2PDOA

Crystal structure of the putative acetyltransferase of gnat family from shigella flexneri
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
140
structure length
140
Chain Sequence
AMEIRVFRQEDFEEVITLWERCDLLRPWNDPEMDIERKMNHDVSLFLVAEVNGEVVGTVMGGYDGHRGSAYYLGVHPEFRGRGIANALLNRLEKKLIARGCPKIQINVPEDNDMVLGMYERLGYEHADVLSLGKRLIEDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyltransferase ypeA
publication title Crystal Structure of the Putative Acetyltransferase of GNAT Family from Shigella flexneri
rcsb
source organism Shigella flexneri 2a
molecule tags Transferase
total genus 31
structure length 140
sequence length 140
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.3.1.-:
pdb deposition date 2007-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2pdoA01
1YR0A 1MJ9A 2QMLA 2ATRA 5E96A 3IGRA 4KLVA 1VHSA 1LRZA 2CY2A 2O28A 4OADA 4KOWA 5DWNA 2R8VA 1I1DA 4JWPA 1SQHA 2J8NA 3G3SA 3PZJA 3TE4A 4CRZB 2FIWA 1VKCA 2Z10A 2G0BA 4XNHC 2IL4A 1Q2DA 3TOBA 3TFYA 1IIDA 2KCWA 3KKWA 4XPKA 1S7LA 2G3AA 1J4JA 2J8RA 2B3VA 2Q4YA 2Z0ZA 3K9UA 4HKFA 3EXNA 2VQYA 1MK4A 3CXQA 4KOTA 1NE9A 4NSQA 4PK3A 3B8GA 1M4GA 3R1KA 4X5KA 4KOYA 2FT0A 2I79A 1WWZA 3F8KA 2AJ6A 1KUYA 1Z4RA 4R9MA 2B5GB 2FXFA 1M1DA 4NEXA 2OU2A 3TO6A 1Q2YA 3D3SA 3W6SA 2R7HA 1Y7RA 3R9EA 2ZW6A 2Z11A 4JD6A 2FIAA 2GIVA 3S6KA 4UWJA 1S60A 4J3GA 3E0KA 2OZGA 1BOBA 2C27A 3RYOA 2VEZA 3SXOA 4KZTA 4ORFA 4NCZA 2B4DB 2ZW5A 3CXSA 3W91A 2A4NA 1KZFA 4KUAA 3DDDA 2ZW4A 1M4DA 2OB0A 1V0CA 3V8IA 2RC4A 4PSXA 2FCKA 2PC1A 3CXPA 5J8CA 1Z4EA 4R3KA 1Z9UA 4E8OA 2QIRA 4AG7A 2X7BA 3DSBA 2G3TA 3GKRA 4AVBA 1B87A 2VZYA 3I9SA 2Q4VA 1QSNA 2D4OA 2GANA 3H4QA 5F47A 1YVKA 4JXRA 4U9YA 4JJXA 1S3ZA 1PUAA 4M85A 4B5PA 1S5KA 4ZBGA 1M4IA 2R98A 2B4BA 1M44A 2B3UA 3PGPA 4CAWA 3D2MA 3R9FA 4YRHA 4GS4A 2PSWA 2EVNA 1QSMA 3QAHA 2Y0MA 1Q2CA 2GE3A 4MI4A 4YFJA 3I3GA 3C26A 2BL1A 3TO9A 