2PDMA

Human aldose reductase mutant s302r complexed with zopolrestat.
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
315
structure length
315
Chain Sequence
ASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLRCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Merging the binding sites of aldose and aldehyde reductase for detection of inhibitor selectivity-determining features.
pubmed doi rcsb
molecule keywords Aldose reductase
molecule tags Oxidoreductase
source organism Homo sapiens
total genus 105
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2007-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2pdmA00
3UZYA 3R58A 3GUGA 4QBXA 2ACQA 4PRTA 4PUUA 2IPJA 1IHIA 3Q67A 4HBKA 3D3FA 5M2FX 1MI3A 3FJNA 1AZ2A 4LB4A 4WRHA 1AH4A 4JQ1A 4LBSA 1ZQ5A 3R6IA 5HNTA 3UG8A 4GABA 4JQ3A 1ADSA 2HV5A 2ACRA 2HE8A 1QWKA 3V0SA 2HVOA 3N6QA 1PWLA 4YVXA 1YE4A 2PDCA 1X98A 4R9OA 4QXIA 1RALA 4FAMA 4XO6A 2PZNA 4H8NA 2PD9A 4NKCA 2IQDA 1A80A 3EB3A 3LEPA 4Q3MA 2NVDA 1K8CA 5JH2A 1T40A 2PDYA 4JTQA 3LD5A 3O0KA 3WBWA 2INZA 2ALRA 1QRQA 1AH3A 1VBJA 4YS1A 4JTRA 1RY0A 2PDQA 1Q5MA 3MB9A 4FZIA 2IPFA 1J96A 4HMNA 4PRRA 1PZ0A 4WDXA 3NTYA 4MHBA 2PDFA 1RY8A 4XK2A 3R94A 4GQ0A 3LQGA 4GIEA 3UZZA 2IKIA 4IJRA 3R8HA 4YVPA 3B3DA 3P2VA 3WBXA 4DBUA 4DZ5A 2CLPA 3LZ5A 2PDGA 3UP8A 2IKGA 2PDPA 4PR4A 2R24A 2IKJA 3G1RA 2C91A 3ONBA 3CASA 1XF0A 3UYIA 4XZLX 1ZGDA 1PWMA 3V36A 5DANA 3H7UA 3DN5A 4GCAA 3H4GA 4XZIA 2F2KA 1EKOA 4Q7BA 3GHUA 3R8GA 2DV0A 4RPQA 3CV7A 5HNUA 1S2CA 1Z89A 4XZHA 1UR3M 2NVCA 4DBSA 4WGHA 2DUZA 2J8TA 2I16A 1YNPA 4GQGA 4JTDA 2PDUA 3V0TA 1YNQA 1GVEA 5JH1A 2WZTA 2PDLA 1Z3NA 2PDJA 4XZNX 4JTAA 2FVLA 3UZWA 2PEVA 3MC5A 1AZ1A 4JIHA 1SM9A 1PZ1A 4ZFCA 1MZRA 2PFHA 4GACA 4JQ4A 3CAVA 3GHSA 2I17A 4XVEA 4ASTA 2IS7A 3M0IA 4L1WA 3LBOA 3UZXA 4GA8A 2IPGA 1EF3A 3R7MA 1AH0A 3T42A 3WG6A 2PDBA 5LIKX 1VP5A 1EXBA 3EB4A 2INEA 4XAPA 3N2TA 2QXWA 4WDTA 4DBWA 1JEZA 2A79A 1OG6A 3DOPA 2PF8A 3H7RA 1XJBA 3KRBA 1PYFA 2PDMA 4JQ2A 3R43A 2P5NA 1YE6A 1C9WA 2BGQA 4IGSA 2BP1A 3BV7A 5HA7A 2IPWA 2HE5A 1HW6A 1X97A 3GHRA 4QR6A 1ZUAX 3CMFA 4XVDA 4XO7A 1X96A 4YVVA 3COTA 1LQAA 5LIXX 3S3GA 5AZ1A 1FRBA 5AZ0A 1S2AA 3WCZA 3BUVA 1R38A 4PMJA 1S1RA 3LN3A 2IQ0A 3V0UA 2PD5A 5LIUX 2HVNA 3LZ3A 3LUTA 3QKZA 1LWIA 4I5XA 2BGSA 4ICCX 3U2CA 1Q13A 3RX4A 2FZBA 1IEIA 4LBRA 4YU1A 4EXBA 2PDWA 5LIYX 4WDWA 4H7CA 1ZSXA 2IKHA 1AFSA 2WZMA 4WDUA 2PDXA 4PUWA 1EL3A 2AGTA 4WEVX 2HDJA 1S1PA 3ONCA 4FA3A 3O3RA 3FX4A 2HEJA 3ERPA 3LQLA 3M4HA 3EAUA 4JIIX 3LENA 4JIRA 1MRQA 1XGDA 4G5DA 3VXGA 3C3UA 2ISFA 5C7HA 2ACSA 2ACUA 3GHTA 2PDIA 4QX4A 4OTKA 4LB3A 4F40A 3BURA 1Z9AA 4JTCA 5KETA 4LAUA 2FZ8A 3LNMA 2PDNA 3UFYA 3G5EA 2FZ9A 1Z8AA 3CAQA 4IJCA 2PDHA 1US0A 4EXAA 5LIWX 3BCJA 4FALA 2FGBA 1T41A 2VDGA 4L1XA 3RX3A 3F7JA 1HQTA 2F38A 3WBYA 4LAZA 1M9HA 3RX2A 4JQAA 2R9RA 3UWEA 3V35A 4AUBA 3CV6A 2DUXA 2PDKA 3Q65A 3UGRA 3M64A 2FZDA 4XZMX
chains in the Genus database with same CATH superfamily
4M80A 5E70A 1W1A1 4L1GA 1YADA 1PCWA 1Y7VA 5A8GA 3VE9A 3GVVA 4XV0A 5CPNA 3LSBA 1H63A 4M81A 4JQ1A 1BEUA 4AG0A 4UTUA 1NWRA 3B0UX 4QIUA 3FFSA 4BZYA 4KEZA 4I7UA 1JCMP 5F2MA 3V0SA 2Y0FA 4YVXA 3VX1A 3PTMA 4LUSB 1KFEA 2PZNA 1HJWA 2IQDA 3ALFA 2R1NA 3FV9A 4KWWA 3UJEA 4PYSA 5LKYA 1TPWA 4H6QA 3PNZA 4US5D 1TELA 1UP2A 2Y61A 2G95A 3NVDA 3ITXA 3CUHA 1Q6LA 1BTCA 3R25A 5C2CA 5XIMA 3H23A 1J79A 1RP8A 1W8SA 1WKYA 1IE7C 4HPNA 1UWRA 3E2RA 2BHZA 1GOKA 1SU5A 3ECQA 5KEZA 5F4WA 3TNBA 3QY7A 2IPFA 2YKKA 3WLMA 1U5VA 2J7EA 4UTKA 4BR1A 1KXHA 2DFAA 4F0RA 5KTLA 3OVQA 4J2MA 1RY8A 3KVLA 3KTXA 4MTVA 1IIHA 5DEZA 4B4HA 1EO7A 1LWJA 2WVTA 2BGNE 5A6MA 3I7QA 3IEBA 4F79A 1YMYA 2HS8A 3R10A 1UH4A 1YDOA 3C0SA 3CH9A 1A0CA 2E28A 2V8ZA 2CLHA 1U1JA 1IWPA 1VZWA 2DZBA 1MMFA 1OFEA 3KVMA 5J04A 4MWAA 5I7GA 3GAKA 1JAEA 2Z25A 3GBDA 3ORWA 4JXCA 3GDBA 1FWSA 3MKCA 4RE2A 1EQCA 4GZIA 1K6WA 4FIRA 5HOSA 3UY8A 1FY6A 4XG1A 4H41A 2UV8G 1XP3A 1U2YA 4J7RA 3V36A 1V03A 1HO4A 3DX5A 4ATWA 4GKLA 2Y2WA 4W8AA 2X1UA 7ODCA 1XDJA 4ZXLA 1VEMA 1TVLA 2PWEA 1PZ3A 1IYXA 1H60A 3PP7A 3A4XA 2O92A 4RX0A 1E6XM 1EB3A 3ANYA 4C7FA 2ZX6A 1TREA 1RUSA 3S47A 2D2HA 3LPOA 4GO8A 3ZSSA 4US6A 4QE1A 4J1OA 2G4JA 1Z3NA 3FN9A 2AQVA 1YDYA 4XZNX 4LUSA 4QE5A 1GJUA 2PEVA 4QS5A 4U10A 1C3FA 3CQHA 3ZM8A 2OU4A 7A3HA 4JIHA 3WD4A 3EX1A 5CGQA 1Z48A 4UTTC 3OHIA 2V63A 3W3OA 4JFSA 4WR3A 3CM4A 2J9YA 4E3VA 4ZQNA 3E02A 3B9OA 2I14A 2XFYA 4XD6A 1VFUA 1Q66A 3G0SA 3UG3A 3QY8A 5HJLA 3R7MA 1OWQA 4QTGA 2V68A 1VFOA 4KW2A 3WH6A 1Q3NA 5EFDA 3WLSA 1BKSA 4O1CA 1JPKA 3GE7A 1UBPC 4PC8A 2P76A 1F3WA 2TSYA 4HZ6A 4QITA 3UXLA 2JGQA 3SZ8A 1MWOA 4DF2A 1XYCA 2HISA 2IPWA 4JYDA 5AHNA 1A49A 1TB3A 3QPYA 4LGXA 1Q2RA 1ZUAX 4LNCA 3W88A 1MDLA 1S2VA 5HWNA 2AKZA 3S3GA 4CU6A 5HUOA 3W1PA 3CPUA 4V1XA 1KO0A 1Q85A 4B15A 1B3XA 1XFBA 4FF5A 1ZBVA 2RKXA 5FEWA 1SPQA 3THDA 1BKHA 1V6XA 3RX4A 4XAZA 3ARYA 5C54A 2JGYA 5G1TA 1V5XA 4UC5A 2ZZ7A 3M0LA 5K4ZA 3WNKA 1J5SA 1CIUA 1FKXA 1A3HA 4B5TA 4AFYA 2NLYA 3KLLA 4LWWA 4HA3A 4G8TA 1BVWA 3IPWA 1VFTA 1VJIA 3XIMA 4Q4OA 3KOYA 4JR5A 2YFNA 4OV4A 5D32A 2Q8XA 3V75A 1WDWA 2CLEA 3QMTA 4NU7A 1G94A 1E51A 4F40A 1C8VA 