2PDJA

Human aldose reductase mutant l300a complexed with idd393.
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
315
structure length
315
Chain Sequence
ASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCAALSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Merging the binding sites of aldose and aldehyde reductase for detection of inhibitor selectivity-determining features.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Aldose reductase
total genus 106
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2007-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2pdjA00
3H4GA 2ACUA 3EAUA 4GABA 1R38A 4OTKA 3BV7A 5C7HA 3UG8A 3LBOA 4JQ2A 3RX3A 2I17A 4DBUA 1AZ2A 2FVLA 4L1XA 2HVOA 4YU1A 3GHRA 3M4HA 1US0A 4JQAA 1EL3A 2HE5A 2IKHA 3LUTA 4YS1A 5LIXX 4YVXA 3Q67A 1VBJA 2DUZA 2DV0A 1MI3A 3G5EA 4WDTA 4IJRA 3C3UA 4XVDA 1S1RA 2C91A 3D3FA 3WCZA 4LAZA 4QR6A 4GCAA 3R7MA 3EB3A 2PDXA 2ACQA 3F7JA 3CV7A 4LBRA 1T41A 3H7UA 3COTA 2AGTA 3GUGA 4FZIA 2IPFA 2PDYA 1YNQA 4XZNX 3UGRA 3V35A 2QXWA 1AH0A 1M9HA 2CLPA 2DUXA 2BGSA 2J8TA 1S2AA 1Z89A 3LQGA 4GIEA 3WBYA 1PYFA 2PDLA 5LIWX 2PDWA 2PD9A 4WDWA 1SM9A 2HE8A 4Q7BA 2PDKA 1PZ0A 1YNPA 3EB4A 3MC5A 2F38A 4JTAA 1OG6A 2PDPA 3R8HA 3R43A 3WBXA 2IKIA 3BURA 1PWLA 1Z3NA 1UR3M 1PZ1A 1HW6A 1A80A 2I16A 4XAPA 3UWEA 2PF8A 3UZWA 3V36A 5JH1A 2IKJA 2INEA 3O3RA 2PDUA 1IEIA 3V0TA 3LENA 5AZ1A 1LWIA 2PDBA 4DBWA 1HQTA 4LBSA 4I5XA 3U2CA 4WRHA 3UYIA 4DBSA 5HNUA 2P5NA 3KRBA 2IKGA 3T42A 3LEPA 2ALRA 4QX4A 4JIHA 4IJCA 1AH4A 4EXBA 3DN5A 3LN3A 3Q65A 5LIUX 4DZ5A 3LD5A 3CASA 1S1PA 1EXBA 2VDGA 1YE4A 1J96A 4F40A 5LIKX 3FX4A 2PDQA 4PR4A 1Q13A 3BUVA 2PDIA 4JTDA 2IPWA 3GHTA 3RX2A 1ZSXA 2PDHA 4JIRA 4H8NA 2PDGA 4GQ0A 3FJNA 2R9RA 4HBKA 2FZ8A 4ASTA 1ZGDA 2PEVA 4EXAA 4JTCA 5HA7A 4XK2A 3R94A 1AH3A 4WGHA 3R8GA 4JTRA 3LZ5A 2NVCA 4Q3MA 1XGDA 1MZRA 4ZFCA 4IGSA 4JTQA 4PRRA 1S2CA 1K8CA 1C9WA 1EKOA 1X96A 1RY8A 4LB4A 3VXGA 1QWKA 3H7RA 1RY0A 2PDNA 1ZQ5A 4XZLX 4R9OA 3M0IA 2IS7A 3B3DA 1Z9AA 3BCJA 2HDJA 2PDJA 2PD5A 4NKCA 1VP5A 5JH2A 5LIYX 3WG6A 1Q5MA 2HEJA 1LQAA 4XVEA 4XZHA 1QRQA 1AZ1A 1Z8AA 1EF3A 1AFSA 3M64A 4PUUA 3WBWA 4XO7A 3UZYA 4FA3A 1XF0A 1X98A 4XZMX 4PRTA 3NTYA 3RX4A 2BP1A 2IPJA 1FRBA 5HNTA 4FAMA 3ONBA 5M2FX 4PUWA 4PMJA 4MHBA 2WZTA 3GHUA 2PDMA 3V0UA 5KETA 3GHSA 3G1RA 1GVEA 2PDCA 4H7CA 1MRQA 2WZMA 1PWMA 2R24A 4YVVA 4JQ4A 2IPGA 4QXIA 4GA8A 4JQ1A 4WDUA 3S3GA 1JEZA 4LAUA 3V0SA 2HV5A 4GACA 4ICCX 3LQLA 2INZA 4XO6A 2ACSA 4YVPA 3CAVA 2IQ0A 1RALA 3DOPA 3R6IA 2FGBA 4AUBA 1IHIA 1X97A 3MB9A 1T40A 3UP8A 3LZ3A 3QKZA 3N6QA 2PDFA 3N2TA 4GQGA 4RPQA 4XZIA 5AZ0A 4JQ3A 4L1WA 4HMNA 2PFHA 2NVDA 2BGQA 3LNMA 3O0KA 4QBXA 2F2KA 2FZBA 2IQDA 5DANA 1ZUAX 2PZNA 3ONCA 2ISFA 4G5DA 4JIIX 3R58A 3UFYA 4FALA 2FZDA 2HVNA 3UZXA 3UZZA 3CV6A 3CMFA 4WDXA 2FZ9A 4WEVX 3ERPA 2ACRA 1ADSA 1YE6A 4LB3A 1XJBA 2A79A 3CAQA 3P2VA
chains in the Genus database with same CATH superfamily
1JULA 1V3JA 3H4GA 3RFAA 2FTWA 2YA2A 4H9TA 3W1QA 5C7HA 3G8RA 5I02A 1XUUA 4UFKA 4LH8A 1JYNA 1SW7A 2I17A 1JVNA 1IGSA 1HT6A 5CXPA 3PBUA 3FA3A 5I3IA 3KBSA 4XD4A 1R47A 5C71A 4JQAA 1W9XA 2ZA1A 1Q7ZA 2HE5A 3R2GA 3T81A 1KBBA 2EPMX 1WV2A 5AB3A 2TSYA 1YW1A 3JVAA 2ZUNA 1RJQA 1BSIA 2VTFA 4WKFA 5C9WA 4FXJA 4IJRA 3WYZA 3WQFA 3G0SA 1MRAA 2EPKX 2QCDB 1E5JA 2NQ5A 4LBRA 2PWDA 3UZ5A 3COTA 1PKLA 3AHTA 3C0QA 1K4HA 4ILSA 1AVAA 4FNTA 1JAKA 2EPOA 4DWDA 1LLOA 3N3TA 3OGRA 2O9PA 4I5UA 1QASA 1C91A 4WJEA 1Z89A 6XIAA 3LK6A 3A3WA 3PZMA 4W86A 1XLMA 1W5OA 3WBYA 3EB2A 1DYSA 2A5HA 2G3MA 3BLIA 1LL4A 1ZJAA 1QNOA 3S2JA 1AQFA 1JGMA 3W23A 3DYPA 3QGKC 4EF8A 3W71A 3RN6A 1O4UA 3M0MA 3NCOA 1ITQA 3TTYA 2QUUA 4K8HA 1UD4A 1CW2A 1KRMA 3WF4A 5CAHA 3WBXA 3WIJA 4Z1AA 1S5VA 2QULA 3THQA 3BURA 3LERA 1PWLA 2HZGA 1JQXA 3QYQA 4QG9A 3GG1A 1SYTA 3I7RA 3SCRA 3NO5A 4PSPA 2VD9A 5HULA 4GYPA 4D2JA 1LP6A 1FWTA 3UXIA 4QISA 3VPLA 2OELA 3PBGA 4EP8C 3TN6A 3WLIA 3PTMA 3SW6A 4FR6A 4RZ4A 3C2VA 1KLYA 1W9DM 3L12A 2JKAA 3QLLA 5MKGB 3CQJA 3BAKA 1B31A 4FOUA 3UJFA 3K1DA 1JRBA 4G8TA 4PYSA 3RRAA 3IK2A 3KRBA 3FYOA 3FOKA 4OBSA 2VCBA 3CAWA 4QX4A 4RW5A 3T05A 3N19B 4JTKA 5L6UA 2QCDA 3E5BA 2Y8UA 5CPSA 1E1EA 4F40A 5LIKX 2QUVA 3UU0A 4JTIA 1OFAA 5REQB 1TPVA 1BD0A 4JOMA 2NX3A 2VC7A 3TJ4A 1W8GA 3DFNA 3RX2A 1V0NA 1VC4A 2PDHA 1EJVC 4JFSA 3ZWSA 1WPCA 4JNYA 2QPXA 3EMCA 4HNNA 4GY1A 3TX9A 2O55A 1CXIA 2OSWA 3GDLA 3WLJA 3LPFA 1ZL1A 1JIBA 4JGDA 4DO6A 4KESA 2F61A 5K2ZA 5MF5A 1KTBA 3DFQA 2B4GA 3M7WA 2AQVA 3AMKA 3WLQA 4GY0A 3FDGA 3SCUA 1C9DA 1S2CA 1P0DA 5EB8A 3QF0A 3GXDA 2CU0A 4AWUA 1A5OC 3WK0A 1TR1A 4W8AA 1UR9A 3V5OA 1E73M 3EX6A 2PU1A 2J24A 1NOFA 2EG7A 1UUMA 3XISA 2FLIA 1A50A 3TOPA 3LG3A 4MYAA 4Z2GA 2CLEA 4P5UA 3BGGA 3DHDA 2XVKA 4UR8A 1NELA 2XG9A 4FR1A 4D1IA 3MPGA 2B7PA 3VD5A 1UC5A 4OZOA 1XLBA 2REQA 4IM4A 1IXNA 3W9ZA 2XTKA 3GNRA 4ZOBA 1LOQA 1KFWA 4XZMX 3GU1A 2A3HA 4UQCA 2G3FA 3EDEA 1BWVA 2PBOA 3AIEA 3ZR5A 8RUCA 1GKPA 1B2YA 4PUWA 3ME3A 4P2VA 3GHUA 2O9OA 4AG0A 1F5ZA 5F4WA 2PDCA 3M5ZA 3ZT6A 4DJFA 3UY8A 3E3HA 2DIKA 2DGAA 2GGGA 4NHVA 4QXIA 2IPGA 1XBYA 4YHGA 3AIWA 3ARTA 1UR2A 4JHOA 2QCHA 1EF2A 4EWND 2ZUTA 4O0QA 1E3XA 2ACSA 