5IB0A 1Y9KA 2OZHA 1RXTA 4AVCA 3BJ7A 1PU9A 4H6UA 3BLNA 2FS5A 4KLWA 4KOSA 3DR6A 5JPHA 3D8PA 3WR7A 4CAVA 4U5YA 2I00A 4QB9A 1XF8A 4II9A 2P6EA 2OH1A 4MBUA 4R87A 2F5IA 2PDOA 4QUSA 3FXTA 4CS0B 2Q0YA 1CM0A 3N7ZA 1S7FA 1QSRA 1QSOA 3R9GA 4AVAA 3R95A 3NE7A 4XPDB 2K5TA 2Q7BA 2JLMA 3T90A 5HMNA 4R57A 4K30A 3IWGA 3EC4A 4OAEA 5EC4A 3R96A 4IUSA 2VXKA 2Q44A 2OZUA 2ARHA 4MJ8A 2PR1A 5EBVA 1IYKA 1P0HA 3JUWA 4KOVA 5ISVA 4IF5A 3FB3A 1BO4A 3DR8A 2PR8A 1L0CA 2AE6A 1UFHA 1NMTA 1XMTA 4EVYA 4BMHA 3EO4A 2BEIA 1U6MA 4FD4A 1B6BA 1MJBA 4QC6A 2EUIA 3G8WA 3TO7A 5KTDA 4I49A 1I21A 2P0WA 2D4PA 1Y9WA 2BSWA 3P2FA 2Q04A 3FYNA 3P2HA 2WPXA 4XPLA 4RI1A 2P6FA 5H84A 4H6ZA 4HNWB 3JVNA 2CNMA 1YVOA 2JDDA 2R1IA 4XPDC 4UWIA 4MHDA 4PV6A 4FD5A 3ZJ0A 5IX3A 3FNCA 1S7NA 2PRBA 3LODA 1ON0A 4AG9A 4UBRA 2JDCA 1OZPA 2WPWA 4B5PB 3FRMA 2HQYA 3QB8A 4QVTA 4Y49B 2CNTA 4L89A 1YK3A 5H86A 3OWCA 3SHPA 3EY5A 3TTHA 2PQ8A 1CJWA 4F0YA 3TT2A 2J8MA 3DNSA 4NXYA 3UY5A 4CAXA 2NMTA 1KUXA 5C82A 4JLYA 2CNSA 2REEA 2FL4A 4NF1A 1R57A 4MY3A 4KOUA 3GYAA 2FSRA 3D2PA 4LX9A 2BUEA 3TCVA 5KTCA 2HUZA 4PSWA 1XE4A 1YREA 4E0AA 5F46A 2FE7A 2B58A 3F0AA 2B5GA 1XIXA 1N71A 2VI7A 2REFA 1P4NA 2ZPAA 4DNCA 3SXNA 4F6AA 4HNXB 5I0CA 5KTAA 4FD6A 1KUVA 4M3SA 1WK4A 4ONUA 5GCNA 1YX0A 4KVME 5FVJA 4MY0A 2DXQA 1IB1E 5JQ4A 4KVOE 4KORA 2ZXVA 3TOAA 1YGHA 4QBJA 4KOXA 4Y49C 2B4DA 1FY7A 5J8FA 2H5MA 3T9YA 4HNYB 1NSLA 4UA3A 1QSTA 1IYLA 1IICA 3S6GA 2VBQA 2ZW7A 2VZZA 3GY9A 3LD2A 3BJ8A 4L8AA 4FD7A 1XEBA 5HH1A 4H89A 1S7KA 3VWEA 1GHEA 4U9ZA 1YLEA 3PP9A 1RO5A 5F49A 4XNHB 4YGOA 4KUBA 4JXQA 3VWDA 1TIQA 4CRYB 4LUAA 4KVXA 3S6FA 4RS2A 4R3LA 2QECA 1K4JA 3F5BA 3W6XA 3ZZIA 4AB7A 4B5OA 2P6GA 3EFAA 1MJAA 3FBUA 3MGDA 4E2AA 1I12A 4OLLA 5F48A 4PK2A 3S6HA 2JEVA 5CNPA 5DWMA 2HV2A 5C88A 5IV0A 3FIXA
chains in the Genus database with same CATH superfamily
