2PDMA

Human aldose reductase mutant s302r complexed with zopolrestat.
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
315
structure length
315
Chain Sequence
b'ASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLRCTSHKDYPFHEEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title Merging the binding sites of aldose and aldehyde reductase for detection of inhibitor selectivity-determining features.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 105
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2007-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2pdmA00
3GUGA 2A79A 5AZ1A 3FJNA 3LEPA 1VP5A 1AH3A 4GA8A 4JIIX 4WEVX 3EB4A 4YS1A 3V0UA 3G5EA 2BGQA 3LNMA 3ONBA 1OG6A 4FALA 1IEIA 4HBKA 4OTKA 2FZBA 4GQ0A 4ZFCA 5KETA 5M2FX 3GHUA 1ADSA 2IPGA 1PWMA 2IQDA 3H4GA 1IHIA 4JIHA 4DBWA 4XZHA 2FZDA 3MC5A 4GABA 3B3DA 2ALRA 3LUTA 1T40A 4YVVA 3R8HA 4WDXA 1Z89A 5LIKX 4LB4A 3G1RA 2F38A 4RPQA 5DANA 3CV7A 3MB9A 3R7MA 4IGSA 1MRQA 2PDGA 1US0A 4JQ4A 4XO6A 3WBYA 2IPFA 4L1WA 3LENA 2DV0A 2PDUA 1T41A 3T42A 3BV7A 3CMFA 4R9OA 4XVDA 3CAVA 3LD5A 2PDIA 4XZIA 2J8TA 3EB3A 4QBXA 1X98A 3UZXA 3LZ5A 5C7HA 3N2TA 3R8GA 2PD9A 3UGRA 2WZMA 3D3FA 2IKIA 3RX2A 3UZWA 4IJCA 4Q3MA 1XJBA 4JIRA 4XZMX 3LBOA 1AH0A 3EAUA 3R58A 4WRHA 4HMNA 3UG8A 3N6QA 2PDCA 1QWKA 4H8NA 1X96A 2NVDA 2QXWA 1AH4A 2PDHA 4DBUA 3BURA 3ONCA 1RALA 3DOPA 4QX4A 5JH2A 1MI3A 3FX4A 3LZ3A 4Q7BA 3WBXA 4YVPA 3LN3A 3BUVA 3Q67A 4NKCA 2PF8A 3V0TA 2IPJA 3R43A 4QR6A 1HQTA 1M9HA 4PRRA 4PUUA 2HDJA 4LBRA 3O0KA 3LQLA 3M64A 1AZ1A 1YE6A 1XF0A 4H7CA 1XGDA 5LIWX 2PDXA 2DUZA 3UZYA 4JQ3A 2ISFA 1S1RA 1MZRA 4JTCA 2P5NA 4PUWA 4LAZA 3LQGA 2PDMA 1HW6A 3M0IA 4JTDA 1Q13A 4JQ2A 3R6IA 3V35A 2C91A 2FGBA 4L1XA 5AZ0A 4XK2A 4FAMA 2R9RA 1Q5MA 1Z3NA 4GQGA 1LQAA 3Q65A 4EXAA 1X97A 2VDGA 3CAQA 2ACUA 2PDBA 1AFSA 3BCJA 2ACQA 3C3UA 2F2KA 2I16A 2IQ0A 2R24A 4PMJA 1PZ0A 4JTAA 4YU1A 3U2CA 3H7RA 1ZGDA 3UZZA 2PZNA 2WZTA 4QXIA 1Z8AA 1JEZA 2IKHA 3S3GA 5HNUA 4DBSA 2PDLA 2PDFA 1LWIA 4JQ1A 4ASTA 2PDPA 2PDKA 1ZSXA 4XZNX 4GIEA 3KRBA 4DZ5A 3CASA 4JQAA 2PFHA 2DUXA 1A80A 1YE4A 1EF3A 3V0SA 2BGSA 4XAPA 4PR4A 3CV6A 4I5XA 1QRQA 3ERPA 4LBSA 2HEJA 4WGHA 2PEVA 4JTRA 3UFYA 4FA3A 4XZLX 1ZQ5A 3NTYA 4AUBA 1YNQA 3GHSA 4XVEA 5LIUX 1ZUAX 1SM9A 1VBJA 4XO7A 4YVXA 5HNTA 2PD5A 1YNPA 4FZIA 3R94A 2INZA 3WBWA 5LIXX 4GCAA 1GVEA 4LB3A 4WDTA 4GACA 2IPWA 2ACRA 2PDYA 3P2VA 3RX3A 5JH1A 2PDWA 1EKOA 2FVLA 3VXGA 2I17A 3UWEA 2INEA 3H7UA 3WCZA 1C9WA 3M4HA 3QKZA 2ACSA 4ICCX 1EXBA 1S1PA 3COTA 4MHBA 2IKJA 2IKGA 3GHTA 2HV5A 4WDWA 2CLPA 2PDJA 2BP1A 3O3RA 2IS7A 2AGTA 3V36A 3F7JA 2HVOA 2HVNA 2NVCA 4PRTA 1S2CA 1UR3M 1S2AA 1R38A 1FRBA 3DN5A 3WG6A 2HE5A 1RY0A 1J96A 1PZ1A 3GHRA 2PDQA 3RX4A 1EL3A 1K8CA 4F40A 2FZ8A 2HE8A 1Z9AA 4JTQA 1PYFA 2PDNA 2FZ9A 5LIYX 5HA7A 3UP8A 1AZ2A 4WDUA 4G5DA 1PWLA 3UYIA 4EXBA 4LAUA 4IJRA 1RY8A
chains in the Genus database with same CATH superfamily
3A21A 4YLWA 5D9MA 2C13A 3SN1A 1E6SM 5E6YA 1PTAA 1OCQA 3QSRA 2WMJA 5GJMA 1ZAIA 4QE1A 4P8XA 3BG3A 1O60A 4KGJA 3WEZA 1HF6A 1KA9F 4REQA 4M6QA 1LROA 1OFBA 3P7YA 1XCXA 4UCFA 1XHGA 2WZIA 4U10A 2EG6A 4UMBA 1F8IA 4O52A 3PBVA 4RLIA 4WY0F 5IHSA 4ZFCA 1GOOA 2G37A 4AX7A 3H4GA 4HMDA 3N34A 3GXMA 4HCDA 4ZQPA 5CSUA 4XZHA 2V5LA 3URAA 3HURA 3MWAA 4GZIA 3QXBA 4XWUA 4E2BA 5TBOA 2VO5A 4IG2A 1DJYA 1RD5A 4K1WA 2ZYFA 4TX9A 3HPFA 2GLKA 3DI0A 4GHRA 3GYCA 3VC6A 3IIVA 3FEQA 4AWUA 3THUA 1A5UA 3L5AA 2VRJA 2VENA 2WVVA 3ARXA 4LCRA 3BAYA 5FSEC 2PRLA 5D37A 1GKRA 3WH5A 1O4UA 4XD5A 2QEZA 1CIUA 2OOGA 4HZ7A 1YNYA 1ENUA 2E9MA 2R14A 3BTNA 5AC7A 2Z28A 2R1PA 5JXQA 1CXIA 4HYWA 4IPLA 3EB3A 1EJVC 3WQ5A 1F73A 1BD0A 3G1DA 1VFSA 3BG5A 1V5XA 2W79A 1V02E 1CEOA 2PD9A 3GS6A 5HJYA 2GQ9A 1QNRA 4AC7C 1UH2A 1XRFA 5DCBA 1Q2SA 2D2GA 4D6EA 3PUOA 3RX2A 2DZUA 3GH5A 1LDCA 3KVMA 1I2NA 5AECA 1K8XA 3MSDA 2X16A 2ZX9A 4BWLC 4CEUC 1DIOA 4RE0A 3AHZA 5A1AA 4AD5A 3GC2A 4CNOA 1HTIA 1E4IA 2V82A 4DO6A 3GXNA 4PZVA 4KCVA 3RJYA 4WKHA 1XYZA 3KVJA 1QPRA 2POTA 2DZAA 3H6OA 1W5OA 4RNIA 2VTFA 5JH2A 3VGFA 4OT7A 4ACZB 4YCPA 4A3RA 4BHYA 3A64A 2VOMA 1SFSA 3TK7A 3Q67A 4JGDA 2PF8A 3GDKA 4TIMA 1XV8A 5DBTA 4XIAA 4D6JA 2CLIA 2AKMA 2HDJA 3ANYA 4AF0A 2Y85A 3K4WA 3WJYA 3N2BA 3EWUA 1JUEA 1VRDA 4NQ1A 1MW3A 2CERA 4B9YA 4Z1AA 3VIIA 2BOGX 5J8LA 3AOFA 3W2UA 5AHFA 2QAFA 1W1A1 4JDBA 1LCOA 1LOQA 3DZ1A 3GR4A 1M41A 1LLWA 1EYEA 2REQA 4KWSA 2YL9A 3VOIA 4BKNA 4M5PA 3R6IA 4NYUA 2JF6A 2ON3A 2QNEA 1SVDA 2GOKA 4JKMA 1J10A 3L4VA 3OHIA 1VYRA 4RNFA 2PE4A 1Q85A 2GJNA 5BMWA 3TWBA 2XM1A 2QJHA 5G2WA 5B7YA 3F5KA 3I3DA 3P60A 1TTPA 8CGTA 3SGUA 1JZ2A 3C3UA 1CLXA 1RP8A 3RM9A 1MQRA 4IMAA 3MJMA 3SJ3A 3U2CA 2CLHA 2DFAA 2DZTA 4O57A 4JTFA 2YA1A 2YLAA 4RX0A 3AZSA 4YN5A 1XYMA 3PPCA 4IMFA 5FCZA 4XUYA 5XIAA 2WMIB 2BVTA 3WF3A 3NL3A 4FEZA 1NDYA 4JNYA 4JKKA 1DTNA 3SUTA 2DUXA 4GMEA 1EX5A 4Z1YA 1KCLA 1UPMB 5G4WA 5JVLA 5JBEA 5E93A 2AOSA 5AYXA 2NUYA 1XDMA 1UWIA 2BWGA 4JTRA 4B5NA 5CGQA 4M6UA 3L0KA 2QIIA 3S2CA 3R89A 3BAXA 1YMYA 2ZA2A 2B7OA 1J0KA 1CGVA 3B03A 4EPKA 1F05A 2VGFA 4RE3A 3I7RA 1PYMA 4PH6A 3DGBA 3G6LA 3GFYA 2VYOA 5AYIA 2XJ7A 1MO0A 2E0PA 3LMZA 1UW9A 1GCYA 