2VFFA 3TYCA 1RALA 1TPH1 1V77A 2V5LA 1V3LA 1J79A 3C0SA 4AUBA 4B91A 2ADAA 4O28A 3MP3A 1A5MC 4IMFA 2PC8A 4UMAA 3PUDA 4HU3A 2HXTA 1WDRA 2CBIA 5F1UA 3SJNA 4F3HA 4HK5A 2YL6A 4PMQA 2BGQA 1OABA 2YCIX 2HXUA 4L7ZA 3SI9A 4BF5A 1ZUAX 1TIMA 3MKCA 4JTUA 2CFFA 1VJSA 2TAAA 3TQKA 2QIIA 2Y7DA 2ZE0A 3DC8A 3IIZA 5BCAA 3ZR6A 4V15A 5GVJA 1L9WA 3AS3A 4X9SA 1K70A 2VX4A 3R12A 3EA3A 2I1OA 1V7AA 2ODOA 1PKYA 4Q4MA 2AKMA 3W7QA 4NAFA 4OTKA 1O94A 3W7LA 4PCTA 3KZSA 9XIMA 4IP5A 3CTLA 3U57A 3GWQA 3TCSA 1JXJA 3EX3A 2POTA 1MXSA 2G95A 1EQCA 3EMZA 1CEOA 1GVYA 1O5QA 3CUJA 1U5JA 5JBEA 1LJYA 3APYA 3W2UA 1UOKA 4G1NA 1V3HA 4MWAE 3GTIA 1EJUC 1UZDA 2FH8A 3BG9A 1NDYA 2FFCA 3OHIA 2WKGA 4DN1A 3BCDA 4DJDA 4PZVA 1JDFA 2VRKA 4WY0B 2ZX8A 1WBJA 2HPIA 3BJSA 3URBA 4AVFA 1H7XA 2E40A 2YDQA 1EWDA 4LCRA 5BOFA 1DWIM 5DT5A 2D3NA 5MKGA 2WSQA 5TD4A 1XCWA 1GG0A 4G6CA 5A8OA 1XHGA 5U4NA 4FX6M 1ISYA 1YDNA 2TYSA 3V1PA 5I77A 2ICSA 1V3MA 3FIGA 1OFBA 3ZS4A 1H3GA 3T09A 2ISWA 1O7AA 3DI1A 2NQJA 1T99A 1UH4A 3CEUA 3B4YA 1JCMP 4OFCA 2ZXDA 2WJDA 3AC0A 3LPPA 6CGTA 1OGSA 2PWFA 4O19A 1S2TA 2DZVA 3OLEA 1KKRA 3WJXA 1VFUA 1CI1A 3ANUA 3PBVA 2ZZ7A 1Q6CA 4Y9MA 2C19A 2F7FA 3I3DA 2XH0A 4ZODA 1OZMA 1XPGA 1F9CA 3VU2A 1HXJA 1GPFA 5H8UA 3MA8A 2GOKA 1H49A 3S1XA 1BYCA 2PTXA 4K36A 4GZ7A 5E6YA 5CGQA 4JX5A 4ZTYA 1OX5A 4NYYA 2VENA 4DO7A 3SCWA 2HS6A 1M7OA 3KHJA 2DQWA 4TVDA 4JX4A 3V0TA 1ZENA 1VFFA 3ZVHA 5KZMA 2PC4A 4IH3A 1V51A 3NXLA 5CSYA 3VOCA 2YCLB 5DF0A 3WF0A 3WK2A 2J7DA 3NDOA 3KOZA 1AL7A 2P5NA 1VS1A 4GYFA 1W0MA 1E0WA 3IARA 7ENLA 1GQJA 3KOWA 3GFYA 2WV8A 2E3ZA 1TA3A 3NM3A 1B9BA 1PIGA 1UWQA 1FH9A 1ODUA 3BANA 4OBTA 2P0OA 6ALDA 3PJXA 3AU2A 4GH1A 3U0HA 3PZVA 3D46A 1XKJA 1ZSXA 5J8LA 1N82A 3RO8A 3VIKA 2YXGA 2CLLA 1F8MA 3G6MA 1W17A 2FZ8A 2RDWA 1S2WA 4P8UA 3IJ7A 1ZGDA 3N11A 4A21A 2YR1A 1B3VA 2Z29A 4L6DA 1SQ7A 2PU0A 4WF7A 3SN4A 1JQVA 3KDOA 3POHA 1N2VA 3G22A 2OEMA 4C90A 4DRSA 1XGDA 3E02A 3CHVA 1PVNA 3SY8A 4H04A 1RUSA 1VBRA 3NQ7A 3T6CA 4FEZA 3S4TA 3VXGA 5JUVA 2Z26A 1QOXA 5E9AA 3E2VA 3B3DA 3IAPA 4HOWA 4GNJA 2X09A 1O5KA 2PD5A 2GZXA 2BWGA 2JE8A 5JH2A 2INFA 4B9ZA 4Z1BA 4OGZA 4GI6A 2VO5A 3I3EA 4XVEA 2QT3A 3O16A 2J62A 1NWUA 3L7RA 3EKZA 5HUPA 1HO4A 4AZCB 3IANA 1PBGA 3HJEA 4JBRA 3N6HA 1RBAA 4NZ4A 4RUBA 3TQVA 3ZJKA 3CB3A 5HOSA 4J4KA 4IXXA 1HL8A 4UTWA 4FAMA 1FWBC 1WKEA 4OUIA 2YDAA 1WQ5A 3GC5A 2WZTA 5D38A 4GVHA 4GIRA 4UFJA 4XQ6A 1GVEA 2DVUA 2WMHA 2XIIA 2YA1A 3WMCA 1JL8A 1XGZA 4BCEA 4I9MA 2E68A 4PODA 2CZDA 5A6JA 1ONXA 2FHFA 3OVQA 1W3LA 2J7FA 1XISA 4R3UA 4DO4A 2G41A 2ZXAA 2DPEA 1GQNA 1UP0A 1A3HA 4XO6A 3CEPA 3CZKA 3OW1A 3PG9A 2IQ0A 4A3YA 1J5TA 3E12A 1XFBA 2ASHA 2Y88A 4C1LA 4RE0A 1XI3A 4U28A 1XPYA 3NPXA 3K4AA 2O56A 4U3AA 5M3WA 2XGIA 3P7YA 2NSOA 4DYJA 4GQGA 3DG3A 2WKJA 4DJFD 3LRKA 3UA4A 4AMCA 4IIBA 2CZVA 1I0BA 3F2DA 3SCQA 4L1WA 5CBJA 2PFHA 1H61A 3KWXA 2AQWA 4LFYA 2D22A 5FOOA 2W62A 4UOJA 1WOBA 2QDDA 3AMGA 4C1KA 4IISA 3R58A 3VIPA 2DT2A 4ZQPA 1P1MA 4L64A 4YWIA 1OYBA 2R1NA 3DENA 1AA1B 4AIEA 3L65A 4PUKA 2WANA 3RITA 2XM2A 1YTEA 3UG8A 4KWSA 1J0ZA 5LHEA 4XX6A 3QLDA 3QPYA 1RVKA 4E6MA 2BHZA 2J7GA 2G3JA 4GVFA 1KCXA 3LHVA 3NO1A 3DI0A 4XD5A 2IKHA 2CLOA 2F6XA 3BARA 2ZDRA 4JYDA 2TRSA 1N8FA 1BF6A 3LCLA 1LL6A 3TIMA 4AEFA 4WD0A 3A3HA 1CYGA 4QR6A 3SDOA 1A53A 1XYCA 3QSRA 2DZBA 2WMFA 2BGNE 1JZ6A 1MQRA 1ISVA 4OOZA 1XLAA 4QROA 1Q6FA 3S5YA 4H9MA 1H1ZA 4UNKA 4Y9AA 3HOJA 1AH0A 3OBAA 4QHRA 4CCZA 3E74A 4G9PA 2DUXA 2BGSA 3JUGA 1K9DA 3GH4A 3HGJA 3ABSA 3L4WA 3LY0A 3TMLA 3GBDA 1DXIA 3P74A 5KINA 3HJZA 1M03A 2D69A 3PJUA 4KRTA 2QCFA 5AHFA 4W85A 5E93A 1KBLA 4Z2KA 2BODX 2ONEA 3GK0A 2PDKA 2CWNA 3PAJA 5LNSA 1F6YA 2P0IA 1D3HA 3EX2A 2V5BA 4CCDA 4Y9PA 1F7BA 1FX6A 2DZTA 4KCUA 1VENA 1W9PA 3JR2A 2OG9A 4WVXA 1OG6A 5CPOA 2GSEA 1TR9A 4AD3A 4MGGA 2H9AA 2NQZA 2E8YA 4ZB2A 4C6MA 1HZYA 1QPQA 1MW0A 4OIFA 5FAJA 4H7ZA 4Z17A 1EPXA 3LXCA 4UB9A 3APTA 5K3VA 3TN3A 4BQ5A 4D6FA 3OGVA 4Z2LA 1MEWA 5CGTA 1P7TB 3GC2A 4W93A 5DFAA 2BXVA 3CV1A 4RXFA 3CK5A 2E9LA 3O3RA 2PDUA 1GWJA 1IEIA 4N6FA 4F0RA 3S2MA 1KO0A 1WOAA 2V3GA 2AKZA 2DZUA 2JBMA 3P8IA 4YLWA 1TRDA 2CXEA 2VGGA 3U2CA 1CB2A 1Q6EA 2QQ6A 3UYIA 3NZ1A 4GUIA 3IIOA 1B1YA 3L4TA 1NDWA 7PTDA 3LEPA 4G56A 3B9OA 3AYRA 4B2DA 4MNMA 4NZ3A 1EXBA 4L4PA 3W7NA 2O9RA 4W8LA 3UY7A 5CJNA 4GFIA 3RLGA 3W1MA 4LCQA 4AWSA 4MMWA 2WNZA 3R1ZA 1I9CB 3PJWA 3BVJA 2Y4SA 3MVTA 1VYRA 2ZA3A 3G2GA 2PB1A 4GQ0A 1HKKA 2JIWA 1UOZA 3ENLA 2R9RA 1GYMA 3LCGA 8TIMA 1QAPA 3SY1A 2R8WA 1EUNA 3R94A 3IJLA 1E55A 3R8GA 1BWLA 4Q3MA 1XQKA 4R7JA 1GJPA 4BQ3A 2FB2A 1BVNP 2V82A 4WCJA 3S47A 1XIHA 5TIMA 3KWSA 1VFSA 3T4CA 1YQ2A 3ITCA 3V3WA 3CZEA 1EQPA 5I0DA 1B30A 3VOJA 1Q3NA 4N4PA 3EDKA 1WNOA 1JPKA 1IZJA 4BQ4A 1C7SA 4Q7NA 2P50A 2WM0A 3FAWA 4Z0SA 1KD0A 3G24A 4N9DA 2O7SA 2DT0A 1F6PA 4K6AA 1NF0A 3GZAA 5AC7A 2E1WA 6A3HA 4Z2JA 2YBUA 2D20A 1AK5A 1E4LA 3NUKA 3HG5A 3FHQA 3HMJG 4V33A 3RO6A 2I56A 3S0CA 3THUA 1TB3A 4PTWA 3DFYA 2HWGA 1JRCA 3CXOA 4DX3A 4IIDA 1NTHA 6ENLA 2MNRA 2VEKA 4AD5A 1A3WA 2WSPA 1M7PA 4P7OA 4NIRA 3Q37A 3BMVA 1NDVA 2YCEA 1VFTA 3BCFA 4LTSA 1F76A 3MSGA 2G0WA 4O14A 1DIEA 4IX0A 3KDNA 3W76A 4AHPA 3APGA 3LPOA 4GUJA 3W22A 4MHBA 2ZDSA 