1TF8A 2ZEFA 1ZG8A 1YR0A 2DPTA 1MJ9A 4OIWA 4B14A 2EWBA 2QMLA 2V8GA 4Q36A 3BI0A 4EFDA 3PFEA 2ATRA 4NGTA 4MFJA 2YGWA 5E96A 3IGRA 4KLVA 4DYOA 1VHSA 4PPZA 5I4MA 2ZEOA 1LRZA 2PJAA 4F9VA 3GLJA 2CY2A 1ZLIA 2O28A 3H8EA 3IU2A 1YMEA 2XEIA 1CG2A 2O53A 4R8FA 4OADA 4KOWA 4UCMA 5DWNA 3KZWA 5THWA 2R8VA 1I1DA 3KHZA 1SQHA 3HUVA 4JWPA 2J8NA 2NSMA 1XFOA 3G3SA 3WC5A 5JM6A 5LRKA 4PQAA 3PZJA 3TE4A 4UFVA 1Z5RA 4CRZB 4P45A 4OMEA 5CBMA 2FIWA 1VKCA 2Z10A 2F8HA 3S9LA 2G0BA 4XNHC 2IL4A 3H8FA 1Q2DA 1XMBA 4P4IA 3TOBA 4P4BA 3BHXA 2PIYA 3KQXA 1JQGA 1IIDA 3TFYA 3H5ZA 2KCWA 5IB9A 3KKWA 3PBEA 4XPKA 4ZX9A 4UIAA 1S7LA 2G3AA 1J4JA 2J8RA 4OC3A 8CPAA 2B3VA 3IO1A 2Q4YA 2PVWA 2Z0ZA 4BBHA 2GLJA 1ARLA 3D4UA 3I1UA 1IY7A 3K9UA 4HKFA 3EXNA 2VQYA 1MK4A 3CXQA 2NYQA 2YNCA 2C1CA 6CPAA 4KOTA 2BCOA 1NE9A 1X12A 4NSQA 4PK3A 3PB7X 3WABA 3V38A 4C7IA 2EK9A 3B8GA 1M4GA 2PJ7A 3R1KA 3PB9X 4OC2A 4X5KA 4KOYA 3SJFA 4WWVA 2FT0A 2I79A 1WWZA 3F8KA 2AJ6A 1KUYA 2ZEEA 5G20A 1Z4RA 3B3WA 4R9MA 2B5GB 2FXFA 2ODFA 5LYFA 1M1DA 1VGYA 3L2NA 2F7VA 3B3TA 4TNUA 4NEXA 2OU2A 3TO6A 1Q2YA 1Y7EA 3D3SA 3JRUA 2R7HA 3W6SA 3LWUA 4CGLA 3NH8A 1Y7RA 3RBUA 3V7ZA 2C6PA 3D7GA 3R9EA 4A95A 1CP7A 2ZW6A 2PVVA 2Z11A 4GM5A 4NFRA 2Z3KA 1AUGA 2C6GA 2FIAA 4JD6A 2DEAA 2GIVA 3FIXA 3S6KA 2PRQA 4UWJA 1S60A 4PXEA 1ZLHA 4J3GA 4NJRA 3RZAA 4MFLA 2PJ5A 4FAIA 2PJ8A 3E0KA 1IOFA 2JEWA 2OZGA 2AFSA 5HVGA 1BOBA 2C27A 5AG5A 3RYOA 2VEZA 1GYTA 3IEHA 3SXOA 4KZTA 4MHYA 4ORFA 4NCZA 2B4DB 2ZW5A 2EK8A 3CXSA 3W91A 1CPXA 4B10A 2A4NA 3SJXA 1KZFA 1X10A 3MRUA 4CAEA 4KUAA 3DDDA 2ZW4A 1Y0YA 4MCRA 1LAPA 2OB0A 1M4DA 1V0CA 4MFQA 1LFWA 2RC4A 4PSXA 3V8IA 2ABZA 5HVFA 1Z8WA 1M4LA 1ELMP 5BWAB 2CF4A 4IHMA 3VH9A 1XOVA 2FCKA 2PC1A 2Q51A 4NGSA 3CXPA 5J8CA 4IK2A 1Z4EA 1TKHA 4R3KA 1UWYA 1Z9UA 2PJ6A 4E8OA 2QIRA 2GU2A 2PJ3A 4AG7A 2X7BA 2PJCA 1XBUA 3SJGA 3DSBA 2G3TA 1YW4A 3GKRA 2AFWA 3SJEA 4A33A 2JBJA 4AVBA 4ZY1A 3T8WA 4MCSA 3IIBA 4F8ZA 1B87A 2VZYA 3SI1A 1TF9A 1PCAA 3PRTA 