2H8ZA 3M41A 1TTPA 4LJ3A 1EEPA 1D7KA 2V2HA 1FWFC 4HHMA 4PTDA 4A3RA 2PLJA 4FALA 3WNOA 1U1UA 2V5KA 1SMDA 3EOUA 1W3TA 1DJYA 1NP2A 1RH9A 1H0IA 4W89A 1ZCOA 2PUZA 3CV6A 3Q65A 3UGRA 3W6LA 4GC3A 3WD2A 3IACA 4QDWA 2VVSA 1CGUA 4O0KA 2ZRVA 3VE7A 4PUUA 3CLMA 2Y5EA 1PV8A 4NX0A 1JIBA 3UVIA 4UQAA 3BK0A 1JULA 1Y0EA 1WPCA 4RR4A 3TK7A 1GW1A 1XPGA 3D0CA 1JQXA 3BZGA 4P8UA 1OIMA 2J8GA 3WK1A 3S5YA 3N73A 4GPNA 1XIMA 4GYFA 4J5NA 4BI6A 3TAKA 1SZFA 3K13A 4HYVA 1X98A 1L8PA 3RHGA 4AHOA 3U5YA 3S2LA 3H2CA 1Q6QA 2G3NA 4XTDA 3N17A 3HQPA 4GQRA 2GJXB 4KCUA 2VCAA 1S2WA 3ATYA 3U7VA 3LD5A 3PBWA 4JTHA 3NFUA 1H7OA 3P93A 1RR2A 1KXVA 1GYLA 4GQBA 2W67A 2XIOA 3B9EA 1JZ4A 3O07A 2ZZ1A 1SGJA 1UR2A 3AS0A 1G69A 3KL0A 2UWFA 3T0BA 2XGBA 2D3NA 3UWZA 4DO5A 2NXHA 1XD1A 3HO8A 2YBUA 3T09A 3IIOA 4DBEA 3S46A 1FOBA 1LLWA 4I7VA 2WMHA 2Z1WA 1ZU8A 5DLCA 4P7LA 1KGUA 4REQB 3RU8X 1JNEA 1OCQA 4XK2A 1TWIA 1S46A 1TV8A 4UZUA 3WLOA 3UZZA 3EOOA 3PY2A 1GNXA 1GG0A 1UD3A 3LCXA 2A7PA 3E9AA 1JZ7A 4IG2A 4K2SA 1FHDA 4AW7A 4DZ5A 2W9MA 1GVIA 3QHOA 1M5WA 4NJIA 4U33A 4B91A 4JGDA 3H55A 3OODA 4XD5A 2C91A 3SECA 4NYYA 2Z1XA 5DMNA 5HDRA 1HJUA 3PWIA 3TKFA 3SN1A 4F2BA 1I6NA 1E1FA 3D6NA 4GCAA 3UJSA 1EH9A 1J11A 4XZIA 3ZZ1A 3HFYA 1NF7A 4BWLA 3IJDA 3GHUA 2XIQA 4TU1A 1TTQA 1UC4A 3BDKA 4X9SA 1KWKA 3MU7A 4AIUA 4DX3A 1Z89A 2PP0A 2OVLA 4WGHA 4LY4A 4D8LA 1JCYA 3AS2A 5MKGB 4Q22A 1R3SA 2X0YA 5FCZA 5I3DA 4QQ3A 4YYCA 1LJYA 3GR4A 3WJXA 3OZYA 1S5WA 3AALA 3BH4A 3DYPA 1VD6A 4LYQA 4DYEA 2QVHA 3P61A 4GY1A 3PZ9A 4AH7A 3O8AA 3L4TA 2FHCA 3CC1A 4M19A 2GJXA 4RNIA 4AWSA 5C9WA 3L12A 4H6EA 1AG1O 5HULA 4IPLA 2GPTA 3GDKA 3NEVA 5I3IA 2X2YA 3IUHA 4LUYA 1GPWA 4H83A 1AJZA 3CUFA 3GZAA 3PZMA 3WK0A 2I17A 2YPIA 1Q2SA 1MXDA 2BB0A 3GB6A 4L1WA 3AMGA 1KCLA 3L2MA 4TMCA 1UKPA 1VJZA 4HMCA 1XICA 3ELFA 4HB7A 1HXJA 4LVGA 4PL1A 2JKAA 4ORIA 1LG1A 4REQA 3DFTA 4FNPA 3RPTA 3BCDA 4NZ4A 1W5QA 2GOKA 2PDMA 2NUWA 2VFEA 4JQ2A 1WZKA 1QTWA 1KM1A 4FR1A 3R43A 1EP1A 3KBNA 4GY0A 3ZOAA 3M7SA 3SN4A 1UUQA 1MFUA 3HV8A 1AMYA 4IP4A 4RZ4A 3R0DA 5FKYA 3W2LA 1JYNA 1OC6A 2R1KA 5DT5A 4CD7A 2QDHA 2CHRA 5FSDC 3B04A 3C2YA 4R3UA 4OUEA 3OLEA 3E5PA 4IPPA 1K03A 3UXDA 2V0TA 2XTKA 9XIMA 3U4FA 3P84A 1HL8A 4ZE4A 2I7GA 4AD0A 4TTGA 2CZFA 4MAVA 4L9ZA 5BRQA 2VFDA 1GCYA 1ONWA 3HURA 3CYJA 3CHEA 3QKZA 2YIHA 3M0XA 3REQB 3T2OA 4O54A 1Q13A 1LOLA 4B9YA 5U4NA 1IEIA 1PXGA 4S1FA 4X22A 2QUMA 3H2EA 4ZOBA 4BA0A 4BI5A 4AVOA 3G1DA 4HJFA 4OJYA 4Y9PA 3ZFHA 4E3TA 3S9YA 4I9MA 4AIOA 1OFPA 3VKAA 2VR5A 3PZNA 5XIAA 3KBVA 4K8HA 1L2QA 2PLCA 3EXSA 1BGAA 2A3LA 3QHMA 2W92A 3LENA 3MHUA 1EDGA 3LLXA 3VIHA 1TE6A 1O6IA 1J5TA 1B0IA 1TPH1 2OEKA 5AC6A 1UWTA 1HFBA 2OX1A 4I9AA 1G0CA 3PJWA 3PZOA 2FZ8A 2PTXA 3SRHA 3P80A 1C9DA 3DFSA 1SVDA 2FFCA 4EXAA 6CGTA 2FYMA 2Z00A 3LMYA 1H61A 3GC2A 1NFBA 1EFZA 5IRPA 3WBYA 1XFCA 5FIPA 3G77A 3WLNA 2R9RA 2I1OA 2PS2A 3PSWA 1TX2A 4I5RA 4GFSA 3BJFA 3AIEA 4EACA 2D3LA 2J6VA 1JFXA 4CQ9A 1F05A 5CLWA 3K4WA 1Q63A 3M46A 3EGJA 4S3AA 4PMYA 2G41A 3RCYA 1HKIA 4PFMA 2D0FA 2QUNA 1OCJA 4V15A 1HL9A 4JCMA 1OX4A 2V67A 1W32A 3ITOA 1KM4A 1BF2A 2ZBTA 2PODA 2GWGA 4DIAA 3B0PA 3TUUA 1I9CB 5IBXA 2BXVA 4EVZA 4LS0A 1JXJA 2ZUSA 5CSUA 4WSHA 2CIPA 2W62A 2WM1A 2QCFA 4L6HA 1R85A 4IF2A 1P0DA 3CWNA 4QFUA 3I6EA 4I90A 4C6LA 5EY5A 4MKNA 3REQA 2WJFA 1W9XA 2YL8A 3AO0A 2QULA 4TX6A 3U2ZA 1CENA 1JR1A 5HR7A 2CFFA 2VX5A 1NVMA 4GIRA 2YW4A 4C6JA 3VC5A 2VWTA 4OV9A 2WSQA 1ECQA 3LHUA 2F2HA 3MUZ1 4C7GA 1D2KA 4MYXA 4QE4A 3ABSA 1L6GA 4GUFA 4MB3A 5K9DA 1E6NA 3T08A 3NQ7A 1B30A 3MSGA 2WZHA 4EPEC 3CV2A 4MOZA 4Y96A 4GI8A 4JEQA 5FD0A 2DW7A 4FLQA 4HJWA 3WDQA 4G1NA 2PTDA 2OG9A 4PUMA 2QIWA 1WDRA 1XYMA 1O68A 3EMQA 1A53A 2PDGA 5H8UA 1PX8A 4IGNA 2CNCA 2WWCA 3TTEA 1CZ1A 1SZRA 1JNDA 3QPEA 3DN5A 3NR0A 4M3PA 4B9ZA 6TAAA 4UTLA 1GVSA 2TYSA 3WLRA 1XCWA 3N3MA 4IPIA 3FKRA 4GMEA 1JL8A 3ITCA 4C65A 4JEJA 2WJDA 2Y8KA 3B97A 2VRQA 1FBAA 3VOFA 1SMAA 1E9ZB 2CKSA 4QSHA 3EDDA 3VDCA 1G4TA 4LRSA 1GVEA 4ZOCA 4I8YA 2WZTA 4U3AA 4M0XA 3DGBA 3GFZA 1W3LA 5CZSA 4PSPA 3ANVA 4LRTA 2R91A 1X1NA 3S6DA 1ZB5A 2VC7A 3BAIA 3M0VA 1HTIA 1RJQA 3CK5A 3W81A 5IM51 1ZNNA 2NWSA 3MI3A 1XRSA 3WFAA 1J0KA 4QG6A 1SFJA 3AMKA 4DY1A 3KBMA 3B8IA 3CAVA 2CW6A 5M3WA 4ZXOA 4S3DA 2ANUA 4DNMA 1N82A 4MPKA 4LCQA 5IFTA 5TF0A 4G56A 1RD6A 1XS2A 4M6VA 5FF0A 1K7EA 3AYVA 3JS3A 3KBJA 1V77A 4JTTA 4CD8A 4J2PA 2E1DA 3PTQA 4GO9A 2W6RA 1M04A 1IQ8A 4NAEB 1XM3A 1L6WA 3WH9A 1IWAA 1VFSA 2A79A 3R12A 3K8MA 1C90A 1XRVA 1O1ZA 3H7RA 2E4TA 3KRBA 3MCNA 4GJIA 4RDZA 3TA6A 4E4UA 2DVXA 1DWIM 4D6IA 4KIEA 1RA5A 2POTA 7PTDA 1UZ4A 1JVNA 4FNRA 2X0SA 3MPGA 1LOSA 3CZGA 2C1HA 3PWGA 3OOQA 3GC5A 3DFQA 4GE8A 1J2WA 1P6BA 4PBFA 1ALDA 3E96A 4CGTA 4GBUA 5L6UA 3W22A 2GDUA 2AOSA 9XIAA 1S1RA 1UIPA 3P0WA 4XBJA 3SUTA 4XAYA 3V0UA 2C16A 1TQXA 4QAIA 3IIPA 3RAOA 1V08A 4LX4A 3IK4A 4Z2HA 3B0YA 2HWGA 3ITGA 1K9DA 4IP7A 3GR7A 3UXIA 2SFPA 3VNJA 4L64A 3FYPA 2EKCA 3B8VA 2FIQA 3CTTA 3PTDA 5JQ9A 1XH0A 1V7AA 1Y65A 3L66A 1EO5A 4A29A 1Q6DA 4WDUA 4WEVX 4C6OA 1LROA 4UB9A 2D23A 4N9DA 4DJDC 3DGRA 3O3RA 4WOQA 3W76A 1XL9A 4YHEA 5I3GA 4JKLA 4HVXA 3IS4A 1RK5A 1E55A 5FF7A 3W1XA 1F3XA 3F2CA 1IR1A 2ZX9A 4H9YA 2X40A 2O9PA 