2PDMA

Human aldose reductase mutant s302r complexed with zopolrestat.
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
315
structure length
315
Chain Sequence
ASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLRCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title Merging the binding sites of aldose and aldehyde reductase for detection of inhibitor selectivity-determining features.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 105
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2007-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2pdmA00
4IJRA 5KETA 3O3RA 4DBUA 1US0A 2PDCA 4YS1A 2DUZA 2ISFA 3D3FA 3UFYA 1SM9A 3R8HA 2PDNA 1UR3M 2IQDA 4WDTA 5AZ1A 1AZ1A 2ACUA 3GUGA 4YVVA 1QWKA 4LBRA 4PUWA 4YVXA 4LB3A 1AH4A 3LEPA 4GCAA 1RALA 1Z9AA 3QKZA 2BP1A 3M64A 1XJBA 1YNPA 2PDLA 1AH0A 1S2CA 3Q67A 1RY8A 1M9HA 1X97A 3CV6A 2IS7A 3WCZA 4YU1A 1YE4A 4NKCA 1R38A 3ONBA 1MI3A 2DV0A 4WEVX 4ICCX 3S3GA 3UZXA 3LZ5A 3N6QA 3O0KA 2PDHA 3R7MA 2VDGA 2ACSA 2PFHA 3EAUA 4HMNA 3RX3A 4Q3MA 2BGSA 4XO6A 1XF0A 2J8TA 4EXAA 4PRTA 5HNUA 3UG8A 5JH2A 2FGBA 1IHIA 3GHTA 3WBWA 4LB4A 1T41A 4DZ5A 5LIWX 3G1RA 3COTA 4FALA 2FZ9A 2PDBA 2IQ0A 5HNTA 1J96A 3MC5A 4JIIX 4FA3A 1ADSA 4WDWA 2I16A 1RY0A 4DBWA 1ZGDA 4H7CA 4QR6A 4JTDA 3R94A 2PDKA 1XGDA 3WG6A 2PF8A 1A80A 4JQ1A 2PD5A 3R6IA 5C7HA 2AGTA 1Q13A 1S2AA 2IKGA 1K8CA 2ACRA 3H7RA 4MHBA 4F40A 4JQAA 4HBKA 4PMJA 3C3UA 4G5DA 3ONCA 4QBXA 2PDGA 4LBSA 2A79A 3UGRA 4JQ2A 3BURA 4JTRA 1VP5A 4QX4A 3RX2A 1C9WA 3F7JA 2FZ8A 2INEA 2PDQA 4XZMX 2PD9A 1JEZA 2F38A 3G5EA 3DN5A 1Q5MA 2FZDA 4JIRA 2INZA 3GHUA 4XZHA 2P5NA 1EKOA 5AZ0A 3EB3A 1PWLA 4GA8A 3UWEA 4PUUA 4RPQA 2PDXA 3LQLA 2R9RA 3FJNA 4YVPA 4JIHA 4PR4A 4JTQA 2IPJA 3LZ3A 1X98A 2ALRA 2HE5A 2C91A 3LQGA 2DUXA 3DOPA 2PDPA 1YNQA 3N2TA 1AZ2A 1X96A 4L1WA 5HA7A 5LIXX 3FX4A 3BCJA 4OTKA 4ZFCA 2NVDA 5DANA 4XAPA 5LIKX 3ERPA 3H4GA 3CASA 3V36A 3CAQA 1HQTA 4LAZA 4FZIA 2PDFA 4XZLX 3WBXA 1EXBA 1Z8AA 3V0UA 3V35A 2IPWA 4GQGA 1LWIA 1EL3A 1AH3A 2PDWA 3Q65A 3M0IA 2PDUA 3CMFA 3U2CA 2IPFA 2PZNA 3WBYA 3BUVA 2WZMA 3CV7A 3R58A 1IEIA 4IGSA 1ZUAX 1LQAA 2HEJA 3H7UA 4PRRA 2FZBA 3LN3A 1HW6A 4XZIA 1AFSA 2IKJA 2HE8A 4XVDA 2I17A 2ACQA 4GACA 5LIYX 3EB4A 2FVLA 4GABA 4WRHA 3UP8A 2IPGA 2PEVA 4JTAA 3LENA 2NVCA 1QRQA 1PYFA 3CAVA 3GHSA 3P2VA 4Q7BA 4JQ4A 1S1PA 2HDJA 1ZQ5A 3BV7A 1Z3NA 3GHRA 4XVEA 4JTCA 1PZ0A 4QXIA 3UZZA 2R24A 1PZ1A 3RX4A 1PWMA 4ASTA 2BGQA 4GIEA 3UZYA 3UZWA 1MZRA 2QXWA 3R8GA 1VBJA 3M4HA 4H8NA 3R43A 1S1RA 4IJCA 2IKHA 2WZTA 3LUTA 4XO7A 1MRQA 2HVNA 3NTYA 3T42A 4GQ0A 2F2KA 3V0TA 1YE6A 2PDJA 4WDUA 4EXBA 5JH1A 3MB9A 3V0SA 4DBSA 3UYIA 4LAUA 3LBOA 2HVOA 2PDMA 2HV5A 1GVEA 5M2FX 4L1XA 4XZNX 1T40A 2CLPA 3LD5A 1ZSXA 4WDXA 3LNMA 2PDIA 2PDYA 3B3DA 2IKIA 4AUBA 1FRBA 1EF3A 3KRBA 4FAMA 4R9OA 1OG6A 3VXGA 4WGHA 4I5XA 4XK2A 1Z89A 4JQ3A 5LIUX
chains in the Genus database with same CATH superfamily
3RXZA 5KETA 1EC8A 5LZLA 3W38A 3QM3A 1WKFA 2HRWA 5I23A 3IV8A 2H9AA 4C7DA 4IH3A 3O3RA 2DY3A 3CWOX 3SB0A 3SJNA 4Z1DA 3TV8A 2ISFA 3EWBX 3H4XA 2HPMA 4D8AA 4DYKA 3WDRA 3B9OA 5BU9A 3MUZ1 5BOOA 2I9EA 3WD3A 4Q8OA 2ACUA 3AMDA 5EMMA 2E6AA 3OP2A 3WDQA 3CEUA 1FH8A 1DJHA 1HF6A 1E0VA 2FB3A 3W7JA 3F4NA 1OF8A 3WIJA 3CUZA 3W1MA 3QSTA 4WGXA 2ZZ4A 3HMJG 4B16A 1B3VA 6XIMA 1QU4A 4RDYA 3FYOA 2A4AA 1UD6A 3D47A 2BP1A 1E72M 2ZX7A 1DTNA 2VGFA 1TV3A 5G4HC 3L5LA 3FY1A 1WV2A 5GJPA 5C71A 4L4MA 3SURA 1TWDA 3H53A 1DJGA 3VCRA 2Z24A 3STPA 2VR5A 5LNVA 2YDRA 1JI1A 1TJRA 1BWVA 3M7WA 4W85A 3GRIA 1XSIA 2FHBA 2VDGA 2PFHA 4LGXA 3TWBA 3WQ8A 5KZMA 4Q3MA 4ZO9A 3W02A 1YDYA 3HZ3A 1O1HA 3LDVA 5DLCA 4PRTA 4DLFA 1UR4A 2GGEA 4F0MA 5K3VA 4JYDA 3AXMA 3GTIA 3OYZA 3GHTA 3GNXA 3FHAA 1JCXA 2P0IA 3WF1A 4PEKA 2DU2A 2FZ9A 3TYUA 4WY0A 2HS6A 1XCFA 4AWTA 1ONXA 4M81A 1RY0A 1MQPA 3KWXA 2G97A 4GC3A 3GC2A 4C6BA 3ITCA 2J7FA 2V38A 2GWGA 3D3AA 2X41A 4C60A 3L4ZA 3QV9A 3CHVA 3EMCA 1OM0A 2NWSA 1VCGA 1E1FA 1S2AA 2GVEA 3D5HA 3MHFA 4PC8A 2G50A 5HXMA 1LWHA 4ZZ9A 2YW3A 3WY1A 3L68A 4HA0A 4GY7A 1FWDC 3WLIA 2FDMA 2XFFA 3N4AA 3VNJA 1RSCA 3S1XA 3W86A 3FV9A 3W81A 4LUSA 5A5WA 4C7FA 4IG2B 2ZA1A 5FL1A 4L9YA 4R33A 1MQQA 1NOFA 4LEFA 1TPDA 3S1GA 3VIHA 1FWSA 1H1YA 1PKLA 2VZSA 4QNEA 3BL3A 5A8QA 1ADOA 5F2IA 3N6JA 1CENA 3KVJA 4BF9A 3RHGA 4ZBCA 5LNWA 4DUVA 4DI9A 2FZDA 1FCUA 4JX4A 3IPWA 3BMXA 3U3HA 4Z1BA 4DVOA 4H19A 1QK0A 1A0DA 3SCNA 2GK1B 4F9DA 2R9RA 3FJNA 1L6WA 2HVMA 5CSRA 1OIMA 4JFVA 3W1AA 5A8PA 2HE5A 4GBUA 1KRMA 3U2OA 2OOFA 4IMCA 4J7RA 3RLHA 1YPIA 1KFWA 3MANA 4DEFA 1LCOA 4PMXA 1N8WA 5HQEA 2W3ZA 1BXCA 4V28A 3NQ6A 1TRIA 1AMYA 3EWDA 3T78A 3FA5A 2WKLA 1SO4A 3A9BA 2NVDA 2QDHA 3N6HA 1RHCA 3QR0A 1MXSA 2H8XA 3CAQA 4PMVA 4I9MA 3TR2A 4BHYA 4PRWA 2C8NA 1R46A 2ZX9A 3TZNA 3EX6A 2NSXA 2GUBA 4EF8A 4NJHA 2WHLA 2GJPA 2WSQA 1P6CA 2BV9A 4BFAA 3T0DA 1NIUA 2YCEA 4EOUA 4IXHA 2BHUA 1FDYA 1FXPA 5AYZA 1CZ1A 3G8EA 1Q4NX 2C0AA 3R58A 3WNPA 3DKLA 2OB3A 2WZEA 3BGGA 1RPXA 3GNRA 1TPWA 4WOZA 4ZB5A 4XTDA 2HEJA 4KEUA 3V5CA 1HW6A 5A95A 4UTTA 2O9OA 5E70A 2EQDA 1WXYA 4D8LA 3P81A 4M6UA 1W91A 3LMYA 4PN2A 3MSDA 1X1NA 4UTHA 5KITA 1YMYA 7PTDA 1UKQA 3ZIZA 1Z69A 3ZT6A 