1VQTA 2ZX6A 4GCAA 1SFLA 4AG0A 2O9TA 3GNPA 2TAAA 2IPWA 4PGLA 4L9YA 4O12A 1GPWA 3K8MA 3SQLA 3ARPA 3GE7A 4MLJA 2INEA 4PN2A 2PU0A 1KXVA 4AD0A 3QKZA 3PC0A 1V8EA 3VKBA 1KTNA 3KOZA 1TWDA 2ZKMX 4HNCA 3NOYA 5CLWA 1FOBA 1E6QM 3KS5A 1QW7A 3ZQ9A 2CLPA 2OZ3A 1YBQB 2YR1A 1C8QA 3NZQA 1L0PA 1S5WA 1EC9A 3CEPA 2KAUC 4JFWA 5AVHA 1KXQA 1DL3A 3N4FA 3T0TA 2WJZA 5IM51 2EBNA 3O05A 1FHDA 1AW5A 4J4KA 4KETA 3W7JA 1KM6A 1TR1A 2Z1SA 5FA5A 4K37A 4LBUA 4FK9A 3MI6A 1GPFA 5K7JA 3PTQA 5FEZA 1ITUA 1T8XA 1K8CA 2E6YA 4GI6A 1FWHC 1AZ2A 1B4KA 3M5ZA 3MA8A 2HWGA 3GVRA 5CC3A 3TYUA 1PB0A 2WVSA 4QIUA 2E1WA 1RPKA 1FWWA 1EBHA 1TVPA 4CD5A 1JNEA 1S3TC 6XIAA 3AXIA 1KXHA 3OOQA 5FF0A 1EFZA 3AS0A 3U9IA 5G1TA 1CXKA 3UXDA 2WV8A 2QPUA 4X2PA 1IT8A 3ITOA 2CHRA 4I6VA 3RCYA 2IQDA 4TU1A 1ISYA 1NDWA 3GVGA 2BY2A 2I5IA 4J3SA 4W86A 1OFOA 1E5NA 5HOSA 1GNXA 3AHXA 2ZZ4A 1AQMA 3PZVA 1W0MA 2YA2A 3GDTA 3IVSA 3MU7A 3TYAA 1TZ9A 2W9MA 2DVTA 4A2SA 2ZUNA 4XBJA 2FGLA 1WKEA 5DT7A 5GJNA 3SJNA 5A8QA 1RJRA 2FVKA 4QBXA 1OB0A 1H51A 4W93A 2PP3A 3LCIA 4GOAA 5E09A 4UFMA 4K8EA 2Y7FA 2IKIA 1LG1A 4W8BA 3CIXA 3KLLA 2BXYA 3TN3A 1Z6KA 2X2GA 3W7KA 1UWUA 1DBTA 4IFOA 3QN3A 2WO5A 2NV1A 5A2BA 3KBWA 4J35A 2V81A 4F4RA 1EYWA 4A8IA 4J3TA 2EG8A 4NAEA 1N8FA 4JCMA 1FCVA 2LLEA 1CNVA 4BK9A 4K6AA 2VHLA 1XCFA 1CLKA 3BURA 5CPOA 2YZ5A 3DOPA 4AMCA 4DJFD 1KV5A 1EGMA 1EDTA 1FY6A 3LXCA 2DU2A 1QBAA 2DZSA 4PC8A 3SGGA 1ZBWA 2Z2AA 1G6CA 4ERIA 4PMYA 2VFEA 1YDVA 1J6OA 3T0BA 4QCFA 3RLUA 3QEZA 2OU4A 3RRAA 1AJ0A 3TNOA 3TWAA 2OGYA 5CBBA 3LI1A 3TTQA 1P4CA 3PBMA 3N6HA 3SQSA 3QV7A 3CUFA 4GISA 3HGRA 1LF1A 4BA0A 3UJEA 4JIEA 2Y0FA 5B80A 1MZRA 4HPNA 3STFA 3VNYA 5H8MA 3GTNA 5CPNA 4PUWA 3TXVA 3SRDA 3W7LA 1V02A 1PL9A 4W7WA 5HMSA 1RR2A 3DU0A 3V5CA 3NQ2A 2YCLA 3OLGA 6CGTA 3M0IA 3QPEA 4JTTA 1YX1A 2AGKA 3WLJA 3N1AA 3A4AA 3TYEA 3B9AA 4L1XA 1ODUA 3W74A 3WN6A 1Q5MA 2D3NA 1GGOA 3TFCA 3WJXA 4H9VA 4H8UA 3H2CA 4MY9A 1W5NA 3Q65A 1QTWA 3PZTA 3OZOA 3CEUA 1W9UA 1IEXA 1KR1A 3DX5A 3PJUA 2OLAA 1UZ1A 2OTDA 1I0DA 5TQLA 4UFIA 1LWHA 3BCJA 4LCQA 4X22A 1UKTA 4AZCB 2YSWA 1C8YA 4MG4A 1Q6OA 1W37A 4QXIA 3R12A 1NIUA 3CM4A 4DBSA 2A6NA 4NZJA 1ZBCA 2G3JA 1L9WA 4GLEA 4GZJA 3ARSA 4CD4A 2V3EA 2C3ZA 2G3FA 2E4TA 1NU5A 3VIGA 3STGA 2E6AA 5BNKA 5BWFA 5FF7A 4L4PA 5DMNA 4AEOA 1RK6A 3AJXA 1FHUA 1GZ1A 1UIPA 1FH8A 1OFEA 4QNWA 3XINA 2WCGA 3BLDA 3WK2A 1LLOA 3A22A 3CB8A 4PEKA 3FLUA 2G96A 4IT1A 4NSBA 2YXGA 4L9XA 4GKTA 4PTWA 3TQPA 4JFUA 4DY1A 4IM4A 1E0VA 3FJLA 2QCLA 4WY0A 1VBJA 2J13A 2R1LA 4MNLA 1S5NA 2VVNA 3AXXA 1UWQA 1JPDX 1J0ZA 4CEXC 3Q2DA 3ZIZA 4OBRA 4UMCA 3FVDA 4WSKA 4M19A 1E56A 4I8YA 3IRSA 5FJTA 2ZA3A 4IQDA 1HL9A 4UUIA 3E5BA 1VKFA 4J3ZA 3IV3A 1YPFA 1DJWA 3G24A 2CBJA 4C6LA 1XFCA 2ACRA 3P2VA 4HHLA 1A5CA 4IIHA 2FVLA 3PF3A 1UP3A 4NI8A 1M65A 4GJ1A 3WCZA 2ZRZA 3LXAA 4X0VA 2BVWA 4D6CA 1KO0A 3VGEA 2D2OA 3LHVA 1TZ7A 3P0WA 2J8FA 3BW2A 2V3DA 2IKGA 1RLDA 8XIAA 3L68A 3N2MA 3G22A 2EPLX 5D05A 4MB1A 4ZVJA 3H70A 4WOQA 3SRFA 3UG5A 2WSKA 4AXKA 5BW6A 3DG7A 5FJRA 1O1ZA 1OCBA 3I6RA 3LTPA 3V36A 3CQ0A 4XUGA 5DO8A 1ONRA 2JBMA 4PRTA 3HV8A 1KM0A 4LYRA 2FZMA 5LNUA 2ZUUA 3VPLA 1KM4A 8RUCA 3LCXA 3KBMA 1WXYA 1TREA 1B0IA 4Q4OA 3RIKA 1JZ3A 1AD1A 3WK3A 1Z42A 4DJEC 5C5YA 2A0NA 3PY2A 5EYWA 4FNPA 3OODA 3MSRA 4I7WA 3FJNA 3OVRA 1FWBC 1FWAC 1VP5A 4GI4A 4GA8A 3KTSA 3EB4A 2PTYA 4M80A 1QHZA 4IL0A 1WAWA 1V3MA 1Q63A 1IEIA 2YA0A 4H04A 3GXFA 3T2OA 2AL2B 3WF0A 1A3XA 4GFIA 3PNZA 2WNNA 4W84A 3DHFA 1ADSA 1E9IA 4QG8A 3TQVA 1QWGA 3ZR6A 3O8AA 1JFHA 1V08A 2X7WA 4KW2A 2FMNA 4PUKA 1XLKA 4MDOA 1TWSA 3OA3A 2GVYA 2D0GA 2FHFA 1E0TA 4M82A 4Y7EA 3N4AA 1Y5WA 3PG9A 5LIKX 3FFSA 4MYXA 1WUFA 3DDMA 1OT1A 2GDVA 4JQ4A 3DHUA 4L1WA 3B8UA 2VCBA 4LUIA 5A8PA 2XM2A 4GRSA 3HBLA 3PULA 4F0HA 3LD5A 1HJSA 3IJQA 3THDA 3TLLA 2XVLA 3VIPA 4FX8A 1BGAA 4XKMA 3GG0A 2OEKA 3N2TA 4ZE5A 4FXFA 2HSAA 4R27A 4ZSTA 1O7AA 2VC5A 4IPJA 1Z7AA 1XYAA 4DO5A 3HU7A 4HNLA 3RPDA 1WOBA 3CMGA 2CITA 3IK4A 3OU8A 3VNMA 1UWAA 4DUVA 5C9UA 3LU2A 1C29A 3VDGA 1G1YA 1XDJA 1AUSL 4XAYA 4WRHA 3DYMA 4NXSA 2NX3A 2H6RA 4K7VA 2A85A 1IV8A 1XCWA 4BEUA 3AMCA 3PUEA 4OV4A 4C6CA 4PCSA 5HULA 2HMCA 2E3ZA 5LNVA 1PKMA 4W85A 4IMCA 3HIJA 4JN7A 3PTMA 5L6UA 3WBXA 1H7NA 1H60A 2ATMA 2O4MA 3THAA 3HGJA 4RL3A 3IAQA 2CKSA 2POZA 1SSDA 3J7HA 1VCGA 3E49A 1MMFA 2VQUA 3ZSTA 4PUUA 2G8ZA 1SJDA 3N19B 1YRRA 3TNBA 4NJIA 3NQ7A 3C2VA 4W88A 3T07A 1H5VA 3VX1A 4DM1A 2CZVA 5HDRA 1M68A 4US5D 4J3XA 3SO7A 3ZOAA 1WBJA 1NOFA 3BPWA 4KFPA 5ENLA 4NZ1A 1S2WA 2VEFA 3HQ1A 2FGBA 5G2HA 3A3WA 2F8QA 1P7TA 3IS4A 3ES8A 2A3AA 4GJIA 5F2LA 2OVLA 3RHGA 4HU8A 2O92A 1CT5A 1W56A 4V15A 1K6AA 1Y8BA 3CZLA 1RUSA 3KL0A 2J88A 3MV11 3WMLA 3UXAA 3DFNA 1DJQA 2IQ0A 2GSJA 3CHDA 3VA8A 4G8TA 2PLKA 2W61A 1VJZA 1PVNA 2CFFA 3JS3A 1A3HA 1QHOA 3FNDA 3ZYZA 2PDLA 3I4KA 2TYSA 3BJTA 4HB7A 4PBGA 6XIMA 3GX9A 3SN4A 4B5UA 1O68A 2GJXA 3GSMA 3ZWTA 6REQB 3CASA 4B5XA 3CC1A 1J0IA 4MUPA 4MZ1A 4PL2A 3B9EA 2ZXAA 3CNYA 3ZT5A 2HS8A 3O6AA 4RKAA 4AD2A 1JYNA 2WM0A 1H2JA 1ELSA 3SW6A 4FIQA 4JTJA 3KUMA 5LNWA 3ABZA 4GC4A 2PODA 4FA3A 1WB0A 5EU9A 4MVAA 4O8AA 3U7VA 1U33A 4LVBA 1RA0A 4MYAA 4AUBA 3GHSA 5KTLA 4OJYA 4CNNA 4MADA 1EC8A 4IMDA 