2QPUA 4G5DA 2QCHA 1FH7A 5ECUA 2X1IA 2ACUA 1P0BA 3FSUA 4Z2GA 3VPLA 2ZX8A 4HA4A 4AY7A 4LAOA 1K8YA 1E6QM 1F2JA 3VDAA 5MHBA 1WA3A 4CQ8A 2YL6A 3FW6A 3NM1A 2Z28A 2YX0A 3WLPA 1WXZA 4QP0A 4UXDA 4FOKA 3NURA 4MB1A 3AOFA 3ATZA 5E0CA 1KXTA 3CZEA 4KEUA 2PLKA 5I3HA 4JX6A 2DT1A 1NARA 4LAZA 3KBSA 2X16A 3TW9A 1NFGA 1EA9C 3CQ0A 2O9OA 4W9TA 3V35A 4C6CA 3PN8A 4NAEA 2OB3A 3M64A 2Y8UA 1JDFA 3BSGA 4S3CA 4QHRA 5A6AA 3WMBA 6PTDA 4TVDA 1B3WA 1EGMA 3FAXA 1QPKA 3KS6A 4J35A 1ISYA 1CLVA 4ZE5A 3SCPA 2FPYA 3K8LA 4H3DA 3EYPA 4IFOA 3CQIA 5HANA 1AH4A 1XDMA 5BCAA 3BMWA 4Q32A 2D20A 3CPGA 3V16A 5LA2A 2EJ1A 4JQ3A 3QH2A 2HE8A 1QWKA 2ZRZA 4QNEA 3GFXA 3WF4A 2DPEA 3U0HA 1W1VA 2JQXA 5CC6A 2VJXA 3HIJA 4CCDA 3ZJ7A 3LXBA 3WMLA 4H8NA 3CIVA 3PPFA 3ZIZA 1B2YA 2VQTA 4ZB0A 3SO7A 3TYUA 1VJSA 4O13A 3OB8A 2D0HA 3WK2A 3IARA 2FFIA 3M0KA 2OZ3A 3C5QA 4HSOA 1PKMA 4AX6A 1GOMA 3V1PA 2P3ZA 4UTHA 1DOSA 2PWHA 4PUKA 2V38A 2OPJA 4XKMA 2E68A 3S8HA 1RLCL 4O1DA 3L5LA 1M1BA 1TE1A 2V3EA 1U22A 1PDYA 4OT7A 1TTJA 4MUPA 4XIAA 4KFOA 2VMFA 3KCOA 4XSLA 2PDQA 1X7FA 3TN4A 4NX5A 3D47A 1GQJA 2WYSA 2GUBA 1S3TC 3TTYA 1HN1A 1S3HA 1S39A 1A0DA 1R2TA 4CD4A 3EDKA 1VEPA 1A0EA 2H8XA 3CGTA 1BWLA 2CLIA 4HHHA 3CJPA 3RIKA 2OZTA 4GIEA 1QMLA 4ZQOA 3U8GA 2PRHA 1Q4WA 3RJXA 1GKQA 7XIMA 1RCOB 5H8MA 2J7GA 1OK6A 3W1UA 4AQLA 1QXLA 3NUKA 5GJPA 3NL5A 2W5FA 3VAVA 2V30A 4P7RA 4OZOA 1E15A 4F0MA 1KA9F 1K8ZA 2NV9A 1PS9A 1TZZA 2VFIA 3LXCA 4QROA 2JK2A 1TO3A 4DZIA 4FF7A 3QYQA 3KTCA 5A6TC 3WJSA 1DXEA 1GJWA 3SFWA 1V51A 5E9XA 1XIGA 4KKXA 4R7WA 4PMZA 4B3KA 3RM4A 4MDOA 4LYPA 4M7TA 4O28A 3GXFA 3T0TA 2VGBA 2RAGA 3L4VA 1WZAA 2NX3A 3H54A 2ODOA 4DF0A 1XIFA 4DBSA 1US2A 3IJ7A 1ODZA 1N55A 2CKRA 1W1ZA 3OG2A 1YNPA 3NZ1A 1PIFA 3WD1A 4AMAA 4PULA 3W00A 1O5XA 4NUWA 2VOMA 3BJTA 2Y5JA 3IJLA 2VEMA 3APYA 4PTWA 4WKHA 1O4UA 3E0IA 4GC4A 1W54A 3H2FA 4QAWA 4JTAA 2ZUTA 4ZTXA 1XRFA 2W61A 4W7WA 4NQ1A 1QHPA 3QFWA 3CWHA 3IIZA 2BY3A 3W2MA 4TTUA 3WDHA 2HROA 5G1YA 3HA1A 3EB2A 3ZXWA 1ZP3A 4IQEA 1SO3A 4WZHA 3RRXA 3WK3A 2V2CA 3LX9A 5CPSA 4O50A 3A12A 3NYDA 4W7UA 3DHUA 4KERA 3AHZA 3PUOA 5M1TA 2GVYA 3T1GA 4JFWA 2FVKA 1I2QA 3NZQA 1EXBA 2PC4A 4Y6GA 3ITVA 1QK0A 3B03A 1FWWA 4WDTA 1MW1A 4W87A 4C6FA 3TW7A 5C9RA 2EPNA 3LV5A 1LTDA 3TC3A 2CHOA 3GSMA 1AQFA 1MQRA 1C91A 3QRHA 1BVNP 3V5OA 1JCTA 3B4YA 1PPIA 4JBRA 2E9MA 3OYXA 3SRKA 2V3DA 3E6EA 5CPMA 3SIMA 3UEQA 1H2JA 2YCIX 3RO8A 3VIIA 4IM4A 1ZTVA 1E6RA 2P5NA 1C9WA 3GFYA 3NM3A 1ZBCA 2JKPA 4C6PA 3LPFA 1T8QA 3F4VA 2J74A 1JF6A 1KW1A 4YNGA 3VMPA 3QFEA 1TTIA 1SYTA 3MDWA 4MLJA 4NG3A 4DJDD 4YTQA 1R47A 2OSXA 1SSDA 2UZ9A 4H9VA 4XO7A 3WSUA 5HJYA 1C92A 2PWVA 1TPVA 4PTVA 1Q6CA 3KRUA 4JICA 4WJXA 1J10A 1ZAIA 3ARUA 4UNLA 3WQDA 3ARPA 4TX9A 1EXPA 2DJLA 3W7JA 4LANA 5AKQA 2XN0A 4JTUA 1XYZA 1XH2A 3EXTA 2WMIB 4ENLA 1VS1A 2PP3A 4AZHA 1KCZA 2BTMA 4ZQMA 3N04A 1R9XA 1LBFA 4M1RA 3TLLA 1KM3A 1AFSA 5EMYA 1ISXA 1CXLA 1EL3A 4NJGA 4ZBCA 4PMNA 1UMLA 1OFDA 3SCRA 2HDJA 3NQDA 1LRQA 2HEJA 4NRSA 5EMUA 5CZKA 4HZ8A 5A2AA 3OZOA 1H11A 3MVTA 2A3AA 4BFAA 2EQDA 1FH9A 4O8AA 4ZGYA 1QUMA 3N29A 3URNA 1YYAA 4CN4A 1EJSC 3O7UA 3DYMA 3TN3A 4R7OA 2OT0A 3LNMA 3GW0A 3ZT7A 3UFYA 1B4KA 1EJVC 4K6AA 1H41A 3TCSA 4BF5A 3CZKA 3NXFA 1KRMA 5A6BA 1H7WA 4KWUA 2J9XA 1EC7A 2A4AA 3GY1A 3KFTA 1WO2A 1PBGA 4WKAA 4JTLA 1OVDA 4AX7A 3HG4A 4DXVA 3WENA 3VNZA 2FHFA 3NCOA 2E8ZA 4KGJA 1XYAA 1A5KC 2FB3A 4LV9A 4QBXA 4RCXA 2PLMA 3WNNA 1X8CA 2MUCA 5M17A 3IGHX 2OEMA 3MP4A 4C5YA 3LTPA 4WRHA 3U3HA 4AB4A 1N7KA 5K4XA 1RLDA 4AEEA 1CXIA 4DLMA 4UNKA 2HV5A 1E72M 4A3YA 1V4YA 3URQA 3V7PA 5DBUA 1PWLA 2A85A 1OIFA 4QXIA 1L6YA 3BW4A 3KRSA 2Z27A 4FXSA 1YRRA 3P7YA 4ZODA 5HR6A 3HBLA 2ZDSA 3P74A 3AROA 3BC9A 1AQHA 3LS9A 4NZ5A 3LHYA 2VWSA 1FUYA 4S38A 3VU2A 2DZTA 3UPWA 4DEFA 1EJXC 2EBNA 1HVXA 3BAJA 2GGGA 2A2IA 2G96A 2WMIA 1W5NA 5SWUA 2VCCA 4O53A 3Q58A 3NXLA 1JRCA 1QI5A 1W9PA 3VDHA 3LGGA 3KWSA 2B4GA 5A2CA 5DBTA 3W26A 2PAJA 1NAL1 1QU4A 1ZHAA 3PTKA 4FNQA 3UZJA 5LNSA 3RYSA 1BRLB 4GWEA 1XXXA 2QCCA 1O5QA 2Z4GA 5DCBA 4IOTA 3T4CA 3APTA 2ZQ0A 4LCRA 4WDXA 4JIQA 2VEIA 4ZMGA 3BE7A 4GGHA 2ZC8A 1JAKA 5ABTA 1NF0A 2WKJA 1V6VA 1OD8A 4WJ8A 4H7ZA 4OQVA 3B3DA 1EHNA 1SZNA 2BHUA 4DO7A 3NIYA 4N42A 3THCA 3VOHA 2E7FA 4O1AA 4Z17A 4N6FA 2IKGA 5JIWA 3W7OA 5I09A 4R85A 4A3UA 4DZAA 4Q8MA 1NELA 4BS0A 2O0TA 1P5BA 2YJQA 3B8WA 3H26A 6A3HA 1KGXA 4C6EA 1QVBA 3H7UA 4LFYA 1DVJA 1W3IA 1DWAM 1CXKA 3MCMA 4G9PA 3LHZA 1TUXA 4DWSC 2Z2BA 4YN5A 4OBTA 3W1QA 1QI2A 2YCLB 1XX1A 4GUIA 4QCFA 1UR3M 3OJGA 2FZNA 1D3GA 1JUEA 2QCGA 2I16A 3POCA 4XSMA 3ICJA 4DI9A 4HK5A 5CSSA 1IWBA 1GVOA 1WKDA 4ZOEA 2NSXA 2POZA 3HJEA 2HXTA 2V82A 1F61A 1C29A 5H2ZA 2ONEA 3UZWA 4IIDA 3FA5A 3O0FA 2F9RA 1R5YA 4F2TA 3Q37A 5I79A 5B80A 2WMGA 1T0OA 4A21A 3TFCA 3QGKC 2PU1A 2CXEA 4HNVA 1PKYA 4I3GA 1PZ1A 1AQMA 1QPQA 4YXGA 3GHSA 1W1PA 3WQGA 5LNWA 2WSYA 3GS6A 3N4AA 1ML1A 5LIKX 3BWWA 1BRLA 1NOUA 1Z44A 3QZ6A 2INFA 1SJDA 3KLKA 4DBWA 1VYRA 3QR0A 2ZWYA 3BGGA 3GYCA 2J78A 3UGVA 3S2NA 3DOPA 3A24A 4LVFA 4INFA 1XJBA 4RZ5A 1KXQA 4MG4A 1N2VA 1FVPA 1W0MA 1LUCB 2HBXA 5LHEA 3W1NA 2ZRUA 1EWEA 1Q65A 3QMRA 2WC7A 1YTKA 4YWIA 4DJFA 1W3HA 2H6RA 2OQYA 3ABXA 4GFIA 2BS9A 4XVDA 