4YWSA 4AF0B 1NH6A 3NEVA 3CO8A 1UUOA 4RE4A 1KV8A 1BLIA 4PMUA 4UNLA 2C18A 1SFSA 1UPMB 3QM3A 1J5SA 2YCJA 3CH0A 3L23A 3FVMA 4I90A 1JEZA 1UD8A 1H51A 4CN1A 2BFGA 2X41A 4H9UA 3V0SA 1EOKA 5HANA 3S46A 5D33A 4DI8A 1Z41A 4LUSA 1H2JA 5T26A 3PB0A 4ORMA 2R82A 4AZ6A 2YZRA 3GQYA 3M0KA 1ELSA 4WSKA 3RU8X 3C5QA 5AVHA 2HQAA 3FFSA 3GAKA 1WB0A 3FKRA 5D05A 4GX9A 4J7RA 1TV4A 1X6NA 1US2A 1A5AA 1J8VA 5A6SA 2NVAA 4ZMGA 4A2RA 3N14A 3B0PA 4N9CA 1K9TA 4S3DA 1OX6A 2DP3A 4HOZA 1QOPA 1NM9A 1G4EA 5IFTA 5A6LA 2H3BA 1V6YA 5K9XA 1L6SA 1ISZA 4A22A 1EJWC 4A8RA 4HHHA 1LG2A 4B3ZA 3G3MA 2GQ9A 1DXFA 4GPNA 3UZZA 1XRSA 4N9BA 4WEVX 3ERPA 3QQ1A 5FEXA 4MKNA 4WX2A 2GUUA 2ZVRA 3ZR4A 1G94A 2VWSA 2BTMA 1EA0A 3I6RA 1UD6A 3CTTA 3BV7A 2PMQA 4HYVA 2QS8A 4PN2A 4Q4QA 5C9ZA 1OEPA 3WDPP 1Q6RA 4JQ2A 1IXPA 2PAJA 3RG6A 3PZQA 5I6SA 3W1RA 2EF9A 1RA5A 2YW4A 1W9BM 1UWSA 5HWNA 4EE9A 2HVOA 3PNZA 2OLHA 4CCCA 3PAOA 5BRQA 4DXKA 3CHCA 4PB3A 3N9SA 4JD4A 4B5WA 1FKWA 4R85A 2OZ0A 3WDJA 1FWDC 3QW4B 1SW3A 4E5TA 1H60A 5CZSA 4ZGYA 1FBAA 1V08A 4YXGA 2PRMA 3IVTA 1O1ZA 3FS2A 1L6WA 3W6MA 2WVUA 3U4AA 2CEQA 2VZVA 3A9IA 3WBAA 1NIUA 1V93A 2XPKA 3EB3A 1BF2A 2E09A 3GTNA 3ZM8A 3AUOA 2VEGA 2QJHA 5D30A 1YRRA 4PUMA 2UWFA 1DIKA 1FCVA 3LBCA 1GVOA 1JZ2A 4W9TA 2VMFA 1OCJA 4E38A 3UGRA 3TEVA 3P62A 1IXOA 2CLPA 5G2WA 2EJAA 3HGRA 2QUMA 1S2AA 1QNQA 5LNVA 1W56A 1F6KA 2FKPA 1R6WA 3KBMA 4GIEA 1R9XA 1OIFA 3TYDA 3PWGA 2Q8ZA 1N8WA 4XUGA 5LNWA 3JW7A 4QGCA 3VOGA 2XN1A 4JFWA 1DHPA 5E0CA 1FKXA 1PDYA 4GQQA 3UJEA 3VNMA 3FXGA 5ABFA 1PPIA 4N7QA 1TSIA 2VCAA 4E4UA 4LVBA 2F38A 4AX7A 2PWHA 2PDPA 2EXOA 3R8HA 6TIMA 4R9XA 3MDUA 4AY1A 1NOUA 3BLOA 4L9ZA 1BXBA 9RUBA 3L5LA 1TMLA 4D8ZA 1XIDA 3ARXA 3W85A 2Z1BA 1W3JA 4HHLA 1L2QA 3SCTA 2WNWA 1K8XA 3AUJA 2AGKA 3TSDA 1R2RA 2WVTA 2WWCA 3KVJA 1SU5A 3HBLA 3LTYA 5I00A 5JH1A 3TWBA 3TW9A 1S5NA 4W89A 2VYOA 2GJXA 4Z08A 5T9BG 4IPPA 5CPLA 3C8NA 2OODA 4DBWA 1YDVA 1TPDA 1JD9A 3A22A 3NXFA 4A4AA 4GIAA 2YB1A 1NP2A 1GG1A 3ID7A 1W32A 4WY0A 3EXTA 4DM1A 3W4RA 1G7VA 3AXHA 3LN3A 4F2BA 3C86A 1S5MA 1S1PA 1VEMA 2VUYA 1GVQA 3UWZA 4A05A 3WNMA 1X6LA 4F66A 1XXXA 1VRXA 3CLWA 3GB6A 1C8QA 1W1VA 1UKQA 1KM1A 1POKA 1XD1A 3PZNA 3W7JA 4KWVA 3G0XA 2QAPA 1K7XA 1V0KA 3QBUA 4Q22A 3SCOA 1BXCA 2FMOA 4P8VA 1R3VA 4S1FA 3CWHA 4JTCA 1Q7MA 4AIUA 3AJXA 3M0JA 5A8GA 4TX9A 2FPVA 3NZPA 3V18A 3LLDA 1WDWA 3BJFA 4ZE5A 2VOTA 1GZJA 5HPOA 4HNOA 2V68A 1M5WA 3OU8A 4GO9A 3SQMA 4IIHA 2DH2A 1BRLB 4U2ZA 2ZZ5A 2NQLA 1U1JA 2O4QA 3TDFA 3H7RA 1UD2A 4FX7A 2PDNA 3OG2A 3CQKA 3DX5A 1KM2A 2VXNA 4I3GA 3KL5A 3VMNA 4YTTA 1V02E 3BE7A 1VAHA 3BH4A 1GW1A 2YJQA 4CN6A 1CGUA 1XIJA 1NFPA 1DJGA 4NKCA 4B16A 5I24A 4IMDA 3GVWA 1LT8A 1EFZA 4HB7A 4HK6A 3VIIA 1TJRA 1JZ8A 2HEJA 3W7GA 3CB8A 1NVMA 3QMTA 4EX4A 4EANA 5GQBA 1Q8JA 2DZPA 1XIMA 1D2KA 5EMUA 2E77A 2WPGA 3FN9A 4M82A 1KR1A 2FHCA 4LOCA 1RLDA 1T0OA 1SO4A 4LV9A 2BOGX 4FI4A 3EDDA 1CT5A 3STGA 5D8WA 1CGVA 5M2FX 1E43A 4PMJA 2WAGA 3PULA 3OB8A 1OFOA 4YCPA 3E2RA 2EBNA 3KCJA 3NSMA 4QJ5B 4MB5A 4AHOA 3KVMA 4NX5A 1IWAA 4G7EA 4JQ1A 4DJEC 3B9NA 4D1JA 3BLKA 3GBEA 3R0UA 3LQLA 2OO6A 4H8VA 4GJIA 1VLIA 1PCWA 4QRNA 3LOTA 2ZZ1A 1QK0A 3LRLA 3UXAA 3F5LA 3HN3A 3BL3A 4JDBA 3N6QA 1U33A 4ZE4A 3NYZA 3V5FA 5DQPA 3IJDA 1P4CA 1JCXA 3W25A 4YPJA 3QY6A 1E9ZB 5AKQA 1RP8A 3W1LA 5BOEA 4PTDA 4DJFC 4DJDC 2CKSA 2QMJA 2ZX6A 1YHTA 1OGBA 2A4AA 3OJGA 3SRFA 3P14A 2KAUC 3URAA 4E8DA 4DXVA 4BHYA 2YBVA 1N7KA 4PUNA 4BZYA 4CU6A 3CMJA 4FMVA 4CEXC 1RJPA 1JR1A 2W63A 2PUZA 1AMKA 4MUPA 1UJQA 4C6OA 3WZ0E 1XP3A 3LB0A 2NSXA 1MQQA 3TJIA 4NZCA 5HR7A 3AS1A 2G3IA 5F4SA 4PMVA 1HTIA 4B4FA 2P76A 3ITTA 3WH7A 1FTXA 2VR5A 3QMSA 1ZPTA 4OOUA 1U5HA 4DBUA 3HGSA 3DFOA 3G1SA 4MTVA 4K68A 3QFEA 4YCOA 4AEEA 2O9TA 4WGXA 2OVLA 2CLHA 3GDBA 2DU2A 4PCSA 4IUGA 4CGTA 1DQUA 2ZZ6A 1QDSA 2OMAA 5DMMA 4Q6JA 4YVXA 1H1NA 2DSUA 2DZWA 4Z0JA 2DUZA 3T0BA 2DSKA 3CIVA 4A8NA 3G5EA 5AHNA 4RNFA 3UJSA 5I3FA 3B8TA 3F4VA 4XVDA 1E4IA 5A2CA 1QXLA 5DXXA 3T0AA 3GNOA 3CV7A 2G37A 2GQ3A 2W6RA 4ZVJA 1TTQA 1F74A 1YIXA 5IBXC 2IPFA 1U1HA 3W37A 4AYSA 2QXWA 3K4WA 1A0CA 1T8XA 4WZHA 5KEZA 2Y61A 4M6UA 2OO0A 1GYLA 3LMZA 5GJMA 3LQGA 1LZOA 3HU7A 3PSWA 2ZXQA 1A4MA 1KBIA 4W4QA 3M43A 3OIHA 3UR2A 3ZJ6A 2XFWA 4RDWA 3EDFA 1DHKA 2PCQA 2B7NA 2ON3A 1PXGA 1EC9A 2ZQ0A 4NNBA 1LOLA 4M51A 5H2ZA 1KGXA 4FOKA 2WVVB 1XH0A 4XAZA 2V5KA 2VI0A 4YN5A 2A6LA 2AAMA 3M5VA 5E1QA 1JUEA 5CH9A 3SM0A 1UH2A 4L6HA 4H1ZA 3N04A 5EBUA 1A5LC 4D6IA 1VFOA 2X0YA 1UR0A 3EX1A 3DFHA 4ORIA 3WQOA 3EA1A 3WQ8A 1HW6A 2D0HA 2I16A 3PFMA 1JCLA 1EIXA 1FUYA 3TTQA 2X7VA 5ABEA 1E56A 1BRLA 3TC7A 1JI2A 3G0UA 5CZ0A 3TE9A 3EPOA 1I2RA 4Q8OA 4DZHA 4UTLA 2YIHA 3U2ZA 4MY8A 3B4UA 4JICA 3BLFA 3LSBA 5CSUA 3FEMA 3ARRA 4NUWA 1V79A 5EYWA 5JQ9A 1RBLA 3G1XA 1A5UA 5A8QA 4UR9A 2DVTA 4MJ4A 1WAUA 1ITXA 3DN5A 3MKVA 4EF9A 1TWDA 1PTGA 2F6UA 3EWCA 4JTGA 4E2BA 5DXYA 4UUIA 1Q13A 3WLTA 3JRKA 3GW3A 2PP0A 4IGMA 5BXTA 1POJA 3AOFA 4OWGA 3XIMA 4C6BA 4X9YA 2ZRZA 4H8NA 4JIRA 4RCXA 1XBXA 3DFSA 2AL2B 4HNUA 1E0TA 2W9MA 3QTGA 3SSJA 4AMAA 4ASTA 3SFWA 1TFVA 3VGEA 3UCQA 4F8XA 5HQEA 3TW7A 1SFLA 4PFHA 5A8MA 4A35A 3A3XA 3DDMA 4XTDA 3OIXA 4YTQA 1PE1A 1QNRA 4MYXA 3SCVA 1MO0A 3B8SA 