4YVXA 4M24A 4BQ3A 3TIMA 3MV01 3AS2A 3FEMA 3EWWA 3PSWA 1W1ZA 4I9TA 2UV8G 4RR4A 3B8WA 4WDTA 1XQKA 1EJUC 3P8IA 4DIAA 1Y0EA 2W67A 1TCDA 4FNTA 1PCKA 3K1GA 3LV5A 5D9PA 3VXGA 4HP5A 1BPLB 2HS6A 3JZEA 4AD3A 5F4WA 3SY1A 1R2SA 3EXRA 4BF7A 1XGEA 1DJNA 3GKFA 3BXWA 4A21A 1X6LA 2QGYA 4YPJA 5BRBA 5D30A 1A5AA 4LYKA 4K68A 4CNPA 1K9TA 3LXBA 4HT3A 3LOTA 2R6OA 3BSMA 4S2CA 1F76A 3KDOA 2X1UA 1JYXA 1R2RA 2YDSA 3TSBA 1WPCA 3AMDA 3FSUA 2NQLA 1TX2A 3G77A 5SWUA 3VINA 2WQPA 2HVNA 2F84A 4REQB 1V3JA 2Z7KA 2VGGA 1ISWA 3T8LA 3W1LA 1B3YA 1QATA 1BFNA 3HFYA 3DN5A 2PLJA 4A8LA 3L0GA 1DJGA 3DECA 2Y61A 1T7LA 1FWCC 5H8UA 3RO8A 1B2YA 2FZ8A 4Y8FA 2PBOA 3HF3A 3SCNA 4J3WA 1JAKA 1C8XA 1N7KA 4C1LA 3UP8A 3KBSA 1KM5A 4Q33A 3UYIA 1QXLA 1KC7A 4I7UA 1ZNNA 1SR0A 3L4TA 1XXXA 5GNYA 3UCDA 2G4FA 1JRBA 3PPGA 1AH3A 4JX4A 4UTFA 4H9UA 3W23A 1OIFA 3CGTA 4HK7A 3GBDA 1RZMA 1CYGA 4ZENA 3QKEA 5IRPA 3N73A 4HBKA 1E73M 5L9FA 3GNRA 1E1FA 4NJJA 3ZR4A 5KETA 5M2FX 4WKAA 3W26A 2GYIA 1V0MA 2RKXA 5C54A 3PB0A 4G9PA 4JIHA 3EWYA 3NZGA 2VD9A 2FZDA 5FJIA 1YQ2A 4GE8A 4ADTA 1ZTVA 4AXNA 3LLXA 1XFBA 3CHVA 3DFOA 3P84A 1BSIA 1EGVA 3W75A 4PRWA 3OG2A 4KPLA 1K77A 3DC8A 2B7QA 2QF7A 3ZFHA 1FDJA 1BAGA 2VI0A 4RPQA 1FCUA 2ZZ3A 4G56A 2HQAA 2HPMA 3EX2A 4PBEA 4O4WA 3IGXA 2BODX 3B4UA 1DWHM 3AMKA 3BV7A 3W7IA 2C18A 3QR3A 4A05A 2X1TA 4Y9OA 4BI7A 5XIMA 4CD8A 1CXEA 4BZYA 2QKFA 3PZOA 1VPYA 3MSGA 5CAKA 1GONA 4O1AA 4S38A 1D9EA 3WLIA 3BK0A 3DFQA 3LGDA 5JBFA 1D2KA 1NDZA 5C9ZA 5DMMA 3S2MA 3UF9A 3A23A 3TU9A 5D4YA 4Q6XA 1IZJA 1K1DA 3OVPA 3EOLA 3MI3A 2EXOA 5I6SA 1BG9A 4YCOA 3WQPA 1C92A 4HMNA 5AOUA 1NTHA 1J0HA 4H6RA 1W2PA 1JZ8A 3AIBA 4O17A 2QXWA 1ISZA 3M47A 3SY5A 1AH4A 2ZRVA 1YPIA 1SFTA 5T91A 1P0EA 1VFTA 4C7GA 1JUBA 4AEFA 3EMZA 3W27A 1AG1O 1C9DA 4LNYA 1J0YA 3SSZA 4ERAA 3VNZA 5BOFA 4KEVA 1S46A 2XZ7A 4IFKA 4YYFA 3UESA 1J0JA 1HQTA 4MMWA 5BOOA 1OF6A 3UERA 2BMBA 5D2VA 2BHUA 1FP9A 3TMLA 5LA2A 3H2OA 1OYAA 3PZNA 1XUZA 1HJQA 1US3A 4M29A 4ACYA 3QJAA 1XBYA 2DZXA 4YYCA 4FOKA 3NAVA 1M6JA 3SCWA 4MDPA 3L12A 5I3GA 4IZGA 2VX4A 3ARWA 3EDDA 3NFUA 4DWSD 3VUPA 5M1TA 3GW3A 4IP4A 1VGAA 2NX1A 5A2AA 4EXQA 4Q4MA 2XN2A 1AQ0A 1AMYA 4Z1BA 2PWFA 4H7VA 3KS6A 3O6DA 1KQYA 1BRLB 1VBUA 1TVNA 3HQNA 3DFHA 5FI8A 3LPFA 3W4RA 3AQUA 1WV2A 3P0XA 3RG6A 2QUTA 2YLLA 1JFXA 4GPNA 3W00A 4U5KA 2PDBA 3QHNA 1YADA 1JXJA 1HJUA 4CNUA 1CXLA 3VCRA 3G1HA 1HIZA 3BAWA 2PTWA 4KESA 5KITA 2QPXA 1XM3A 1JEZA 2QT3A 3KRSA 5AHIA 2ZUVA 4XKYA 4LU0A 7REQB 4ATLA 2PDPA 4EF9A 4J7RA 4V2XA 5I00A 1DOSA 3WFAA 1A3WA 3K5XA 4G2DA 1JYVA 1YTEA 1XC6A 1GQKA 3GU1A 2A1YA 2XVNA 1F4AA 2VURA 1E6PA 2JK2A 2WC3A 5JUVA 3ERPA 1R85A 4ZOAA 2XIBA 4XSLA 4HOXA 3MQTA 3WQDA 1BVZA 1H0IA 1D3CA 4IIDA 3NZ1A 3W7QA 2IW0A 1F4HA 3CHCA 1ITQA 1MSSA 3GTXA 4ZXLA 5HQEA 1RPXA 1K03A 3LM3A 3ABOA 3RO6A 4LSBA 3A4WA 4KEMA 1J2BA 1SZEA 3Q58A 5CAHA 1R9YA 4RV3A 4ZO9A 3GIPA 4L1GA 2OSWA 3SI9A 1W8SA 5I24A 3GW0A 3AXKA 1PTGA 1R3RA 2EF9A 2O7QA 3HM7A 1XYFA 1JVNA 3I4EA 1EKOA 1X38A 4EPDC 1XWYA 3T08A 7TIMA 1PX3A 3WBEA 3W53A 3NDZA 4XD4A 2WPGA 2CLOA 1NELA 3W7MA 1UH3A 3TYCA 3S83A 1VPXA 1R87A 3FS2A 2GQ8A 1JGMA 4HK5A 2VNCA 4IQEA 5KSWA 4B15A 3S1GA 1YEYA 2QVHA 4BF5A 4GO9A 4ATWA 2OCZA 4JTLA 4FB7A 1B3WA 1HO1A 1EWEA 1LUCA 4L6DA 3O16A 4HZ6A 2WHMA 3C8FA 3WUFA 1HP4A 4AU0A 3VOJA 4RDYA 3LI0A 4M56A 4PMQA 1GHRA 4YIWA 4YTUA 3NUKA 1RV8A 1NFBA 1NFGA 4UTIA 2F7FA 4PMZA 4NG3A 5I06A 1ICSA 5F2MA 2QUUA 5REQA 3ELFA 1ZY9A 3NPUA 1PYFA 3TR2A 1XP3A 5LIYX 2JGYA 2O4QA 4IJBA 3QY8A 4IGMA 3IJ6A 2OB3A 1DXFA 4AQLA 3P82A 1W1IE 3ME3A 2ZRWA 3W72A 1W3HA 3KRZA 4GQQA 3TTYA 3F4NA 2YDAA 1S5TA 4W4QA 3QH2A 1JULA 5RUBA 4CN4A 4YTQA 1OK4A 3GVWA 1WXJA 4DZHA 1BYAA 4X61A 3ONBA 2RJGA 4N7QA 3OVGA 2C16A 1JDCA 4FNRA 2E77A 2GWNA 3VVGA 3MUZ1 5AHNA 1E6ZA 1KFCA 4QQ3A 2WWDA 3OBKA 4AEEA 3N2CA 1OSEA 4RZ4A 4J3UA 4N02A 2EAWA 2F9RA 2P1FA 2YOCA 1BTCA 1OCNA 4DBWA 1R47A 1RXOB 4Z0JA 1WOAA 3M5YA 1UB3A 4U2YA 1G69A 3AC0A 5IDIA 3ARRA 5KINA 3IUIA 4YVVA 4PCTA 2VZOA 4ACZA 3E0WA 3IPWA 3OP2A 3EYPA 2P53A 4UTKA 4GVIA 1R3QA 1ZBVA 1JJKA 2J66A 1H7WA 4OV9A 3BCFA 1R3VA 1BG4A 4Z2HA 3SUVA 4QEHA 2Q6ZA 5K4ZA 3URNA 3HPZA 2PDIA 3TJXA 4KMQA 4XZIA 3UPMA 4GYPC 1NEYA 1XI3A 1JZ4A 3ARYA 1F9CA 2ZICA 3RK8A 1JPMA 3UBPC 3HG4A 4A8RA 1E9YB 4NX5A 1BYCA 2OR2A 4NNCA 3N6JA 1A5OC 3AU2A 2Y5JA 4HNOA 1KFEA 3RU8X 4Z08A 1E1CB 4IJCA 1SMAA 1PIFA 1E4MM 4LC6A 3G8EA 1X6NA 4H2HA 2ASHA 4A29A 1DVJA 2NUXA 4PL1A 2WBKA 3OZYA 2WNQA 1HUVA 1F61A 2NXIA 2C14A 3MHUA 2UY5A 2J78A 2PDHA 3AYVA 2BGNE 4ML4A 2E9LA 3NYDA 1OZQA 1JRCA 3WELA 4JY8A 3OGVA 2NV9A 3LTYA 3TYZA 4XAFA 1T0OA 1A0CA 3VKCA 1ADOA 4RDZA 3A5VA 2YB4A 5EB8A 4UCGA 2C8NA 3PTDA 4BCEA 3JU2A 5EPDA 1XGDA 1NOWA 1F3EA 2FJUB 3CZ8A 1VBHA 3CTLA 1KRAC 1AW2A 2WMIA 3EDKA 3KL3A 3S9YA 1HJVA 5EMLA 2ZZ6A 4P8UA 1JAEA 3QGKC 2ZVRA 3QHMA 1AQHA 1C7TA 4C7DA 2CXGA 4GUIA 3DG6A 4F48A 3V35A 3S6OA 4O8RA 4CVUA 3ITGA 4LUYA 3P5YA 5K9CA 5DRCA 4XQ6A 3KZPA 1QNVA 4XZWA 5MF5A 1EF2A 3TN4A 3M0XA 2NQ9A 1QMLA 1TZZA 1X7FA 2DSKA 4B16A 2CEQA 4QLKA 1AFSA 1QI4A 3H53A 1XGZA 4RNJA 1PKYA 1E4LA 1RQHA 5C2XA 2PF0A 4W8AA 4XISA 4H3DA 1TV2A 3NM1A 3ZJ7A 1SW3A 5IHRA 2HCVA 1ZL1A 1W3TA 4XZNX 3GB6A 4O1EA 3EMQA 