4QDMA 1IV8A 2C1IA 1JDEA 5CEWA 1E3ZA 2J9ZA 4IXXA 3SY1A 3LCWA 3VNYA 1E0VA 2UBPC 3C3NA 1DQUA 1OHLA 4GYPC 2AL2B 2C3ZA 5HATA 3ZR5A 4H8UA 2KAUC 3IJ8A 2BWGA 2DQXA 2IQ0A 4E4FA 4FPSA 4MJMA 3WUGA 3DBNA 4UOZA 4AZ7A 1XIEA 3A21A 4G7FA 3TSBA 1IT7A 5FF2A 1BG9A 4GXWA 5AHIA 4B90A 3UBPC 3WLHA 4NT0A 2BY2A 3GNDA 4HIBA 2GVLA 4LBRA 1XWYA 4BY3A 1XI3A 3AIRA 1W9DM 3AYRA 3QPZA 3W25A 3EEZA 2ZADA 1PEZA 4K37A 3LERA 1EJWC 3QV6A 4QCEA 5EA9A 4JIEA 5I24A 4ES4A 2VT0A 4R34A 3I6RA 4DI8A 2VYOA 4J28A 1KTNA 2WNWA 4B4FA 3FX4A 3TYDA 5TAOA 3QSRA 3ZLGA 3LQLA 3QC0A 2GUUA 3RR1A 3GXTA 3QLLA 3E74A 1XYBA 4C6IA 3HZ3A 3USZA 3KCJA 2OYMA 1XIDA 1S2UA 1KR0A 4ATDA 1E40A 5FESA 3TJ4A 1BYCA 3GHTA 2DZVA 1XG4A 2X8RA 3VGEA 3EMCA 1K8XA 2YR1A 4M8UA 4ZO9A 3HPXA 5KITA 3PZTA 2XSBA 1UH3A 5AYXA 4P7QA 3WMSA 3IGSA 4M29A 4ACZA 1HKWA 2YW3A 3T6CA 3EOLA 1T41A 1ZENA 3QR1A 1XG3A 1OFOA 3H8AA 3TSMA 5CBBA 3WIJA 5I23A 4O57A 3AI0A 1S5VA 4AUBA 1D9EA 5LNRA 3BJSA 1BVZA 3HB9A 5AHMA 3VCCA 3CTLA 4LF1A 1U83A 1UP3A 1UOZA 5I07A 2CWXA 2WLYA 2W27A 1TV4A 1U33A 1JZ2A 1LUCA 2RJHA 4DO4A 4MF4A 2R14A 1TYGA 5HUPA 4DN1A 3FJNA 2WCAA 4LBSA 1QPRA 1ZQ5A 3RITA 4C91A 5C0QA 2DZSA 3WDRA 1KFBA 3EWDA 3SCUA 2D69A 3AYTA 3N6QA 4YPJA 2ZUMA 2ZZ2A 3FXYA 3FK4A 2Q71A 1TR1A 1EPVA 3P3BA 2XVNA 2VZTA 1EA0A 3VDGA 3GNOA 1OX5A 2Y7EA 4Q3MA 3AQUA 1K8CA 2PDYA 1MNZA 2QJMA 3A13A 4LQ1A 1XCFA 4JTQA 4MB4A 3VIKA 1E1CB 1KV8A 4PRWA 1W9VA 2H3DA 3O0KA 1GTEA 4IH3A 1VFMA 4ZOAA 2V6AA 5IHRA 5CCZA 4ZB2A 4D6GA 1QFEA 1X1ZA 2JEPA 5I77A 3QLDA 5I03A 1RQBA 3M47A 5GQBA 4C1KA 3KOWA 1RY0A 1VYPX 1YPFA 3ZVHB 3DYOA 4XKYB 1CECA 3SJ3A 3ZMRA 5D2WA 2C8NA 3KOZA 3L7RA 1F4AA 1RBLA 4B16A 1OM0A 2ZA1A 4DWSD 5LA0A 1A47A 1ITQA 3B8DA 4MIMA 1ISVA 4IPJA 3V5FA 1VLIA 1P1XA 3NEHA 2FDMA 4R5EA 4BEQA 2QLYA 2XIMA 4IJRA 5RUBA 1BSIA 3NG3A 1KBLA 4HCHA 4B5UA 4WUIA 5AB3A 3WELA 5HWMA 4IT1A 4HA0A 1QI3A 1F9CA 3C0LA 1K9TA 5K9XA 3A3WA 4TVCA 1B31A 1AVAA 4LUIA 1TJ1A 4JD4A 3S9IA 3G1FA 1XHGA 5JIPA 1UQYA 3IJ6A 4K8GA 1DHKA 1MW0A 1VENA 7TIMA 1XV8A 1PHQA 1Q6GA 2FQIA 5DCEA 3MA8A 4HPXA 3NO5A 1VPXA 4NI8A 3W84A 4H2HA 1YHTA 2WMKA 4ONVA 3OLIA 3OVGA 3W83A 1FHLA 4ICNA 3MMTA 3BSMA 3WF1A 7ENLA 2ESCA 3BLFA 3NQ6A 1B3OA 3V5CA 4TV5A 4WJEA 2I56A 3T8QA 1KFJA 3F5KA 4DBDA 5DFAA 4KFPA 8TIMA 4IZGA 4LAKA 1XUUA 1BWKA 1LBLA 3NSMA 5I02A 2NQ9A 3N9SA 1LZOA 1VKFA 4J40A 5G2IA 4L4LA 2ZOXA 1I2NA 3VNKA 1QOXA 2XJ7A 4H8HA 4PMOA 2V3GA 1YIXA 4XB3A 3GRIA 3H12A 3CAWA 1E1CA 1WOAA 3PHAA 4AXKA 2EJAA 4KT2A 3M16A 3PZIA 3OG3A 3WFZA 3SQMA 5GNXA 1XLLA 1MFVA 1ELSA 4M1BA 4I6KA 3DXIA 1EJUC 1VYSX 3WQOA 1NWTA 2IPGA 2E5CA 3I3EA 3T42A 1MW2A 3C86A 1RK6A 4JIPA 4BQ5A 9RUBA 3GBEA 3OQ8A 4K7VA 3WQVA 3RF9A 2BMBA 2ZTJA 2ZZ4A 2NQZA 3BXWA 3FS2A 3WL1A 2DSUA 3U48A 1JZ5A 4R88A 1W5MA 3LY0A 5I00A 4HKPA 1KBBA 4S3BA 1EUAA 1WB0A 3G3MA 4AZ5A 4UQ9A 4JTEA 1GVFA 1F7BA 3TMLA 4H19A 4JX5A 4IL0A 3GXNA 1F6PA 1SW7A 4IFKB 3N15A 1JPIA 4WLCA 3GUWA 3IRSA 2PWFA 5CAHA 1VR6A 3UR7A 1CX9A 2RDWA 3MKVA 2VFFA 4UR8A 4NI3A 4ZO8A 5AC7A 3WD0A 3ZSTA 4O0QA 3OIHA 3FIGA 2GSEA 3U2CA 1GVQA 3RJYA 3DAQA 1EJRC 3AHXA 3B9NA 2BVWA 4UQBA 5CBIA 3ZYZA 2PDWA 3T2PA 5LIYX 3R0KA 4NHVA 4L4PA 4RKAA 3KZPA 2C7FA 3VGFA 4B2DD 2RDXA 1XRTA 1LDCA 3EZ4A 3H6OA 3RXZA 1EWDA 2GUYA 1SUXA 1C8YA 2E9BA 2TRSA 2DZUA 3EAUA 2Z29A 4W8LA 5D03A 1IZCA 2E5BA 3NQFA 4PCPA 2I5QA 1DP0A 3MUXA 1HKKA 4HA1A 2ISSA 5IDZA 4UTWC 1JD7A 2A7NA 2YCJA 2A3CA 3I4KA 1Z9AA 1Q4NX 1HJXA 3VGDA 1R3WA 1UHVA 2BODX 3W1RA 3BVJA 5JBFA 4Q6JA 3KL3A 1P0EA 2TODA 5LIWX 3UERA 3AIBA 2OO6A 1YTDA 1FA2A 1G4EA 2OKTA 4HOWA 3I68A 2QR6A 2J24A 3SB0A 1YPIA 4AXNA 4KEMA 4KCWA 4ZQRA 4C6MA 2GYIA 2G3FA 3M44A 4MLRA 5F2IA 1POJA 2NXGA 2P10A 3TYBA 3EKGA 2GWNA 2CWNA 1I0DA 3RGTA 3KL5A 3FA3A 3R58A 1JYXA 1NM9A 1OD0A 4NL1A 4IXHA 3LDVA 3W9ZA 3ARVA 4Y9NA 4DPPA 1J4EA 5GNZA 2DDXA 1I8JA 3DZ1A 2O55A 1VIZA 3K1DA 4X9YA 3HGJA 2XZ7A 2ZVRA 3L2IA 4AZGA 1RCXB 1ODUA 4M51A 3KOFA 3W70A 3QV7A 1BD0A 3DI1A 2JBMA 2PTZA 4IFKA 2PDCA 2YGYA 2AL1A 1O60A 1J0YA 3IAPA 3W1TA 2WCGA 3UZ5A 4D6JA 3RFAA 1BWVA 5A6JA 2AMXA 1CB7B 4J3XA 4XX6A 3RCMA 4CQBA 4QJ4B 2RFGA 3CUZA 1GOOA 1WZMA 3MCOA 1E56A 3QQ1A 4JOMA 2QJNA 2DIJA 3B8SA 2WZIA 1M7JA 3C61A 2ALRA 4IPNB 4UCFA 4A35A 2A6LA 1IGWA 2P88A 4EPBC 4XTIA 2IW0A 3NJ3A 4IP5A 3BLDA 3L68A 1JUKA 4PEKA 2WNNA 1POKA 4S23A 4FZIA 1RPKA 2QPXA 5F2GA 3UWVA 1K7FA 3RLUA 3AICA 3ARRA 4KGLA 1H7PA 1GUVA 3NPXA 2OCZA 4X3ZA 1HIZA 2CBIA 1ZS2A 2G8ZA 3CU2A 3LQGA 4IISA 3VGBA 1PAMA 1MNSA 3PR2A 5CG7A 3T78A 1Z7AA 2GDQA 4JYEA 3NQVA 3R8HA 1UWSA 1XLBA 4K68A 2YZRA 3TE9A 2G3IA 3L23A 2B0MA 4FXFA 5CJ5A 4JTGA 1B9ZA 1JI2A 3GH7A 3LYEA 3VVGA 1IXQA 1XIIA 3AHYA 4RNHA 1CB2A 1J93A 1V02E 2VQUA 3DC8A 3PM6A 3S1GA 5HXMA 4EXQA 4B5WA 1BG4A 1H7NA 1ONXA 4XZLX 1H1ZA 4GH1A 5D33A 5DXXA 4H9TA 1C8QA 1VBUA 3C56A 1S2TA 4AISA 1V93A 2KX9A 1UROA 3B8TA 4Q7BA 2QS8A 5M5DA 3T4WA 3CV7A 1RVGA 1QPOA 2C14A 3TQKA 5A2BA 2PA6A 4IJBA 3CZ8A 3MP5A 1XINA 3GVWA 4RV8A 3EWZA 4OVXA 1EDQA 3S2MA 4U5IA 1R6WA 5B7YA 3URBA 4YTSA 2TPSA 1OT1A 1GPFA 4ORMA 3WX7A 3ARQA 2PDJA 4F0LA 1TV2A 3MBDA 2Y7GA 1E0TA 3PBMA 2Y88A 7TAAA 1F3EA 3EPOA 3VCRA 3WD3A 4C90A 1LL7A 1FCBA 4JAWA 1PZ2A 3HGSA 3WJWA 5E09A 4NNCA 1OB0A 2W79A 4LVBA 