2HTMA 4DAFA 2DSZA 3CU2A 3B04A 3FJLA 4EIVA 3N9KA 4XWUA 5LGXA 1TMHA 1K8CA 5H8MA 2VCCA 1NDZA 1GOOA 4QEEA 2YL5A 2QCNA 1Y8BA 2ZXBA 3GXTA 2XSXA 4CNUA 4DPQA 5FJTA 1E40A 1FHVA 1R9YA 1P0KA 5AC8A 2BVDA 5D32A 5G1MA 4RDZA 1P7TA 3ZZ1A 2GWGA 3USBA 1K7FA 2NXGA 4MZ8A 3OODA 1Z42A 2ZRUA 1R0MA 2E9BA 1DBTA 1FWHC 1XFCA 2C16A 3CIXA 2X2GA 4KGLA 1J0HA 3HPAA 4LGXA 2JGYA 3VD4A 4XO7A 3SJ3A 3OBKA 3FY1A 4DBEA 1E71M 1PX4A 4FLOA 2WVVA 4HA1A 3TXVA 3LMYA 1AW2A 1EHAA 1FRBA 1DEDA 3F4DA 4K7YA 1M7JA 3V0UA 5H8PA 4PTNA 1BXNA 4HYWA 3H55A 5EMLA 3G1HA 1FWFC 4D72A 2XSBA 1JZ7A 4Q8VA 4UXDA 4PTXA 3PZOA 2R24A 3OYXA 1OT2A 2EGZA 4YVVA 1EZWA 4HZ7A 1X39A 4J3XA 4XBJA 1H7OA 3RCYA 2IUZA 2Y5JA 4F0SA 5RUBA 1XYAA 4HGXA 3S8HA 3ABQA 4INFA 2ZA2A 1C3FA 1W54A 3BLLA 3FDKA 4XKYB 3VUSA 1LQ2A 1W2PA 2RJGA 5IHSA 1PJ9A 3RYSA 1X7FA 3CL7A 4UTMA 4OVXA 4ZXOA 2YYUA 3N29A 2DZXA 1A49A 1BYBA 3E6EA 3TU9A 2VC6A 1OFQA 2WNQA 3AZSA 3UPBA 3WJYA 1H7NA 3S5OA 3VDBA 5G4HC 3NIYA 4IQLA 1H0IA 4HJWA 3WH8A 3VKKA 3BAYA 3S42A 1YPIA 1V0LA 4UZSA 4UZUA 1XH2A 4X2PA 3NOYA 3AXXA 3CV6A 3SZ8A 5BRBA 4LUIA 2J7EA 3R0DA 3WQWA 4ML4A 1FFRA 2A79A 4K39A 7TIMA 2C0HA 3M6DA 3AQUA 2ACUA 4DWSB 3MUCA 3OLGA 2WJFA 2QCLA 4FXFA 3POCA 4WLCA 4L80A 1WDPA 4JTLA 2HS8A 1J6OA 1Q4NX 3LX9A 2WQDA 3MP4A 1CLVA 1CGXA 3L67A 5D2TA 1UMYA 3TN4A 1F61A 5E09A 4QDWA 3LUTA 1VRDA 1E6SM 2A3CA 4NP7A 2F6KA 4B9YA 4M7SA 1MUCA 4B2DD 5KZEA 3EWDA 1WZLA 5XIMA 1K8ZA 1R3RA 1S1RA 5BW6A 2I5QA 3IK4A 2RFGA 1RR2A 1VHNA 3PUEA 1IZKA 4GQBA 2REQB 2J77A 3IJIA 4EK7A 2VNCA 4UCGA 1KXTA 2C71A 4PE8A 3B8UA 4IL2A 3SCNA 3VFLA 4Q8TA 3GXNA 4JL1A 2VVNA 3OLDA 3PC0A 1YBQA 3W6LA 4GYKA 2HROA 3NPVA 4PUJA 3W75A 3NQMA 4OUEA 3CQHA 1S39A 2VX5A 1IGWA 3QPEA 2JEQA 5DBTA 1CZ1A 4PMXA 3MV01 2E9MA 3OG3A 2HE8A 3EZ4A 2XVPA 3U6WA 3MV11 3WFZA 3T07A 4H7VA 2VURA 3O8AA 1QPRA 2WCGA 3OVRA 2E25A 4LY4A 2FIQA 2GYIA 1P1XA 3FNDA 4B92A 3GR8A 3NQAA 3WFLA 5A8NA 4Y90A 2Z1WA 1PZ1A 4XZWA 2NWRA 4OECA 5HWMA 3KTSA 1XRVA 4H9XA 3SQSA 1OM0A 3WL1A 2NLIA 1Q7QA 2OEKA 3HG2A 2CC0A 2J8FA 3UZWA 2WBGA 1RCQA 2Q01A 5C2GA 3OPSA 2E5BA 3MMTA 1J0JA 2C14A 3LM3A 3BSHA 4CQ8A 3II1A 3AHVA 2Z2AA 1KM6A 2W27A 3BOFA 3BMWA 3UA3A 5E6ZA 4AD0A 1GZGA 1ENUA 3NL3A 5T91A 1L6GA 3HG3A 4GXWA 5CPMA 2G4FA 3BZJA 3N12A 1IT0A 1W1IE 2PWEA 1H7PA 2Y8VA 4LVDA 4W5ZA 3OA3A 1FWWA 3DHUA 1R8LA 1AH4A 4EPDC 5LIUX 2XIJA 5CLWA 2RJHA 3VOHA 3PANA 1FHLA 1AMYA 1J6PA 3BO9A 3WUBA 1W91A 1XBZA 2PDQA 2OX1A 4O1BA 2C79A 4QG8A 2VR2A 4QCFA 4CVUA 1DJZA 2G97A 3WJSA 2RDXA 3H2NA 1BHGA 5LYRA 1GVRA 2E6AA 5HPCA 5DMYA 6PTDA 3AYTA 3HGOA 4KCTA 3P82A 4HYRA 4M80A 4D71A 1EDTA 2CZ5A 1BKSA 4MOZA 4H19A 4UTHA 4LBUA 2DY3A 4K38A 2WM1A 1E1CB 3BXWA 1VBUA 5JXQA 3WNPA 2ZVIA 3ARUA 4C1NA 4N9EA 3TTSA 2V2CA 2R1LA 2E7FA 1YPXA 1SZEA 4QLKA 2Y63A 4BFAA 2CHRA 2BLEA 1TYGA 3M0IA 2V6AA 5CPTA 1TJ1A 1ZB5A 3CZJA 4O8RA 2RGMA 3AJ7A 3T0CA 2HDJA 1JJKA 2HSAA 9CGTA 1XICA 1U83A 1TVPA 1UHVA 4E0CA 3O7UA 1Q45A 3B0XA 4HN8A 4IPJA 3NVTA 4S3EA 1MUWA 2XH2A 3P61A 2HPMA 4ENLA 1D7KA 2IXUA 3S9ZA 5FI8A 4O0KA 3DFTA 4FA3A 3KP0A 3VD9A 1GT8A 5G5IA 2B81A 5DY3A 1CB7B 4GIYA 3VCCA 2QCGA 3ITLA 1LBMA 1AODA 4J2MA 4U5IA 1X1NA 4GWEA 1FWJC 3HTWA 5ECVA 1L2UA 1NWRA 1RJRA 2WZMA 5A6BA 4J5NA 1PWMA 3GIQA 3T8LA 1EJTC 1F4HA 4ZO6A 3U7BA 3ZT5A 3W82A 3QY7A 4JR5A 1U22A 4RJEA 2E6YA 4TX6A 3RUBL 2BOFX 1QI3A 3A9BA 1M6JA 3LM7A 4O1DA 4AU0A 1Q6DA 1DJWA 1MZHA 4LAUA 2YW3A 5GJNA 5AOUA 2HV5A 3EWWA 1TE6A 2INZA 4IICA 3GD6A 3SN0A 4AZIA 2SFPA 1M1BA 3CAVA 2GDQA 5DT7A 1SFTA 2V8ZA 3QQ0A 1MXGA 3QW3A 5JIWA 2AAAA 2NXHA 3UP8A 3KBJA 3NQFA 1ITUA 1JYWA 3QPZA 2EEXA 1T6MA 1U30A 3I10A 1WZAA 2XGBA 1S2VA 4PMNA 4OT7A 1D8CA 4WIWA 4K8GA 4C7GA 1SJDA 2R1PA 4ROPA 4J3TA 3VK5A 3LNMA 3W07A 1AL8A 4M3PA 3V1HA 1BEUA 1UPPA 3HA1A 2ISFA 3LHUA 4ERAA 3CZGA 2V69A 4GYPC 1E6ZA 3CL6A 3VKJA 4AY7A 4GCXA 2HVNA 5E0FA 2PLKA 4B5XA 4CNOA 4C6KA 3IGXA 5I3GA 2ACRA 4IIGA 1YE6A 4UMBA 4C91A 1BWKA 4UNIA 1UWUA 5I79A 2XHYA 2WLYA 4RNJA 3CUZA 3LBOA 2ALDA 2LLEA 3QJAA 4KW2A 1KRAC 2AMXA 3N3MA 3ZSSA 4YU1A 2RDUA 4GO8A 1VH7A 1HVQA 4IMAA 1H7WA 3MU7A 4QE5A 1DKWA 4YS1A 3I6EA 3DKLA 1WZMA 2DW6A 1D9EA 1UYQA 5TAOA 4FLRA 4DQWA 3W1NA 5L9FA 4ACZA 1K6AA 2WOQA 4M5PA 5GNXA 4MZ1A 3TFCA 1FWCC 3W26A 1VEOA 4X0NA 4I6KA 2VQTA 4A3UA 3B05A 1R9ZA 1PZ3A 3NGJA 3L9CA 1LWJA 1YNQA 3B9AA 1MW1A 5FACA 4HA0A 2O92A 3P80A 3V35A 8XIAA 2J27A 1V3KA 2QCMA 3GG8A 3MY9A 4LXFA 4AVNA 3MVIA 1TX2A 1MEIA 4F2TA 2FMNA 1EP1A 4KWUA 3KCLA 1WX0A 4I8YA 2DFAA 4XD6A 3EGJA 4WOZA 3AAMA 1LRNA 1ONEA 1WE5A 4WSHA 4FHAA 3P0XA 3AIVA 1PZ0A 3EB4A 2CBUA 2YXXA 1WKYA 1WUFA 4XAYA 4JTAA 1OC5A 3PUGA 1EDGA 2X40A 3R43A 3WUEA 2VEMA 1F3WA 1X38A 3W7RA 2QJNA 1ZALA 4QSFA 3CT2A 2BMBA 1Q66A 3HM7A 3IJ8A 1A80A 1H63A 5CEWA 1OB0A 1G69A 1VYPX 5AYBA 1QUMA 3NJ3A 3EKLA 4LC6A 4D8AA 3TYEA 1OC6A 1W3KA 3PS7A 3G8EA 4Y9NA 4KCWA 4KGJA 2QZRA 3LENA 1G4TA 2J7BA 4CD8A 2PDBA 3TXZA 3FA5A 4W7VA 1R86A 4TR9A 4A3QA 4TXEA 1G01A 1CIUA 4P61A 4I9JA 1WZKA 3EXRA 3WN6A 3NAVA 3CC1A 3QYSA 5I03A 3LBMA 2AL1A 4I8DA 4EXBA 1J2WA 3GNXA 3GTFA 1CCWB 3DKJA 5BZAA 6REQB 1DWFM 3HPSA 5G4EA 3VDHA 1RXOB 2IPWA 3REQA 1MW3A 5REQA 1OY0A 2QF7A 2XSAA 4Q8WA 5TBOA 4AD1A 4DLMA 4NZJA 4D8LA 1LRTA 3QHMA 