3I9SA 4UFWA 3IWWA 2Q4VA 5K8NA 1QSNA 3LMSA 2D4OA 7CPAA 2GANA 3H4QA 4HPSA 5F47A 3HLPA 1YVKA 4JXRA 3B3VA 4U9YA 4JJXA 1YW6A 1S3ZA 1PUAA 4M85A 4P10A 2ZEPA 1EE3P 5AGEA 4B5PA 1S5KA 4NGQA 4ZBGA 1M4IA 2R98A 2B4BA 3CDXA 1M44A 1HDUA 2B3UA 4ZYQA 3PGPA 4CAWA 3D2MA 3R9FA 2WZNA 4X3RA 4YRHA 1NSAA 2CXAA 3FEDA 4NGNA 4GS4A 4Q38A 4AXVA 2PSWA 2ZEDA 1ELLP 2EVNA 2OOTA 4M6HA 4KSAA 1QSMA 4UEZA 3QAHA 1ZG9A 4MMOA 4CGOA 2Y0MA 1Q2CA 3NH4A 3NFZA 1HEEA 5A28A 2GE3A 4MI4A 2RFHA 4YFJA 1ARMA 3I3GA 3KQZA 3C26A 4OC0A 4G1PA 4RUHA 1Y0RA 4B13A 2DPSA 2BL1A 3TO9A 5IB0A 1CX8A 1Y9KA 4P6YA 3PB4X 2OZHA 3WC7A 1RXTA 4IAVA 4UFXA 3CPXA 2QVPA 3NH5A 4H2KA 3GB0A 1Z8TA 3BJ7A 4AVCA 1PU9A 5JGFA 4A31A 4H6UA 3BLNA 2FS5A 4KLWA 3CPAA 4KOSA 3DR6A 4DUKA 1A2ZA 5JPHA 3IJ3A 3D8PA 3WR7A 4CAVA 4MHPA 4KS9A 2HB6A 4U5YA 4M6GA 1LCPA 2I00A 4WJBA 4QB9A 2Q7SA 4P4JA 1XF8A 5DS0A 3CZXA 4II9A 1XRYA 2P6EA 4R7MA 1IGBA 1IU8A 2GREA 4MFKA 5HVHA 4K3NA 2OH1A 4MBUA 4R87A 5LYIA 2F5IA 2PDOA 4PXBA 2PE3A 3WT4A 4QUSA 5K8MA 5EMIA 3D67A 4B6ZA 3FXTA 4CS0B 2QYVA 2Q0YA 2C6CA 1Z8LA 1F2OA 4P4EA 2GFQA 1CM0A 3N7ZA 1S7FA 1QSRA 4NGPA 1QSOA 3R9GA 4AVAA 4EWTA 3R95A 2AFXA 3NE7A 1QQ9A 4XPDB 3D7FA 5ELYA 4PXCA 2JBKA 2K5TA 2Q7BA 2JLMA 3T90A 1IOIA 5HMNA 4R57A 2PCUA 4K30A 4RN7A 3IWGA 4MXUA 1Z2LA 3DLJA 1BPMA 3EC4A 4OAEA 4LQGA 5EC4A 3R96A 5HXDA 4CGNA 4NGMA 3QNVA 4IUSA 2VXKA 4Z65A 2Q44A 4Q7AA 4C2XA 3RNZA 4DJLA 1XJOA 2OZUA 2ARHA 4MJ8A 2ZELA 2PR1A 1QMUA 5EBVA 1IYKA 1P0HA 2BOAA 3JUWA 4KOVA 5ISVA 4IF5A 1CBXA 1BO4A 3FB3A 3DR8A 4X8IA 5AG6A 2PR8A 1L0CA 2AE6A 2PJBA 3NE8A 4OC5A 4NJQA 1UFHA 3H8GA 1NMTA 3PBBA 4NGRA 1XMTA 4EVYA 2AFUA 1OBRA 4BMHA 3N5FA 3EO4A 2BEIA 2PJ1A 1U6MA 4FD4A 1B6BA 1MJBA 4YU9A 4QC6A 4EMEA 1YLOA 2EUIA 4B12A 3G8WA 3TO7A 5KTDA 4I49A 1I21A 2IMOA 2P0WA 2D4PA 2HC9A 2Z3LA 3IC1A 1Y9WA 2BSWA 2Z3OA 4MCQA 3P2FA 2Q04A 3FYNA 3P2HA 3TC8A 2WPXA 3RO0A 4CYPA 4XPLA 5CPAA 4ZY0A 2CIJA 4UCNA 