4DZ5A 3H21A 4K1GA 4PSRA 1W32A 3C0LA 1BLIA 9RUBA 2Y70A 2BGSA 3AO0A 4S3EA 1QRQA 5HAOA 4UZUA 1ZJIA 1ONEA 1YBQA 1L6SA 2VRQA 3OBAA 4Z1CA 3APTA 2HBXA 1E3ZA 4IUOA 1P48A 4H01A 4YWSA 5JQ9A 3TCEA 3LYEA 5LIUX 2OLSA 2QCGA 3WDJA 1QK2A 4MWAD 3IANA 3EEZA 1Q6RA 4Y96A 2DSZA 2ATSA 2V5JA 3GC4A 4DJFA 2X05A 3UJRA 5I03A 1GOIA 4JEQA 3ZLHA 1HG3A 4I5RA 5E9XA 1B30A 3ARVA 3DKJA 3WLTA 1EPXA 4LB3A 1OGGA 1XLFA 4NT0A 3PFMA 1EWDA 3RX3A 3KTXA 2XDFA 1V3KA 3QR0A 3IUDA 3MMUA 4H6KA 2NX9A 5FD0A 3EKZA 3WUEA 2EPNA 1VH7A 4HMCA 1UROA 1XDLA 3ZJKA 1C9WA 2WAGA 2WHKA 1CDGA 1XW8A 2X1SA 1ZRQA 2WYSA 2DSUA 5D33A 5E0KA 1UYQA 5EMUA 4MHBA 4GGBA 2V69A 1VFMA 3GNDA 2Z7GA 1GVYA 4Q8VA 3JZUA 4BQ5A 3L21A 3T4WA 1B3ZA 2DT2A 1E6NA 4RK8A 4IOTA 2I7GA 4HA3A 2HVOA 2CBVA 4QJ5B 3EDEA 2W92A 4GNVA 4KIRA 4E3TA 2PRMA 2XVKA 4ZQOA 1SO4A 2ZUMA 4ZB2A 4KFNA 5A6AA 4AHQA 1V4YA 4LVFA 4AISA 1CGXA 1JCNA 3MSYA 1ZS2A 5HA7A 3QY6A 1H1NA 4QSHA 4IIEA 2PWDA 3BANA 1QW9A 5I78A 2DVXA 2DY3A 3NZPA 2PSNA 4QE5A 7XIMA 3XISA 2HNEA 1J9YA 4L9ZA 5K4XA 2GUBA 3EOUA 3ISIX 2WBGA 2H8ZA 3W1PA 4LY4A 2MNRA 4O1BA 4QITA 5IFPA 2GGJA 2FPYA 5EMMA 2G0WA 1P43A 3G3MA 2OEJA 3MBFA 3UNTA 1R86A 4WIWA 3NA8A 1GTEA 2Y7GA 2ESCA 3GG1A 4IICA 1E1EA 3S5SA 4DI9A 1VLIA 1H09A 4UTLA 1B5TA 1D3GA 2J7DA 4LB4A 4C60A 3C8NA 3ITXA 1BQCA 4R5EA 3B0UX 3N29A 1NDVA 1T8QA 4JBRA 2VP8A 2BS9A 4MKNA 3UR8A 3WBYA 4AH7A 2IPFA 3CLMA 1KRBC 3ATYA 3DERA 5DXXA 4XIMA 3PAJA 3BLEA 1U5VA 2EJ1A 1AK5A 3SRHA 4DPQA 2E8YA 2IQTA 1DWFM 4DI8A 3H26A 5D38A 1I4NA 1E15A 4DWDA 3WQOA 2D3LA 4KCUA 4AZ7A 3QRHA 3VKKA 1XISA 2ZA1A 4WXYA 3OZPA 2YCEA 1E3XA 2X41A 1G94A 4ICMA 5DY2A 3FJ4A 5CJ5A 2VQTA 3VD7A 2B7PA 3R58A 4A22A 5A6SA 5I3DA 3Q45A 2FFCA 1GKPA 4D72A 4F0KA 1QWKA 4H9TA 4AHPA 3TUUA 3FAXA 1W1VA 1X7IA 3W83A 5T8GA 2TRSA 3W6MA 3CHFA 1FUYA 1FWGC 5BXRA 1W3IA 1JGIA 3DYOA 5C70A 3VOCA 4GXWA 1K4GA 3I6TA 3EX6A 4C6IA 4UTJA 3FX4A 1UZDA 2RJHA 3I10A 2CLKA 2QIWA 2GQ3A 1PZ3A 1BF6A 4H7ZA 3EA2A 4XBSA 5FJJA 3AFBA 1F07A 4D6GA 4DELA 1M9HA 1UASA 1MFVA 2GL5A 1M7JA 3V1HA 5BU6A 3RGTA 1E55A 3QW3A 2Q01A 3OQEA 4KCTA 2BDQA 3ABRA 1D8WA 4GCXA 4QISA 2NSXA 5M03A 3W7EA 3LDVA 3R79A 4LXFA 3QMRA 2QMKA 3UJSA 4Q7IA 3AS3A 3L7RA 3CT7A 1YDOA 1FHVA 2CBUA 3WSUA 2X8RA 1S5VA 3ARQA 3D6NA 1XIHA 3VAVA 4RE2A 3UA3A 1V03A 1Z3NA 4LUTA 1PE1A 4Z2GA 2J79A 4MY8A 1KCZA 3W6YA 4W8LA 3AYRA 5K9DA 3EDJA 3QV9A 4WJEA 1S2UA 4JXCA 3MZNA 4X0NA 1TWZA 1OJXA 3TMQA 3QY7A 2I16A 3L2MA 1WCGA 4PMJA 3GTHA 2D20A 4Q8TA 2R8WA 3T7VA 1IXOA 4UTTA 1EA0A 4AIEA 1FFRA 2OO6A 2IKHA 1XH0A 2PWGA 4U2ZA 4HKPA 2RDUA 3TDFA 4DJFC 4H4IA 1NWSA 4E2VA 2L5HA 3GK0A 1IWAA 1Z41A 3U2OA 1M3UA 2QUVA 3UCCA 4C7FA 4PMOA 3N14A 3W3OA 3USZA 2Z4GA 3MUCA 7A3HA 1LRQA 2QCCA 4RNHA 4E38A 4H9YA 1U1UA 1LL4A 4ZR8A 3IJ7A 3UWWA 5KZEA 4DLFA 2AAMA 5MKGA 2QVNA 2PEVA 3WQFA 2Z26A 1L6GA 2OX4A 3DFTA 4O50A 2WOQA 3NGJA 3T1GA 3FA5A 4B9ZA 2CESA 3RYSA 1DV7A 3AICA 1S2VA 4XO7A 1W91A 3U5YA 3SCQA 2PD5A 3GM8A 3DYPA 4EAMA 4XAZA 3WH7A 3R94A 1XIDA 1Q6CA 2INZA 2UY3A 1EIXA 3UWZA 3V16A 3OGSA 4U3AA 2HZGA 3OQ8A 1P0NA 3PZUA 1FXQA 2GJLA 2PDWA 4X2RA 4LEFA 3MVTA 3W2KA 4PULA 1DEDA 5T26A 1ICQA 4HYVA 4F2BA 2G3MA 3W71A 4GVHA 2Q02A 3LSCA 1U5JA 1H41A 1IWPA 2YIHA 1F8MA 3CL6A 2QV4A 3F5JA 4C90A 1R2TA 4US5A 3M0JA 4TO8A 1PX8A 2AL2A 3CPRA 5FJPA 3E2SA 4A3QA 3T2PA 2VC9A 3PUDA 3PZ9A 1OC6A 3DFYA 3CV1A 2Y6ZA 5CSRA 1WO2A 1XLMA 4F2TA 4UBPC 1CB2A 2BV9A 2E7FA 1ZP3A 2RH9A 4WF7A 5FL0A 2J27A 2VZSA 3NZRA 3FAWA 2E40A 4MFEA 1WKDA 5AHEA 3UG3A 2HRWA 1I9CB 5EMJA 2QUNA 3L2IA 1E0WA 3O15A 3KOXA 2VJXA 1UC4A 2GGHA 3D47A 4JX6A 3T6CA 3U8GA 2ZXQA 1YPXA 1G0CA 7ODCA 1P1XA 1U2YA 4GYJA 1E6RA 2RDTA 3NO3A 1OG6A 1LM1A 4TMBA 3W28A 2AL1A 2ZVIA 3HJEA 3L67A 1DE6A 3WUBA 5A2CA 1POJA 1U30A 3OIXA 4ERGA 3USBA 2WC7A 1TJ2A 3CO4A 4ZA0A 4FXJA 5D03A 2IPGA 3DESA 3IJ8A 1OD0A 1A0DA 4BWLA 5BZAA 3EGJA 2D73A 2XVGA 3GYEA 3VMOA 3VD3A 1HT6A 3B0PA 1TPH1 1E6XM 4U4MA 1BYBA 1CLVA 2WSRA 4JFSA 3KTCA 3LCWA 4H6EA 5CCZA 1K6WA 3P67A 2A2IA 3R4IA 4IWWA 2E9BA 3TW9A 3G8RA 1OC5A 1E70M 1MZHA 3VOHA 1MRQA 2YDRA 2PDGA 2WSQA 1DWAM 1OFAA 3KL5A 1BVNP 3GTIA 4ILSA 3UWYA 1TMLA 5MHBA 3W1UA 3BW4A 1KTCA 2E8ZA 1I2RA 5GJPA 3SIMA 4AD4A 1UKSA 4CQ8A 1Q8AA 4N2YA 5FACA 2J24A 4WVXA 4F8XA 2VZVA 3QGAC 3AYSA 2WQDA 2ZE0A 1LBLA 3PN8A 2J74A 5HWMA 5XINA 3WH6A 4IFKB 4UFHA 4ZB5A 3BLKA 1JDFA 3H2FA 4OBSA 2CNCA 3OO2A 3GAYA 4P8VA 2FYMA 4JDYA 3RJXA 3TV8A 4QAIA 4S1FA 2YW4A 3CH9A 2XSXA 5D04C 4IGHA 4IFRA 4AD1A 5LHEA 2HBVA 4XZ9A 1HKMA 3O7UA 4LUSB 3TH6A 4L6HA 3LHUA 1RALA 3C2OA 1UD2A 4AX6A 2ZZ5A 4QE4A 3G1SA 4NKCA 1E40A 1XKYA 4DBDA 2VEPA 1XIEA 4GNKB 3RM8A 1QNPA 1U83A 3ZT7A 2QUMA 1R5YA 2HNHA 3W86A 4B4HA 2IPJA 1OWQA 4D6FA 3M9YA 5F2GA 1W9VA 4KEUA 2A3BA 1VAHA 2WCAA 1XD0A 1XIJA 1YHTA 4CLMA 1NM9A 1JPHA 1L2UA 2NZLA 1OC7A 4LNCA 4EAYA 1V6VA 3N9KA 2Y5EA 1QPKA 2XN0A 1M5WA 1EGZA 3QMSA 1B90A 2DJLA 1PBGA 2YW3A 3AIEA 4RZBA 4UTTC 1TPB1 2FIQA 2GVLA 4S23A 1K02A 4LALA 6ALDA 1JCXA 3U7BA 1KGUA 1VEPA 1XBXA 4UC5A 2PDMA 4WK9A 3GBEA 1TV8A 3E96A 4UQBA 3BWWA 4HTYA 1PDYA 1Q13A 4QROA 3H8AA 5G4HC 1M04A 3K8LA 4M3PA 4MKVA 4FO4A 3P5ZA 3MYOA 3RILA 1GVIA 1TFVA 4AB4A 2PGEA 3TQKA 3H2NA 3VIKA 4GI9A 2BSLA 4IISA 1QK0A 3BAKA 