4S3GA 4WUIA 4DNMA 3GNPA 4GI8A 2C3ZA 3EXSA 1ZCOA 4PMRA 4NJKA 1TJ2A 3E9AA 3MKKA 3O07A 4WGHA 1OK6A 3TYBA 4RL3A 5GJPA 3NQCA 2WVSA 4S2CA 1OZQA 3VKBA 5AHLA 5D9PA 3VNLA 3W7IA 3RNDA 3BG3A 1EKOA 3FXYA 3FAXA 5D2YA 1QT1A 3K8KA 2E6FA 1ZZMA 2ZCGA 1N8IA 1PAMA 4GKTA 2FH6A 2F84A 1OX4A 4GRSA 5PTDA 3KX6A 1P6WA 5AC4A 4AHQA 2IS7A 2Y6ZA 1DORA 3NR0A 2FZNA 3BWWA 4ICNA 1KCKA 4RR4A 2CNCA 1OFPA 4V28A 2Y5EA 3ICJA 3TFXA 1AW5A 5H6HA 1OD8A 3RU6A 4RPPA 4LAKA 3QVQA 2YL9A 5K9DA 3B06A 3HF3A 4LU0A 4S39A 1GVFA 3BQ5A 5AYIA 1T8QA 1XS2A 3TVAA 5H91A 4CVWA 3LHZA 2QPSA 3K2GA 4ZB0A 8XIMA 3MI3A 2WCSA 1QI4A 4CD4A 4H7CA 1XR2A 1XLLA 3CGTA 1OD0A 4NAEB 3KM8A 3FYYA 3BC9A 3H2FA 1RPKA 1EP2A 2X2YA 4HN4A 5KSWA 3GDRA 4I7VA 2GJPA 1OYAA 3VGFA 3EWUA 2JQXA 2CPUA 3TR2A 1I1WA 1FHUA 3PPCA 5K4ZA 4H9VA 5DLCA 4NVTA 3HZ3A 1B5TA 1KFCA 3HMCA 2OZTA 3ZXWA 4HK7A 1T40A 2MANA 3PBMA 2VUNA 4US5A 2W91A 2ATSA 3B0VC 3MYPA 4IG2B 4HSOA 4J3ZA 7ODCA 3PK7A 1HJSA 3L5AA 3QMRA 5M17A 1EIBA 3JZEA 3M5YA 1HJXA 1HO1A 5KMYA 2BX7A 3CLMA 4JIPA 2C7FA 2X7WA 3IVSA 2ISVA 4X22A 3DUGA 3Q94A 3MMDA 4GI4A 3RM4A 4UFMA 1TG7A 3SN1A 4FX8A 4F9DA 4CD5A 4LB3A 2GFTA 1A5SA 2PE4A 1XLDA 1QHPA 3K8MA 4RDYA 2A85A 1DIOA 4CN4A 1DTNA 4XIMA 3MS8A 4P8XA 4H8HA 4KEUA 4BK9A 1PCKA 1N55A 3W7HA 2H9AB 3TC6A 3HIJA 1LRQA 4PBGA 5BXSA 2YDRA 1UMLA 4UTIA 3BSGA 2CHNA 1M53A 1DJHA 2WMKA 3SCSA 3VKAA 4CKQA 4Y2WA 4EKJA 4GQRA 1QHZA 3W2MA 1FWRA 2CW6A 4NI3A 2PBGA 3BJTA 1Y65A 1BVZA 3L4XA 3VZXA 2OKTA 4FNRA 1LWHA 3H24A 3M0HA 6TAAA 2BOEX 1P6BA 2ZIDA 3GXPA 2P8BA 4LAZA 1I45A 5TQLA 1KXQA 5C9XA 3PVFA 2PDXA 3ABXA 2ACQA 1ML1A 1K1DA 3BAIA 1LQ0A 2AGTA 1ZRQA 3MT1A 4A29A 4TO8A 4XKYA 5I3JA 1EC8A 4HJFA 2WPBA 4J1OA 3A47A 3TAKA 3W28A 3OYZA 4JYFA 3S1UA 3WNNA 3IUHA 4O17A 2A6NA 3BW3A 3TZFA 1R46A 3EOEA 3KL0A 1XH1A 1TTPA 5A69A 3QH2A 5BMXA 1UKOA 3G1VA 3WQ4A 1NQ6A 3EYPA 4R7WA 4UQ9A 3V4BA 2ZC1A 1H09A 4HNTA 4LANA 4RK8A 1EGZA 4HPGA 1KC7A 3MC5A 3WH6A 3U9IA 1VIWA 4R34A 3S9YA 3R25A 4NASA 1IE7C 1U2YA 3LDVA 4KEMA 4J40A 1REQA 3CMGA 3HG4A 1TPB1 3H8AA 3H2MA 3WQ5A 1ZAIA 5AHIA 1FXQA 3TYUA 5EMMA 1KKOA 3WLMA 4JNMA 1IXQA 3B40A 2PF8A 3K30A 4PB4A 3PM6A 2J6VA 2BY2A 3T40A 4J3WA 3A13A 3N15A 3Q45A 2FHBA 3EA2A 5C2CA 4E2DA 1RK6A 4Y8FA 8CGTA 1BGGA 2A7PA 4Q6XA 3WMBA 4MJMA 1ICQA 5C8BB 1HQTA 4C60A 2PZ0A 4IGNA 1UWTA 1V6XA 3A23A 5DCBA 1DJQA 2DT1A 3ES8A 2VT0A 3S2CA 2IKGA 1UP2A 2W3ZA 4GZIA 3KRUA 3LD5A 3L2IA 1PDZA 2Y2WA 3BG5A 3RM9A 3BUVA 1CXHA 3ZYZA 3WLRA 4J28A 3TROA 1QU4A 1UQYA 3DYOA 3CQ0A 5EFDA 1OF6A 2FJUB 1J11A 4HTYA 1H7RA 1U5VA 3QRHA 8A3HA 1R7OA 1Z69A 5CC3A 3VM7A 1JYVA 1BFNA 2PEVA 3O0FA 3TJXA 5HA7A 1XSIA 4CNPA 4JHZA 1YX1A 1AH3A 4NZ1A 1F2JA 2ZZ2A 3N13A 1C8XA 3UG5A 2I5IA 1A5BA 5D37A 1VIZA 1TQXA 2W67A 3QOKA 1MWOA 2ZBTA 1W1B1 4PRRA 2V3DA 5BU9A 1QW7A 5I5RA 1A5KC 2R1MA 3WQCA 1W9UA 1RH9A 1TV5A 4HSNA 1RD6A 1E3ZA 3HQNA 5J5RA 3DG7A 5AYYA 2E28A 4XZLX 2A3LA 5KZDA 3A4AA 4MY9A 1RP9A 2EKGA 1TV2A 4GGHA 3SURA 1HKWA 4JN6A 1VQTA 3GW0A 4UCFA 4H41A 4C6CA 2QPUA 2QJMA 3QC0A 2PTZA 3H7VA 4XBSA 4RKAA 1PUDA 2XN0A 1LORA 1TWSA 3W7CA 4YMZA 2YB4A 4XG1A 4EAYA 2FPTA 5E0KA 5HNTA 4U4MA 1I2PA 5CC5A 1FOBA 3A24A 4N4QA 3CJPA 2PDMA 5KETA 3STCA 3TTEA 1XLHA 3GR4A 1ME8A 1YNYA 4DWSD 2G3NA 3CPUA 3GE7A 4G7EB 2WMIB 3A4WA 1GJUA 2TODA 3N25A 5EMJA 5AYXA 1RLCL 4DELA 1FY6A 3L5MA 2A3EA 4QLLA 3IWPA 6XIMA 4B3LA 1KQYA 1RBOB 4MNLA 2DQXA 2PLMA 3NG3A 5CZTA 4J27A 2XIOA 3O06A 4AFYA 4JN8A 3R6IA 3MI2A 2F9RA 2FGBA 4RW3A 1V03A 3CUIA 3NL5A 1L6FA 2GVEA 4UQAA 2YA0A 1DJNA 5ABGA 4HNVA 5GNYA 2PI6A 3S1VA 2KX9A 2PDFA 3TA9A 4W7UA 4RPQA 5AZ0A 1XIBA 4FOJA 4NRRA 3WO8A 4A8IA 1XYBA 4FS9A 1AG1O 2J8GA 1XG4A 2XWEA 1RCOB 3EOOA 2EPHA 1JD7A 1HJQA 1YXDA 1YXYA 4AZHA 1TJ0A 3WENA 3BDKA 1EGVA 2CKRA 3MW7A 1WBHA 3H70A 1VPQA 4CU7A 2Y7GA 2DUAA 4QCEA 4EPKA 3NM1A 2VOMA 5HAOA 4MJZA 5DY2A 2GSJA 3FGCB 4JFVA 4JCLA 4WDXA 5AC6A 3URNA 1ADSA 2CLFA 4ZENA 4KF1A 9XIAA 3C2RA 3LHTA 1JDCA 3CAQA 4O1CA 3RR4A 4J3VA 5LNRA 4HP5A 1A4LA 3GU9A 4AH7A 5C9UA 2DEPA 4GHRA 1IEQA 1TV8A 1R38A 3PPFA 4OV9A 4B4HA 3PBWA 2Y7FA 1TREA 1TVLA 2A3BA 3RPTA 2DZSA 2Z1KA 1GW9A 4QDMA 2IXVA 5FEWA 3ZJ7A 4Q32A 2ZTJA 1DXEA 2ISDA 3FJ4A 1ZP3A 1W3IA 4YTRA 1A3XA 4ALDA 2WHMA 3WCZA 2B31A 1KTNA 2Q8LA 3KLLA 3R7MA 4BKNA 2VFDA 1UB3A 1UW9A 1K9FA 4KWWA 1C93A 1V6UA 3AISA 1B3OA 3MQTA 3C0JA 1GHRA 4FZIA 1VR6A 4KPLA 1OCQA 3IEBA 3IGUA 3UNTA 2WMJA 4CD7A 2J7CA 1FA2A 3A64A 1JCNA 1UZHA 3SR7A 4DBDA 2VM8A 2J9ZA 3NOEA 2X1UA 2CBJA 2WCAA 4XV0A 3R89A 3JU2A 2JKPA 4O11A 1LTDA 2XIMA 4O52A 4AW7A 4X3ZA 2X1SA 3SUUA 3N2XA 1GNXA 2PDLA 2PDWA 2FPYA 2PD9A 2XFRA 4F0LA 1SJBA 2UZ9A 1SZRA 2F2HA 3NNTA 4NJJA 2I5GA 1E0XA 4S3BA 1NF7A 3W02A 4DWSA 2EKCA 2XH4A 3UESA 2CLIA 4LW7A 1I75A 1XW8A 5GNZA 2IKIA 4O4VA 2GVYA 1OCBA 4LRSA 4AQLA 3AMDA 1J2BA 1KCLA 2ATMA 1AD4A 3NURA 4OE7A 3W53A 3LPGA 3VCNA 3C56A 1CECA 3TZNA 2B0MA 4JPGA 3A4XA 5HINA 3TCEA 2D2JA 1IIGA 3N2OA 3EWYA 2OTDA 4KS0A 4G7FA 3SGGA 1Z7AA 4PMOA 4HVXA 1UP3A 4P7QA 1IT7A 3GDKA 1LWIA 1OYCA 1TUFA 3EBVA 4JL2A 1ZNNA 2Z1VA 2P10A 1W3HA 3GG7A 4JTJA 3W7OA 4AY8A 2YX0A 3GY1A 5HNUA 2W66A 4IJBA 3LV6A 3ISIX 3QR1A 4Q8UA 2ALRA 2QGYA 1G4SA 1WYIA 1EEXA 4EXQA 3HO8A 2VDGA 2Y7EA 1YE4A 3MYOA 