2OWWA 1FDYA 1ICQA 4S2CA 2R1LA 4JQ4A 2CZEA 3EWYA 2ZDRA 2RGLA 1OZQA 3MV01 4RK8A 4GA8A 4FP1A 4XUGA 4V28A 4V2XA 3FYOA 1OJXA 2CESA 4IHCA 1FHUA 3TN5A 3C2OA 4KCTA 4DZHA 3GIQA 5MF5A 3PJXA 3H4WA 3PUEA 4M82A 1SR0A 3VOIA 1SZEA 1VEOA 2OEJA 2OR2A 4MAZA 4O52A 4Z42C 1Z41A 1J9YA 4HT3A 1JDAA 4H04A 1KBJA 4LBUA 5J5DA 1R0MA 1C7SA 3I6TA 2WW5A 1E6PA 3LBMA 3BV7A 5HA7A 4KF1A 3UT0A 3W7EA 4W93A 1K9EA 4DJED 2DGAA 4RUBA 3YPIA 2YDAA 5KZDA 4KWSA 1KTCA 4K7YA 1YPXA 3FGCB 4PCSA 1QATA 4LS1A 5I6SA 3M5ZA 3MSDA 1UYQA 2VGGA 3TOYA 3PVFA 1X1OA 5A3HA 3NQMA 4W85A 5AYBA 3MWAA 4I7WA 2OZ8A 2YA1A 1LLOA 1HGYA 1NWSA 3W01A 3N2XA 4LTSA 2ISVA 5AC4A 1PIGA 4N4PA 3OVRA 4GVFA 3T05A 1OGSA 4UTJA 4GCXA 2YBTA 2HTMA 2BXZA 4IL2A 3PBVA 3BOLA 1DYSA 2A3HA 3U2EA 3MMDA 3EWUA 4G7EA 1KM5A 3BG5A 4ADUA 1K9FA 2DSWA 4GUGA 4M56A 4H7CA 4HU8A 3MMWA 3WQCA 3K2GA 2VZOA 3KVKA 3W7HA 1M01A 3A3HA 2AGTA 3DH7A 5BWFA 1DWFM 1TRIA 2J47A 1VFHA 3S5OA 2OSYA 3R13A 3MHFA 5I0DA 1V79A 4JIIX 5ENLA 4O16A 4LEFA 3VMOA 3CXOA 3LNPA 5EMJA 3FCPA 3W1MA 3W75A 3GTIA 5BXSA 4FHAA 1HUVA 4UQEA 3M07A 4QX4A 5J5RA 1NWUA 1IT0A 2GQ8A 3OBKA 5AHLA 2F61A 3W7RA 1B5TA 4YTRA 2E5DA 3KCLA 3TV8A 3GG0A 4IUGA 5HNNA 2VEKA 3BCJA 4Q4KA 3NQ2A 1UKTA 2VDGA 3RX3A 4Z1YA 1NFPA 3OBEA 4HU3A 3F5LA 3FEQA 4AY1A 1RP9A 5JVLA 2PDKA 3C4UA 3USBA 2VC5A 1PVNA 4U3CA 2WC4A 1TA3B 1A4MA 1ZY9A 3P60A 3AMDA 5TQLA 2DW6A 1W1IE 2E6YA 5BYWA 5H91A 3KOXA 5M03A 2YCEA 3CQJA 1R9ZA 2B7PA 2X7VA 4W84A 4NZFA 3FGCA 2EHHA 2CLOA 1UA7A 5EKYA 1UCWA 4DWSB 1YE4A 1OGGA 2H9AB 1E5NA 4AD1A 4GXMA 5BROA 2I9UA 1RALA 2WMJA 1MSSA 4OIFA 1H49A 2XH0A 1R7OA 4Y90A 1XCXA 5BRBA 1XSIA 1QI4A 4B92A 5DY2A 3L4ZA 3FSTA 3LU2A 1Q8AA 4LXFA 4HU0A 2HVMA 1MEHA 1G4PA 4EAMA 1LQ2A 4PMXA 1W6TA 1Z42A 1V7YA 3EPMA 2XFFA 3G1VA 4MZ8A 2PPGA 4AAJA 2CPUA 4O12A 2HCVA 1M03A 3CLWA 3IJ9A 1CEOA 1XSJA 4KETA 1D8CA 2YB1A 3RLGA 3M0MA 2WBKA 3VA8A 3F4NA 4TIMA 5D4YA 2ATSA 1TIMA 3CHVA 3NPVA 3GG7A 4R27A 3N2OA 3BLPX 4TMBA 2NW0A 1KLYA 3MUCA 4PRRA 2P0OA 1K4GA 1VH7A 3U9IA 1XD0A 1NH6A 4RE0A 4PUJA 1FTXA 2PTYA 3QZAA 4NJKA 4KRZA 5C8BB 1AA1B 4MMWA 4IWWA 5BMXA 3OA3A 3DG7A 2CC0A 3RNDA 2YSWA 4YVPA 4A2RA 3TYCA 1ZFJA 3GK0A 1JCNA 4DBUA 1SR9A 3VNMA 2E9LA 3KP1A 3S6OA 4E8DA 3H24A 1DJQA 3KHJA 3NL3A 3ES7A 4L5ZA 4PR4A 4KFNA 2WC3A 3FVMA 3SJNA 1ZBWA 2NV1A 2NQLA 2FTWA 4NF7A 2XM1A 3UJFA 2P50A 1O1HA 2W4XA 3WY1A 5F7UA 1YDNA 4H6KA 3WUFA 2C0AA 4J4KA 1WUFA 4IMGA 4WHBA 3LSCA 1EKOA 5CC7A 1TA3A 4XD4A 1R87A 1ZPTA 2DV0A 4EANA 3AZTA 3G1YA 4EK7A 4MWAD 3S2CA 1GYMA 4OGZA 3HPFA 3M6DA 3NWRA 5DXYA 1R3VA 3CAKA 1R3YA 2CETA 1YKWA 1VIWA 3XINA 4FMVA 4DF1A 1EOKA 3N1AA 3TNOA 5TD4A 1Y5VA 2PDLA 3UJRA 3UWUA 3R11A 4TQTA 5C7VA 1JQVA 4RE3A 3NSNA 1UPMB 3ZLHA 1P6WA 4WF7A 4RJEA 2DY3A 3FJLA 5CZ0A 2GGHA 5EMLA 1E9LA 4UTMA 3JRKA 3LI1A 1UZHA 4FIQA 1A5LC 2DIEA 3F4WA 3WBAA 3VINA 5G5IA 1GOIA 3NQCA 1GQIA 2IS7A 1WAUA 1GW9A 3UZXA 5LSMA 4B3ZA 5CGTA 3EXRA 1IIGA 1XLKA 4ZB5A 2INEA 2DZPA 4D1JA 5CBJA 4LUJA 1WKEA 4S3GA 4PCTA 2CLLA 2C0HA 3VIMA 4CVWA 2FJUB 1BHGA 2VKZG 2CLFA 4BWLC 3W2UA 1OQFA 3EMZA 4WSJA 4ERGA 4GNKB 4KWVA 4B3LA 5CJMA 3CS2A 4NNBA 5IOBA 3LCHA 4EF8A 4ROPA 4W86A 3NA8A 2IXVA 2WBGA 1IEXA 5EYWA 1MXSA 3EKLA 4O0ZA 2G4FA 3VUPA 1GVRA 2VENA 3W7IA 3CMJA 4MUZA 3COTA 4DUVA 2WKGA 1I0BA 1E71M 1XBYA 1XYLA 2GVJA 4WCJA 2DU2A 1A5SA 1FRBA 1I75A 5AZ0A 2CLKA 4QJ5B 3V1HA 1WAWA 1PCKA 5G1MA 4NZ3A 4L7ZA 1LP6A 4IIBA 4RXFA 3P8IA 5FSEC 1MYRA 4F48A 2FZBA 2GSJA 1QCWA 5LGXA 4BHYA 1TV7A 1X39A 2P8BA 4N2YA 1ZSXA 5EB8A 3W37A 3QKEA 1ITXA 1A5OC 2XYLA 3A3XA 4BEUA 4GUHA 3UCDA 4O18A 5AYZA 3AS3A 3LBCA 2FZMA 4O14A 1GORA 3HG3A 2ZFAA 3BZJA 3B06A 2GJPA 3UXAA 4MY9A 4DUWA 4CU8A 3H2OA 5IHSA 4JIRA 1MRQA 2FLIA 1MQPA 2YXGA 4A3QA 2YLLA 4DYKA 1RA0A 2A5HA 3SURA 4AF0B 5C7HA 1EP2A 1WDSA 1WP6A 4OTKA 1GHRA 1WNOA 2C18A 1HO1A 3M7WA 2BHYA 4WOZA 1UWUA 1J6PA 1WUEA 3OZMA 4ZR8A 1U30A 4MJZA 2OODA 2GDVA 5HQEA 1L9WA 2EPKX 2WQPA 3I3BA 3A47A 3U57A 1M7PA 4KH2A 3OP2A 4ZQPA 1IEQA 4MDPA 1BF6A 3PSVA 1H0GA 3N25A 2CBJA 1HP5A 4JTJA 4WGXA 3LHVA 1QASA 5D02A 3UY7A 3BOXA 3O05A 1FH8A 2ISDA 4L6DA 3HG5A 3TXVA 3CL8A 3L0KA 3BLIA 3UZYA 2GGEA 4UNIA 1MXGA 3PUDA 2X05A 3W73A 3PC0A 3T55A 1GKPA 3Q67A 5D37A 3MUIA 2B81A 1F74A 5E6ZA 1RPXA 2F8QA 3SCVA 4DHGA 1AZ2A 4NVTA 3CL6A 4F9DA 1FDZA 5HNTA 3UG8A 1IF2A 5LYRA 2RJGA 3WLQA 4CD6A 4Q8WA 1TG7A 2V81A 2QIIA 2OKOA 2DZAA 1W37A 3GU2A 3PK7A 4XZBA 5DCDA 1H7XA 1AQ0A 3ZT5A 1JYWA 2BLEA 4AEFA 2D2GA 3T7VA 3P0XA 1K3UA 1PB0A 4AVFA 5H6HA 3DC0A 2PRMA 1W5OA 2QT3A 1UMYA 3EKZA 4N9BA 5LHFA 1G01A 1VHNA 5A69A 5KZMA 3VD9A 3V3WA 3LI0A 3C2EA 3WQ4A 3W86A 1QRQA 2ZA2A 4B5SA 1R30A 4GQQA 1F8IA 1TVPA 4YTTA 5AOUA 1AODA 5BRPA 5K9CA 4HPHA 1IEVA 3VDBA 1I2PA 5E5CA 2VZUA 2WOQA 1WDPA 1NDYA 3CMGA 3L2LA 1T5AA 3ME3A 1KLZA 1LL6A 4CQAA 1OABA 1F5ZA 3SSJA 4AD2A 4GRSA 3TYAA 3PZUA 3UCCA 4F4RA 3W7PA 3PPGA 5C9XA 4AF0A 3VD4A 1LCOA 1K70A 1BQCA 2PCQA 4CUCA 2XFRA 3GH4A 4UFLA 3AXXA 3WBXA 3WQFA 3FYYA 1RJPA 4QDPA 1MQQA 4OECA 3TLQA 1V0NA 1AL8A 4V33A 4AMCA 3CO8A 2YB4A 4UR7A 4Q4RA 3QEZA 1LORA 1QNVA 3HMCA 3UYCA 4LNYA 3NQ8A 3GTNA 2F7FA 3UR5A 2TAAA 3L67A 3QJAA 1C8XA 3AAMA 4MKVA 1D3HA 2HRWA 4WXYA 3H70A 4JN8A 3T07A 4S2BA 1TWWA 1UQZA 1KQZA 