3C86A 1J5SA 3WLLA 5CEWA 2AQOA 2D23A 4LYQA 3QFEA 4KFOA 4FLOA 5IBXC 4RXGA 4MF4A 3GXDA 1R0MA 3G1AA 1ML1A 3NVDA 1MEHA 4CQ9A 1H49A 2VGIA 1HNYA 2BVDA 1V0LA 1B3OA 1UC5A 3NDOA 2CW6A 3CIWA 4LEQA 1WDSA 1EPVA 3QZEA 3S6DA 1TPVA 3EDFA 5BOEA 4ASTA 1UJPA 3QYSA 4GIEA 3STCA 1TV4A 1HFBA 4AZ5A 1LP6A 2OQLA 2PFHA 1FWSA 1A5SA 2QCDB 2VFHA 3DUGA 3EOEA 4UOQA 3WJZA 1EXPA 1V79A 1R7AA 3GH7A 1ONXA 3H54A 3CUZA 1F5ZA 3UFYA 1CWYA 2DW6A 4GBDA 1R3WA 1QAPA 5DX7A 4P7QA 3IIOA 4RE4A 4Q8OA 1N55A 4JYFA 3WD0A 1OABA 3I68A 3ZVHB 1H0GA 2ZX5A 3B40A 3SEPA 3B9OA 4JS3A 2CZEA 2QULA 1P0DA 4KWWA 2B7NA 4S3DA 1XLGA 1QI5A 1LUCB 3VGDA 1B9ZA 1L6WA 1ZCOA 1DIEA 1K8YA 3ALFA 3BZJA 1NH6A 4K8HA 2FHBA 1UP0A 1KGWA 3E2VA 1OX5A 3VCNA 3G1FA 1FH7A 3VCCA 3TKFA 4B5TA 3PZMA 5I79A 2O9PA 5D8ZA 4AZHA 1HKJA 3QFWA 3TR9A 1I60A 3NJ3A 3SM0A 5REQB 3SECA 3R13A 3WQ8A 2XGIA 1B1YA 1KBIA 4OBTA 5LSMA 3ANUA 1UR8A 3U48A 4UNIA 3WLOA 4DWSA 3WNKA 2QQ6A 4HHMA 3CMJA 1UZ4A 5DMLA 5GNXA 2I57A 4UFKA 3TJ4A 2E25A 1XIBA 3AWNA 3P74A 1QI3A 4NU7A 3TTSA 5TF0A 3GQYA 3QSTA 4UIOA 1THFD 3WMCA 1A47A 1QW8A 4GXPA 2X2YA 2V5KA 1QPQA 2BLEA 2FDMA 2ABBA 3E38A 3NEHA 3A4XA 5HWNA 3NL2A 1PZ1A 3GHRA 2DPEA 1QI2A 3OLIA 1BWLA 3P3BA 1X1ZA 4EWND 2ZRUA 1KBLA 2P10A 1GW9A 2QDHA 5CJNA 3L4WA 3TW6A 3WQEA 4XZBA 2QJMA 4Z2JA 4AY8A 4WKFA 2QYGA 5GVJA 5HJXA 2XN1A 4Q8PA 2CCRA 3FVMA 4YNGA 4JIIX 4WOZA 3R11A 4YS1A 1HP5A 4CN1A 4CU8A 3RPMA 3GXTA 1JZ5A 3TA9A 4Y6GA 3N4EA 4S3JA 3STPA 4K38A 4FALA 4NZ3A 4M51A 1GWJA 2C79A 3U4FA 3RU6A 1VJSA 3BJFA 2XSBA 1V6XA 4AIBA 4DAFA 5K2ZA 1JI2A 5E1QA 1KCXA 2RDXA 3S5NA 5HR6A 5I7GA 3TC6A 1W9PA 1UOZA 4WXZA 3G6MA 3BLIA 5AC6A 2XFRA 4JY9A 1RJQA 1REQB 4TUFA 2P3EA 3LHYA 4GABA 4XD3A 3ENLA 2ALRA 4J28A 4GVFA 1NF7A 1GQNA 1BQGA 2F38A 1QO2A 3TN6A 2W6RA 1V3HA 2GVJA 4GINA 4P7RA 4JFVA 2F6XA 4JYDA 2D24A 3SY8A 3G0SA 2PU1A 4NXKA 4JTHA 1OBAA 1UD6A 2J8GA 3AIVA 8TIMA 4GH1A 3O1NA 2CPUA 4HVXA 5I77A 3DHPA 2OO0A 1VENA 1EQCA 1OT2A 4MPQA 4CCEA 2ZFAA 2YX0A 2G97A 2V5CA 4F0RA 2JE8A 3B05A 1XJBA 3LGGA 3CPUA 4S39A 2JQXA 3QZ6A 2VMFA 4U5IA 1HKKA 2XIMA 4D6HA 4JIQA 1R3YA 3EX3A 4NRRA 1BRLA 1ZZMA 3W38A 2OODA 3BOXA 1POKA 2VZTA 4KRUA 2OWXA 2WPBA 3CXOA 4QX4A 3SUSA 3VDCA 4NIRA 1DHKA 3JUGA 3NO1A 3MPGA 3BV4A 1IIHA 1NWRA 2WM1A 3RXZA 3VDHA 1Q3NA 2NLYA 2FPVA 1YXCA 3QC0A 2A4AA 2WNZA 4LT9A 4F79A 3BSHA 1Y65A 2DZBA 3O0KA 3S5YA 2XH7A 4JN8A 1AJ2A 4NHVA 1X39A 2DUZA 2G3NA 1KTBA 5CBIA 7REQA 1FDZA 2J7GA 4LQ1A 5I23A 2WNWA 4R88A 3MKKA 1ME9A 3PM6A 4ES4A 4ZQCA 1KNWA 4HOZA 2E5BA 5C9WA 2PUZA 3DEQA 1TPC1 1W5MA 3VMPA 2DJXA 1UUOA 4GYFA 3PK7A 1L2QA 1IYXA 1ZJHA 3GG7A 4B90A 3N04A 4Q8QA 2FLIA 4C6JA 3KBJA 3CO8A 4GGHA 2V9DA 5A6TC 1LQAA 1O6IA 1OY0A 4JL1A 3VC5A 3LBMA 2OZ8A 4NILA 3M41A 2HROA 1GQJA 1W5QA 3DIPA 3BC9A 2IUZA 3KWSA 2DT3A 3BMVA 1XC4A 3CK5A 3W02A 3CUIA 3UJFA 2VXNA 4TXEA 3R25A 3QPYA 4QFUA 1NVMA 3E0FA 1OINA 1TPUA 4DHGA 3IRDA 1UR9A 2J7FA 2DSVA 1FHLA 2GK1B 4V33A 1MUMA 2DH3A 1WZLA 1ZSXA 1UKQA 3RR4A 3CT2A 1PDZA 4KWVA 3QLDA 2NSOA 3ECQA 3PPHA 4C1NB 1C90A 3UXKA 1OVDA 4UTWA 4O0QA 3UCQA 4QNEA 3K1DA 3ZLGA 2OZTA 3IAPA 1R3TA 4D1JA 5LYRA 2CU0A 1JL8A 3NTYA 4HPGA 4FLSA 1CX9A 1BSLA 2Y7DA 1SO6A 4FR1A 1K3UA 1ZUAX 3TQ0A 1E51A 3RLHA 5CPMA 4Q7NA 4DWSC 5HNTA 4FP1A 4A4AA 1GOKA 3HZ3A 4ML9A 3VZZA 1SZGA 1VHNA 4M6VA 2Z24A 4X60A 3LERA 1D3HA 4TV5A 2ZQ0A 4DJEA 5JH1A 3BLLA 3M0HA 5H6HA 1ISXA 1QVBA 2CYGA 4ZO7A 2OZ0A 4LOCA 3BLPX 3P14A 2OJPA 1RHCA 1UD8A 4KIEA 4AYSA 2FH8A 1GORA 5HUPA 2IKJA 3IIPA 4TVDA 2DW7A 4GUGA 4I7VA 1O5KA 1V6WA 4FNQA 5EBAA 2CZFA 5A8GA 1TO3A 1TA3A 3CQHA 1WDWA 5LXEA 2EJAA 3AUOA 1MYRA 1TCMA 2C0AA 3F1QA 1G67A 3SSJA 3WK0A 3KM8A 1BHGA 1VF8A 2NVCA 1JXKA 3AIWA 5DMYA 1RBAA 3CL7A 1IXNA 1EX1A 3EZ4A 3VKAA 3W1QA 3S47A 3UR2A 3WQ4A 1ZFJA 2ZXDA 1FRBA 3VUSA 2HE5A 3G0UA 4I9JA 2X30A 2PURA 5C9RA 4ORMA 4PB5A 1PKNA 4PMUA 4MY1A 1PIIA 1U22A 3RAOA 2UY2A 4WDUA 4IXHA 1WA3A 3UW6A 4DO4A 2A3CA 5HNNA 4KRZA 1WKFA 3EKGA 1CENA 3AHVA 1Y5VA 1DWGM 1HXJA 3VTRA 1GVOA 3TSMA 5DEZA 4LPCA 1UKPA 4M1RA 3GDLA 3GFZA 3EA1A 3IARA 3T9PA 1E1CA 3WQVA 5CC6A 1XSKA 4INFA 2HISA 1D8CA 4OTKA 1VBGA 1IXQA 4CU6A 3Q37A 2PLMA 3JRKA 4K7YA 3OB8A 3W1TA 4FF5A 4IPPA 4J2PA 3BOLA 1W9DM 2F6UA 1CECA 3MC5A 2UZ9A 3KX6A 3L66A 2ALDA 2YPIA 3LA4A 1ZCCA 1XBVA 4PUNA 1PAMA 5A95A 3A47A 4DB7A 3QMTA 5I0DA 1A5LC 3E0LA 4WDXA 4HIBA 3TJLA 4PTXA 1FWDC 5DANA 4PUJA 3CV7A 4JTEA 1YW1A 4QM1A 3WLPA 1BGGA 4PFMA 1SU5A 3ZJ8A 3W70A 3TXZA 4DNMA 2P0OA 2GVEA 2D0HA 1XSIA 2CWNA 1TUFA 1ZALA 3G0XA 2QW5A 3HPAA 2WJEA 4XVDA 5I02A 1E9ZB 3NGFA 3W07A 3NSNA 4UFLA 4QHRA 2DZWA 2WK2A 3A3XA 1QNOA 2EKGA 4W89A 5EA9A 4BJHA 3R8GA 3SURA 3N9SA 3O6YX 3DI1A 3UXLA 5HUOA 2J47A 3UY7A 1LL7A 3M44A 4JIRA 4Q22A 1Z44A 4JOMA 5CH9A 3LPPA 3TCSA 1PX4A 3RLGA 4J27A 3QQ0A 3BL3A 3F4VA 4HMEA 4D8LA 3EAUA 5ABFB 3TN5A 3A9IA 1EP1A 4I3GA 3THCA 3WY1A 3VM5A 2XWEA 1J6PA 3M0KA 5E5CA 5LNRA 4K2SA 2J9XA 3NVTA 3KWXA 3W9ZA 3EMCA 1TJ1A 3CTTA 1EBGA 4PCNA 3QBUA 5U7SA 3PFRA 1XG3A 3NWRA 1IR1A 1YYAA 1H1ZA 3EWBX 3QV8A 5ABGA 3AIQA 4H2CA 4Q8NA 3ZT6A 4HPXA 4UWMA 4QR6A 1NY1A 2V2CA 1JG9A 3VZYA 1VEMA 2CKRA 5FKYA 4LUTB 4LS1A 3CZEA 3DG3A 3JR2A 3KXQA 1VCVA 3TZNA 1XIIA 3IJDA 1JPIA 2J4GA 4MM1A 4AZIA 