAVA 3P0XA 3N3TA 2TODA 3P80A 1ZCCA 5HAOA 3PY2A 3KBMA 1PO9A 1POKA 1T7LA 2YIHA 1U1HA 2ZC8A 4OIFA 1Y5WA 3KWXA 5D02A 4NZ5A 5CZ0A 1UKSA 3NSXA 3B4UA 1MW3A 4Z2JA 4PUWA 1IHIA 4MB5A 4L6HA 1V3JA 1EUAA 1BKSA 4JYDA 3TIMA 5BNKA 3OG2A 2OLSA 3S83A 4O14A 1XPGA 2SFPA 1JCYA 5HQMA 2Z1KA 2NVCA 1L2QA 1E43A 1N82A 2EJAA 3DKLA 3YPIA 4IIDA 3AZSA 4FNTA 1JDEA 2ON3A 2I5QA 4XQ6A 3FYOA 4JFSA 4QJ4B 3GBDA 4HYRA 1NF0A 4DUXA 4FSAA 4Z1CA 1F3TA 5KITA 1DJYA 4HMDA 4P7OA 3DCPA 4IMAA 3K8KA 3LNPA 2DZVA 5I07A 5LIXX 3ZLHA 3GNXA 4FNUA 2CHRA 1CGTA 1NDYA 1CB2A 2PP1A 4UFJA 3BOFA 3M0XA 3NR0A 3A64A 3PR2A 1TFVA 2QCGA 2DH2A 5D2VA 3F2DA 2DQWA 1SU5A 1EPXA 4YLWA 3IJ9A 4OWGA 1RY0A 1DXEA 5E0CA 3ERPA 3KP0A 3V5CA 1KCLA 3QQ0A 1U1JA 3LTPA 2XTKA 1YX1A 1LUCB 1Y8BA 2QZRA 1H0GA 2A3HA 3DC0A 3WSUA 4HA1A 1L9WA 1NFBA 3LQLA 4B5SA 1HGWA 1DV7A 3ATYA 3GFZA 5CGTA 3FX4A 3QLDA 1US2A 2F8QA 1XLKA 2V3FA 4W7VA 3ZIZA 1Q8AA 5CCZA 1CTNA 3TP4A 5AFDA 3NJ3A 4B9YA 1YRRA 1W91A 2OU4A 3W1TA 4AMAA 1F8IA 2A6NA 4EVZA 1JPKA 3EDJA 4PUMA 3CPUA 4AG0A 3MSYA 2ZWZA 5ABFB 1RBLA 3A23A 3I10A 3LV6A 1KRMA 2IW0A 3LCGA 3QSRA 3V0SA 1XD1A 1Q2SA 1H62A 2ICSA 1AH4A 5HOSA 1LL4A 1ZFJA 4X3ZA 3SJNA 4LBRA 3O0FA 1W17A 3LLFA 4FR6A 4IPLA 1J79A 4IZGA 1LM1A 2JKEA 1M1BA 3IV3A 3KZPA 4K8GA 4Y8EA 1KA9F 3AALA 1O12A 4Z2IA 3W76A 4B92A 2HPMA 2EGZA 1TX2A 3M0VA 1JDFA 2PCQA 3VX0A 3MUZ1 2VR5A 1XCFA 4FO4A 1QHPA 3VMNA 4G7EB 2IQTA 3PB2A 1EFZA 1ME7A 4XZWA 2ISWA 4R27A 2XSAA 4UQEA 1LJYA 5DMNA 4BWLA 1TJRA 1JCNA 1TO3A 1FTXA 2J7HA 4Y8FA 4PUUA 3AIWA 1IV8A 1K9TA 4HNOA 4JTLA 4XV0A 3FV9A 4M6VA 4IMFA 3UGVA 2CLHA 4B90A 4GUGA 1H7WA 1EBHA 1EJTC 4GYKA 3OODA 1HGYA 2E67A 3CAVA 4W4QA 4ZQCA 1SFTA 2WMIA 2PWUA 