3T81A 1GQKA 3PVFA 1I0BA 1B3XA 1HL9A 1P7TA 4QGCA 5EMUA 5BWAA 4K1GA 4R3UA 2JF7A 1Q6QA 3GHRA 3G24A 3T55A 3ITOA 2OVLA 1XYFA 4UFLA 1H5YA 4XZ9A 5D8ZA 3KVMA 1MUCA 3SCUA 2OSYA 1XYAA 4MNMA 2QT3A 1W8SA 1QR7A 1FWAC 1HJSA 1TZ9A 2XGIA 3SCRA 5DT5A 3M47A 3UJRA 2P88A 2VZTA 2ZVRA 2EPHA 2Y0FA 2OWWA 3M07A 3GBEA 3UXDA 2VC7A 4WDUA 5LSMA 4DF1A 2QR6A 4PBFA 3IAQA 3V0SA 3WNMA 4QNWA 1WOBA 1UC5A 3UJFA 2QDGA 2VTFA 3AYRA 2E6YA 3LU2A 1DJIA 1GVEA 1GPWA 3K4AA 1TPC1 4FNRA 4AD1A 3MMDA 3QHNA 3DENA 4Z2IA 1UPPA 1JF5A 3HG2A 1HFBA 3IV3A 2Y7GA 2ZXQA 1KM3A 1P1XA 8XIMA 4FAMA 2VM8A 4FLRA 4MDOA 3AAMA 1O94A 1BRLA 3WH9A 4AD4A 5DBUA 3VM5A 4MY1A 1TWWA 1GYMA 1LF1A 2L5HA 1TPVA 3UXIA 4YCPA 4Z1CA 1XLBA 3D3FA 3IIOA 4Z2GA 2NX9A 3ARXA 3GKFA 1TB3A 3CB3A 3BK0A 6ENLA 2PI6A 3LXBA 1EEPA 4FIRA 1M65A 1RK5A 4H8VA 1DEDA 4GUIA 1X7IA 4MWAA 1TIMA 3MW7A 1O1ZA 2CLIA 5D2YA 4HPXA 3FJ6A 4MPKA 1MXDA 3SUUA 4LB3A 4TUFA 4NAFB 3CL6A 1EPVA 4HD5A 2ZADA 1LUCA 1V3HA 1QPKA 1W5QA 4YWSA 1EJUC 1LM1A 2NQ9A 4J2PA 2FTPA 4JTHA 3GQYA 1Q7ZA 1D7KA 3V3WA 3G2GA 4NVTA 1Q4WA 1W1VA 4HK7A 3P67A 3W37A 3KS5A 1AW2A 3WD1A 3QF0A 1MSSA 1OFBA 4ZO6A 4G8TA 1F07A 4LS1A 4Z1AA 1D9EA 3EAUA 1MW3A 1V7AA 4ZB0A 1FBAA 1HXJA 2V3GA 1W3IA 1K4HA 4L9ZA 1F4AA 2YA1A 3DFPA 3N17A 3T07A 1ISXA 1WOAA 3I4EA 2FJKA 1JZ6A 3QTGA 4MFDA 2PF0A 4MG4A 4IIDA 3BLKA 3AS2A 1K9EA 3NR0A 4AIEA 4NRRA 1WZKA 2HROA 3H2AA 2P1FA 1SZGA 1YW1A 4F66A 1B1YA 3LCGA 1J96A 4AZIA 2FZMA 1HJXA 3BOLA 2WNWA 4H7CA 3I3EA 3QRHA 2O0TA 1GHSA 1XBXA 2BY0A 3BPWA 4GJJA 3A64A 1UWTA 5E6ZA 5C7HA 1Z48A 4MOZA 1UYQA 4PBEA 3HMCA 2DFAA 2EGZA 1QUMA 3RCYA 1RBAA 3TIMA 3UA3A 5F2LA 3BCDA 3OB8A 1UUQA 2Y70A 3S9ZA 4F40A 5F1UA 5EB8A 3ATZA 4G56A 2PDGA 1J12A 3HU7A 1GUVA 4MKNA 4DZHA 3QC3A 4UTWC 5I02A 3AS0A 3RG6A 2CW6A 2FPTA 1C7TA 2QCEA 3FIGA 4LCRA 1C9DA 1JJKA 4ZQNA 1D7FA 4FB7A 2ZE3A 3R11A 1H0IA 4R53A 5HPOA 1H7NA 1FP8A 4X2RA 1EDTA 3B9DA 3OVRA 4PUUA 1XIBA 4POCA 2WSRA 1I2RA 4KCVA 1SR9A 2XGBA 2X05A 3EPMA 2XZ9A 4YVPA 1D3HA 2PCEA 2AQWA 7REQB 5C9ZA 3CIWA 1I1XA 2NXHA 1V8EA 2V0TA 4Z42C 2PAJA 3QZ6A 4NI3A 3PN8A 2ALRA 2YCLA 3HQNA 2D2OA 1KBLA 2DUXA 1J18A 1BYDA 2XH4A 2F8QA 2GQ8A 3S6OA 3PG8A 4C6NA 1QNQA 6XIAA 5I6SA 4L1WA 5AC8A 4I5RA 1UR2A 1DWJM 1PCWA 2VVSA 1TWIA 2F84A 5CG0A 5AHLA 1X38A 3VOJA 2VDHA 2R6OA 3UZJA 2W91A 2BXVA 4XAPA 4QS6A 5HUPA 4MNKA 3I7QA 4U5KA 3UQNA 3N2BA 1KGUA 3CPGA 2P53A 2OLAA 2FVMA 2XWEA 3VX1A 4QSFA 4JTGA 1WZLA 3TN5A 4UXDA 5AC7A 3AZTA 1VIWA 4NX5A 4LV4A 4B5SA 4QLLA 4HOXA 2F6UA 3XISA 4P61A 1V3KA 1FWJC 2PDWA 3XIMA 3S1UA 1JDEA 4QCEA 5C55A 3Q58A 4FMVA 3IARA 4M82A 3BUVA 1TE1A 4U10A 3MZ2A 2GZXA 4HYRA 1J93A 1X39A 3MI3A 5IDZA 2VC6A 3LN3A 3M5ZA 4PTXA 3EDEA 2YYTA 4YTUA 2EPLX 1BEUA 4GACA 2XM1A 4JTTA 5I00A 1TVPA 2E5BA 2YCIX 2EEXA 2DEPA 2XSBA 5FF3A 3UVIA 1C91A 1MEHA 2MANA 4BI7A 3DUGA 1GOOA 4QJ4B 2GJLA 2HDJA 4UTJA 2OLHA 4DJED 5HOSA 2A3CA 1E6QM 3KOWA 3OYXA 4HIBA 3WQ6A 1CX9A 4JTCA 2GUUA 3FEQA 2FDSA 4F3HA 2WPGA 1PWMA 4MNJA 4N9DA 1KXHA 2VEGA 3OA3A 3FOKA 1A49A 1JXJA 3CZEA 3EX2A 3EA3A 3WFAA 4LY4A 3T0BA 2A3LA 4UTFA 4XZBA 4IP7A 3GLCA 1CGUA 5JH1A 2BMBA 1H4PA 3A3WA 4DBSA 3PG9A 3QR3A 5I78A 2FMOA 2IXUA 3LHUA 2J77A 5D9MA 2J74A 3JZUA 5BYWA 1JXKA 2W27A 4GI8A 5CC3A 3WLMA 4CN4A 1JD7A 3G0UA 1TVNA 4JFUA 1GORA 2CCRA 1TCMA 1TYGA 2WCGA 3VMNA 3UXAA 3C8FA 4Y6GA 3B8WA 1MFVA 5T91A 3GVWA 3BSHA 4PMRA 1GT8A 1AD1A 4MVAA 4C6KA 1KWKA 3FS2A 3WEOA 4LALA 4D6EA 2VRQA 2VUNA 5REQB 3CYVA 2PRHA 1QNOA 3OU8A 1BGAA 1MDRA 4YVVA 1NWRA 3PJUA 4IWWA 3M0JA 2IW0A 1EQPA 3L9CA 2VEKA 4REQB 4D9PA 2W5FA 5C2CA 4DO6A 2RFGA 5C70A 5IBXC 2BXZA 3NQAA 2D1ZA 1IXQA 3LEPA 4S39A 2PMQA 2VOTA 3WLRA 3UERA 3A4JA 1ME7A 5H8MA 1XLGA 5DXXA 4C6MA 1ZL1A 3Q67A 1M68A 3IRDA 3HPAA 2ZYFA 2XWDA 2OCZA 3WZ0E 2X0SA 2YSWA 2W92A 5LNRA 4BKNA 1E4IA 4INFA 3PPFA 3OZMA 5AYIA 5PTDA 4AZBA 1UA7A 4A3RA 1F05A 1VPXA 1B4EA 3KRZA 5A2BA 1VFMA 5E1QA 2J8FA 5H8PA 3NFUA 1RXOB 4GNVA 2OU4A 2BB0A 2CPUA 4PTVA 4CVUA 4QTGA 1UR0A 5I24A 5BU6A 1HTIA 2PS2A 4F0KA 5E0CA 3LI1A 3HV9A 3W88A 3SR7A 3P82A 3W1LA 1Q7MA 3N29A 3GYCA 3NZQA 3CC1A 1K8XA 3GXIA 3I65A 4R9XA 1ADSA 1W8GA 4DUXA 3ZYZA 2I16A 1MRAA 1KM2A 2J7GA 3ITYA 3U4FA 2NXGA 4UC5A 3DIPA 2OT1A 4F0SA 1H2JA 2PD5A 2CZDA 3F5LA 2QUTA 5EGRA 4E4PA 1MWOA 2V5KA 1PV8A 1Q13A 3VNDA 5I07A 2V5LA 1VCVA 3SJ3A 4MLRA 3RDKA 5HMEA 4JTJA 3ONCA 4AZHA 3W6YA 1XLJA 4LT9A 5FEXA 3W2UA 8TIMA 3ARZA 3E2SA 3SUTA 3KRSA 3ANUA 4QX4A 4XISA 5CPOA 2INEA 2Z27A 3WF0A 3M5XA 3UD6A 4QLKA 2I5QA 1F3WA 1R85A 3VIFA 4GXWA 3H4WA 2G41A 3WBAA 3CZ8A 1BFNA 3W22A 1W9DM 2P0OA 3F2BA 3UNDA 2A6NA 4LPCA 2YXOA 2OXNA 2CLEA 4O0ZA 3SY5A 1NDZA 1D3GA 3TMLA 3WQVA 5D03A 1GOWA 4Q8WA 4X9YA 1IXPA 1QOXA 1YQ2A 2PDXA 3BQ5A 4E8DA 2REQA 1JCTA 2NUWA 3AIEA 1XR2A 4O52A 4I6VA 2OQYA 4FEZA 4GCXA 3NPWA 4F8XA 3VKBA 1X98A 2V5CA 4GINA 1G7UA 4UZSA 5IRPA 4US6A 4HCHA 1RCQA 1BAGA 2DZVA 1AJ2A 1OB0A 3U7VA 1N8FA 3H8AA 3WJZA 3KW3A 2CWNA 1GHRA 1HNYA 4QG6A 1L2QA 3BCJA 4JICA 3VD9A 1LRQA 4QJ5B 4MSSA 2ZRVA 1HJVA 4CQAA 3T2QA 3T05A 3NIYA 2GGHA 4NJIA 1JDAA 4DJEC 1DE5A 3FXYA 4UBPC 2PSNA 2ZZ7A 3ZR5A 4U4MA 1F8MA 2C71A 1HQTA 3W2JA 3WFZA 4EWJA 4L61A 2IPWA 2ZTKA 3JS3A 4TTGA 4OV4A 2YFNA 3H6OA 5HMFA 4YWIA 1CXEA 