4AIUA 3PS7A 3UZYA 3IJIA 2V67A 2DGAA 2ONEA 2WHJA 3L4ZA 5AC5A 3UQNA 4IHCA 1UD3A 1PPIA 3DFSA 1X8CA 4GIRA 1LRTA 3POCA 4LAZA 1DORA 3CUJA 1XSJA 4CNTA 1OGSA 5FIPA 2NUWA 4W5UA 1C93A 4B4FA 4HSOA 3NQAA 4N4PA 4O28A 3CAKA 4OOZA 1NWTA 4O53A 2RDWA 3OYZA 2PWVA 5IOBA 5E6ZA 3N2XA 3SUUA 3FJ6A 1GHSA 4UTWC 4LS0A 2ZX7A 4JTKA 3UWUA 4ATDA 3CAQA 4IP5A 3F2CA 3IIXA 4M8UA 5HK4A 4N6FA 5AFDA 5D9OA 2EHHA 5MKGB 1D7KA 1WDPA 3BSGA 4FMVA 1O5RA 2GDUA 2Q71A 4DF1A 1TR9A 3QM3A 3GU9A 1T96A 1QO5A 3THQA 5M17A 3EBVA 4JL2A 3BJSA 4UNKA 1PTDA 2ZZ2A 2WW5A 2X42A 2OYMA 4DRSA 4NJKA 3W7GA 7PTDA 3H7VA 3W2NA 1XINA 1W1YA 2FTPA 4DJDD 3VKJA 2AKZA 2J62A 4QGCA 1JCJA 1MQPA 3PWGA 4O0KA 1V7YA 3E0VA 4M0XA 2V38A 1F6KA 4I5XA 1BKHA 3R1ZA 4Q8MA 2AQWA 4JFTA 2CBIA 1MXGA 3SAZA 4LF1A 5CC5A 3GIQA 1YXDA 5GPRA 5JU6A 1ZQ5A 2VCAA 3A13A 1EA9C 1AMKA 1IGSA 4WSHA 3FDGA 3R8RA 1SJAA 1HVQA 1V0KA 2PCQA 4E3VA 3U0HA 4HU3A 4X9YA 1UR1A 3A3HA 5CPTA 1S5MA 3MKVA 4FZIA 1K7FA 4HHHA 3C2RA 3UPWA 4Z2LA 4OKDA 3GD6A 3RLVA 2BTMA 3VIJA 9CGTA 2E09A 3WDPP 2GJRA 5DRIA 1GG1A 5J5RA 3W7OA 1UD4A 1J93A 3LB0A 3MS8A 4LTSA 3N2OA 3S2LA 1WZAA 2JFEX 1E5JA 2ANUA 4NYYA 3CWHA 1EDQA 3VOFA 3NEVA 1JR1A 5F1VA 1A0EA 3XIMA 4JTGA 4DYJA 4L7ZA 1PSCA 2NW0A 1JF5A 1FDYA 1ISVA 3EXSA 5G1MA 4A3HA 4GNJA 3GNNA 4C91A 5HATA 3WKZA 1ITCA 1TELA 3H22A 3AJ7A 3N15A 3MMWA 1GYMA 2HV5A 3MUAA 3NQBA 6PTDA 1RBLA 4H00A 3CYJA 3O3RA 1PS9A 2UY4A 3SB0A 4MNJA 3ZXWA 2AGTA 2RAGA 1KCKA 3E0IA 3L5LA 4W9TA 4WUIA 2VFIA 5F7UA 4QRNA 3RUBL 1S2AA 1PV8A 2XPKA 1R38A 3D5HA 4LVAA 4PTDA 1J96A 3QHOA 4F40A 3VIFA 4TOQA 4ZTYA 3T0CA 3VK5A 4XSMA 1QHPA 4MUZA 3HN3A 2PDNA 5F4SA 2Y62A 2QR6A 3EB2A 1MDRA 4MWAC 2F61A 1PHWA 2PTXA 2FB3A 2JGQA 2V68A 1W1TA 1QCWA 2ZADA 3LEPA 1XPYA 2ZWYA 1H5YA 4O1DA 3G5EA 4G1NA 2Y7EA 3VD5A 2ISSA 3BH4A 3R0DA 4ZOBA 3V18A 3P61A 3IJLA 4S2BA 2YFNA 1X1NA 3L4XA 2QHAA 1OGBA 4MJMA 1OCJA 4LV4A 4K36A 3LTSA 1JCMP 1WYIA 2ZUWA 4G1KA 5KMYA 3I3BA 2WZEA 3UEQA 3LHWA 4L6OA 5DQPA 3IVUA 2NXGA 3P8JA 1VPQA 3B3DA 4F3HA 3QTPA 3AIUA 2W91A 4B2DD 2DIKA 4LUJA 2CLMA 3WENA 4ZQNA 2Q8LA 1SUXA 4GZEA 1N8IA 1VYPX 4YHGA 4GY7A 1M7XA 4YXGA 4CQAA 1G7UA 3R7MA 4IGSA 3HQOA 3SBFA 4QG6A 1DJZA 3MBDA 3K8KA 3K30A 1TIWA 3RDKA 1KBJA 4FIRA 4IPIA 1WDRA 1Z32X 4UQCA 2JALA 3ZSSA 2CHOA 1SZRA 3HG5A 4ZCWA 2BHYA 4KF1A 1W2VA 5E70A 2AAAA 3UZXA 2VFDA 3WEOA 1UA3A 3WNMA 3UGRA 2X09A 3U2EA 3O63A 1FKXA 1HGYA 2TODA 1KKRA 3L0NA 2E6FA 3CL8A 1WDQA 1GQIA 1UR4A 4IQLA 2PB1A 2QJIA 1OFQA 1V93A 4NUWA 2VZUA 3DH7A 5A6KA 3VNIA 4JZ5A 3UPBA 5HWJA 3WF1A 1UBPC 3GO2A 4GUJA 2OSYA 3N6QA 1SW7A 1X96A 2J9YA 4MSSA 4OOUA 3ONCA 5CZJA 3WUGA 3IVTA 3TA6A 2Q09A 5D02A 1OEPA 3ARUA 2W66A 1F3WA 3L4UA 4I90A 1PZ2A 1AQFA 1JF6A 1SYTA 1XLBA 3R43A 4NZCA 3QZAA 2TMDA 1TQXA 1WKYA 3HG2A 1MQQA 4MNKA 1AZ1A 3OLDA 2Y5SA 1K4HA 1GVFA 2NQZA 1LTDA 3CQJA 3W7PA 1GEHA 3U2ZA 1H7XA 2Y63A 4B91A 4GX8A 1F74A 4PB4A 3WDHA 5CSYA 1M7OA 4Y9MA 3T78A 3LQGA 3BGAA 3F4DA 4U3CA 5CSSA 4C6OA 4L4LA 2I5GA 2OMAA 3W01A 9XIMA 2WWCA 3NXFA 4GYKA 4NASA 3SCPA 1V3IA 4IP7A 2J7HA 4NZ4A 4P2VA 1CBGA 2QJJA 3PJWA 2NXHA 4DF2A 3NSMA 1G01A 4F0SA 3N3TA 4EXAA 1AW1A 3T2QA 4HD5A 5C55A 1LT7A 3K4AA 3HOJA 3FW6A 3JVAA 4UFJA 1WP6A 5I3KA 3PHAA 2EPMX 4NF7A 2UWFA 4MZYA 2YYTA 2QLYA 2YGYA 4YU1A 3UZZA 3K4DA 1GTHA 4CQBA 2Z6JA 1TX0A 1L8NA 2PZNA 2Y89A 4NZFA 4B5VA 1LORA 4OQVA 1L8PA 3NYZA 1TJRA 4HPHA 2E28A 4QG9A 2OELA 4BFAA 4F2UA 4S3BA 1OK6A 2OLHA 4E2OA 4P7LA 4D71A 4JTUA 3MYPA 1W1PA 4HZMA 2VELA 2UBPC 5ECUA 4E4UA 2BB0A 3WQGA 2X0SA 1A80A 2WJDA 3FV9A 3G3DA 5LXXA 2OWWA 4XBKA 3VNJA 2Y4SA 4J3VA 3NURA 4MJ2A 4PMXA 4HNTA 4FNUA 3GZAA 5CG7A 2JIEA 1IZCA 4PYSA 4W7UA 4H6QA 5D8WA 1YTDA 3O6CA 4J9JA 3ITTA 5CQ1A 4MAVA 3W1RA 3F4CA 4E8CA 1EZWA 5BU9A 3VNLA 4LANA 4JNZA 1SMDA 3FSTA 3NL6A 4EP8C 3MCOA 3EA3A 4C5YA 2PI6A 4W7VA 4DWSB 1C7SA 3BICA 5A5WA 3WBWA 4V27A 4RV8A 4L80A 4RDVA 3EX1A 1E0UA 4C6KA 2VCCA 1TWWA 4XD6A 1VLWA 3PAOA 3DKLA 1JQVA 4HPJA 1VD6A 2J7CA 1CPUA 3VD9A 3WF2A 5HNRA 3KHJA 4WCJA 1A5NC 4URIA 3VNDA 1TIMA 4GK8A 4ICCX 1EXBA 2VT0A 2VFFA 4QDPA 4CD7A 1MW1A 3CUHA 1Z69A 4H1ZA 1KD0A 4FSAA 3D46A 3OYXA 2FFIA 1UA7A 4BF9A 4MFDA 2V2DA 1EJSC 5CZ0A 2VUNA 2DZPA 2FZNA 3N3MA 3ZZ1A 3BVJA 3VIMA 1OD8A 3PWIA 3MZ2A 4J5NA 4DF0A 2OYKA 4L4OA 2NWSA 5AB3A 3DGRA 1CW2A 4D8ZA 5DY3A 1UR0A 3STEA 4E5TA 1U1JA 3BGJA 3FOKA 4XTIA 5GNZA 4TV6A 3SCVA 4GQBA 2PDQA 3MP4A 1UMYA 1QT1A 3MCNA 2HE8A 1Z9AA 2YXOA 4U31A 1PWLA 4LAUA 4P7NA 3HGSA 2OX1A 5CC7A 2VX6A 1H3GA 2BG5A 2ZZ1A 2CETA 3UZ5A 5EMYA 3KP0A 1QASA 2WLZA 1XH1A 4GYPA 1HL8A 1BKSA 4RDWA 2ZC1A 2ISVA 4H8VA 5JIPA 1HJWA 4Q32A 4IXXA 4JEJA 2Z1BA 2XIQA 1ZLPA 3F2BA 2FKPA 4Q4RA 4PB3A 1KV8A 5EBUA 4Y8EA 1Y5XA 1MDLA 2Z0IA 5IFTA 3IUHA 4A8NA 3WLRA 1X6UA 3B9NA 4EX4A 4LUSA 1IE7C 1ESWA 1Z89A 4L5ZA 3AXHA 5I3IA 1P0BA 1P6CA 4I5UA 4R34A 3MB9A 1NWUA 4DN1A 2PP1A 4TVCA 4ZODA 4ZQMA 2YB1A 4N9CA 1MXDA 4POCA 3AU6A 3BW3A 4LVGA 1I45A 3CZGA 4GX9A 2A21A 3LENA 4LC8A 4AHOA 1T41A 4I6KA 5BRQA 4R9OA 1JZ6A 1KFBA 4DUOA 3ABXA 1GW1A 4IGNA 3AISA 1X8FA 3LZ5A 4FS9A 2ZDSA 5C7HA 4KWOA 5FAGA 5AC4A 3V7PA 3U57A 5CBJA 1MEWA 4UB9A 3PNUA 5HMDA 2WSYA 1LWJA 4KRTA 5BXTA 1B9BA 1GKQA 3BZGA 4NX0A 2YYUA 3LBOA 4DQWA 4ZOCA 4JKLA 