2YZRA 3TUUA 3HURA 3G77A 1I1WA 3VYLA 3W4RA 1XLFA 4GK8A 2QUTA 4HPNA 4LPCA 5LNUA 2H3BA 2NXGA 1MXSA 3E2VA 4UFIA 3N2CA 1LG1A 3KW3A 1KM0A 4TVDA 4KWWA 3IS4A 4L7ZA 2DW7A 4Q6JA 1GZJA 3TXZA 1XM3A 3WQ8A 5HQEA 4YS1A 4PUEA 3DENA 4GIRA 5CC7A 5CC5A 3MV11 4GINA 4U28A 3W37A 2C71A 1QO2A 4PFMA 1GG0A 5DQPA 4RW5A 5DRIA 4E6MA 3VKKA 2E09A 4MYXA 3PUDA 2O7SA 2W67A 5LSMA 4W8AA 4GYJA 3OLEA 3HG4A 4JDBA 4W87A 3W7CA 1A5LC 4ZZ9A 3EWYA 3O8AA 4RZ6A 1TPWA 5F7UA 3CEUA 3M0JA 4PBFA 3H2NA 3N3MA 3EXTA 2XWEA 4A8IA 4ZO8A 4LUJA 4XBKA 1RLCL 3HFYA 2G50A 3TV8A 3AO0A 3WF1A 2Q8XA 4W85A 3B3DA 2DZTA 1I2PA 3W26A 2X1RA 4LAOA 3GNOA 3QBUA 3NQEA 1FWIC 3G2GA 5MKGA 1JQXA 2P76A 1E73M 4QAWA 5C54A 3EX4A 1XLJA 1CLKA 1HKVA 1FWRA 5M1TA 3PBMA 3FXGA 3M47A 4CGTA 3ATZA 1XIHA 3G1HA 4X2RA 4QIUA 3L5LA 4IL2A 1PWLA 1VCVA 3RPDA 2QMJA 2TPSA 2WSPA 2J7CA 4NG3A 4MZ8A 3WQVA 4HNTA 1EZ2A 3LLXA 2HROA 1EJSC 3VD3A 1FDZA 4HOWA 4C6LA 1OIFA 5CLTA 1XBXA 4ORIA 1DWHM 1GKPA 4I9TA 2J79A 2PDFA 4GPNA 4HHLA 1DBTA 4UFLA 4MB4A 4GI8A 3UZ5A 4GKTA 1UMLA 5EFFA 2ZX7A 3ES7A 3IJLA 4XAFA 5D38A 1N2VA 1W2PA 3ZT6A 1XR2A 2V30A 1JJKA 5LIYX 4S3JA 4UMAA 1HTIA 3THAA 1TQJA 2IKHA 1NOWA 4IX0A 4NT0A 4HYVA 3JZUA 1ODZA 4DXXA 3RHGA 1OF8A 2EHHA 3WNLA 2DT1A 1EC9A 1JUKA 5CJ5A 3RRXA 4JDYA 3ZOAA 1WE5A 2JKAA 3H26A 4HZ6A 4NU7A 1E4LA 4QDPA 4IGSA 3VM5A 3CZJA 5AC6A 3F2CA 3V1PA 1C90A 3SJ3A 5C2CA 4AW7A 4V2XA 2BBFA 1K8CA 2A21A 7XIMA 2OQHA 4IIEA 4X0VA 2JEQA 3PC0A 4ADSA 5HWJA 1O5RA 1X38A 1J5SA 1XC4A 1OC5A 3L4ZA 2YGYA 4ATDA 4TVCA 4FNSA 4UFKA 4XUYA 1SR0A 2XGIA 3RLGA 1H50A 1FXQA 3VC6A 3L12A 4IJRA 2QDHA 3ONCA 5D30A 3C2VA 4HOXA 4XX6A 3VNKA 5D9OA 1GORA 1E56A 2OKTA 3WH5A 5I2UA 3CV6A 2ZQ0A