4I7WA 1TUFA 2FHCA 3IANA 1WDSA 2ZX5A 4JX6A 4CLMA 1JFHA 4E38A 4RNIA 3R0UA 4NNBA 4DWSB 2V5BA 3GZ3A 1R7AA 4U33A 3QV8A 2QUUA 1WX0A 3A21A 4ILSA 4AC1X 1FY6A 3LM7A 1ML1A 3MU7A 1XIDA 2VWTA 3ARPA 2WAGA 2HPIA 1S2WA 4GX9A 4XIAA 1KFJA 1UWAA 3W7PA 2QDEA 2DSZA 2NW0A 2QZRA 4HNTA 1QWGA 3TJIA 3CAVA 5T26A 3KZPA 3W29A 2FFIA 1W37A 3BV7A 3HG3A 1TV7A 2ZOXA 1FP9A 3M9YA 2W4XA 2A7RA 2EF9A 5ABFA 1FCBA 6REQA 2BGQA 4L4PA 1O5RA 3IRSA 3DAQA 4B3KA 2Z7GA 3NQCA 2WC7A 2RDTA 3M4HA 1LP6A 3KXQA 1SFLA 4M6VA 4FSAA 3SUVA 4NI8A 4ADUA 3SIZA 3W73A 3UR2A 1RJQA 1XFCA 2WC3A 3OOQA 3GH4A 3VKAA 1EP3A 4JIPA 4M19A 2G3NA 3L5MA 2NT1A 4CEUC 3HPFA 2PTYA 5E0FA 3PNUA 4DAFA 3MV11 1TV8A 2ZA3A 4UWMA 1SGJA 3PZ9A 4B3LA 3OGVA 4TVUA 3DYMA 3O7UA 5K7JA 4HT3A 4IJRA 2I5IA 2DJLA 3BLPX 1JPKA 1TQJA 5C7VA 5K4ZA 4GD0A 4AIOA 2QCMA 1LBFA 3L65A 4A29A 4AWSA 1SM9A 3B9AA 4FNQA 1RPKA 4DI8A 2F2HA 1GQJA 4I9JA 2E28A 3MDWA 3I68A 5HDRA 1TJ0A 1VPQA 1AA1B 1WE5A 5H91A 4YPJA 3POHA 1KFBA 3FGCB 3HJZA 3U2EA 3D46A 3H55A 2NV9A 4QISA 4XD6A 4B9ZA 2ZICA 2G4FA 3KM8A 1KRBC 4KRTA 1QHPA 3MCNA 4TX6A 5L6UA 5FL0A 2Z0IA 1WUFA 3U2ZA 3TC7A 1KCLA 4W7WA 5HNRA 3KTCA 1SUXA 4BEQA 5AC6A 3MY9A 3STGA 4GNKB 1UPMB 1G4SA 4G2DA 2HNHA 2WVUA 1K6WA 5AY7A 3GWQA 3GR4A 1NH6A 4V15A 4WEVX 1EGZA 5I7GA 3G1FA 3W2KA 2OEMA 3PULA 1H7OA 5T9BG 1NFPA 3KOFA 3MWCA 3A4XA 5K9XA 1AW5A 4RCXA 3DGBA 1XPGA 1TX2A 3WJWA 1E70M 1FWIC 1H5VA 5EPDA 5GVJA 4MWAE 1LQ2A 3E5PA 1H7WA 1KA9F 1JCLA 3CUGA 2BGSA 2CZFA 1CPUA 2NLYA 3EDDA 2XSAA 2WJZA 2AOSA 3UG8A 5JH2A 1M5WA 2YCJA 5G4EA 1E3XA 2FGBA 1UW9A 5G1YA 3RLUA 4KFNA 4UR9A 3DI0A 4LB4A 3KHJA 1EA0A 2PWEA 1WA3A 3DXIA 3GG1A 4DZ5A 1QPOA 1V0MA 4MMWA 2G5WA 3LM3A 3COTA 2PDBA 4Q6XA 4UQEA 4FA3A 4B4FA 2CZ5A 4HJFA 1H7XA 3BMWA 1VF8A 3UG4A 4NZ1A 4U3AA 4JTDA 2V2HA 2YBUA 3UY7A 4KFOA 4UTWA 3WG6A 5DBTA 1CGVA 4XQ6A 2J66A 2XYLA 2QLYA 3R6IA 1XV8A 4XSLA 3KHDA 3L5AA 2WWCA 2WQPA 2ALDA 1PKNA 4RR4A 4XIMA 3VX0A 2FPYA 3ENLA 1OZMA 3A13A 3WK0A 1CXLA 2OELA 2EXOA 3OLGA 3ABSA 3LGDA 3EA2A 4M7SA 4IJBA 4LV9A 4YHGA 4TU1A 2WZHA 1B3WA 1IT0A 2XISA 2A79A 3S2LA 5HULA 2WJEA 1I2NA 5AKQA 2HBXA 3G0SA 1HO1A 1PHQA 3DN5A 1SPQA 2ZUVA 1WBHA 1YPXA 3BDKA 1SO6A 2ZZ2A 4LJ3A 1E71M 3L0KA 3PSWA 1WAWA 2GGJA 1LG2A 3TK7A 2WMIA 3ME3A 3JU2A 4XZHA 2P5NA 1EJSC 5A6SA 2B81A 4KBXA 2C19A 1BSLA 4ROPA 3FDKA 4H2HA 3CZGA 3N18A 3PSVA 4X0VA 4XG1A 2ZRYA 4NU7A 1H41A 5M1TA 2ISVA 4RDZA 5F4SA 2CU0A 3UWZA 3BLOA 2R94A 2YR1A 3L4UA 3S8HA 3ZJ7A 1EPXA 2IPJA 4P8WA 1DXIA 3L4WA 4ACZB 2WM0A 4RJEA 3LV6A 2X2GA 1ITQA 4IIEA 3UBPC 3QY8A 5CPQA 3SN4A 1B9BA 1NFGA 1JCYA 3CAWA 3VGFA 3L4VA 4GX8A 3NQVA 1K03A 1P1MA 1K4GA 3DG3A 2QULA 4LWWA 2HCVA 4JS3A 4D6CA 2ISWA 4WHBA 1LJYA 2VFFA 3A3HA 4PBGA 4I7VA 3KLKA 5CJMA 1XW8A 4PCTA 3TYAA 3CASA 4JEJA 3V36A 1R3QA 5F2GA 4L5ZA 4IQEA 4J5NA 4P7LA 5HJLA 2XIJA 3OHIA 3BGAA 1HVXA 4E0CA 1TSIA 3N04A 1KR0A 1J9YA 4GQGA 3CQKA 4C5YA 1OYCA 4K37A 5EFFA 4W5UA 5H2ZA 3O6AA 4JYFA 3Q65A 3GNOA 2DT0A 3CXOA 1TTIA 2DSVA 2R1NA 3QBUA 2O7SA 1HUVA 2PZNA 3W7GA 4HOWA 1IEIA 4WKAA 1HL8A 3S1VA 3SFWA 1BTMA 4O1CA 2V2CA 4YN5A 3S5SA 3S83A 1W2VA 2IKJA 3B0VC 1T8XA 3CT7A 4LEQA 1ME9A 3WEMA 4MJZA 3ABOA 3LPOA 4KMQA 4AX7A 3I7RA 4TIMA 3HGRA 3P8JA 1VEOA 3UESA 1C8XA 5DN1A 1IV8A 3FKKA 1OFOA 3H2EA 5A6BD 3CIVA 4ZOBA 4US5A 1JYWA 1QBBA 4EPEC 1ONEA 4JFSA 1H60A 1ZJHA 3CV2A 3P61A 5D2TA 4JKMA 4Y7EA 1VEPA 1OX6A 2R24A 1PZ1A 4IGHA 3MCOA 3PY2A 2QCGA 2OX4A 4GIEA 1KTCA 3U8GA 5HINA 3TW9A 1KQZA 1VCFA 4EK7A 4GE8A 4FNTA 1UIPA 1QDSA 2VEIA 3KTSA 1MYRA 1VJZA 5A2CA 3N9KA 2GOUA 3MJMA 2GUYA 4ML9A 5H1WA 4PL2A 1CW2A 1DKWA 4AZ6A 4H6QA 3W1UA 4D71A 4L9XA 1HKVA 4LAOA 4UFIA 1F5ZA 4A8IA 3PWAA 4ERGA 4OKDA 1OD8A 3A23A 2AQVA 4M80A 3QV7A 4WDXA 1NM9A 4ZE4A 1GOKA 1WKYA 3TP4A 3ZJ8A 1K70A 3G8RA 3A6OA 3NGJA 4LS0A 3TQ0A 3GVQA 1EF3A 3BLIA 1XQLA 4ZO7A 1QNPA 3KBMA 2O9PA 4HTYA 2GFTA 5GNZA 4H9XA 3AZSA 2NQHA 1NDWA 2ZVIA 5IBXA 1XGZA 2G3FA 3A4AA 3CZLA 3LCIA 1GEQA 1YDNA 3A9IA 5E9XA 3VAVA 1WDWA 6PTDA 2OR2A 2E7FA 2AKMA 2P8CA 2O56A 2CETA 1GKPA 1M7JA 4GVFA 2H8ZA 2VOMA 3NVTA 3S5YA 1L2UA 1OFEA 5CBIA 3HM7A 3OVPA 4DPQA 4Q8NA 4ZMGA 5KTLA 1UJPA 3H2MA 3AISA 3O15A 4XKMA 1POKA 1VBUA 3VZYA 2BS9A 3MKCA 3GXNA 1QWKA 2HSAA 5RUBA 3GXTA 3TTEA 4M6QA 4YVXA 2GJXA 1KFLA 4E6MA 4IPIA 2V5JA 1AQHA 3S2JA 4AHPA 1ONWA 1UD3A 3NQ7A 5A6TC 3T2PA 1XJBA 1FHLA 3WBEA 2PDLA 3GFZA 3LBMA 1R6WA 2IS7A 5LGXA 1TTJA 4W88A 5FIPA 1JG9A 2OYKA 3VD7A 4NKCA 4O1BA 3NQMA 3ONBA 1B54A 4YHEA 3MMTA 4ZVJA 3R25A 3UXLA 2MUCA 3E0IA 2Y7DA 1IT8A 1TZZA 2BG5A 4G7FA 2Q09A 2QPSA 3BO9A 2PDHA 1LOQA 3QVQA 1AUSL 3R7MA 2F61A 3QOKA 5DF0A 4H8HA 4JTIA 1EX5A 1MW2A 1S3HA 3NXFA 4MM1A 1XF0A 2E8ZA 4Q8PA 3AC0A 4UMBA 2A5HA 1T99A 2CBIA 3FW6A 1OSEA 4C90A 2OZ3A 2VZUA 1I9CB 2ZRUA 4A8LA 3A3XA 1UASA 1AVAA 3MHGA 5FJRA 3OA5A 1CGYA 5HNTA 4ATDA 3CL8A 1KQYA 4JCLA 4Y9NA 2D3NA 4UNIA 1IE7C 1QT1A 4LCSA 1V7YA 4S2BA 4Z0SA 3HG5A 3W9ZA 4PUKA 3ZWTA 3FJLA 2QEZA 5M03A 3NSXA 4IPPA 1WUEA 1LWJA 4H01A 4RXFA 5A6AA 3QQ1A 4J3TA 1EIXA 3C0SA 4DUOA 4S3CA 1Q6RA 4LOCA 2VCCA 4JTKA 3U9IA 1ISYA 3F4WA 3VPLA 1FWBC 2XTKA 4JFWA 4EPBC 3LTSA 4DUWA 1C9WA 3F7JA 1S2VA 2BHZA 3QC0A 2DGAA 4FI4A 3DFNA 3K8MA 1JCJA 2CXGA 4Q4PA 3BOXA 