1JFXA 1WXJA 3FX4A 1M7XA 4RV3A 2C8NA 4JTDA 7REQB 3B0YA 1B3ZA 4QS6A 3K46A 5CC7A 1O5XA 5B7YA 3VCRA 4XD3A 2YYTA 3MP5A 3LI0A 1US3A 1KM3A 2P53A 2YOCA 3WEOA 4XK2A 2PGRA 3KUMA 4R27A 4MADA 1CWYA 4E2OA 3AIUA 1J93A 4O18A 1NP0A 1FDZA 4XKMA 3NQ8A 1CXKA 3F2BA 3CQIA 3GS6A 3LA4A 1SR9A 3W72A 1OK4A 3C0LA 3ARPA 2V9DA 4PUDA 3MMUA 5BOOA 3SRKA 1RY8A 3VNIA 2ZX7A 4DVOA 1B4KA 4NNCA 3DYMA 4UTTC 3DGRA 1HJUA 1WUEA 5D09A 1CGWA 2WHJA 2GLKA 2R94A 5CBBA 2RDTA 4Z1YA 2ZX9A 4YTUA 1A5NC 1SVDA 3N17A 3H54A 3PHAA 1TQJA 1TCMA 4ZBCA 3E0IA 4IWWA 1AZ1A 4HNLA 1R3WA 1Z44A 2Y85A 1F73A 1QO5A 1K02A 1TE1A 4XAGA 5I3DA 3LCHA 4HNCA 2WB5A 1VFMA 3TONA 3NTYA 5LZLA 2VVSA 4XAFA 5D02A 5CZJA 4GG9A 2XN2A 3WQGA 4Z2IA 3UWUA 5AHMA 4Y96A 4Z42C 3AIQA 3STEA 3ZFHA 4D6DA 1CXFA 5BNKA 3WSUA 3LTPA 5J04A 1GVSA 3GZ3A 3OVPA 1EP3A 1GOXA 1MRQA 2E67A 1UCWA 1M3UA 2Y24A 3P81A 5IM51 3F5JA 1FP9A 1XV8A 2QEZA 3B8WA 3D6NA 3E2SA 1V5XA 3IJ9A 2VFEA 1XLKA 4QE1A 3VZYA 1X8CA 3TWAA 3O63A 1UKTA 3F4CA 3PZUA 2VDIA 1TZ7A 4AB4A 4PMYA 4JFUA 2A3AA 3CHFA 1W6TA 4AXNA 3BGAA 4GY7A 4UQDA 1MUMA 3H53A 3P0WA 3A21A 3BLPX 3HQ1A 1I0DA 1VB9A 3AROA 4BR1A 2QJJA 1GUVA 4H8UA 2GWNA 3OBEA 1E9IA 4XZIA 5BYWA 4C6IA 4PL2A 1G0CA 1SSGA 4JQ3A 1G67A 1QCWA 1CNVA 4H9YA 2NQ9A 1I6NA 3TJLA 1UH3A 2Z4GA 2CCRA 2NVDA 1KFBA 3O0KA 5E9XA 3OO2A 2FZBA 4S3KA 2GK1B 3QZEA 4JHMA 4HIBA 1E6PA 2HK0A 1GOQA 3ARVA 4CUCA 1EXPA 3QV6A 3W74A 5FF4A 1FCQA 4FALA 5D2WA 1VKFA 3H2EA 1NWSA 2E4TA 2FZ9A 1PV8A 4R7OA 2XVLA 1TVNA 5D8ZA 4GNVA 3SUTA 2Z28A 4KBXA 3VILA 3GKAA 1KW1A 3CPGA 3WNOA 5HQLA 5HBFA 5I2UA 4JEQA 4ZOAA 2OYKA 2QVHA 2DH3A 1ADOA 3CM4A 4QITA 5CPNA 2EG8A 3U3HA 3VMPA 4NG3A 3OOQA 2WJEA 2FVLA 2FDSA 2J47A 2Q09A 5FSEC 1QATA 3RAOA 1US0A 2VELA 1JPHA 4ZQRA 1PYMA 4PCNA 2ZC8A 3O15A 4Q4KA 4L5ZA 1JF6A 4O13A 3I7SA 1LCOA 4ATLA 2G50A 3AIRA 3AYSA 1GTHA 5T8GA 4ADSA 3WFAA 4QJ3B 3MSYA 3LNPA 4XUYA 2PODA 3E38A 1KM0A 4NF7A 1TX0A 4RV8A 1KGUA 1AQHA 1MNZA 3MJMA 3VDCA 2D1ZA 1XQLA 3VIMA 2QV4A 4ICMA 1B3YA 3OEXA 3EOUA 4QIUA 2PDYA 4NJIA 1CXLA 1TELA 1WDQA 3C2FA 3TK7A 4HZ8A 4C6PA 2R6OA 4WSJA 4BA0A 5FJRA 3TQPA 3RCMA 3W38A 1UWAA 2OFJA 5I78A 2I7GA 3D5HA 1IF2A 3ITGA 3S5NA 1GYNA 4S23A 3VX0A 1E72M 4ZZ9A 1C7TA 1SFJA 4GJJA 1TJPA 1XLCA 1J12A 1UIPA 2ABAA 3ATYA 2VHLA 3KXQA 3KRSA 3S2NA 5FJIA 2NT0A 4NJHA 3P93A 2YBTA 4LYQA 4TTGA 3OZPA 3HFYA 3E0WA 3KTXA 3T0DA 4W5UA 3G18A 4MIMA 1SO3A 3G1FA 2WWDA 1ODZA 3H12A 4K7VA 3CV2A 1P0EA 3PNUA 1J0KA 1JPMA 4U5KA 4HSHA 4MWAC 1TTJA 2OPJA 2NUYA 3CNYA 4W88A 3MHGA 3UPWA 4TU1A 3WUFA 2W0UA 2D3LA 3L68A 5BXPA 2Y8KA 3CYVA 1V8EA 3QY8A 3NQEA 4JIEA 2ZUUA 1ZAJA 3N9RA 3VA8A 2P3ZA 2BSLA 3PZTA 3WQ6A 3T1GA 2OZ3A 5G2HA 4LEQA 3ALGA 1F05A 3S5ZA 1DIDA 2OSXA 1BTMA 3SBFA 4BY3A 1XDMA 1VBGA 1JYXA 3PFRA 3U4FA 3BTNA 3VNJA 2D0FA 2OEJA 3RLUA 2FFIA 1VJZA 2NZLA 3SIZA 1BG9A 1DE6A 3KOYA 3NPWA 3Q65A 3NQBA 3W87A 1E6XM 1DL3A 2OU4A 3NDZA 1JF5A 2JEPA 1EBGA 3C6CA 4POCA 3D47A 4BF9A 1E6NA 4B3KA 4U10A 2ZYFA 3WF3A 1KTCA 4MNJA 1DWJM 3S6TA 1E51A 1GKRA 2NV2A 2JFEX 5BWAA 4BS0A 2WSKA 4J3UA 2J74A 4H4IA 3E96A 2GL5A 3EMQA 4A8LA 3L2LA 4UTUA 1HUVA 2O7QA 5AYZA 2QHAA 4HA4A 3GSMA 2NVCA 4GUFA 2VEPA 4JN7A 1XX1A 2NX1A 3BAXA 2YL8A 3F1QA 3DBNA 3WUGA 1C9WA 3VKCA 1R3YA 3DG6A 2PF0A 4F0KA 4W84A 2I14A 2QJGA 3W1AA 2RKXA 1QWKA 1W5MA 4FPSA 5HWJA 4P7RA 2CESA 2RGLA 4R9OA 4Y8EA 4L6OA 3PSVA 1HFBA 4NX0A 4CQ9A 1XSJA 4H2CA 2GVJA 3BCJA 2BY3A 2BG5A 1WKFA 1NFBA 2OLAA 4IIEA 3VFCA 1E9LA 4IQJA 4TVCA 4XZHA 1PL9A 4NRSA 3KHDA 4S38A 3W7KA 1Z8AA 3H22A 5I06A 3WD0A 4PMZA 1E4MM 1TPUA 2QVNA 3KRZA 2C6QA 2GJXB 1DWAM 3AHZA 2QCEA 4KCVA 2OR2A 4NZFA 2BP1A 4XSLA 1PTDA 4ZTXA 4W87A 1KRBC 4ZFMA 2OQHA 3UT0A 3MO4A 3C61A 3SEPA 3UEQA 1GHSA 2FGLA 3E1F1 1FQ0A 4OKDA 3P84A 2EG6A 3B8IA 1Q85A 1XIEA 2Z25A 3IGHX 1A47A 4QNWA 4NXSA 4NILA 4AAJA 4AD4A 3SUWA 7XIMA 1EPVA 4WDUA 3SAZA 1C90A 4FNSA 3C3NA 4PEEA 4IMEA 2GUYA 4ICCX 3BQ6A 1ALDA 1EX1A 2V3FA 1RAKA 2OGYA 1TV7A 2J9XA 3TLLA 4KEVA 3C2YA 2GUBA 3GXIA 3H4XA 1B9ZA 1JGIA 2OYLA 5LXEA 2Z1XA 3SSZA 4YYCA 1K6WA 1PZ2A 2ISSA 4KIEA 1SMAA 3F03K 3TMQA 2JK2A 3GRIA 1V7YA 3NQ6A 3MCNA 3OLIA 1P5BA 3MHFA 5E5CA 5LNUA 3ORWA 1HX0A 4U2YA 1F3TA 1LLZA 4LC8A 4OV4A 3VIJA 2PTYA 5FIPA 3CS2A 3Q58A 3DIPA 2NXIA 1UR4A 3EOSA 4Y9OA 4LUTA 2XU2A 5CKSA 4LYRA 3P60A 3TTOA 1W1A1 1MXDA 2NUXA 4M56A 4KIRA 2GGJA 3N4EA 3UZXA 3ZO9A 1IV8A 1MYRA 4LJ3A 1OFRA 4AWTA 3ANYA 1GPWA 2R1KA 3RIKA 5EMKA 3PWIA 1P43A 4XSMA 3VO0A 2GQAA 1M01A 3PG8A 1XLJA 5CC6A 4CQAA 5HK4A 4C6FA 4Q8MA 3G77A 1EDQA 1IEWA 3ABRA 3ITYA 3WF1A 4HPHA 3MHUA 1NFGA 1DJXA 1ME7A 4L4LA 3KOXA 4PGLA 4ZSUA 5CCZA 4C1NB 3PWAA 4FB7A 1BKHA 2YCLA 5G4WA 3SFKA 2FTYA 4HPJA 5HUOA 3THAA 1QK2A 3GHRA 5FJJA 3AHYA 2OT1A 5FSDC 3PY2A 5IBXA 1TTIA 4Q4PA 2XISA 3WH9A 1W5QA 1MI3A 1H5VA 1NARA 4EVZA 5HQMA 1GONA 5C2XA 5XIAA 3D3FA 1UIOA 1GEHA 5I07A 1LDCA 3LHYA 5KITA 4QG6A 1I2QA 4NAEA 3VVGA 1UKPA 1QI0A 3H7UA 3EKGA 3GYEA 4CQCA 2I9EA 4C7FA 5M03A 2GGEA 1DQWA 5F2LA 1E70M 2GJRA 1UR8A 4UWMA 3STPA 4MWAD 3CAKA 5FAGA 4X61A 2XIBA 4TUFA 1XDLA 1QO2A 1JDAA 3ZVIA 5LIWX 4ZQMA 3NO3A 1FP8A 2JF7A 2J66A 4O10A 1V4YA 3T0TA 4GVIA 1G4PA 3SUVA 3QQWA 3I65A 3LCWA 4O50A 4LY8A 2CLKA 4XB3A 2JKEA 1B54A 1EB3A 1ZBWA 