3R8GA 4G2DA 4AIEA 1SFTA 4A8LA 3CB8A 3CUJA 3LCGA 2VP8A 2J27A 2PWGA 3M5VA 2I57A 8A3HA 3ITTA 3BOFA 1TMQA 2OOGA 5BW6A 4Y9AA 1W3KA 3LHTA 4ZFMA 4E6MA 3UWYA 5BOFA 3B05A 2DSKA 3P5ZA 4DUXA 3N13A 3B0XA 3RU6A 2DT0A 3PFMA 3OA5A 1YXDA 1AZ1A 3M6YA 5MKGA 1PIIA 3MSYA 3II1A 2VC9A 2E6FA 2JFEX 2OMAA 3NZRA 1FQ0A 3BL3A 4AVNA 1Y5WA 4IMEA 3GVRA 3G0UA 4GVHA 4O15A 3DFHA 5EFFA 1A5UA 4UIOA 3E0WA 3WQ5A 1OFRA 2WM0A 3BAWA 3NQEA 4JFVA 3AUJA 3PB0A 2E8YA 4NASA 3M43A 4RW3A 2PDBA 1QBAA 4HNTA 3EB4A 3UF9A 4JFTA 1YX1A 1F73A 1IXNA 5AVNA 1CPUA 2QXWA 2YCKX 1KBKA 4IMDA 2ISWA 3ZO9A 2V5CA 1A5AA 4FOJA 1AK5A 3SGUA 5LXEA 1DBTA 2JIEA 3L9CA 3KE0A 3RG6A 3N14A 2GFTA 3KDOA 3S0CA 2J4GA 3DCPA 4EAYA 1KM2A 5CGMA 1NIUA 4LUTB 5C6MA 3N4EA 1SJCA 3D3AA 4K3ZA 3BMXA 3TTQA 4NJJA 4NXKA 1GQNA 3BANA 4KMQA 5GJMA 4N4QA 4IMCA 3UCQA 5LIXX 3ABQA 1P48A 2CZDA 2DUAA 1YXCA 2NXIA 5T8GA 2QJHA 1YBQB 1CNVA 2Q8LA 3OYZA 3T44A 1YDVA 4JFUA 4PMJA 5D9NA 3MANA 1EC8A 2CYGA 4W88A 4HOXA 3LUTA 1LWIA 4W4QA 4I5XA 2BGSA 3GU1A 3NQAA 1LG2A 5HMFA 1LBMA 2ALDA 4NP7A 2YOCA 2PGEA 4UQDA 3RUBL 3DIPA 1PE1A 4FO4A 2VRJA 3ABRA 1EDTA 5FJJA 4WDWA 4E2BA 2IKHA 2GQ3A 2WANA 4J3WA 4BKNA 2LLEA 1JI1A 1DXFA 2ICSA 3SW6A 2FDSA 3ZR6A 3KEHA 3B4UA 3GC4A 5FEXA 1BXBA 1H5YA 5KINA 1JCXA 5BWAA 2E67A 1UR0A 2HK0A 3R8RA 7REQB 1QR7A 5BZAA 3AXMA 1UUOA 1CLKA 1EX5A 4JHOA 2ATMA 5LXXA 6XIMA 3NAVA 1RCQA 4DAFA 3DUGA 3MI2A 1QWGA 1PKNA 3TXZA 1H7RA 1HZYA 2NV2A 4C1NB 1JG9A 4MY1A 1T7LA 1B57A 1TV3A 4QLJA 1W5PA 5AVHA 3E2SA 3F7JA 2XVPA 3GKAA 4YCPA 2ZUUA 5BNKA 3C8NA 3MSRA 4YMZA 3H7VA 4LC6A 4Q8PA 3S1UA 4L9XA 2Z6JA 3MZNA 4IIHA 2NX9A 1GKRA 4HN8A 1RD5A 1RV8A 3BMVA 2W66A 5A8NA 1XQKA 1UJPA 3BPWA 3G2GA 4LUTA 4US5A 4HCDA 1U1HA 3WF2A 3KM8A 4ML9A 4LC8A 8RUCA 2QMJA 2I5IA 3DDMA 4A8IA 3PBUA 3R4IA 3TWBA 1EJTC 1QOQA 3N6JA 3QM3A 4KCVA 4ADSA 5C9ZA 5I3KA 4CQDA 1KQYA 3V4BA 4AY8A 5HBFA 3EDFA 1YBQA 1PTAA 3S1VA 4NKCA 2QJIA 3P62A 1VAHA 2VFHA 4GY7A 3WQEA 3DHFA 4JL1A 1P43A 1PSCA 4JKKA 1JCJA 1HNYA 3TIMA 2BV9A 3TYZA 2Z1BA 2DH2A 1K7XA 1B3VA 1SJAA 5DMMA 3DU0A 1BYAA 4OE7A 4CNNA 1TUFA 4A3HA 4Z0SA 2XH7A 3MS8A 3AZSA 1QHZA 1M6JA 4UCGA 2J7CA 3VZXA 2XPKA 1EEXA 1BPLB 1Q5MA 4DAIA 3MB9A 2WJZA 3WLIA 2DZWA 3VKCA 1J96A 4GNVA 1A5BA 5EL1A 1IT8A 5K7JA 4Z2LA 1UKSA 3NTYA 4Q8QA 2OZ0A 2P0IA 4Y2WA 2Y85A 3VKKA 1FWBC 3U5UA 3F1QA 1R2RA 3WMCA 1MEIA 1I1WA 4IGHA 5EPDA 3R94A 4U28A 3I10A 4X2PA 3N12A 1E73M 1FCVA 4JKMA 3WF3A 2DEPA 4MKSA 4F3HA 2Z7KA 4FX8A 1TFVA 3OVPA 4C1NA 1L6SA 5CZTA 1A5MC 1CDGA 2QUUA 3GNXA 1SW0A 2VGFA 3MY9A 3SQSA 1IR2A 4TOQA 1AW2A 3CL7A 4AHQA 1OC7A 2ZXDA 2GK1B 1ZGDA 1WDQA 2BX7A 2E6AA 3HF3A 2E0PA 3IVTA 3GG8A 1U5JA 3TP4A 4IQLA 4KPLA 1Q6OA 2J88A 2BASA 4C6BA 2E40A 4L61A 5HNUA 3GIYA 2PBGA 3O9NA 1DJGA 3G1HA 4QJ1A 4E4PA 5LNVA 4MADA 2NVCA 4WVXA 1M7OA 1ZRQA 2ADAA 4Q8UA 3P81A 1W9UA 3BG9A 3ENLA 3QC3A 3RILA 3EEGA 2ZX5A 1GQLA 2I9EA 3RPDA 1V6WA 2QGHA 1P7TB 4WSKA 4LVDA 3W23A 5TIMA 4MWAE 3XISA 4BK9A 1GEHA 1E70M 2P3EA 3AJ7A 3TX9A 2WHKA 4D8AA 3LGEA 2Q6ZA 1TZ9A 3VKJA 4MZYA 5EGRA 1YEYA 2J77A 3TQ0A 2ZE3A 3P82A 4MZ1A 1SM9A 2QCDB 4FLSA 1X6UA 2YXOA 2BG5A 4PZVA 4UUIA 1KFKA 2FB2A 2OGYA 2XIJA 3OTRA 3ZVIA 2HZGA 1AD1A 4MSSA 4UFKA 2VVNA 3WFLA 4LU0A 3WG6A 1A5CA 2TMDA 1JYVA 3HN3A 4XAPA 3DG3A 3CHCA 1JXKA 4P7NA 1T6MA 1J01A 2FTYA 3TR2A 1AJ2A 2ZXAA 3TTOA 4CN6A 3LV6A 3WEOA 4QG8A 2A3BA 1VCGA 3ARXA 1THFD 1XLFA 3O16A 2X1TA 3K1GA 3LGDA 2YDRA 3MMUA 2C19A 4Z0JA 3CH0A 2RDTA 3VKDA 1HW6A 1P4CA 3NO3A 4E0CA 3G1SA 4AYSA 5D04C 4EOUA 3OBAA 1DXIA 3CMFA 3P5YA 5E9AA 4ZSTA 5J8LA 4YVVA 2GVEA 4F2UA 3C2RA 4Q8OA 1XGZA 4PL2A 4ATLA 3N18A 2GK1A 1TR9A 4NRRA 1QDSA 1N8WA 2DSVA 3FDGA 4DM1A 3BUVA 1NDVA 3LN3A 2V5BA 2PD5A 5AECA 4UWMA 1K1DA 3VFCA 2HNEA 3TTSA 4FK9A 3G18A 4EE9A 1AUSL 2E09A 1DJIA 5F1UA 2FVMA 4F9JA 1Z6KA 5JBDA 3CPRA 3QV9A 1F3TA 4NY2A 2CCRA 4RPPA 2WZMA 4GH3A 3C52A 3HJZA 3VD7A 4PBEA 1P7TA 3EWCA 3VMNA 1C93A 2ZICA 4GYJA 2O7QA 1TSIA 2VM8A 3SIZA 1XW8A 1HJQA 1PO9A 2BVYA 1DJZA 2WV8A 2EPMX 4K38A 2R6OA 1XGDA 3CZJA 4XUYA 3GNPA 3S5ZA 2QCDA 5DT7A 3VKBA 1DTNA 1J0IA 3BURA 3C2FA 1CGVA 3KX6A 4S3EA 3SCWA 4LCSA 1I60A 3VIJA 1GQKA 2Y62A 5K2ZA 4IJCA 3K30A 3VIOA 2PU0A 4LPCA 2NUYA 3IIVA 2FGBA 2NWRA 3NVTA 3TJLA 3P14A 3RN6A 1FWAC 4C60A 3ARSA 3H2MA 3O6AA 5D9OA 2OLHA 6XIAA 4CCZA 5EBUA 1W17A 1VHCA 1JZ3A 4L65A 2FZDA 3N3TA 4CEUC 4EIVA 4XZMX 3L21A 1O66A 1X8FA 4Y9OA 3AU6A 1AL7A 3TAOA 3NZPA 2J79A 2Y70A 2FH8A 4AZ6A 2NQ5A 4JHZA 1ZJBA 4IIEA 4HBKA 2EKGA 4F0SA 1R8LA 4ZTYA 1RBAA 2WAGA 4UTIA 3PJTA 4QSFA 5DY3A 4KBXA 3IVSA 2J6XA 3HG2A 3O15A 1PUDA 2PBOA 1SW3A 1UKQA 4HK6A 1QHOA 4C1LA 2C71A 4GHRA 3HGOA 4W7VA 3W6YA 3IVUA 4XBKA 4ERAA 1FFRA 3BQ5A 1A50A 2BFGA 4H1ZA 1VQTA 1BLIA 3LEPA 2NVDA 2UY5A 3UESA 1DE5A 1E6SM 1CGYA 3F4DA 2VCBA 3TQVA 1OFBA 1EP3A 5A6LA 1IXPA 1SQ7A 3QQWA 2V3FA 5AC8A 4H8VA 2INZA 2O56A 3GXIA 3CQKA 1ONEA 3K46A 4RNJA 2OXNA 3SRFA 3PS7A 4JTFA 3W7MA 3GXDA 2G97A 3AMCA 2QGYA 2YL5A 4R53A 2RDUA 2PWUA 2WO5A 4UMCA 1AD4A 3F2DA 3G1XA 4MHBA 1UD6A 4IG2B 1XLAA 4HSNA 3FJ4A 4S3FA 1ISZA 3QV8A 3L5AA 4D6HA 3OU8A 4M6UA 1TJ0A 2J7DA 4CVUA 4UTTA 2OQLA 2IKIA 2WVUA 4PB4A 5AN7A 4JTKA 1ZAHA 2ZRYA 2CLPA 4IMAA 4AZCB 4AC1X 4OHQA 2IKJA 3G1RA 4EP8C 