2BWGA 1LG1A 2C1HA 2ASHA 3R0DA 4JDBA 5U7SA 4R7JA 4O1DA 1WQ5A 3K4DA 4IMFA 3QMRA 1OYBA 2Z1BA 4FS9A 3APTA 4YTRA 7A3HA 3MSRA 2YCKX 5EA9A 5CSYA 2BNJA 1R87A 1OC7A 1TO3A 3VDBA 1VLIA 4CN1A 4H9MA 3FVMA 3OW1A 3QPYA 4CU8A 1KFKA 3UW6A 2A3BA 3SCVA 3RR1A 1W3LA 4GI9A 4IPLA 1HKWA 1UP2A 5BRQA 3BSGA 4R85A 3VNIA 3DOPA 4S23A 4O11A 1HJWA 3E2VA 3KP1A 5H8UA 2R1KA 4K8HA 3F1QA 4Z2JA 2E9MA 1EOMA 4GI4A 3UJEA 3VCCA 8A3HA 3VD5A 2WVTA 3AWOA 1FWRA 1PJ9A 3FX4A 1B30A 2Z00A 4LCQA 1X1OA 1DP0A 2Z26A 2ZDRA 5AHIA 4KEZA 1VLWA 2D24A 4XV0A 4C6LA 1TPUA 4FOJA 1BVWA 2GQAA 4F0LA 2B7OA 4YNGA 4F9JA 3L0GA 1SW3A 5GJMA 1REQA 1E1CA 4PMUA 3SGGA 2Z4GA 5U4NA 4B15A 5FSDC 1PE1A 1IZJA 3DFYA 5CBBA 2BFGA 4QQ3A 3TX9A 1XUUA 3B04A 4HU0A 1F3TA 1WPCA 1KFEA 3CV7A 2ZXBA 4DJFC 3CHEA 4D2JA 1W1ZA 3UWYA 4HK5A 3EKLA 4HNNA 1GOXA 4RV8A 3MYPA 4IM4A 4RPPA 3ZR6A 2EHHA 1GJWA 4C1KA 3TFCA 1FKXA 4L6OA 2YB1A 4XVDA 4XBKA 3GIPA 2PWGA 2E40A 2ZUNA 5DCDA 5LIYX 5G1TA 2O55A 4WRHA 3ZJKA 1UC4A 4IFKB 3PZQA 1B5TA 3LENA 3IACA 4JTEA 2J9YA 3BAXA 2OFJA 3LLXA 1JDDA 4ZSTA 4U2YA 3WK1A 2VR4A 1TQXA 5DCBA 5FI8A 1UR1A 4F2TA 3M43A 2V81A 4XVEA 2H3BA 5A3HA 2DH3A 4PE8A 3FAWA 4UTLA 2A0NA 4KGLA 3IGUA 4KPLA 3K46A 3G1HA 1HJQA 4HNLA 2FTYA 1NY1A 4GY0A 1W1A1 3BAIA 2BX7A 1A5AA 1M01A 4FX7A 1S5NA 1P0KA 4UOZA 1PVNA 4OT7A 3S9IA 4FLSA 1J0HA 1IEVA 4DN1A 1J01A 3VM7A 2D0GA 4LC8A 2YL5A 1G01A 2JKAA 1CIUA 1XPYA 2QV5A 4QRNA 1MNSA 1B9ZA 1N82A 3QN3A 3QTPA 4ZOAA 1V03A 3E49A 3LD5A 3EX3A 4NXKA 3NQBA 2YXGA 5CC7A 3VNLA 4Q8QA 2W62A 4GLEA 4I7UA 4R7OA 2H9AB 1HZYA 5GNYA 3DECA 4AAJA 4XK2A 1US3A 3F4DA 2PB1A 4UTKA 6TIMA 1US2A 2V2DA 3T4CA 4BI6A 1Z32X 1LLOA 3CUXA 4C6PA 1KGWA 4O50A 1IYXA 3R8HA 3UGVA 3OLDA 3EMQA 1NWSA 1AL7A 3H7VA 4MWAD 5AZ1A 4AD2A 1AZ1A 2RJGA 4NNCA 4YTQA 3ARTA 2G96A 1NP2A 3TTYA 1RA5A 4ZTXA 4UUIA 4JN6A 3KWSA 4PUWA 4NX0A 5CPMA 4C6QA 1FXQA 5I3IA 2W66A 1JD9A 1XKJA 3M6DA 3KS6A 2VEFA 2R8WA 1YNPA 1K7XA 2X1RA 2Y63A 2DIEA 1RLCL 3H54A 3ORWA 3WQFA 4ZQCA 1JYXA 2Y61A 2J62A 1ME8A 3UR7A 3AOFA 4B5UA 4KFPA 1V6TA 2NQ5A 4CU7A 5GNXA 1E15A 5DELA 5HWMA 3I3DA 3SQSA 5TD4A 4EPDC 4NG3A 5CSUA 2ACSA 4I8DA 3RX3A 5EU9A 4BI5A 3LHZA 4Y9AA 2EAWA 2XN2A 4IUOA 4NASA 4BK9A 1J79A 4RE2A 4Y8FA 1H0GA 3GG7A 4S3KA 4FR1A 2BSLA 3GIYA 3FCPA 2J47A 4NZFA 2WQDA 1KM6A 3PPCA 1DWHM 4QS5A 4AVFA 3AFBA 4R34A 3EX4A 3FA4A 3WJSA 5DX7A 4LYQA 3NURA 1KW1A 3GNDA 1ZGDA 3WK3A 1JFXA 3W1RA 2IUZA 1SQ7A 7XIMA 3PFRA 1W9VA 3I4KA 2B7NA 4CUCA 2RHGA 1K9DA 2V3DA 1Q66A 1E3ZA 4R88A 4PODA 2YB4A 4QE4A 1EA9C 2Q6ZA 1CI1A 2X2YA 5CPNA 3T0CA 3UVAA 2ZUMA 4DO5A 1WDRA 4DB7A 3HPXA 2CHNA 4AU0A 3WLJA 1VFSA 1NDYA 4QBXA 1J10A 3C5QA 1W5PA 3GB6A 1KV5A 1CEOA 5CC5A 2IXVA 1VP5A 3H22A 3TSMA 3EOUA 4H2CA 1EHAA 3PP7A 2F38A 1VBHA 2Y7EA 4WKHA 3CLWA 1M3UA 5FJJA 4LU0A 5F2MA 3TLQA 3W28A 4J35A 3QY7A 3L0NA 3HGOA 2PWFA 5E0KA 2YBVA 4LANA 5AVNA 5IXEA 4MAZA 2J24A 5L9FA 3RPTA 4IMEA 1XDLA 1V6UA 3ALFA 4IQDA 3L4TA 3UWQA 4G6CA 2PPGA 4OQVA 1LORA 1W9BM 1P6BA 1XYCA 3PM6A 1O12A 2BASA 1JCMP 2FYMA 3GD6A 1J2BA 3NZGA 5KZ6A 3W7HA 4BZYA 2Y88A 4HSNA 4H9TA 1W2PA 2GGGA 3NL5A 1E4MM 3ABQA 4AY8A 1YADA 5FACA 3EYPA 1E43A 4Q8TA 1TA3A 1QCWA 4PTDA 5LIXX 2VC9A 1L6GA 1TV4A 1ZLPA 1RJPA 1EC7A 2BBFA 3MSYA 1DQXA 3MUY1 1GWJA 4LAZA 1EXBA 3GNPA 4NUWA 4IFOA 3DFQA 4B5VA 3E74A 4AEFA 4BQ3A 2FMNA 3TUUA 1Z7AA 1NP0A 1XLDA 3CUIA 4DF0A 4QLJA 3IIXA 2YKKA 1XDJA 1XRTA 4LVDA 3QY6A 1F3XA 4DX3A 4GUHA 4W5ZA 1TFVA 1XISA 4P7RA 4O13A 2ONEA 4O1AA 4QM1A 3AMLA 5JBEA 4HOZA 4KRUA 3W7RA 2BLEA 2AAAA 2WVVB 3W25A 3ZWSA 2CKSA 4DHGA 4CQBA 3ANYA 1KCZA 5C8BB 2PA6A 3QZEA 1UUMA 2OT0A 4FX6M 3VDCA 4OHQA 1K1DA 3WYZA 2GDQA 1TKKA 1E56A 1KGXA 8XIAA 4H4IA 1W56A 3TLLA 2YJQA 5H6HA 1OFAA 1XIGA 3SBFA 2CC0A 1A50A 3WH6A 1GZGA 1V79A 3G6LA 1W17A 1XCWA 3SADA 4UFKA 2W61A 5D9PA 4FLQA 3THCA 1B2YA 2YLAA 1DYSA 1VBJA 4C6CA 4GIAA 3F2CA 1S1RA 4FNSA 3LUTA 3DBNA 1WCGA 1R7OA 1KRCC 3S1WA 3KL0A 3QGKC 3ITXA 3PWIA 1XD0A 7REQA 4MWAC 1L6YA 1RVGA 3AIBA 4KWVA 1EGMA 4LAUA 2ZBTA 4OUEA 5CQ1A 3ES7A 2FHFA 3ISIX 4E4FA 1VD6A 3HTWA 2CLLA 1BRLB 3LNMA 4WIWA 2QVHA 3T0AA 4Y2WA 4AB4A 2PDYA 2XVNA 1BGGA 1IR1A 4XBSA 3H2FA 1DWFM 2JEQA 2P3EA 3PTDA 4LY8A 4RUBA 1OZQA 1UR8A 3TYBA 1OG6A 4OFCA 5DY3A 3MP3A 2JQXA 4DRSA 1Z89A 1FWFC 2FTWA 3AHTA 4B2DA 3ZZ1A 2WJFA 1J0ZA 1EC9A 4WD0A 2GSEA 4MF4A 1E6RA 4GFSA 1TG7A 3KFTA 2JFEX 4XD5A 1DOSA 3W2LA 3VZXA 3W7CA 1Q63A 4P5UA 3QGVA 3MWAA 3WMBA 4WDTA 1V0LA 5CEWA 4HTBA 3OLIA 3KUMA 4MYAA 3SECA 1SO5A 2Y5JA 3DFOA 3CL7A 3GUGA 3OZPA 2ON3A 4HPGA 1OJXA 1BSIA 3QR1A 4J3XA 4GBDA 3W75A 5TBOA 2WVSA 3AZRA 2NQJA 5CAKA 5F4WA 4NP7A 1W54A 4FNUA 3MI2A 4QG8A 4JR5A 3B06A 1YBQA 4PB4A 3E3HA 2Q3OA 1S46A 4PCPA 3PZVA 3CV6A 1YPFA 4YU1A 5BXSA 3M6YA 1KBKA 1UKPA 1IIGA 4O57A 5AC4A 3FA3A 4E3TA 1WDDA 1CGWA 1JYNA 2CBVA 4GIRA 4MDPA 3V18A 1EZWA 4ZOEA 2ABBA 4HPHA 2QCCA 5A8GA 5BXPA 1B3OA 1UWUA 1KRAC 2BOGX 3G1DA 5CKSA 3TQKA 2PTDA 3UNTA 2B7QA 3NVDA 4ZA0A 5T8GA 4RE0A 1OWQA 1V08A 2OSWA 3RILA 3RITA 4X2PA 3RMEA 3SQMA 4WLCA 1XI3A 4RKAA 3T8QA 2DSKA 3ZLFA 2E68A 1XHGA 1JPIA 4WDWA 3WKZA 4CKQA 1MZHA 4DBWA 5M17A 3AIUA 1I2PA 1GOQA 4L6HA 3OLEA 1EF2A 2VVNA 4DZIA 2LLEA 3S9YA 2PDKA 4LUTB 2EG6A 1VYSX 3WEZA 2XU2A 3L4YA 