1W1PA 4LUJA 1HIZA 3MMWA 1IEVA 1ZJHA 1YDOA 1TO3A 4O4WA 4FLSA 4IFKB 4GGBA 5JMUA 1MMFA 1QPOA 3UWEA 1R5YA 1J18A 3NDYA 1JDDA 4UR7A 1H1YA 3CUXA 3V36A 5A95A 3LSCA 2IKJA 3HV8A 4UC5A 3MBDA 3S9IA 3QXBA 5F2GA 4FK9A 3VNZA 1RV8A 1RCXB 3OA5A 3TN5A 2UY2A 2WQPA 1ONRA 2CBVA 2IW0A 4I5XA 1XC4A 4PA8A 1GQLA 3UVAA 1X7IA 4LVAA 4O54A 2EJ1A 4DNHA 3L0NA 2VL4A 4HU4A 3PJTA 2ABBA 2L5HA 1G9HA 4ACZB 2ZUWA 1I2NA 3S1WA 3G1YA 3G1AA 4O8AA 4IMGA 2OLSA 2V5JA 3FJ6A 4UQEA 1TIWA 4C6EA 4NSBA 1GORA 3S5SA 3HPFA 2DIJA 1X1ZA 5LSMA 4ECLA 1RK5A 3QGVA 5D2XA 1WCGA 4HU8A 2I9UA 3CHDA 5E70A 5FF7A 2W92A 3NSNA 2RH9A 2O4MA 2CETA 3GH5A 4EXAA 1R3SA 4MNKA 2QDGA 4MKVA 3FSTA 1G1YA 1Q6GA 3GDMA 3V5CA 2Z7KA 3NA8A 3ZLHA 1DE5A 5IDZA 4GVGA 4G1KA 3MZ2A 3QHNA 2QCCA 4P8WA 1XC6A 2BVTA 1XL9A 1NSJA 1LYXA 1PX8A 2Q3OA 4PMDA 4JKKA 2VRQA 4WXYA 1X96A 3WDRA 1Q8AA 4QLJA 1SUXA 4QJ4B 1CDGA 4RZBA 3NEHA 1LUCB 4K2SA 1C92A 1JUKA 1TKKA 3NZRA 1I60A 1Q2SA 1M41A 1P6CA 4LCSA 1PKNA 3MANA 1EX5A 2ZX5A 3U2OA 1V3IA 1VP5A 2WO5A 3U2EA 3EPMA 4FIRA 3C4UA 1DWHM 4YYFA 5HMDA 4UQBA 2BDQA 1U1UA 2X1IA 3DGBA 4XZBA 3BV4A 5JVLA 1UC4A 1EF3A 3QSTA 3AZRA 4NYUA 4JAWA 5HXMA 2HNHA 4REQA 1ITCA 1EUAA 4IIFA 3UZYA 3W86A 3WD1A 1X98A 2PGWA 4MAZA 1LG1A 1K7EA 2ZUVA 5ABHA 2QV5A 3ZJ8A 2ZFAA 1FWIC 1P0NA 3RM8A 2Z00A 4ZB5A 1E15A 4WKHA 3A5FA 1UD5A 3GNDA 1DQXA 1VEPA 4TQTA 3G1RA 2H3DA 1CENA 2BB0A 2Z6JA 1DTUA 1LL7A 4HU0A 4JYEA 1VZWA 1NQKA 1W1TA 3MBFA 1UROA 2NWSA 3TKFA 2OXNA 4L65A 5TNVA 3AXKA 4HCLA 4I7WA 1HKMA 5FD0A 4I7UA 5DO8A 1KB3A 1FXPA 3N34A 3OTRA 2EAWA 3DOPA 3MUAA 4DHGA 3LCIA 3U7VA 1TZ9A 1DJYA 3NZQA 2W61A 4MJ2A 1T96A 4I5RA 3H26A 2X16A 1ZTVA 4DUWA 2CIPA 2E5DA 3EOLA 4KKXA 1PIFA 3N2TA 4ATDA 2GPTA 3N4AA 4U31A 3H2OA 3QGAC 3PTDA 2E1DA 3IIVA 4ACYA 1OBAA 2J78A 2Y0FA 2BHUA 5DANA 4NJGA 2GK1A 5A6MA 2DJLA 4TV6A 1GOMA 1XIFA 1EHNA 3CUHA 3T08A 5FESA 1J0IA 4M6QA 3P2VA 3PTKA 4ZR8A 3W73A 4B5SA 3CT7A 2E6DA 3EEGA 2OX4A 1GOWA 3LCFA 1ZBKA 1R85A 4NI8A 1AQMA 3E49A 1XYZA 5EPDA 3ARSA 3SGZA 1HKIA 2OZ8A 4HTBA 4WK9A 4Q8PA 1HP5A 4RZ5A 3CPRA 2OWWA 5A6AA 1YKWA 2DV0A 2J79A 3VUPA 2Z6IA 2WHLA 4WDTA 1BQCA 3QTPA 1OGGA 3F4NA 4JZ5A 4M1RA 3P6LA 3ZLGA 3O9NA 4GCAA 2P1FA 2C1GA 4I9AA 4IOTA 1C8VA 3VD7A 3AWOA 5EA9A 3W00A 3K8LA 3TSMA 2OJPA 3GUGA 4S2BA 3VOFA 1XLIA 1D8WA 3SO7A 4LYPA 2TPSA 4NQ1A 2Z0IA 4DUOA 3UWWA 3UG3A 2P3EA 4JTEA 1ECEA 1Y7VA 3B03A 3RPDA 2NX9A 1AJ2A 1FWEC 3DHFA 4I6VA 2BXZA 2MUCA 3HQOA 4C6NA 3GM8A 1FDJA 3L2MA 2OB3A 1GZ1A 1A5CA 5CJMA 4H6KA 2PP3A 3ZVHB 2VGIA 5C70A 3O1NA 1KFKA 1VD6A 1OX4B 4I9TA 1PHWA 2PWGA 1AW1A 3WEMA 2DORA 2I57A 4D6GA 2BV9A 3WJWA 3M47A 2V38A 1V02A 1TA3B 3UYCA 2YXOA 4GZEA 2NT1A 4ZO8A 3TYAA 1IIHA 1VCGA 3FHAA 1Z3NA 3OQEA 4MB3A 1XRFA 3CWOX 3S2LA 1XIGA 2BNJA 1T5AA 4WKAA 3B0UX 1NAL1 4H6RA 4UTWC 4ADUA 4FO4A 2YCKX 2QGHA 3B9EA 4LNYA 2XUCA 1UUQA 3HV9A 2INEA 4U3CA 3AS0A 3LXBA 4MF4A 1EJSC 2DSWA 5AZ1A 3CYJA 3BGJA 4IQDA 4GUHA 1QVBA 2FJKA 1NJJA 4L1GA 3IACA 2VFIA 4US6A 1L0PA 4M19A 1KFJA 5I3KA 4Q4OA 3W81A 1G7UA 2VJXA 3WEZA 4CCEA 1TPC1 1V6TA 3IPWA 3ARZA 1UZ4A 3M6YA 4IJCA 4UOZA 1JPDX 3BAJA 3U8GA 2Q6ZA 2OGJA 5CGMA 2GGHA 4KRUA 2WMIA 2X0HA 3M41A 1NY1A 2V5DA 5A8PA 2Q02A 5C0QA 3R8RA 5HJLA 1ZU8A 5IRPA 4ADTA 2ESCA 5D4YA 3GHTA 4E4FA 1EJRC 1QMLA 1XCFA 5M1TA 3FJNA 5BU6A 5BMWA 1NU5A 3DBPA 1Y5XA 4ZCWA 3MTWA 5C6MA 3VTRA 4JTRA 3VKDA 2ZKMX 1SJAA 3TOYA 1CPUA 3M9YA 5HATA 1R7AA 3VIFA 3H23A 3HB9A 4WJ8A 2B7OA 1XYLA 2XINA 5CSSA 1UA3A 1HJVA 4D9PA 3MUZ1 1TMQA 1FVPA 4RDVA 4KFOA 4HCHA 3GU2A 1Z9AA 1W31A 3TH6A 2CZFA 5EGRA 4F79A 3KBWA 4S3CA 2DDXA 1TWZA 3WG6A 1Q5MA 3EWZA 5JBDA 3LI1A 5IOBA 4JNZA 3WLSA 3SGUA 4AC7C 1OQFA 4FIQA 1F3EA 3QZ6A 2XZ7A 4M8UA 4RXGA 1AFSA 3W70A 3ZMRA 4H6QA 4PTVA 4JEJA 4PUUA 3H4WA 2DIEA 2YKKA 3GLCA 2PA6A 3L4VA 2J25A 2TMDA 4GNKB 1ZP4A 1HN1A 2Y70A 4W8BA 3S1GA 3DU0A 1CGTA 2Z24A 2VD8A 2QR6A 1KXVA 2DVXA 4REQB 3GHSA 2QYGA 4DUVA 3BSMA 2UY4A 3VC5A 4KWOA 3LLFA 4HA3A 3E2QA 5HDRA 1RSCA 4LF1A 1C29A 4DF1A 3O2LA 4LAMA 4GACA 3ITVA 3OVGA 4IG2A 4X0VA 2V0TA 1LROA 4J2PA 4IHCA 1T7LA 3JZUA 1ZY9A 2XH7A 4AZGA 2PTWA 3WQDA 5C5YA 1PX3A 4HD5A 3B8DA 1LLWA 5C55A 3WD3A 3WD4A 3ARQA 3T8QA 5B7ZA 1IYXA 3R79A 1W9VA 4NT0A 4O0ZA 4LQ1A 1KGWA 1R3QA 4PC8A 3VNDA 4AIBA 5M5DA 5A3HA 1ONWA 2F2KA 1O5RA 1BGAA 2GVLA 2IQDA 2QKFA 1DOSA 3NL2A 3K5XA 5CSRA 3AZTA 2PWVA 1PSCA 3M46A 3FA4A 1PEZA 4GE8A 3RHGA 4FNPA 1LT7A 4JIIX 5ENLA 2FZDA 3VI2A 3BLDA 2XM1A 3TW6A 1XKYA 1GTEA 1SGJA 5D9OA 1SZGA 4D6JA 1DPMA 1SPQA 4CNSA 1MDRA 1YPFA 4DZIA 3A6OA 4K1GA 4E8GA 2VC9A 2A0NA 5EFFA 1S3HA 1TWWA 3FEQA 5LGZA 1H11A 1AZ2A 1TCDA 4IMCA 4N2YA 1REQB 3E5PA 2QMKA 3M4HA 1RZMA 3W1XA 2WBKA 1KQZA 1OJXA 1SSDA 5LA0A 2VWTA 3OZMA 1BAGA 2A7RA 2ZTKA 4DEFA 1JNDA 4C5ZA 2PLJA 3Q67A 2ZRWA 2CERA 4A3HA 4GXPA 1VBJA 2FVMA 2OWXA 4FNUA 1VJIA 1V6VA 1JPIA 5A1AA 1EC7A 4S3AA 3G3DA 2B7QA 1QW9A 4QTGA 3MJYA 1XCXA 1CBGA 3T55A 1JZ5A 1OCNA 3F7JA 4JXCA 3IUIA 3VDGA 4RE2A 1UBPC 5B80A 3IIPA 1K4GA 1RHCA 3GUWA 1KCZA 3S6DA 4IPLA 4LEFA 3U5UA 1OT1A 3MZNA 4YTSA 2V3EA 3MI6A 1M9HA 3UXLA 3AYVA 3IVUA 4C6JA 3VNYA 1SR0A 4E8CA 1QWGA 1BSLA 5DEZA 5GPRA 2HK1A 2P88A 5F7UA 5AC5A 1H5YA 1KV5A 1ICPA 3NVDA 5HJYA 5IFPA 4ROQA 1NEYA 4KQNA 4KMQA 