4EIVA 3GXPA 3UG8A 3E02A 2PDCA 1TPEA 1GT8A 1JYWA 3FGCA 2GGIA 2J25A 2ZUSA 1FA2A 2V30A 4MKSA 3QC3A 1XUUA 4ZMGA 2XFWA 3EPMA 3N18A 1K9EA 4Y9NA 1WAUA 2A3HA 1RK5A 4MJZA 1GVRA 4EACA 4D9PA 4C6NA 3QPZA 1EH9A 3UZJA 4PRRA 1AJZA 1W9BM 4TTGA 3HTWA 1C8VA 5A6MA 1B57A 5D32A 3W25A 1F7BA 9XIAA 1R9ZA 1KM2A 3IK2A 1MEIA 4RW5A 4TR9A 4O1CA 1GYNA 1XLEA 1VFUA 2X40A 2ZWZA 3BLFA 4C6FA 2QCHA 5CGTA 3W2MA 1RBOB 2TPSA 4LGXA 1WE5A 2B4GA 4R33A 2QCDA 5U4NA 2P5NA 4W87A 2NT0A 3T0DA 3EXTA 3LLDA 1ZHAA 2QDEA 2BY0A 1J18A 4ZO6A 1HW6A 3OG3A 4HU4A 2PCEA 5JIWA 4P5UA 4EKJA 1T99A 5A8NA 4KERA 3RM4A 2GSHA 1VFLA 3UWQA 1FWJC 5AZ0A 4YMZA 3O07A 3EOOA 4PUMA 3RN6A 3MJYA 4DZAA 4GQGA 3M43A 1Q65A 1GEQA 2YXXA 4HA0A 3ZVHA 3WFZA 5LGXA 2V3GA 2FTYA 1KGXA 2Z27A 2Q8ZA 3UA4A 3V3WA 4XAGA 4GBUA 1BYDA 5DLCA 1XD1A 1EHNA 4WX2A 5I5RA 2E5CA 3PP7A 4LAKA 3GAKA 1LQ0A 3MANA 1I6NA 4EWJA 3KAOA 1R6WA 1ZGDA 4C65A 1TMQA 1W1B1 2OQHA 1H63A 1J11A 3KVLA 3VZXA 6A3HA 3S8HA 1J79A 3FHQA 2V6AA 2OKTA 3QF0A 6ENLA 2BOFX 1HVXA 1S39A 2P8BA 4QQUA 2VR5A 2OYLA 1IT0A 1Q6DA 5HMFA 2YZRA 5ABHA 3M1ZA 4KBXA 4CVWA 1XIMA 4Q8UA 1YLVA 3OVQA 1TUXA 5FESA 4O16A 5EGRA 1FWNA 4FPSA 3PPFA 1LT8A 3W29A 1NF0A 4O54A 4S3GA 2PMQA 4EK7A 4AWEA 2G50A 2PAJA 3BMWA 4NJHA 2ZDRA 3W22A 4C6DA 1G5AA 1RSCA 1B3VA 2DZVA 3SCTA 1DWJM 4D2JA 1UCWA 1UWRA 4P61A 3C0SA 1G4EA 1R30A 2Y1HA 3W81A 1GJUA 4UR8A 4GIYA 3SCOA 4AZGA 4H9ZA 4E4FA 4ZB0A 5A8MA 1ICPA 3W84A 3CS2A 5IDZA 3KOWA 4DBEA 1TA3B 1VIWA 3E9AA 3KHDA 2GVGA 3RPTA 3U5UA 2DQXA 2VD8A 4GI8A 1UR2A 3CH0A 1JUKA 2I17A 3GVVA 2HVMA 4S3KA 3AUJA 1EJRC 2OQYA 2YCIX 1F6YA 5LKYA 4IMGA 4C6QA 1FVPA 2FPTA 3GG8A 3COTA 3FY1A 3W1AA 4JTIA 3S1UA 4LY8A 1LZOA 4WDWA 3II1A 3NM3A 2E68A 2D22A 3ZMRA 2QAPA 3WDQA 5EMKA 3I7SA 4PMRA 4GQRA 1LLZA 1KRCC 4A2RA 2B81A 2GQAA 1XIFA 2GJPA 4RPPA 4ROQA 4L64A 1R46A 1UPPA 3GH4A 3A5FA 1REQA 3LMYA 3Q94A 3B9DA 2JF7A 1KWKA 4AMAA 4RZ6A 3W87A 2KZHA 4UTMA 2W63A 5AYBA 3K13A 3MHFA 4B3ZA 3H12A 1Q6GA 3WG6A 4NZ5A 3AZTA 3C2EA 1Q7ZA 4B5SA 3GTFA 1CGWA 2FZ9A 3BCDA 4I9MA 2Z2BA 4R9XA 4G5DA 2FQIA 4EXBA 2I1OA 2ZOXA 4FHAA 2VEGA 3EPOA 1W5PA 3GFXA 1TJPA 3FA4A 1RCXB 4MWAB 1UUQA 5HBFA 3RF9A 4WLCA 2Y2WA 4O14A 3OHMB 1X1OA 3QLLA 3TP4A 5K9XA 5FJUA 3NXLA 4QSFA 1Z48A 1W3JA 3KBVA 1S38A 4AW7A 3ANVA 4XV0A 1P1MA 4D6IA 1A49A 5BYWA 5AY7A 4GQ0A 3GHUA 3NQDA 1WZKA 2V0TA 1Q7MA 2OWCA 3GXIA 2Z6IA 4N6EA 3LSBA 1GZGA 2VDHA 1IEWA 3UVAA 1TPDA 3KDNA 1OX4B 2F6KA 3QOKA 1T40A 3UXIA 2BBFA 3MO4A 3CUXA 1HO4A 3GDMA 3QVQA 2ZTKA 3B8IA 2XYLA 3AROA 1IF2A 3NO5A 3HGOA 3TONA 1FFQA 2O55A 1GK8A 4KCWA 4XO6A 3RMJA 3M0YA 1Q2RA 2VC6A 2DV0A 3CAWA 2VOTA 3ZR5A 2QS8A 4CQCA 1IT7A 1XLJA 4DVOA 3SCSA 2JIWA 4GO8A 3LPOA 2E1DA 1XPGA 2J8TA 1GOMA 1GOXA 5FEWA 5BCAA 3ITLA 2WZMA 3MUIA 3V5OA 1QPOA 5CLTA 5DCDA 3IV8A 3UZWA 5FOOA 1Q6LA 3VX0A 1YDYA 1KKOA 5F1UA 4F0MA 4C6EA 3GUWA 1V51A 3RCNA 3B97A 2VFGA 2RFGA 1EEPA 3VE7A 1ODZA 4RZ5A 4N0RA 2PWUA 3H24A 1CXHA 1CB7B 4V1YA 4JIPA 4EOUA 3N13A 1XYBA 3LN3A 2GGEA 1WZMA 5A69A 1XQLA 2HXTA 5G5IA 4N9BA 2CIPA 1OFRA 2NWRA 2PWHA 1TPFA 3PJTA 4FOJA 3W85A 2A7NA 4QEEA 3VU2A 1EIBA 3M64A 5HPCA 1YE6A 4H7CA 1O5QA 4C1KA 3PB2A 2QZRA 4R53A 3W7NA 3G18A 2H9AA 2GK1A 3WFLA 2ADAA 4IF2A 4G7EA 1EP3A 2C1HA 4AY1A 4DZIA 4HYRA 3W7RA 2EO7A 4GUHA 1DP0A 4C1NA 1ECQA 4NL1A 1H11A 1IEVA 4F9DA 3FK4A 5B7ZA 4HCLA 2VWTA 4O13A 3WK1A 2FJKA 1W3LA 1DE5A 1W6TA 1A50A 1ALDA 4GZ7A 5I3JA 3U6WA 4HN4A 1XIGA 3C4UA 3CQIA 2NV2A 2PLCA 2XISA 4EE9A 4UQDA 4BQ2A 3NPWA 4K3ZA 5J5DA 2QPSA 4ZE4A 3I65A 3L5MA 3V4BA 1SZNA 1XICA 3L2LA 3S5OA 2OT1A 4NAFA 3S0CA 3UJ2A 5BROA 3QQ1A 4YTTA 2F2KA 5A3HA 4JHOA 3DFPA 1PCWA 3DENA 2BASA 4MJ4A 2X1IA 2D69A 5HNUA 1QUMA 2SFPA 4HGXA 5FEPA 3JW7A 3IEBA 4C5ZA 4PFHA 1V0NA 3KOYA 1VS1A 4LYPA 2W4XA 3KRUA 4E8GA 4E6MA 4TMCA 2O7SA 1TTQA 3SFWA 4MZ8A 3ID7A 2CHNA 3QYQA 2WKLA 5JMUA 1YIXA 4PR4A 3TTEA 2G3IA 3NQMA 3KFTA 3SCRA 3UETA 2HEJA 3AXMA 3WMBA 1M03A 3S9ZA 1XLLA 1QOQA 4ZXOA 1FKWA 4JAWA 1E71M 3TW7A 1XS2A 5EFDA 3FHAA 3VGGA 3T81A 3O06A 1WNOA 3FN9A 5HINA 4M7TA 4Z17A 5FF3A 3LK6A 4JR5A 1QOXA 5FEXA 1U1HA 1YNPA 3S6TA 1YDNA 2DVUA 2VUYA 5I07A 2A7PA 1C91A 1VR6A 4L65A 3A12A 5G1YA 2NVAA 3UR7A 1B3XA 3W24A 2R1MA 4DPPA 1GOWA 5EKYA 1W17A 3TYDA 4X3ZA 1DPMA 1UQZA 2WXDM 2YDQA 1SO3A 5A6LA 2PS2A 2PWEA 3VILA 1OG0A 3ALGA 3GWQA 2OXNA 4DNHA 2HK1A 3NQ8A 1XLCA 5F4XA 4UR9A 1XL9A 1V7AA 1XBZA 1GQLA 3KLKA 1ME8A 3MDUA 4NVTA 1FH9A 1RLCL 1H62A 2V5BA 1Q6QA 2C7FA 2H90A 5GQBA 1QJWA 3ARZA 3MDWA 5AVNA 4Q4KA 3T4CA 4M81A 1HKWA 1TV5A 1S2CA 2EQDA 3TEVA 3GNOA 3B8DA 3BARA 2NLIA 5CKSA 3BE7A 2XINA 4C6MA 4CD6A 1CXFA 3W2LA 1QBBA 3RX4A 2C15A 1J8VA 3EWCA 2PTDA 3UR5A 4JTQA 4PODA 1ZB5A 1VFOA 2PGWA 4LWWA 1E4NA 5DFAA 5F2IA 3DC0A 2HJPA 1PXGA 2HPIA 4U33A 1UD5A 3AYTA 3AI0A 2AQVA 3E5PA 3UNDA 3LS9A 3WNNA 1TV3A 1YKWA 3VDAA 3EX4A 2W27A 4OIFA 2BGQA 2J75A 3LNMA 1DKWA 4JHMA 1NQ6A 4JTSA 4KGLA 4DJDA 3I3EA 3AALA 3WX7A 3Q4DA 2GUUA 1RQBA 1FWEC 5AN7A 5H1WA 2FZBA 4MAZA 3IACA 1IHIA 3ITVA 5ABFA 4DAIA 1WX0A 3M0MA 3CYVA 3WO8A 5AKQA 1MUCA 4GIAA 1I8JA 1HZYA 3APGA 3S2JA 2WVTA 3C0JA 1TRIA 2ISWA 5CGMA 4O1FA 2NQHA 4UTUA 5D2XA 4H83A 1A5BA 3WNOA 1NAL1 1US0A 4IX2A 1WDDA 1PUDA 3QQWA 1E9LA 2TSYA 3T42A 