4QSHA 5G5IA 2GYIA 3SM0A 2IKGA 2RGMA 4WQ6A 1YXDA 2GVGA 3QW4B 1IEXA 4UR8A 1TMHA 5BRBA 3AI0A 1S38A 5GQBA 1BD0A 3O9NA 2GSHA 3TJLA 1V5XA 1H51A 4D72A 2OGYA 3AICA 1GJPA 4AVNA 3FEMA 1Z6KA 5F4XA 2OOGA 5FF7A 4LRSA 4HU4A 4IIBA 1V3JA 4HZ8A 4NRSA 4ZODA 4H83A 4AWUA 1KKRA 3TE9A 3PWGA 2Z1WA 5J8LA 2J8GA 3TJXA 2AMXA 1FH7A 3B0YA 2FIQA 4UTUA 4V2XA 4CNUA 3GTNA 1GG1A 1Q8JA 5CJNA 4HPJA 5ABEA 1B57A 1K3UA 1YNQA 3VKDA 3ITGA 1DJNA 2NV1A 2DVTA 2D2HA 4GWEA 1W1TA 3LGGA 4LVBA 1THFD 2CEQA 5AYBA 4ERIA 4DJFA 4FP1A 3VIGA 1LOLA 1TPFA 2HK0A 1JL8A 4LRTA 1QPRA 2FGZA 5KSWA 2F7FA 2DVXA 4ALDA 2JKPA 1OCJA 2QMJA 4XZLX 3F03K 1MNZA 4RZ5A 1HT6A 1OHLA 3WNOA 1M7OA 1I2QA 1DIOA 3IJ9A 3KVLA 2ZTJA 3WFLA 4KWWA 1FVPA 5CGQA 3WLNA 4QG9A 2W79A 2PRMA 2GQ9A 1E6XM 4MZ8A 3MP4A 3B03A 1AMKA 3B8VA 3H7UA 3KX6A 3DH7A 3G3MA 3HQ1A 1V02A 1AFSA 4JCMA 2HE8A 1KCXA 3KOXA 3L2LA 4ACYA 3RPMA 4CGTA 2VFGA 1O7AA 1N8IA 3OQ8A 3BXWA 1QI2A 1VB9A 4O8RA 3G1YA 4HB7A 3E1F1 3WLKX 2V3FA 1SZEA 2VRJA 5F1VA 1UKOA 5DEZA 1DQWA 1ICQA 4NYYA 3DZ1A 1J6OA 1B0IA 1U1HA 3EGJA 3VILA 4JNMA 4H9YA 3SSZA 4P8UA 1NVMA 4AD5A 1QO2A 4PULA 1MZRA 2JIWA 3TXZA 1OFRA 4H8NA 3UJ2A 4OVXA 1VJIA 3VOIA 4MUPA 5GPRA 4OJYA 2G4JA 3C4UA 2SFPA 2F2KA 4OOZA 4GXPA 3NPVA 2VFDA 2OGJA 1NU5A 1EWDA 3MVTA 1PEZA 2QJNA 4AXNA 4ZQOA 2G0WA 3EXRA 5BMXA 3LCWA 3LX9A 3B0PA 2VXNA 3GW0A 1KM1A 4J4KA 1UKTA 3ARYA 3EOLA 1JRBA 4ZQMA 2CLPA 1WXJA 4DJDA 3B3DA 3CH9A 2Q71A 5BW6A 2F9RA 1LZOA 2PP0A 1UBSA 4R9OA 4DPPA 1VFHA 2W63A 2WM1A 4JDYA 5IOBA 3TKFA 3SCWA 2E6DA 3WQPA 2V8ZA 4MPQA 3NYZA 3R5EA 4NIRA 3WDPP 4FXSA 1KCKA 2VFHA 4CNPA 1UR3M 1H1NA 4LUJA 5C9RA 4FX8A 1POJA 4PSPA 3JUGA 1J5SA 2OZ8A 3GXFA 1HX0A 4DWSA 1H63A 4E5TA 2YA2A 5DRIA 4RV3A 3KBWA 1KM5A 2UZ9A 4N2YA 4W86A 3FLUA 2CLKA 1CTNA 1E6ZA 3FYYA 3CQHA 1RALA 2WNNA 4GVGA 4GO8A 1FQ0A 3M64A 5ABTA 3O07A 1VC4A 5C6MA 4XAFA 1S2CA 1RY8A 3LMZA 3OTRA 3C0JA 1Z41A 4A05A 4PCFA 5A6KA 1JZ8A 2OWXA 4DO4A 2P3ZA 5FF4A 4S1FA 1S5TA 3KBJA 3LZ5A 4E2BA 4W7UA 5CG7A 2X1UA 2PLCA 2A3AA 3C3NA 2XIBA 3WDJA 2EPNA 2Q8XA 4XO6A 2J8TA 1E0UA 1XYLA 4EXAA 3LCXA 3ZLHA 1UB3A 4GQBA 2MNRA 3B9EA 1DPMA 2Z6IA 3KBSA 5TQLA 1VH7A 5DRCA 3W1XA 4HHMA 3U5YA 1UWRA 1J0IA 1N2VA 1MVYA 1ZBWA 3O0FA 4GMEA 3TTOA 1LLWA 5AYYA 3G1RA 3F5KA 3TNOA 1FWGC 1NWTA 4PMOA 1TIWA 4LF1A 3SRDA 2E8YA 2YZ5A 1CXFA 4W8LA 5HANA 1XSKA 1W32A 4HZMA 4KH2A 2EBNA 2ZA2A 3AMKA 5CH9A 3G22A 1K9TA 3RGTA 4B5XA 2WSKA 2QS8A 3MTWA 2QAPA 3MSGA 5LKYA 3EXSA 3SY1A 2WZIA 3PTKA 3DFSA 3GDKA 1RVKA 3MUAA 1DJYA 1T96A 5E09A 2Q8LA 2WMHA 5C0QA 3PJTA 1OX4B 3VKJA 2GSJA 3CQIA 5KINA 1VJSA 2NUYA 3B4YA 1LL4A 4O17A 2WMJA 5ABHA 2VNCA 3ZR4A 1W9PA 3SCPA 1GVIA 1U5VA 2PD9A 1Q5MA 4KEMA 1EYEA 2EPMX 1U2YA 3WNNA 4Q32A 3PBVA 3WELA 4XAZA 1RR2A 1GNXA 2A85A 4M8UA 1CGTA 4WCJA 3IIZA 9XIMA 4N0RA 4XBJA 3ELFA 3NO1A 4Y9OA 2WANA 3OBEA 3VMOA 4TX9A 1CNVA 1U30A 3IUIA 3TEVA 1PWLA 1IEQA 2QCDA 4OOUA 2AKZA 5C9WA 4CNSA 1SJDA 1ZJAA 4FF7A 3OIXA 1PUDA 3VGGA 3QLDA 2OPJA 3VE7A 4UB9A 4NXSA 2A1YA 3ARRA 4JIHA 4IIFA 4PR4A 3VNMA 4NZCA 2X1TA 2QCNA 4W84A 5FD0A 5FAJA 1PPIA 3M0VA 3UR8A 1XIEA 3IK2A 3GX9A 2WJDA 2Y8KA 3POCA 4GUGA 1W9UA 1EUAA 3B8UA 4DAIA 1W31A 1E5JA 1PIGA 2RGLA 4GYJA 4ZOCA 1KXVA 4Q4OA 1ELSA 1E73M 5A2AA 5M3WA 3M1ZA 1K9FA 4C1NB 1TR1A 4MY8A 4FZIA 2PDFA 3RF9A 5AOUA 3QH2A 3NOYA 1AD4A 1D3CA 1A4LA 2DUAA 1S5VA 4DXXA 4E2VA 1TJPA 4ORIA 3ZSTA 1DJXA 2BVTA 3AMCA 4TMBA 2DW6A 4E8CA 5C2GA 1ZRQA 1E9LA 3EOOA 3URNA 2QAFA 2XH7A 3B0UX 1NTHA 5CZ0A 1OFPA 4QDPA 3G1SA 2QKFA 2VGIA 3WQEA 3DFHA 3BE7A 2NSOA 1RJRA 2XHYA 8CGTA 1EO5A 4ZXLA 3GZAA 4PGLA 4I5UA 3MO4A 1XRVA 5D4YA 4NSBA 3ZVHB 1O6IA 4US5D 2V67A 1DJWA 2C14A 1QRQA 2Y85A 4BR1A 2EPKX 3BJSA 4GOAA 3GHSA 3CT2A 4MJ2A 4GZJA 3E02A 5HMSA 2QGHA 3HA1A 3NGFA 3UZZA 4FO4A 3NSMA 1H3GA 3USZA 1WP6A 1EDGA 3R8GA 4DF2A 1K7EA 2VDIA 4A8RA 2CFFA 3B05A 3NZRA 4XO7A 1YDVA 1EDQA 3TOPA 1JYVA 4NL1A 3WL1A 3ZOAA 3M46A 1HKIA 3BMVA 3MV01 4L80A 5DQPA 2HVOA 1PB0A 4OUIA 5XINA 3SI9A 1D8WA 4D6FA 4XZNX 4MB3A 1EJXC 4RNFA 4EAYA 3S42A 3VO0A 3ZVIA 3RUBL 1A3WA 3EX1A 2DSUA 1SFTA 3LXCA 5KMYA 1YNYA 4XWUA 3VGEA 3UEQA 4NJGA 3B8IA 4KQNA 2QJMA 3VDGA 1OFDA 2Y8VA 1K02A 2YOCA 4O4VA 5BXRA 4KEVA 1V6YA 2XH0A 3SFKA 3TA6A 1RP8A 4FHAA 1T5AA 4X61A 2YBTA 1FWTA 3HJEA 1TELA 4YS1A 5KZDA 2PBOA 3OGSA 3VGBA 3W83A 1OINA 1OCQA 1E9YB 3LLDA 1YTKA 1BYAA 3OBAA 2J25A 1J6PA 4PMNA 3E96A 1TVLA 1LT8A 5LNSA 4Q33A 4JBRA 1PTAA 4PZVA 3W53A 2I1OA 2VI0A 4RLIA 3GIQA 4AWEA 1KBBA 1UWIA 1FWHC 2V69A 2ZQ0A 4UQCA 2OYLA 3PNZA 1AH0A 3VYLA 1X97A 1ZENA 5D09A 3P14A 1YE4A 1QI3A 4YMZA 3XINA 1RQHA 1FOBA 3WK2A 2DV0A 1R9XA 2Z1SA 3K13A 2Y8UA 4Q4KA 1XP3A 2V63A 3ICJA 4BJHA 3HF3A 1LL7A 3O0KA 2QIIA 2J7DA 3KOZA 3W7LA 1W5NA 3LERA 3C8NA 2X16A 2R1PA 2CZEA 3PTQA 1PX4A 1JPHA 1D2KA 4URIA 2QCHA 1HN1A 3TR9A 2XVLA 2NT0A 4KF1A 4N7QA 3PTMA 4Q7NA 3NM3A 3WH8A 3M0XA 2XIOA 1GEHA 3PC0A 3AYVA 1ZBVA 1WDQA 3MPGA 3PANA 3T9PA 2ATSA 2CIPA 3THDA 2BGNE 4EAMA 3RMJA 3N9SA 4F4RA 1XC4A 2WBGA 4MAVA 1GKQA 4BF7A 4GZ7A 2OKTA 2I5GA 3GY1A 2B0MA 2DIKA 4LBUA 1PDZA 5A8MA 4B9YA 1G67A 1ALDA 1VHNA 4D6IA 3N4FA 1C8YA 1DJZA 4EF9A 2PU1A 1K6AA 3VC5A 1OEPA 1PX3A 1K8CA 1YLVA 4DIAA 2ZCGA 2WLZA 2QJJA 3H2OA 1E40A 1XYMA 