2WZHA 4GJ1A 1H41A 4PH6A 2WC3A 5EMYA 4GOAA 3WMLA 3NL6A 4O12A 4M81A 4ZL1A 1D3GA 4MUZA 1YNPA 1CLXA 2BVYA 3WL0A 3BICA 4LV4A 4GC3A 4JTFA 2J6XA 4YNGA 2AMGA 1CXEA 5MHBA 4TV5A 2XGZA 4E3VA 1EYWA 1B3XA 1XRTA 2OQLA 3UETA 3KW3A 1HKJA 2D24A 4WJXA 3UW6A 3GVRA 1VHCA 4GMEA 4IFKA 4UTJA 4L9XA 2H6RA 3CHEA 3RILA 4GX8A 1ZJIA 4FF5A 2WW5A 2BS9A 2BZNA 4ML9A 2VZSA 1XM3A 3O05A 2ZRYA 2PCEA 4HOXA 4LBSA 4WRHA 1CTNA 4DUXA 3L4UA 3BPWA 1JFHA 4L56A 4ZQOA 1NOWA 3CASA 2G8ZA 3TNOA 1Q2RA 3VABA 4XZ9A 5HNNA 1BPLB 2PDIA 3BK0A 1QOQA 2X1RA 2D73A 5ABFB 1PB0A 3NQVA 1YXCA 3I3BA 5AFDA 4HQVA 2PP1A 2PDGA 5FL1A 2WK2A 3LCXA 3OZOA 1UWIA 2C0AA 2GVGA 2ZOXA 4K3ZA 4US5D 4BJHA 5A2BA 5DRCA 5DCEA 4G2DA 3HPZA 4TMCA 1AJZA 2Z7GA 2FYMA 5AHEA 3VM5A 5FJOA 3LZ5A 1E1FA 4KERA 2Z2UA 3W6YA 1IWBA 1B4EA 4GYJA 4ZFCA 3TUUA 2C1HA 4BI7A 4LWWA 5AN7A 4S3FA 3UWQA 3GC4A 3A5VA 3SRHA 1CX9A 3IGSA 5G2IA 2YDSA 2ZRXA 5C9RA 4NL1A 4C7DA 4ZXLA 2A21A 1XDJA 4M6PA 4F48A 4JKMA 3BW4A 4C6LA 1HG3A 2G5WA 1MFUA 1JCJA 1VYSX 4ERGA 4CU8A 3MCOA 3DXIA 4EPBC 4ZO7A 3RDKA 2VZUA 3WLHA 4DLFA 3VAVA 2ZZ4A 3S83A 1TWIA 2HRWA 2A7NA 4H83A 4MB4A 2VEIA 1QPKA 2WKLA 3CL8A 1EBHA 1ECQA 2AL2A 3I4KA 4M7TA 2XVGA 3M64A 4Q8NA 4F4RA 3WLPA 4R88A 4MDOA 4GINA 1QR7A 3FLUA 3CUGA 4LALA 3TP4A 4R53A 3W83A 5CZKA 1JUBA 3R13A 3IJQA 1RQBA 4PL1A 4JDYA 1A0EA 1XLGA 3C2OA 4JTSA 4UMCA 3GIYA 1ME9A 2NW0A 2Y5SA 3SB0A 4CLMA 4J9JA 2WSRA 2FQIA 3M0XA 4V2XA 4CD6A 3AXMA 4IPIA 1OFDA 3LV5A 1IEXA 4C6DA 4F9JA 5K7JA 5FEZA 2OQYA 1JNEA 4UIOA 4FF7A 2PS2A 3FK4A 3FVDA 4D6EA 2YLAA 3KOFA 4TTUA 5CG7A 4ZQNA 5CLTA 3RLVA 5I7GA 1V6WA 2XFYA 1W5PA 4BEQA 1R87A 1P48A 4EPEC 3QKZA 1Q63A 2W5FA 4TMBA 3DC0A 3I4EA 5T9CE 1GKQA 3EPNA 5A6BD 3N2BA 1B57A 4H3DA 3QR3A 4JTHA 2JALA 2YLLA 2BY0A 1I1XA 4LYKA 2E0PA 3LTSA 1LBFA 4NNAA 5BXRA 3DZ1A 2VP8A 4DXXA 1FDYA 3VIOA 3V75A 4L4OA 2ZRVA 2E5CA 3RF9A 2PZNA 1WXZA 3GXFA 4BEUA 7A3HA 1MSSA 1Y0EA 1LF1A 3ZIZA 1W1ZA 4DY1A 1W3TA 5EU9A 3WQEA 5EL1A 2VZOA 3CMFA 3W2LA 3TQ0A 4Q4RA 3ATZA 4FSAA 3UF9A 3M5XA 1XJBA 3D3AA 1JDEA 3C52A 1YEYA 2XDFA 2GDVA 2XVNA 3EAUA 1K8YA 3CWNA 3T78A 3U5YA 3IV8A 4MKSA 1FHDA 1X6UA 2XIQA 4O1EA 5LXXA 3FKKA 2UV8G 1EWEA 4AD2A 4MAVA 3NZGA 1ZHAA 3D0CA 1TUXA 5A6KA 1OG0A 4WXZA 1KBJA 4L1XA 3MUY1 3QV8A 4QQUA 4O16A 1CGYA 4HCDA 4ONVA 3UJ2A 1KWGA 3M0ZA 4MWAB 3F5KA 1XYMA 3AS2A 2VGFA 4MLJA 4IX2A 4DJED 1ISWA 1I8JA 4BWLC 4CNNA 3UGVA 3ABZA 2PRHA 3E0LA 5FF0A 4C65A 3C3UA 4DB7A 2BXYA 2C91A 3ZOAA 3GIPA 1GEQA 5IDIA 1DP0A 2R14A 3PB2A 2XJ7A 3USZA 1EZ2A 3AO0A 3P8JA 5IHRA 3ANVA 2IMRA 2V5CA 4H00A 1UQZA 1ZCCA 4XZNX 3TLQA 4DO5A 3BMXA 3UERA 1IR2A 1FH7A 5FJPA 2BASA 4P7LA 4HPXA 2GSHA 3GVQA 4QEHA 1YLVA 2J8TA 3KTCA 5A5WA 2HMCA 3W1TA 3NQDA 5LHFA 1D3CA 1TV3A 2ANUA 4MLRA 4N02A 1Q6QA 5D9MA 1V0MA 3UBPC 3UPMA 1MNSA 4PULA 4WDWA 1EA9C 1SM9A 5J5DA 1GGOA 3BZGA 1GQIA 2WZEA 4HMDA 2WYSA 3OGSA 3CZ8A 4PBFA 3N2CA 1E5NA 4TVUA 2Z2BA 1OADA 1OSEA 2HJPA 1XLFA 3O6CA 1EJXC 3Q2DA 4F0HA 1IWPA 1YMYA 3NQGA 1XUZA 2FTPA 1FWGC 4A3RA 2EPNA 4QQ3A 4N42A 1E0VA 4QS5A 3SY5A 3WK3A 3I68A 4X2RA 2FB3A 4QP0A 4XAPA 4XIAA 5HMFA 1S5WA 2Z27A 2Z1SA 1QI5A 4D6HA 3GYCA 2FDMA 3ALFA 4QAWA 1KBKA 4GZJA 4U33A 3M0LA 2WC4A 5D04C 3GVGA 3KBVA 4K1WA 3IUDA 5AY7A 4OHQA 3THDA 3UWVA 4E4PA 1BQGA 4O15A 2V30A 3DERA 4LX4A 5KTLA 1HJWA 4L61A 3P3BA 3GR7A 4QDPA 1KFEA 3T42A 2C1IA 1VFLA 1WO2A 4O57A 3WY1A 3MCMA 2HCVA 2EQDA 3AMCA 1JI1A 5XINA 4ZEPA 4NAFB 2NQHA 4BI5A 1QBBA 3T4WA 5JIPA 1JXKA 4A6GA 4B5VA 3PZIA 4DF2A 1W37A 3L21A 2PPGA 3SUSA 1ZAHA 4KRZA 4UFLA 3LYEA 1CLKA 3UNDA 4L4MA 4WQ6A 4UOQA 2WC7A 2DZAA 3KEHA 3VGDA 1W5NA 6REQA 4FXRA 1M68A 2P8CA 3EDJA 1S5TA 4HKPA 3SADA 2J7HA 4BF7A 1WDSA 4J3SA 2XYLA 3W01A 3G1DA 4AZBA 1L8PA 1DJIA 5CQ1A 1AUSL 4B15A 1JCTA 2BVWA 2PTDA 5FF3A 4GXMA 4MY1A 4MZYA 5FL0A 3UQNA 2X30A 1J01A 1EJ7L 4X60A 4URIA 5F2IA 3AU6A 4IUOA 1QNVA 3LLXA 1YBQB 2GQ8A 4PSRA 3UD6A 1O6IA 2NV1A 5HJXA 1O60A 2GJNA 2J13A 1VBHA 4H2HA 2VEFA 2JGQA 1DWGM 4JX6A 4C6QA 3WBEA 2PGFA 1LQAA 2G4JA 3B97A 4MPKA 1OFEA 1TPWA 3LGDA 3W2JA 2QNEA 3R5EA 4PB5A 4TOQA 1KLZA 3PF3A 3SRDA 2D2OA 2OYMA 3DEQA 4PRTA 4AZCA 5DRIA 3RX4A 3W7DA 3GAYA 4V27A 1F3XA 1I2OA 3M1ZA 3ONBA 2WMGA 3AMLA 5FJUA 4QSHA 1MFVA 2W4XA 2V2HA 4LF2A 3PPGA 4JIQA 3UXDA 3VX1A 3ZT7A 1XGEA 1I4NA 3HPXA 3S3GA 1OC7A 3FSUA 4Q33A 2J75A 3TR9A 4RNHA 2PWUA 1KM5A 1D7FA 4F2UA 1W2VA 4QNEA 3T2PA 2JF6A 3O6DA 4X63A 4YVPA 1EEPA 2ZUSA 1KFLA 3MSRA 3ARWA 7REQA 2CHOA 3VE7A 1UWRA 4DYEA 3KAOA 4OQVA 2UBPC 3SECA 4PUEA 1IHIA 4MPQA 1EO7A 5KZ6A 3W24A 5IXEA 3GG0A 3UWYA 5DELA 3KBNA 4DJEA 3EEZA 1A0DA 3N2MA 3UR7A 1F8IA 3QN3A 5JBFA 4DI9A 3WK1A 4HMNA 4W7WA 5A94A 3W7MA 4RE3A 3KVLA 4OBRA 3LHWA 1TPEA 1W3NA 3ONCA 4WOQA 3VGBA 1E6RA 4G5DA 4KH2A 1IZCA 2HVMA 4JY8A 3UFYA 4HMEA 5CG0A 4M1BA 1IQ8A 3ECQA 1R3TA 1XSKA 2F8QA 4V1YA 3CZLA 4NZ5A 3FCPA 1VCFA 3M44A 4IT1A 3VGGA 2AOSA 4H9ZA 4Y6GA 4NXKA 3WKZA 2D0GA 4CQDA 4YL2A 1Z6KA 3GFXA 3DFPA 3UZJA 3W2NA 3RX3A 3WDHA 2VFHA 1HP4A 1XLEA 2EPLX 4GLEA 3AWNA 3RCNA 1IT8A 4O53A 1RQHA 1MQPA 4YHEA 5C54A 2H8XA 1EL3A 2VGBA 3PP7A 4LUSB 4A2SA 3RGTA 3CO4A 5F2MA 5LIXX 2XZ9A 1SJCA 5DMNA 4FNQA 3M0YA 4CNTA 3SCPA 1XWYA 4HZ6A 1RPXA 1GCYA 4IP4A 2ZWYA 2DJXA 3FGCA 2UY5A </