1CCWB 5A95A 1BYDA 1Q8JA 3VCNA 4Q33A 2H3BA 1CGWA 1LF1A 3O63A 1XLJA 4HYRA 2NLIA 4M24A 5DANA 5FEZA 3O06A 3FHQA 5DN1A 5D30A 3QY6A 2YYUA 3KUMA 1DE6A 1WXJA 1BXNA 1BTMA 3W0KA 2NQJA 2EF9A 2HSAA 4HTYA 1GOQA 4XISA 3GTXA 4RPQA 1ITUA 2BOGX 3CIWA 5I3JA 3FNDA 4EWJA 4LYKA 3CV1A 3T2QA 2R1PA 3V0TA 4OBRA 1C7TA 1FWTA 5REQB 5BXPA 4I5UA 3VIPA 1TMHA 3LPGA 3VM7A 2J75A 4F0KA 3LXAA 1UIOA 2V5JA 5G4WA 1OADA 5F4XA 2FH6A 4V27A 4C6KA 3WH5A 1UR8A 3SY8A 1LWHA 4BF7A 5A94A 1RXOB 2L5HA 1QI0A 4LH8A 2VZSA 1S5NA 3ABOA 4ZA0A 4UBPC 2D73A 3E3HA 2MANA 2ABAA 2PGRA 3NDOA 4I6VA 1JDDA 3HTWA 2BY0A 3CZLA 5CSYA 4UTFA 2XVKA 2OT1A 3HQ1A 4LY8A 2VELA 4DVOA 1Q7ZA 2NT0A 2XINA 3CUXA 1JEZA 4D72A 4CQCA 4GZEA 3DI0A 2PF8A 3C2VA 4LF2A 1FFQA 2QW5A 2P8CA 1FWIC 4JN6A 1TIWA 2BDQA 3QOMA 4O19A 2BGQA 2BP1A 2V2DA 4TO8A 1XKJA 4PFHA 2WHMA 1GOWA 4AZCA 3LM7A 4PMQA 4JDYA 5JBEA 1W31A 3GWQA 2VURA 3T81A 3ZJ8A 1KFCA 3C6CA 5CZJA 2Q3RA 1J12A 4FLRA 4Q4MA 3BLKA 4PMDA 1N8IA 3SGZA 2CEQA 3GNNA 3AWOA 1FXPA 3LM3A 1QT1A 4ACYA 3ZLFA 4N9CA 4MYAA 3ANUA 3QF0A 4X61A 5FF4A 3APGA 1QAPA 1E1EA 1W1YA 2J62A 1ECEA 2XH2A 2WVVB 3W29A 4YCOA 1W2PA 3WQ8A 4TX8A 4XZWA 1CI1A 3F4CA 3VABA 4QQUA 2XGIA 4CD5A 1XDLA 3OGVA 4YIWA 5REQA 3W24A 4FXRA 4L56A 3S1XA 3CWOX 1TPDA 4K1GA 4N7QA 3R79A 3NDYA 3IWPA 1VBRA 4CNOA 1JDCA 4CLMA 4WX2A 4HPJA 3BSHA 5GJNA 1G1YA 2ISFA 1SO6A 1OZMA 4MM1A 2DQWA 3STCA 3TC6A 1OEPA 4E2OA 2W0UA 3PBYA 2ASHA 4LAUA 4O10A 1DHPA 2XG9A 4PA8A 2PDNA 2QV4A 2VL4A 3WNMA 1XUZA 4JTIA 4DJFC 2WB5A 3CAQA 4X60A 1JZ6A 4RZBA 3BV4A 3S2JA 3QGVA 8XIAA 4PSRA 1E0WA 2AKMA 1KGWA 2OWCA 3WBEA 4L4OA 3Q94A 3DG6A 4XD3A 1XBZA 3UWEA 4O4WA 3CHDA 3KP0A 2NSOA 1V3MA 1ZAJA 1OX4B 3NSXA 3UW6A 4GI6A 3FJ6A 1VPYA 3CNYA 1WE5A 2WNQA 3GUGA 3NO1A 4TXEA 2EO7A 4PRTA 5A6BD 2IPJA 3W87A 3PF3A 5BMWA 3VTRA 4LB4A 2R82A 4HSHA 3S42A 1EHAA 3DFYA 5FF3A 2CERA 2NVAA 4JDBA 2VO5A 4GABA 3MZ2A 3HV9A 3ZR4A 1TKKA 2HVOA 1XQLA 2YZ5A 5XINA 3A4JA 3ZS4A 3KRZA 2PCEA 3MO7A 1A80A 3TA9A 3EB3A 6TIMA 3WL0A 4W8BA 2WKLA 4HNCA 4RDYA 1W3NA 3MWCA 4M7SA 1ISWA 2OX4A 4CCEA 4IX2A 1W8GA 3GDTA 3OW1A 4AEOA 1MRAA 1G7UA 2WVVA 1BSLA 5D9MA 4KRTA 1MW3A 1VF8A 2VEPA 3A22A 4X0VA 4ALDA 4AZIA 4C6NA 2PURA 1XSKA 4BCEA 4MNJA 4KIRA 1P0NA 2R1MA 3VGGA 4D1IA 2HMCA 3PZQA 4KEVA 3VI2A 3QVQA 2EXOA 3W53A 2G3MA 2F6XA 3HM7A 2CZ5A 5I2UA 1ZJHA 4NNAA 1WKFA 5D38A 3RDKA 4V1YA 5DX7A 4W5UA 3K8KA 2YBVA 3CBWA 2C79A 3CEPA 3VO0A 1EIBA 3G22A 4YLWA 1J18A 3WUEA 3VC6A 1SFSA 3LZ5A 1CXHA 3O6YX 4AIBA 3CIXA 2Y63A 3UP8A 4A22A 2PDPA 1RHCA 2ZCGA 1OCNA 1OGBA 2VNCA 4F0HA 1EGVA 4L9YA 3GIPA 3VOCA 5DRIA 2DVTA 5ECVA 4EF9A 2VRKA 1VFLA 1PWMA 3EBVA 3F5JA 3B9AA 4UFHA 3E0VA 3BLOA 1QJWA 1R2SA 4Q6XA 2J7HA 1TWSA 5CXPA 1B90A 3AZRA 1CGXA 5GNYA 4MPQA 3KTSA 4WQ6A 4AZBA 1B9BA 2WK2A 2J8TA 2QQ6A 1UASA 2BVTA 3B40A 3TFXA 4QRNA 2WVSA 5I06A 1V0LA 1UW9A 4QEHA 1L0PA 3IV3A 4CNPA 4HNOA 5BOEA 2YCLA 5CSRA 1DQXA 1E4NA 3CT7A 4TVUA 3MC5A 2WNZA 2FMNA 4M6QA 4GIYA 4ZL1A 4PUEA 3W4RA 1B1YA 2XISA 4GZ7A 4G6CA 2E25A 3E38A 4O11A 1BGGA 4Y7EA 1UC5A 5DRCA 1IXOA 4RE4A 3MJYA 3STFA 4YJ5A 4G1KA 1OK4A 1T99A 5CQ1A 2OOFA 3IUDA 1WOBA 3W7DA 2UY3A 3VIGA 4NZCA 2Y7FA 1EZWA 2GSHA 1UG6A 1PDZA 2CHNA 2B31A 2VHLA 3GDRA 4XAFA 1QNRA 5CJNA 5CPQA 4CEXC 2AGKA 4FOUA 3KW3A 5D2VA 1E0UA 5BOOA 4K39A 1MDRA 1UPPA 3ZJ6A 1KBIA 1UB3A 1XIHA 1REQB 3PPHA 1CLXA 1J0JA 4U2YA 2JIWA 3BGAA 2VC6A 1OG6A 3RLHA 5F4SA 1PYFA 5PTDA 3OLGA 1TVNA 4MNLA 2QCNA 3W82A 1Q45A 1EIXA 3PFRA 5C70A 1SO5A 3WH8A 3GDMA 3JR2A 3DHPA 3VGHA 3U4AA 2BXYA 5ABHA 3UR8A 3GHRA 3HU7A 1W3JA 4PE8A 4O4VA 1ADDA 4JN7A 3E5BA 5T91A 3AUOA 5FOOA 3BG3A 2JALA 5AZ1A 2A7RA 2E3ZA 1WXYA 4GX9A 3SUVA 4CNTA 3NDZA 4ROQA 3WCZA 3NL2A 1R38A 2HS6A 1XPYA 4NZJA 1VRDA 5LIUX 4BJHA 1NP0A 3QW4B 3BAYA 4ZQCA 3SEPA 4QISA 5E93A 4DJFD 3MKKA 4MJ4A 1WV2A 4FSAA 4GIAA 4H01A 4RW5A 3TYEA 3TW6A 2AL2A 2OFJA 2PSNA 4PTNA 4R9XA 4YU1A 4E2DA 2OYKA 1YTEA 5HQMA 3A9IA 3A6OA 5F2LA 4L80A 5FA5A 5DF0A 2VUNA 4W5ZA 5CLTA 4P8VA 4PB5A 3ONCA 5C71A 2WSRA 2OELA 5LZLA 1UP0A 4WY0F 2VD9A 5DMYA 4AD4A 1ZBKA 5CC5A 1UR4A 1K02A 4F8XA 4HMEA 3N2CA 4H9XA 2PC8A 3AHTA 3MI6A 4QGCA 2UY4A 3GDLA 3QTPA 4LT9A 2XN1A 4LSBA 4GK8A 1DWGM 3QHNA 3G3DA 1G7VA 4MB5A 3JVAA 4I9TA 4NZ1A 1A5NC 1E4MM 4LB3A 2GZXA 1ESWA 4D2JA 4DM2A 4GI4A 2XH4A 2O4MA 2GJLA 2Y6ZA 1RAKA 3G5EA 4H9ZA 5HMSA 1LRTA 2Z0IA 4O1BA 3RR4A 3MHGA 1LOQA 4PCNA 1US0A 2RH9A 1NQ6A 4FNUA 1OYBA 3AC0A 2QDGA 1KKOA 1FDJA 4Z1AA 3GO2A 3N11A 1OYAA 4GVGA 4RDVA 5HPOA 2DUXA 1REQA 1XLCA 1HL2A 3LG3A 4JS3A 3PANA 4EX4A 3QYSA 2D2OA 3AIVA 2A3EA 2QCMA 5C55A 3IV8A 3LCFA 3H2NA 4M6PA 4MNKA 2B7NA 3A4WA 4MNMA 1UZ1A 1MI3A 4J3ZA 5D9PA 4HP5A 5LA1A 3QTGA 2Y24A 4QEEA 3R6IA 4Y8EA 3AIQA 1YXYA 3W28A 2J66A 3O2LA 2R8WA 3DKLA 1QO2A 4K8EA 4C6DA 4HU4A 4LS2A 4R9OA 4IX0A 4WKFA 2OLAA 1QK2A 1EPXA 1VCFA 5E0KA 2CU0A 3EOEA 3AIWA 4PTMA 3R89A 1TPB1 3TVAA 1BXCA 3GTFA 2ON3A 2BOFX 1J6OA 2WWDA 4XQ6A 3N9RA 2YA0A 3AYSA 3A4AA 4UMBA 1JUBA 4AWEA 1US3A 1QBBA 1TCDA 4Z2IA 3FY1A 2QV5A 1V6TA 1KCXA 1SFLA 4E8CA 1Q6FA 8XIMA 2Q09A 3CB3A 1UWIA 5T26A 2V5LA 4HGXA 1AH3A 3PZGA 2V9DA 4RV3A 1KB3A 1ZZMA 4JTRA 5FACA 4GUJA 1KNWA 3S5SA 4YYFA 3U2OA 1L2UA 4JNMA 3ZT6A 1HJVA 1R46A 2HQAA 4LYRA 1MVYA 