2KX9A 1SSDA 1OYAA 9XIAA 1IT7A 4HPNA 5K2ZA 1GOIA 5HQLA 4NAEB 1EBGA 4GY1A 4B5TA 2PU0A 2X42A 4MB4A 4TV6A 3UG5A 3A22A 4C1LA 3W7KA 2DP3A 5AFDA 3BVJA 1HKMA 3LPFA 1W1PA 4JFTA 4Q6JA 3AIVA 3VU2A 2Y5EA 2X1SA 4PTWA 4CD7A 1XUZA 1HKKA 4CD8A 5HWJA 5B7YA 4G7EA 3NQ2A 3WDIA 3MHUA 1J11A 1XIIA 1X6UA 2CWXA 4Q7IA 1R3TA 1RUSA 4C5ZA 2R1LA 4Q8VA 3FNDA 2BVYA 3NSNA 2WSPA 5I03A 1E1EA 2CBJA 3GS6A 4K2SA 3O63A 4GG9A 1UP0A 2GLKA 4LS2A 3PF3A 3THQA 2J4GA 3OG3A 3TDFA 4GH3A 3URAA 1UZDA 4UCFA 3E0WA 2AL2B 4LH8A 1CWYA 1JNDA 3UCQA 3PZNA 3L21A 4ONVA 4UFHA 2PGFA 3S46A 1E51A 1VRDA 3BLDA 3C6CA 3THAA 4J3VA 1MW1A 4DBDA 3SRFA 3WUGA 2X0HA 4QJ3B 2X0YA 3ZFHA 3OGRA 1OT1A 3PBGA 3TSDA 3NZ1A 1HGYA 4K38A 1A5SA 3FXGA 4AZCA 5D9OA 4N02A 3M0HA 4AH7A 3HQOA 3CTLA 3K30A 5AHNA 1EL3A 1A0CA 3FAXA 1VYPX 2WXDM 4B4HA 5IHRA 4ORMA 1UH4A 3M0IA 1Q85A 4J3SA 3DHUA 4HP5A 5JVLA 4AEEA 4IGSA 1UH3A 2VRKA 3ID7A 3A5VA 2BHYA 3VA8A 5E93A 3H12A 2XG9A 1WZAA 1MUWA 2NUXA 1JIBA 4C6FA 1W3KA 2I57A 3EB4A 2VL4A 3UP8A 4KGJA 2NVCA 1G9HA 2ZC1A 4K68A 3RO6A 3ABXA 1M03A 1M1BA 1SU5A 1WDPA 4GKTA 2ODOA 1EIBA 3E0LA 4OE7A 4J9JA 3CIXA 2Z2BA 4NF7A 2F6XA 4ZFMA 2XJ7A 1KFCA 4IFRA 2VT0A 2E4TA 1V02E 1VQTA 4UNKA 2ZRXA 3PPHA 3SCQA 3C2YA 5FEPA 2QDDA 4IJCA 5CBJA 3NWRA 1EX1A 2WZTA 1G4PA 1FFQA 3CQJA 5GJNA 2WNQA 3IIVA 4GQ0A 2E1DA 2RJHA 4Z2KA 4AYGA 5J5DA 3TXVA 5CZSA 1DHKA 3FSUA 5FEWA 1R2TA 3AIWA 3P5YA 2J7CA 4LF2A 3VABA 2PGRA 3TN3A 4GNJA 2ZWYA 1XXXA 2HV5A 1E9IA 1XG3A 3VOCA 3WF4A 1OK4A 3WSUA 1TPB1 1QPNA 4HU3A 5LXEA 3KRBA 3PJWA 3N25A 1DVJA 3IAPA 3W7IA 4HA1A 3HOJA 1KB3A 2AQOA 1ISWA 1XD1A 3VIIA 5M5DA 3CM4A 2HK1A 4KESA 1UCWA 3R1ZA 4JTLA 3WO8A 4UMAA 3FKRA 4IP5A 3MKKA 3B4UA 2VMFA 3KP0A 4GRSA 2C1IA 3L66A 4DZAA 5D04C 4N6EA 3AJXA 3UY8A 1J0JA 3S47A 1FA2A 2OQLA 3QFEA 4WF7A 1KNWA 1P0NA 4D6JA 1V77A 1BG4A 3DKJA 3WLSA 3QSRA 5EMYA 4MTVA 1M7XA 3W87A 4IZGA 2E25A 3A47A 1GOMA 5IHSA 2OZ0A 4PYSA 2HJPA 2YGYA 3EMZA 3SGUA 4GCAA 3RJYA 1Z9AA 4M3PA 4B5WA 1UH2A 3CPUA 5DFAA 3ZXWA 3T08A 4GVHA 3MDUA 4KT2A 3M44A 2QJIA 4LX4A 4Q4SA 3HPSA 3BCFA 2Y24A 2ZX8A 1OX5A 2PWVA 4YJ5A 4PFHA 4PUDA 4I9AA 1UMLA 5MKGB 1HP4A 3ARVA 3WUFA 4AXKA 2J7BA 1QNSA 3GVVA 3FHQA 3TC3A 2XFWA 3NEHA 1ZBCA 4AZ5A 2E3ZA 1VS1A 4HHLA 3U0HA 4OU1A 2W67A 3UETA 3QQ0A 3PAOA 4HKPA 5ABGA 2D0FA 3HG4A 3WBWA 3Q94A 4D6HA 1J4EA 4CCEA 2CKRA 3NEVA 4N4QA 1ZP4A 5BROA 4E2DA 4DLMA 2NVAA 4UQBA 5AB3A 3GO2A 4QR6A 1ZCCA 4HA3A 3P3BA 1ICPA 4PH6A 4KIRA 1GW9A 4V33A 4C6DA 3BAYA 4PUEA 3H26A 5FJTA 1PCKA 4Q4MA 2E6FA 4Q8MA 3W27A 3HGJA 4AY7A 1NELA 1XLKA 3UCCA 4IUGA 2OLSA 4JNZA 4A8NA 4CNTA 4XX6A 1GZ1A 2YXXA 4FR6A 1F2JA 3INPA 2JGYA 2ZUUA 1JAKA 2FVKA 4AG0A 3TW6A 3ZT7A 3OBKA 1YYAA 2Q3RA 3NQEA 1LDCA 1IGWA 3BGJA 2JIEA 3VIPA 3WJXA 3RX2A 1FCQA 2YW4A 2RUSA 2J79A 2ANUA 3CMJA 3LLFA 3W7MA 3G1XA 3N73A 5CPLA 4ATWA 2C79A 1OG0A 2DIJA 1Q6OA 5D2XA 1Q65A 3YPIA 2DZUA 3AS1A 2INZA 1QI4A 1TZ7A 4IMAA 1UROA 3EB3A 3AHYA 2C1GA 1FWCC 2CLHA 3LQLA 1ZCOA 3GTHA 3JW7A 1P48A 4XKYB 1VAHA 4LW7A 2VHLA 1EEXA 1SJCA 5DO8A 3ITVA 2CYGA 4GC4A 4HMCA 3AU2A 1R30A 1TWSA 1E4LA 2TRSA 3RN6A 1EJRC 4JN7A 4GJ1A 3N2CA 3SW6A 1AZ2A 3HFTA 1WZMA 1PO9A 5HATA 1X96A 5D30A 3GDTA 1ICSA 3GC4A 1SSGA 1F6KA 1RP9A 3M5YA 2DVUA 4O12A 5BRPA 1T8QA 3ARQA 4IL2A 2OSXA 3DESA 1REQB 1E1CB 1TMQA 2H3DA 3NG3A 3CYJA 2UY5A 3B8SA 1ESWA 4ML4A 1VHCA 1DTUA 1UP3A 3H4GA 1XLHA 4ZQPA 3AUOA 1CBGA 1PS9A 1ZNNA 2UY4A 3CWNA 1OC5A 2Y7FA 3BW2A 3B8TA 1N55A 2EPOA 1Q6LA 4LYRA 2VURA 2WMGA 7ODCA 1FCVA 1RQEA 3EZ4A 4AEOA 3EOSA 2PDUA 3VFCA 2A7NA 4IIHA 1OY0A 3U2CA 2IPFA 5D2VA 1Q6EA 1RZMA 4IQLA 1OC6A 3BLFA 1ZUAX 3ALGA 1HO4A 3P5ZA 1GYLA 3UCDA 4XZIA 5D38A 3E9AA 1P0DA 2X7VA 4WK9A 1UR9A 2O9TA 3UWWA 4GABA 2XN0A 2IPGA 2TODA 3NNTA 1I2OA 5LA1A 4HSOA 4A2SA 3DHPA 3AIRA 2YZRA 4X0NA 1S1PA 2ZZ3A 5B80A 3L2MA 3E38A 1ONRA 1ZS2A 4NZ5A 3IGHX 3K1GA 1OCNA 3PZTA 1GVFA 2CITA 3G6MA 4DO7A 3LI0A 4HMEA 2RDXA 3WMCA 3U57A 4ZL1A 2PCQA 3UZYA 1GVQA 4AD0A 1QW7A 1AJ0A 4GYPC 1BF2A 1CXHA 2HNEA 4A2RA 2A3HA 1UMYA 2KZHA 5AHFA 3O06A 4EACA 1NAL1 1W1IE 4K8GA 4TOQA 5TNVA 4DNHA 1NOWA 1KBJA 1WNOA 1WYIA 3UT0A 2EG7A 3NCOA 3LBOA 1KBIA 4HNCA 4RE3A 3UWUA 5TIMA 4CQ8A 1T40A 4O53A 2XM2A 4DYEA 5J04A 4U31A 2Y2WA 4O0QA 4B2DD 1AQMA 3J7HA 4RW5A 4M7TA 5AC5A 1VRXA 2CXEA 3L4XA 2PURA 1NDVA 3HN3A 4NJKA 4LFYA 3M0MA 1GK8A 1TTPA 3TAOA 1QI5A 3TYCA 4N6FA 4G9PA 2NWRA 4WVXA 1O95A 3CK5A 3E0FA 3CH0A 2PDNA 1GQNA 3LCLA 1ZP3A 3VTRA 1N7KA 5TAOA 3LS9A 3C61A 5CPTA 3K2GA 2PTXA 2HQAA 1ECQA 3GFYA 4H04A 2OJPA 1GYNA 4NYUA 2VD9A 4I3GA 1BLIA 2BY1A 2WYSA 3QJAA 2WW5A 5EFDA 4HCLA 3EKGA 4EE9A 2Y62A 2WVVA 1FWEC 1XX1A 3SN0A 2J7EA 1R8LA 3AXIA 2XIMA 3PJXA 3LSBA 3QKZA 4Y90A 2YDSA 3KEHA 3QV6A 1AQ0A 1JGMA 1M9HA 1IEWA 3RNDA 2CHRA 3LSCA 3UJSA 3WCZA 3RFAA 5SWUA 4L4LA 3W00A 3RPDA 1G6CA 4N9EA 2O4MA 1ZAIA 3PB0A 1AW1A 3K8LA 4F0RA 3Q45A 1FFRA 4WUIA 1QAPA 2GOKA 2XIQA 2D73A 1CYGA 3LCFA 4HMNA 3EXTA 3L7RA 2VEMA 4QAIA 4OV9A 3REQB 3DERA 1UWQA 4KWOA 3WLPA 3R89A 3WQWA 4FXJA 3TQVA 1M7PA 2RH9A 1QW8A 2VQTA 1IWAA 4WJXA 5TF0A 1PX8A 4CQ9A 4C6OA 3LPGA 4X22A 3UXKA 2DH2A 1FDZA 4M0XA 4XZWA 3EKZA 3MUIA 3W1QA 4JIIX 4QHRA 5D8WA 1LT7A 3TCSA 3NAVA 3UU0A 1G69A 2BY2A 1QTWA 5EKYA 