1UMLA 1JPKA 1AODA 2P50A 1FCQA 2P88A 1JI1A 3AMGA 1P6BA 4V1XA 5A6BD 2WKJA 3RMEA 3H4XA 4UOZA 3MCMA 1MW2A 3IWPA 4ROPA 1RP9A 4LS2A 3D3FA 1XRTA 3OPSA 1FWTA 5D2TA 4IX0A 2H3BA 2XUCA 4PTMA 4GJJA 3LCHA 3RR1A 4TTUA 3IGHX 4RUBA 5BWAA 2E5DA 4TVUA 4Z1DA 3KP1A 1A4LA 2J6VA 3L23A 4NP7A 1JQXA 1XRSA 1FXPA 3PZGA 3NQGA 4IG2B 3NDYA 1CGTA 1FP8A 4CCDA 2OKOA 1ZBKA 4O15A 2IMRA 4ZTXA 3W1MA 4FX6M 5D9NA 3HQPA 3NQFA 3H2EA 4Z2IA 1U5HA 4PMDA 4EF8A 2DSWA 1OFDA 1LBMA 4PBFA 2WVVB 1TYGA 4ECLA 1CCWB 3FDKA 3O0FA 1HKIA 2JKPA 5LHFA 5IBXA 1GUVA 2C1GA 4QS5A 1B54A 4Y9AA 2RHGA 2OFJA 2YBUA 2DDXA 4DM2A 3CIVA 4LBRA 2EGZA 3WD3A 4NRSA 3ZLFA 1XF0A 2PC8A 4QJ1A 5LIWX 4ENLA 5DXYA 2A6LA 3W88A 1DXIA 2QCEA 5TIMA 2XGZA 2ISFA 1V6YA 7CGTA 2DEPA 2Z29A 1I0BA 4WHBA 4U28A 2O9OA 5TNVA 8A3HA 4NNAA 2MUCA 3LX9A 2ZRXA 3SZ8A 3PZQA 3DAQA 3CUGA 1XH2A 2BXZA 3GNXA 2J7BA 3WH8A 3HB9A 1A5KC 4HA1A 3GVQA 3NQCA 1DHPA 2VGBA 4OE7A 1FQ0A 4B2DA 1X97A 3P6LA 1TG7A 3RITA 3NCOA 1MNZA 2I14A 3VYLA 5AHMA 5I09A 1M7PA 2VKZG 4GH3A 4W5ZA 6TIMA 2CLLA 3SDOA 3AIRA 4JTAA 3WYZA 2J6XA 3S3GA 4AF0B 4S3CA 3E12A 4ZL1A 3MP3A 5DCEA 4O10A 3WLQA 5FL1A 4YHEA 4JQ1A 4H41A 4R7WA 3WH9A 2HTMA 2PDKA 5LNSA 3WD2A 4J2MA 1K7XA 3A6OA 1UKOA 4ZOEA 2VX5A 1J12A 3KW3A 2WLYA 2REQB 2FGZA 4S3AA 1C3FA 5LGZA 3HPSA 2YCKX 5K3VA 3WDIA 2OPJA 4BEQA 2XIJA 4LBSA 4BR1A 3MUY1 4QJ3B 3T55A 4HTBA 3WJSA 7ENLA 5D2WA 2WMKA 3MHGA 2XZ9A 4CUCA 3B8TA 3CWOX 4MIMA 5C8BB 5D09A 4OVXA 5HXMA 1N8WA 1H7PA 1UQYA 4PUDA 4LRTA 5FF4A 3L65A 3PBGA 4Z0SA 4HJFA 4PUEA 1O1HA 4WD0A 3VI2A 1I2PA 1DJIA 2ZIDA 2GUYA 3GC5A 3T0AA 1KBKA 3REQA 4GC3A 3W7CA 3NR0A 1G4PA 1EJ7L 5LIXX 3GIYA 4KKXA 3C2FA 2X7VA 1EJTC 3LCLA 3I6EA 3C6CA 4H8HA 4AIOA 2HK0A 2GDQA 3UY8A 3NG3A 3HA1A 1KFJA 5M5DA 2P76A 4R3UA 3M6YA 3MUXA 3LCFA 1MW0A 4LFYA 3S4TA 4AFYA 4OGZA 3NNTA 1E72M 3GHTA 3TSDA 2EG7A 3HFTA 4DO7A 4R7JA 2PDJA 1UOKA 1XX1A 4WSJA 1OHLA 1R3SA 2A7RA 5C7VA 4LF2A 3APYA 3URQA 2V63A 3ZJ6A 4IMEA 3BAJA 4UZSA 5CJMA 2QJNA 4DJDC 2F2HA 1S2TA 4M1BA 1JCLA 1TWIA 5HMEA 3VMNA 4UR7A 1TVLA 2AMGA 5KEZA 4NI3A 1W3NA 4Z2KA 4X9SA 5IXEA 3SRKA 4FXSA 1RY0A 3ES7A 1IGWA 1KFWA 5KZDA 2OEMA 1DJHA 5DN1A 3OA5A 4LH8A 4EPEC 4DXVA 2ODOA 3ZWSA 3LNPA 3VE9A 4MNMA 2FH6A 1DTUA 1SR9A 5C71A 3PBYA 1EC7A 2ZRYA 5H8PA 1RY8A 2A79A 1GJWA 3LPGA 2A3EA 1VZWA 4QLLA 3UU0A 2VRKA 1DJXA 1AL8A 2VEKA 3OLEA 1XYCA 4GG9A 4G7FA 2WHLA 3MVIA 1Q7QA 1L6FA 3PZIA 1KB3A 2BY1A 3M5XA 2Z00A 1VFFA 3MI2A 4IIBA 1RD6A 3WL0A 4I9AA 4XB3A 2WMHA 4JICA 2CLEA 3TTOA 4O19A 3PWAA 3P93A 3A9BA 3PBUA 1Q45A 3LUTA 3S9IA 2GSEA 1OIMA 2PC4A 3BQ5A 2O0TA 3G1RA 3UWVA 1LBFA 3BO9A 4ZQRA 1VB9A 3TJIA 4XTDA 3HMJG 4ZEPA 5CZKA 4RW3A 2B0MA 3NQVA 3NPXA 4US6A 1TPWA 3NOEA 5G4EA 2Y24A 4MB3A 1WXZA 2Z1WA 3CMFA 1P0KA 3BGGA 4C6PA 3M7SA 3FGCB 3RRXA 4OUIA 4FNSA 2XFYA 4OU1A 5I2UA 1RCQA 1NJJA 5C9XA 3U4AA 1MWOA 3C61A 3V1PA 1X98A 3VABA 2Z25A 3W82A 3PJXA 4HSNA 5BRPA 2W62A 2ZE3A 4HN8A 2DP3A 2PP0A 4UOJA 4YTRA 1JD7A 2PRHA 3SADA 1DWIM 3MT1A 3HPXA 4KQNA 3MWCA 1W54A 3FXGA 3VD4A 3W7DA 3A24A 3LHZA 4J40A 1OYCA 4H8NA 3GLCA 4AVOA 2NVDA 2EPHA 3TOPA 3MO7A 4OECA 3B04A 4L4MA 3LZ3A 3M0LA 3OW1A 4LX4A 3OGRA 1IWBA 4YVPA 2VEIA 5AYYA 3KE0A 3HMCA 3F4WA 3TVAA 1EQPA 3I7QA 3LQLA 4N4QA 4HZ8A 2V5DA 3HG3A 3RFAA 1TQJA 4PMVA 2DIEA 1DQXA 1PO9A 2XIIA 2V2HA 1JD9A 4PTNA 4DXKA 3TOYA 3WBAA 3M46A 3WJWA 2XH4A 1SFJA 1EDGA 3S1WA 4JTCA 2C0HA 3H2MA 4ZZ9A 2KX9A 1F3TA 1VIZA 1O94A 1P6WA 4ADSA 2ZC8A 3BMXA 3TFXA 2W0UA 3FA3A 2Z1XA 3HJZA 1UWTA 2QMJA 4PCFA 4NJGA 2DUAA 4RCXA 2C91A 4NAEB 1RAKA 4XK2A 1TJ0A 4JYEA 2VX7A 3E1F1 3CWNA 1XLDA 2H3DA 3FYOA 1O12A 1G4SA 4QS6A 1LOLA 3ITYA 4D8AA 2ACUA 4QJ4B 2GFTA 4F9JA 1EUAA 1IXPA 1XLHA 3ATZA 2VWSA 3W2JA 4A35A 2R24A 2YCJA 4FF7A 4IUGA 3CZJA 2VEMA 3H55A 3RCMA 3FCPA 4UXDA 3DBPA 3NQEA 4MWAE 1M53A 4L56A 2PDFA 4AWTA 3HV9A 2HXUA 4IH3A 3B4YA 1H7RA 1LWIA 2XHYA 3SIZA 5A6JA 3WNPA 4H9MA 2EPKX 2DT0A 1IEQA 1ZENA 2XU2A 1I1XA 1G7VA 2QDGA 4ONVA 4CKQA 3EEGA 1YE4A 2GPTA 1EO7A 2P3ZA 2FTWA 3VGHA 3BAIA 2YCLB 4E2DA 2R91A 3W7HA 4XAPA 3CV6A 3AHTA 4JN6A 1UBSA 1TTJA 1O66A 4AAJA 4WGHA 1TKKA 1CZ1A 4LW7A 2YFOA 5H2ZA 1KLZA 4XZLX 3WQ6A 2QJGA 3UG4A 2JEPA 1BWKA 4DJED 1V6TA 4BI6A 1N2VA 3E6EA 3KEHA 2ICSA 1YNQA 2ISDA 1XKJA 3S1XA 1SPQA 1TRDA 2DORA 1SM9A 3FYYA 1KWGA 4WR3A 3M0ZA 3WLMA 1CGYA 1Q6FA 4FLQA 1VCFA 1QFEA 4C6BA 1DIKA 4FX7A 1Y7VA 2Q3OA 4GVGA 2CWXA 4WJ8A 4Y9PA 4LV9A 3LV6A 1GVEA 4K8GA 2BFGA 4Q4QA 1QOPA 2QCNA 3GDRA 3T40A 4ICNA 1OF8A 1XYLA 4UQEA 2DIJA 4EPBC 4BI5A 4UMAA 3H7UA 4YL2A 2YBTA 4B92A 3WIJA 5CG0A 1NQKA 2IXUA 4OWGA 2ACSA 2H8XA 2XH2A 3B0VC 2CLFA 3FIGA 3ITCA 1DYSA 1K9DA 2RGLA 2DQWA 3DCPA 1ZAHA 1RVGA 4DXXA 5BMXA 3LRLA 5G2IA 2NT1A 2BOEX 4AZ6A 1OZMA 4Q8WA 1HGWA 2VM8A 4ZO8A 1MVYA 1VHCA 2V3FA 5HR7A 5I3FA 2GWGA 3NQ6A 3VIHA 1YXYA 2W5FA 1VFHA 4WY0B 5H91A 4F0LA 1GJPA 1UR3M 4DYEA 4MTVA 4BY3A 2YJQA 3INPA 3QTGA 3WZ0E 3GU2A 4HU0A 1GVQA 2J77A 1QI0A 3SUWA 3R0UA 3KBNA 3TC7A 4OZOA 4Y90A 2CZDA 4LAMA 4PMNA 2WJFA 4BS0A 3ABSA 3UYCA 3EKLA 3WEMA 1M1BA 3VM7A 4MLRA 4I8DA 1TSIA 3GUGA 5D2YA 1LJYA 3LHTA 4N9DA 1JNDA 5AZ1A 2E67A 4IIGA 3UT0A 2G41A 2BHZA 3BDKA 1V6UA 3W0KA 4X63A 4ZFMA 3MP5A 5CPSA 1LL6A 3DBNA 3UGVA 1B4EA 1W31A