4Q4PA 3LLDA 1LQ0A 1QNOA 1PZ0A 4LALA 4P5UA 1KV5A 4ZO6A 4JCLA 2QF8A 3GM8A 3M0ZA 3ZVHA 4XKYA 1JF5A 2VEFA 5CH9A 1ZJIA 1OSEA 2A1YA 3EWXA 2QVNA 4XZ9A 3TMQA 2ZTKA 3MYOA 5I3FA 2Z1KA 3P2VA 3N2BA 1TJPA 4UR9A 5G2HA 3KXQA 3SM0A 4P8WA 2VDHA 5IXEA 2VX6A 1PX4A 3WLTA 2PI6A 4O17A 1OFQA 2V5DA 1XISA 4PN2A 1B4EA 3FHAA 1UD2A 2VI0A 4BQ3A 2G3JA 3LB0A 3RLVA 4DXXA 4MFEA 3DESA 3T0AA 1PTGA 3SN0A 3AU2A 2DP3A 1K77A 2E77A 3OLDA 1WX0A 1I2RA 1NOFA 4S39A 1V3IA 1EF2A 3OZPA 1DJHA 1S5MA 4HYWA 2QJJA 3GZ3A 4N9EA 1ENUA 5C2XA 1S2CA 4JL2A 1GZGA 2WCSA 3H53A 4HHLA 3CUGA 2ZC1A 3L5MA 1K6AA 1G4SA 4JY8A 1GYNA 2EPHA 1NTHA 1XC4A 5KSWA 2EPLX 3SI9A 5FJIA 4UZSA 1UBSA 3FXGA 3MUY1 4PH6A 4HCLA 1M41A 2VGIA 4B5VA 4JHMA 2PMQA 4YHGA 2AAAA 3H4XA 4DUOA 4XBSA 1NY1A 1HKMA 2F6UA 4IMFA 5B7ZA 2REQB 1SJBA 5E0FA 5FJOA 4U4MA 2PP1A 3WUBA 1GOXA 1Z69A 3SQLA 1JPMA 1TZ7A 1V3KA 3TDFA 4DJEC 1QW9A 1ME8A 2ZYFA 5HINA 5C9UA 4ZFCA 4GI9A 4GACA 1A4LA 1DTUA 4UMAA 2GGIA 3TJXA 2OGJA 2Z1SA 4LW7A 3I7SA 4UOQA 3WN6A 3STPA 4DYJA 1VP5A 1X6LA 3MT1A 3SR7A 1EOMA 4POCA 4WD0A 4ZEPA 1RSCA 4EPDC 1P0KA 4P8XA 4DJDA 1V8EA 3N2TA 1TWZA 1ZL1A 3BCFA 3B8UA 1Q7QA 4DB7A 1FCUA 1ZALA 3ZWSA 4RDWA 4U31A 3UD6A 3N6HA 3LCLA 1MEWA 1VB9A 1B54A 1TPC1 3OHMB 3T8LA 4C6QA 4ZZ9A 2XIIA 3Q4DA 4IGSA 1FWNA 3LCIA 4HQVA 2BBFA 3J7HA 4J3UA 2HK1A 4U2ZA 3URAA 1R3TA 4GD0A 1L8NA 1X96A 1NOWA 1XLDA 3VOGA 3UG4A 3WH7A 3BLEA 3MP3A 3TQPA 1EBGA 2HPMA 4WXZA 3GXMA 4GOAA 1KFLA 1ZJAA 3EX4A 2DIKA 1H09A 4OWGA 3K4DA 1O95A 1S2AA 4FNSA 4DLFA 1W56A 4BQ4A 5GVJA 1WBHA 1UWAA 2HVNA 3U6WA 5EU9A 3N9KA 3SCNA 3PNUA 3W72A 3RM9A 1P1MA 1AW5A 5FJRA 5A8OA 2J7FA 1D3CA 1YW1A 3M1ZA 3W07A 4JZ5A 3NQGA 2Z26A 2VX7A 4XAGA 3UG5A 1ITCA 4O1EA 1QNQA 1X7IA 2X30A 3W7QA 1KM0A 5FL1A 1FP9A 5FJPA 4ECLA 5AYYA 5T9BG 3EX6A 2VDIA 4TUFA 2O4QA 1IZKA 4Y8FA 4E8GA 1V3LA 1Y5XA 5TNVA 2QPSA 3E0FA 2REQA 2PGFA 1SZGA 4PMUA 3EA3A 1GZJA 3NNTA 2QAFA 2WHLA 3PWAA 2ZRXA 4IGMA 3W1LA 4R7JA 2HNHA 4D8ZA 4FLOA 3H21A 4H6RA 7CGTA 4Z1CA 1G67A 4JNZA 1KRCC 2DT3A 2PDIA 2E6DA 2VR2A 1TJRA 5KETA 2AQWA 4IQDA 1OFAA 4Q4QA 1N8FA 2EPOA 2PDHA 4QLKA 2WZEA 1EJ7L 3VD3A 3AS1A 3MQTA 2OSWA 4IIGA 1K4HA 5A8MA 3FLUA 1FWJC 5FL0A 3WEMA 2CBVA 3MDUA 1Q6RA 4JQAA 1GONA 4OKDA 3WYZA 2HBVA 3S9ZA 4MY8A 3IAQA 3MV11 3SAZA 1O12A 3PBGA 1JZ8A 1BFNA 4EKJA 4FB7A 5HJXA 2VEGA 2WQDA 3UJ2A 2MNRA 1DWJM 4BF9A 2ZWZA 4A05A 3PAOA 4GNJA 4JX4A 3ARWA 3W2NA 3AFBA 3N19B 3AIUA 3W7LA 5BXRA 4TR9A 3TN6A 3LHWA 4WK9A 5AHEA 4ZENA 3HPZA 3GH5A 2GVGA 4O8RA 3ITYA 3T0CA 3NZGA 3F03K 4OBSA 4GJ1A 2CXGA 1TMLA 4MFDA 3TZNA 2DVUA 2Y8VA 4FAMA 1AJ0A 4EWND 1ZCCA 2PD9A 5AFDA 5AY7A 5LGZA 5AYIA 4Z2KA 3HPSA 3SCOA 3THAA 2VD8A 2J8FA 2Z7GA 3VNLA 5CKSA 4MVAA 3HGRA 2GQAA 1E3XA 1MUWA 3CHFA 2VOTA 3SDOA 3LTYA 1KR1A 1V02A 3DFPA 3BQ6A 1DJWA 2E1WA 5C5YA 2ZVIA 3SUWA 4PB3A 1PL9A 5BU6A 3OQEA 1VPQA 3HQOA 2ZA3A 4FX7A 5EBAA 4CNSA 2FGZA 3JZUA 4PBGA 3E2QA 3E1F1 1TV5A 1QW8A 1OBAA 1W9BM 4FI4A 1AW1A 2AMGA 3VD5A 3HMJG 3TROA 1JFHA 4MWAC 1LLZA 1XBVA 2C13A 4AHPA 1DWHM 2XUCA 1OINA 1TPEA 4I8DA 3GR8A 2DSZA 3ARZA 1UD5A 4OU1A 2IMRA 1XKYA 3WKZA 2X2GA 2Q02A 3PG8A 5BU9A 2QCEA 3NGFA 4Z1BA 2DZXA 1TCMA 3EDEA 3JW7A 3E2VA 1VBGA 2WLZA 5H1WA 2Z2UA 4GBDA 2OJPA 2R24A 1NJJA 3DFOA 5KMYA 1XBXA 1GT8A 1O5RA 3S1WA 1OC5A 3CASA 2FTPA 5DO8A 2IUZA 4HN4A 1XF0A 3UYIA 2P1FA 1FWEC 1UUMA 1RJRA 5EMMA 1P6CA 3G1AA 4YWSA 1E9YB 3MJMA 3M9YA 3UU0A 1TX0A 1B3ZA 3INPA 1MO0A 1U5HA 3TU9A 2QYGA 5A5WA 3THQA 3NGJA 1JCLA 2Y5SA 1SO4A 2G5WA 4JY9A 1E9IA 1Z32X 5FAGA 4GXPA 3MBFA 3SFKA 2XSXA 2QKFA 4JTDA 3G6MA 2PDUA 3Q2DA 4NAFB 3ISIX 2QEZA 4L6OA 2WPGA 5L9FA 5JH1A 4A4AA 4HOZA 1W91A 1HF6A 4PGLA 3S83A 3V18A 3B9DA 1FX6A 1YQ2A 2XVGA 4X2RA 1H3GA 1PYMA 4QM1A 3UWQA 4AWTA 4Y9MA 1X6NA 2A6NA 4B5NA 1OYCA 3PB2A 2VZVA 3MUAA 1VCVA 4RNFA 1UKOA 1IGSA 2VR4A 1NQKA 4IICA 3VYLA 3LMZA 5CPTA 5JU6A 1FXQA 2BVDA 1ME9A 5HQLA 5U7SA 3CO4A 1GJPA 1GG1A 4D6CA 4CNUA 1ICSA 1V0MA 3SUUA 3M0IA 2XN2A 4UQCA 1Q7MA 3SCSA 4JPGA 3PZVA 1FWCC 5TBOA 3SCQA 4C7DA 1D8WA 2OQHA 3GTHA 4JNYA 4H4IA 4PMRA 4Z1DA 1DKWA 1TQJA 3GNRA 5HMDA 1XIJA 4DELA 4H7VA 1CXEA 5E1QA 1LT7A 1I45A 1ONRA 3CUIA 2ZRWA 3G0XA 1G6CA 3HQNA 3W71A 3B0VC 2XWDA 3IGXA 1WCGA 3TSDA 3N34A 2GOUA 3VNIA 4JYFA 3BGJA 3CYVA 3VZZA 3DECA 2EGZA 1TPFA 4AD3A 1TRDA 4KS0A 2YA2A 2OWXA 6ENLA 4S3JA 3O6CA 1EYWA 3GX9A 3ALGA 1X97A 3MVIA 3ID7A 5A8PA 4ZVJA 1LL4A 3EA2A 3IUIA 4PEEA 3WDJA 1R9YA 1FWRA 4DO6A 1PJ9A 4KRUA 3CEUA 4HTBA 1F8MA 1H62A 3TR9A 3G6LA 3BLLA 4CCCA 1XYFA 3FDKA 3DERA 1DORA 3O6DA 3QSTA 3SGGA 4HZMA 3WJZA 1DL3A 1S38A 4IFRA 1T96A 5JMUA 4HMDA 3VILA 3M5YA 3WO8A 1CW2A 2QZRA 3AHVA 3TC7A 3W85A 3AXKA 3K5XA 3CT2A 4QJ3B 2YYTA 4EXBA 4XIMA 5I5RA 4P7OA 2W63A 1HG3A 1GZ1A 3BARA 1GK8A 1VRXA 4NAFA 2O7SA 5FEPA 1CT5A 1GHSA 1XLHA 3N4FA 4OOUA 4FA3A 4JTSA 4CN1A 1G5AA 1F76A 2GGJA 4RLIA 1F6YA 1IEWA 1QNSA 1F4HA 1O7AA 2XGZA 2VFGA 3M4HA 1R7AA 1LYXA 2ZUNA 1ZLPA 5HPCA 2ZE0A 1LRNA 1ZP4A 4ACZB 3BW3A 4BI7A 2VX4A 5CAKA 2V69A 4OOZA 5E6YA 3WEZA 2ACSA 3UVAA 1EQPA 3WLKX 1RQHA 4JTCA 1E4IA 4WIWA 4Z2JA 3GXPA 1CXFA 1MUCA 1DEDA 2FZ9A 3LPPA 1S5TA 2FGLA 1GGOA 2IQTA 2NT1A 3RO6A 4D6EA 2QUVA 3FA4A 3GAYA 3NPUA 2HXUA 5K3VA 1J2BA 1UD4A 5D8WA 3VZYA 3BAXA