4A35A 7ENLA 2XVGA 4W8BA 3LHVA 1XGDA 3LTPA 3WMLA 1GGOA 4CEXC 4JPGA 4JYEA 3VNYA 2WHMA 1UD4A 2XINA 2Z6JA 3S5ZA 1VFLA 1DQUA 2D22A 5AVHA 1A5NC 4BY3A 4KW2A 4IGNA 4HBKA 4PMJA 2ZUSA 3SCOA 3T6CA 4AISA 4UOQA 3T4WA 1JF6A 1S5WA 1T6MA 4I8YA 3MBDA 2DQWA 1TTQA 1BHGA 3WMSA 4UNLA 3CS2A 1U83A 3R79A 1ITUA 2HTMA 1CLKA 3GHUA 1NF0A 3ITTA 4LVGA 1EKOA 3CU2A 3USBA 5BOEA 4IL0A 1JZ4A 2BY3A 3MBFA 4QP0A 1LL6A 3U6WA 3UWEA 1ZB5A 3UWVA 2GVJA 5LYRA 2NV2A 3PAJA 4LYPA 5LA2A 1F61A 2TSYA 3BOFA 4FK9A 1Y8BA 3N2XA 4KKXA 4AD3A 1TA3B 2WHJA 3H23A 1XIMA 2GDVA 3KZSA 2XIIA 4S3BA 1JRCA 5LGZA 4EP8C 3VDHA 4DJFD 3GKAA 5D33A 2VR2A 3BQ6A 4PMQA 3WQDA 2A6LA 4DYJA 1O4UA 3URBA 3KCJA 4OGZA 1KM4A 5FF2A 5DANA 4L65A 4OBRA 1ZU8A 3GR8A 3RIKA 1JI2A 3HBLA 3AWNA 3EBVA 3V1HA 2DZAA 3GW3A 3UYCA 3S0CA 3A24A 3V35A 3E0VA 3PUOA 1UD2A 1I60A 1OGBA 4D1JA 1JCNA 4AF0B 4JTFA 5IM51 4XB3A 4LUTA 3WBYA 4YYCA 1YRRA 3TN6A 2XUCA 5F7UA 2FQIA 1UD5A 2R14A 2Y6ZA 5XIMA 1EJWC 1LQAA 4ZO8A 4JL1A 1RCXB 3W7OA 1UZ1A 3PUGA 3T2OA 5IFTA 2PUZA 4X63A 1MDLA 4GQRA 2A21A 3ZLGA 3N15A 4D8ZA 1GZJA 5CZKA 1DV7A 1MW0A 4O4WA 2XDFA 3VUSA 5HNNA 3DBPA 1P43A 2ZFAA 3IUHA 1RQBA 1XDMA 4JQ4A 2OWCA 4DQWA 1ZQ5A 3MO7A 2O4QA 4CQDA 1BQGA 4FNPA 4Q4QA 3WNKA 1SMDA 3A5FA 4S3JA 4QXIA 5FKYA 4EKJA 3RX4A 2JE8A 3UPBA 2G95A 3L2IA 3QQWA 1DWGM 3C2VA 4P8VA 4UMCA 1J5TA 1QK2A 4UFMA 3SCTA 3CTTA 1QOPA 2PGWA 4J40A 1U1JA 3APGA 3MUCA 3EDJA 3VZZA 5BCAA 2HS8A 3N14A 2OTDA 4XUGA 5JIPA 2CLMA 1AK5A 1T7LA 1ZY9A 4HNOA 4ZSUA 3K4WA 4DJDD 3CWHA 3LB0A 2EO7A 3D0CA 1H50A 1H7RA 1ITCA 5JMUA 3OO2A 1Y7VA 2OX1A 5I79A 3STFA 4MYXA 3S6TA 1PHWA 3F2DA 1C7SA 3RCNA 4KCTA 2IKIA 4AUBA 3VUPA 1SO3A 5I2UA 3MS8A 2A7PA 1FRBA 2EKGA 4PCNA 3GAYA 2ZC8A 2WOQA 1EP2A 1ISVA 3DC0A 4WGHA 4V27A 6TAAA 1L8PA 3AJ7A 1GVOA 4H6KA 3KCLA 5LNUA 4N42A 4E3VA 1WKEA 4TVCA 4L4OA 2X8RA 4DWSD 3UFYA 3I6RA 1XIJA 3DHFA 2V9DA 1CECA 4U28A 3HB9A 4MUZA 2IQDA 2JGQA 4Y9MA 3KCOA 1TPEA 4AZGA 1JZ5A 2R1MA 1UQZA 1OF6A 2QF8A 1YBQB 3NL3A 3GVRA 1XC6A 5I3GA 4Y96A 1E6PA 1SJBA 2A3EA 4C7GA 2J78A 3V4BA 3RLVA 4ZXOA 5HQMA 1OQFA 3IS4A 1VKFA 4AC7C 2CZVA 5CPSA 1W9XA 1ECEA 2J13A 1U33A 4GUFA 1EWEA 3U48A 3PZOA 3WF2A 1IXOA 4Z2LA 1XKYA 3RM9A 1GVRA 4DXKA 4HQVA 3N2MA 5DMLA 4LNCA 2QNEA 2GJRA 3GYEA 3PZIA 3VCNA 1LTDA 1E4NA 4IT1A 3SAZA 4WSJA 3WL0A 1X6NA 1UZHA 1RK6A 3ECQA 5C9XA 4Z0JA 3S2NA 2DQXA 2AL1A 2PLKA 3QEZA 5FESA 1FUYA 3E2RA 3VIMA 3QOMA 3PR2A 3L23A 1PBGA 2Z1KA 3TMQA 3GDMA 5FJPA 1BWKA 2XVKA 3IVSA 1J8VA 1OT2A 1DXFA 4PUJA 1HIZA 4S3AA 4RX0A 1O5XA 1YHTA 1T41A 5MF5A 4W7VA 3TNBA 1OFQA 4ICMA 1CT5A 4WR3A 3TTQA 4TQTA 2ESCA 2C7FA 2J75A 4RL3A 3BTNA 1GVYA 4O1EA 3N1AA 4PA8A 4JHZA 4A6GA 3WQCA 3ZM8A 2VGBA 4X9SA 2AGTA 2D0HA 4V1YA 1UIOA 3CUHA 2PE4A 3OPSA 1C93A 1DIEA 3KAOA 3SRKA 1B3ZA 3SCSA 1XLFA 2ISDA 4RE4A 1V0KA 4G5DA 3BSMA 4IP4A 4JOMA 4GK8A 1FDJA 2KAUC 4IHCA 4DBEA 3AYSA 4EVZA 1W5MA 3T1GA 4DM2A 2EJ1A 1V6WA 4JTRA 4X3ZA 4HHHA 3PZMA 3GXDA 1A4MA 5CSSA 3CGTA 2PDQA 1XH0A 3DX5A 4NY2A 1I1WA 3QXBA 4IG2A 2CNCA 3RM8A 3WUBA 4KCUA 2WLYA 3CZJA 1FKWA 4C6IA 2OYMA 3CV1A 3C86A 2OO6A 2VCBA 4TX8A 1XLAA 2E9LA 3R0KA 3EWCA 5FJIA 1WBJA 3W76A 1XICA 2JALA 4NHVA 4Y8EA 4JTQA 3CZKA 5JBDA 5CZTA 3NO5A 3EDFA 1M41A 5D2WA 3HQPA 1BWLA 1Q45A 3LQGA 1J0KA 1ODUA 2GK1A 2PDPA 1TMLA 1R9YA 4RDVA 4ICNA 1TV5A 3GK0A 1CLXA 3GG8A 3P0XA 4IISA 2GQ3A 1CGXA 1S2UA 4A21A 5HA7A 1G1YA 3V5FA 3LGEA 3NQDA 4ZCWA 3R10A 1Q6GA 4JKKA 4QEEA 1V51A 1XLEA 4TMCA 4QQUA 4WSHA 1T0OA 1C8VA 1VR6A 4UFJA 4HVXA 1G4EA 3CO8A 4U2ZA 3CQ0A 2H6RA 2W9MA 5FAGA 3RRAA 1H1ZA 1H62A 3JZEA 4OBTA 5EY5A 1P0EA 1NOUA 2AAMA 3S5NA 4B91A 4C6EA 3PZUA 1ZTVA 2TAAA 1R47A 3GBDA 3EWZA 4QROA 3P74A 3W7NA 3KRUA 1X6LA 4XAYA 4QDMA 1XBYA 4TR9A 4AZ7A 4HYWA 1DJQA 1DBTA 2FZBA 4DJDC 3IJQA 4FXFA 2GL5A 1OX4A 4GYPA 4QCFA 4DNMA 3LCHA 1ADDA 3V16A 2FVLA 5JUVA 4H8UA 3W26A 5HBFA 4J3ZA 2PC4A 1RH9A 2AGKA 4M1RA 3CLMA 4Q7BA 2V5DA 2VZVA 1CXKA 4KS0A 4PB3A 1C29A 1FHDA 5FJOA 1OGSA 2FZNA 3BJFA 4Q8UA 1C3FA 3GVGA 3O6CA 3VGHA 1XLCA 4F2UA 1H49A 2WHKA 3EDKA 4LUYA 2QXWA 5G1MA 1KLZA 2CBUA 1Q6CA 4DWSC 4UQ9A 2IKHA 3BZGA 4LVFA 5AN7A 3QYSA 1MRQA 3QHMA 3TONA 1XRFA 1P4CA 4WY0F 3IJ8A 2BOFX 3MQTA 1XH1A 2JK2A 3C2RA 1PTDA 3LTYA 1A5UA 4EXBA 4S3DA 3HFYA 4R27A 1WB0A 4LC6A 3R4IA 2BTMA 5DCEA 2V68A 3ZS4A 4HNUA 2J7HA 4U3CA 2QGYA 5LA0A 1U5JA 4WY0B 3WUEA 1EP1A 5XIAA 3IVUA 4FF5A 2V30A 4YL2A 3TQPA 3W84A 4C91A 4C1NA 3H70A 3AXXA 2Q01A 4IPNB 4KERA 4P8XA 4CCDA 4QFUA 2CLOA 1VEMA 2ZIDA 4UQAA 3TFXA 1L9WA 4A3QA 3R2GA 2PDCA 5EL1A 3LPPA 3VINA 4LUSB 4LNYA 2OODA 5IFPA 1FHUA 1W1YA 4WX2A 2PWHA 1K8YA 1TE6A 1K77A 2OMAA 4O54A 3MUXA 1IF2A 4MZ1A 4TTUA 4TV5A 2E5CA 2PP1A 2GJNA 1GTHA 3PBWA 4OBSA 4PTMA 4LTSA 2EG8A 3N4EA 4GIYA 3TTSA 3PFMA 4NJJA 2V3EA 3H2CA 3W24A 3BWWA 3ZVHA 3P6LA 1U1UA 1GCYA 3NPUA 2ADAA 2ZZ6A 4CCZA 3FK4A 1F7BA 3I6TA 1S2TA 3W0KA 4NAFA 4R7WA 4ICCX 2QUMA 1XLLA 3GU9A 4C6JA 4YLWA 3N9RA 3ABZA 1NQ6A 3P0WA 1ZJIA 4M24A 2HBVA 4GZIA 4EXQA 3LOTA 4QDWA 5C5YA 3VIOA 1AG1O 4PMZA 3G3DA 4G1KA 4JL2A 2F6KA 4BS0A 1R2SA 2DT1A 1XS2A 1QNVA 3BJTA 4MGGA 4O18A 1Q2SA 1R9ZA 1PIIA 4CU6A 3BAJA 4K36A 1KR1A 3B0XA 3UR5A 2C16A 4YCOA 4A4AA 4L64A 4O1FA 3MP5A 4FALA 2Z28A 2IQ0A 4IX0A 4PMDA 3C56A 4LYKA 3C2OA 1G5AA 4PUMA 2VENA 2OEJA 1KO0A 3U7BA 2PF8A 1ZALA 2WPBA 2WWDA 1V93A 3GNNA 4ES4A 5LHEA 5BOFA 3WLTA 1GJUA 2O92A 4JX5A 4AFYA 3UPMA 1EBHA 3OIHA 3T8LA 4HZ7A 3WLHA 1R3VA 2ACRA 4N9BA 1PL9A 2TYSA 2WMFA 3LHYA 1BYBA 2YDQA 3C3UA 1Q3NA 1FWNA 3EB2A 4PMYA 4ZB2A 1GQIA 2YL6A 3DHDA 3W1TA 3ATYA 1RBLA 3DU0A 3NL6A 3HGSA 4B92A 1P7TB 3H24A 3QPEA 1JEZA 1YDOA 1CB2A 1JUKA 2QCDB 5HJXA 1LLZA 4J27A 2VC5A 3HV8A 1PAMA 3W7EA 4XUYA 4M51A 5DXYA 1UG6A 4CNNA 4O8AA 4XTIA 1SVDA 4KIEA 1PIFA 4RPQA 2XGZA 5AHEA 3I10A 3O1NA 3DYPA 1A5OC 1Q6DA 3W82A 2IMRA 3FN9A 1WO2A 1WKDA 1A0EA 1E0XA 4Q22A 1CDGA 3IJLA 4GGBA 2Y4SA 4UCGA 3GE7A 4GYFA 4H41A 2R82A 1BG9A 3N11A 1JUBA 3W2MA 3N2TA 2BVDA 3APYA 4NZJA 4WXYA 2Y89A 1MFUA 4WXZA 1JR1A 1KV8A 5KZEA 4QJ1A 3OVGA 2QW5A 1OVDA 4OTKA 1HG3A 3AMGA 1R3RA 4O16A 1E0WA 4B3ZA 4WJEA 4PCSA 3ARSA 3VK5A 5CJ5A 2J27A 1H11A 3ERPA 1QHZA 3DEQA 4IPJA 2XVPA 4Z17A 3VKKA 4U5IA 4H1ZA 3W70A 4DM1A 5HK4A 2NX1A 4RZ6A 1M04A 1EJ7L 1HKJA 4ZGYA 4JIQA 3NO3A 5AECA 3GU1A 1FTXA 2Z25A 3H2NA 3IJIA 4UR7A 5DMNA 3H21A 4EX4A 2RDWA 3BH4A 5D05A 2PTWA 1NFBA 4O14A 5FOOA 2DDXA 2XPKA 1YEYA 2C13A 3M5VA 1MUMA 3K8KA 2VCAA 4MWAB 1L8NA 4JHMA 3MZNA 2I17A 2ACQA 1XWYA 3O16A 1UJQA 4LQ1A 2PEVA 3WD4A 1LUCB 3CUJA 5I06A 2VO5A 4ECLA 3C52A 4GUJA 4NAEA 1QNRA 4RNJA 3AROA 1E6SM 3TOYA 3WH7A 3WNLA 2YLLA 2IQTA 2PZ0A 4AIBA 3NM1A 1IIHA 4AIUA 3V1PA 3GU2A 1MEWA 3UG3A 2D20A 4QE1A 1B4KA 4L1GA 1QXLA 4IOTA 3GFXA 1PKMA 4FIQA 3R43A 3CJPA 3DG7A 3VNKA 5KEZA 1QPQA 4MKSA 1CB7B 3PZGA 1P5BA 1UA3A 5JQ9A 1Y65A 2Y1HA 5BWFA 1Y5VA 1JZ3A 4A3YA 1OD0A 1OIFA 3W6LA 3PPGA 4I6KA 3ZMRA 1R3WA 3SUSA 1H09A 4HK6A 1BVNP 2AL2A 3TA9A 2QUVA 2ZUTA 4RK8A 1JQVA 3C2FA 4L1XA 1SJAA 5HR7A 1SMAA 5DT7A 1M53A 1RA0A 3G18A 3N3MA 1TR9A 4GPNA 3LNPA 2Z7KA 3G0XA 1OGGA 3BW4A 3UPWA 3BAWA 3FVDA 3QYQA 1LROA 3RU8X 5I09A 2DZTA 4I5XA 1HJUA 3ITLA 5BXTA 2X1IA 3SRHA 1TWZA 4J28A 1YKWA 4YTSA 5BNKA 5A8OA 1E6NA 1QHOA 4WJ8A 3UZ5A 1QASA 3DG6A 4H6RA 4DBUA 1US0A 2VX4A 4QIUA 1MO0A 4O19A 1QW9A 5D9NA 4CCCA 2DJXA 4BWLC 4MZYA 4ENLA 3IEBA 3P62A 1V3IA 2ABAA 3BG3A 3SQLA 3JR2A 4UIOA 5EBAA 3CHCA 3VOFA 4JN8A 5D37A 1C92A 1BPLB 5I77A 1X8FA 1W6TA 5REQA 1W3HA 1R2RA 4MLJA 4M5PA 4O0KA 1VFTA 1A47A 2YX0A 4HA4A 1UBPC 2ZE0A 1I6NA 1SW7A 3SY8A 3EWXA 3GDRA 4JY8A 2B31A 5A6JA 4REQA 5HUOA 2EJAA 1JZ7A 2C18A 3N12A 4FOUA 3F5JA 4F79A 2B7PA 1W3TA 4BQ4A 5G4WA 3S3GA 2VKZG 1SYTA 2YCLB 4ZEPA 4XSMA 1UD8A 3U5UA 1XSJA 1ISZA 4P7OA 3DDMA 3V7PA 4H9UA 2GVYA 2Y5SA 2V82A 3CHFA 5HNUA 2G3IA 1F4HA 2WC4A 1IHIA 1SZNA 2GGIA 1ZPTA 3MVIA 1XM3A 1DORA 1Y0EA 5HR6A 3B40A 2YL8A 3CNYA 3QFWA 2XFYA 2J6XA 1JULA 5J5RA 3NJ3A 4GISA 3MC5A 1IXNA 1DWIM 1IZKA 1UUOA 3KBNA 3CAKA 4JNYA 4X60A 3IVTA 1JPMA 1F9CA 4JD4A 3AQUA 3AHZA 2DPEA 3OVQA 3C2EA 3WLLA 1PZ3A 2HISA 1A5MC 1WAUA 1A3HA 5I5RA 5A1AA 3DI1A 3L67A 1O60A 4PTNA 4GFIA 3KVKA 7CGTA 3NXLA 4RNHA 4ZENA 1KXQA 3W1PA 1QJWA 2XSXA 3OODA 4MHBA 3VIKA 3M0YA 3SGZA 1EQCA 4JQAA 3VVGA 4BA0A 1AL8A 3AUJA 2X7WA 3S2CA 3IIPA 3HO8A 3UGRA 3RCMA 3R8RA 4MB1A 3BURA 4G7EB 2FZ8A 4MB5A 5HAOA 4O28A 1KD0A 2DW7A 3LHWA 1QFEA 1XCXA 1L0PA 3PHAA 9RUBA 1ZJBA 4EIVA 4MJ4A 1PKYA 3M0KA 1KM0A 4H9VA 4IIGA 1B90A 1P6WA 3FYPA 3QMSA 2QCFA 1RLDA 3PS7A 4GVIA 2QV4A 2HZGA 3I6EA 3OG2A 1BXBA 3TWAA 3LXAA 4LXFA 2ZRZA 3JVAA 1TX0A 1V4YA 2DT2A 2GWNA 2G37A 4DWDA 4YXGA 1RCOB 1Z44A 3W1NA 1JDFA 3BW3A 3PUDA 2VX7A 5MKGA 3CUFA 4JXCA 2WKJA 2NQLA 3GTXA 1EOKA 1BKHA 3NDOA 4IICA 1HVQA 1XH2A 5HPCA 1FH9A 1F8IA 1JQXA 3EWUA 4XAGA 1CLVA 5I0DA 1G94A 4S2CA 4WSKA 4AZCB 1UHVA 1L6SA 3EWYA 3MMWA 3W72A 2E1WA 4HSHA 3RR4A 5LIKX 4P7QA 1R3SA 1XRSA 5FCZA 1LOSA 2E77A 4JZ5A 3M7SA 3WBXA 2HWGA 3BZJA 3GR7A 3NQGA 1UKSA 5CLWA 3VFLA 2YFOA 4AQLA 2P50A 1R0MA 5A8NA 1VZWA 3AALA 4QEHA 3PB2A 2VUYA 4KCWA 3WQ5A 4JAWA 4JY9A 4ZR8A 4JTSA 2DZBA 1A5LC 3W85A 1RAKA 5FEZA 2B4GA 5CGMA 3T0TA 2PODA 4PRRA 1CCWB 5I3HA 4R5EA 1MXGA 3KLLA 1NJJA 1W5OA 4KWUA 6ALDA 2PGEA 4LAMA 3W07A 4RW3A 1GONA 1A5CA 2ZZ1A 1DHPA 2VP8A 2CHOA 2Z29A 1L6FA 4K7YA 2VQUA 3I3BA 1PYFA 5G2WA 2FH8A 1PTGA 4KETA 4L56A 4S38A 1TJ2A 2WMKA 2OQHA 2D69A 4XD4A 1Z3NA 2QMKA 2DT3A 1PZ0A 2NZLA 1OBAA 2E5DA 2ISSA 4DJEA 3KDOA 3OHMB 1NWUA 1GG0A 3M0ZA 4AMCA 1B3YA 1MMFA 2JBMA 2YIHA 1EH9A 1NEYA 4Q4RA 2ZDSA 2VX6A 2P10A 4TVDA 1X7FA 2HVNA 1E55A 4XKYA 3T42A 3S2MA 1NARA 1V6XA 3V0TA 3QPZA 5HWNA 2JKEA 3DCPA 3GDLA 3GH7A 3MA8A 3PBUA 3ARWA 3UYIA 2Q02A 3G1AA 4B5NA 2YYUA 4HZ6A 3BV4A 2R91A 1RD5A 5I3DA 1DWAM 3BG9A 5I3KA 2D3LA 2GPTA 4J3UA 3Q4DA 1F74A 3HPZA 2FLIA 2ZZ5A 3P60A 2WB5A 3VNZA 5EMJA 3BICA 1KC7A 2GVLA 1JNEA 2Z2AA 3VXGA 4LUIA 3PBMA 2XZ7A 3T40A 2WKGA 4JQ3A 3RK8A 4Y9PA 2PWDA 1G4TA 3W23A 1V3MA 4BCEA 4N9CA 2QJGA 1MEIA 3SIMA 1ITXA 5DMYA 5CXPA 1Q7QA 1LYXA 1LBLA 4O15A 3SEPA 3S6DA 2QPXA 3BANA 2WSYA 3VD3A 3QZAA 4GKLA 3LRMA 3TH6A 3UA4A 3ZSSA 3CHDA 3AXKA 3AIQA 3VMPA 2DORA 4CQCA 2HXUA 2NQZA 2ZWZA 3AYTA 1GPFA 1G0CA 4AX6A 3FGCA 4H7ZA 3RM4A 1AH4A 1DE6A 2W0UA 4H9ZA 3TJ4A 1W0MA 2QCLA 4JEQA 5B7ZA 3M16A 2EKCA 4K1WA 2REQB 2WNZA 2UV8G 4GJIA 3W7QA 5JU6A 3KL5A 4UOJA 3F4VA 3URQA 5G2IA 1KLYA 1XBZA 1R38A 2ZXDA 1HL2A 1TCDA 4NZ4A 5HMDA 1SR0A 1U22A 3N6QA 4CNOA 3RO8A 1DIDA 3SDOA 3HURA