3FEEA 4RI1A 4ZI6A 4KSFA 2P6FA 5H84A 5AG4A 3CT9A 3BXMA 4P4FA 4F9UA 1R43A 4H6ZA 4HNWB 3JVNA 4MRIA 2CNMA 4CPAA 4W9YA 1YVOA 2JDDA 2R1IA 2WUUA 4A2ZA 1FNOA 4UEFA 4XPDC 2V8HA 2YNCC 2O4HA 3B2YA 4UWIA 3D7HA 4MHDA 4PV6A 4FD5A 4ONWA 3LACA 3ZJ0A 5IX3A 1LANA 1S7NA 3FNCA 2PRBA 3LODA 1ON0A 2PIZA 4AG9A 4FBEA 4JYWA 4UBRA 5F09A 2PJ9A 2JDCA 2V8DA 3D7DA 1OZPA 4A30A 2WPWA 4B11A 4B5PB 3FRMA 2HQYA 3QB8A 3IWEA 3FH4A 1YSJA 3K2KA 4UCPA 4QVTA 3NA6A 4Y49B 4C68A 2CNTA 4L89A 4CAFA 1YK3A 5H86A 3OWCA 4UF4A 3GIUA 3SHPA 3KHXA 4FWUA 3EY5A 3TTHA 2PJ0A 2PQ8A 5G1ZA 2GLFA 1AYEA 2CTCA 3FMCA 4YWYA 1CJWA 4F0YA 1AMPA 4F0XA 3TT2A 5JH9A 3B35A 2J8MA 3S9NA 4MCPA 1LAMA 3DNSA 4NXYA 1BAVA 3UY5A 4CAXA 2NMTA 5K8OA 1KUXA 5C82A 4C7HA 1FT7A 4JLYA 4R76A 2CNSA 5G22A 4BINA 4CYQA 2REEA 4KSIA 1H8LA 5LRJA 1F57A 1RTQA 2FL4A 2PJ4A 4NF1A 3KR4A 1R57A 4MHZA 4FUUA 4MY3A 1CP6A 3KGQA 4KOUA 5J1QA 2XEFA 1LOKA 5LYDA 3GYAA 2FSRA 3FJUA 2OR4A 2FVGA 3D2PA 4A32A 2ZEMA 4LX9A 4ZGYB 5LRGA 3KL9A 5K8PA 2BUEA 2Z3MA 3DGVA 3TCVA 5KTCA 1BPNA 2HUZA 4PSWA 3KASA 2ZENA 3BI1A 1XE4A 1YREA 1Z8XA 4E0AA 5JQ4A 2YNDA 1JWQA 2FE7A 3QAYA 2G9DA 2B58A 2QJ8A 3ISZA 5F46A 1R3NA 3F0AA 2Q43A 2B5GA 4A94A 1XIXA 5D29A 1N71A 2VI7A 4OP4A 2WSAA 3IFEA 2REFA 1P4NA 2ZPAA 2BO9A 3SXNA 4A39A 4OKOA 3FECA 4DNCA 4F6AA 4HNXB 5I0CA 5KTAA 4M6IA 4FD6A 3B3SA 2J9AA 1KUVA 3RAMA 2ZEGA 3PFOA 3IU1A 4M3SA 2ZOGA 1HDQA 3FVLA 4UEEA 1WK4A 2Z3PA 4PXDA 4ONUA 5GCNA 4P44A 1YX0A 1ZG7A 4KVME 5FVJA 3PB6X 4MY0A 4A38A 2DXQA 1IB1E 2Q4ZA 3KR5A 4UIBA 3VATA 2XEGA 3KI9A 4KVOE 3VARA 4CYOA 4KORA 2IJZA 2ZXVA 4OIDA 3TOAA 1YGHA 4QBJA 4KOXA 4Y49C 2B4DA 1TKJA 1FY7A 3B3CA 5J8FA 2H5MA 3T9YA 4ZY2A 4HNYB 2EBJA 1NSLA 4UA3A 1QSTA 1IYLA 1IICA 3S6GA 1BLLE 2VBQA 2XEJA 2VZZA 2ZW7A 3GY9A 3BJ8A 3LD2A 4GXHA 4L8AA 2CTBA 2WYRA 3B7IA 4P4DA 2AFOA 2V77A 4FD7A 1XEBA 4CGMA 5HH1A 5D8NA 4R6TA 2ANPA 4C2ZA 4C2YA 4H89A 1S7KA 1VHEA 3VWEA 1GHEA 2DF5A 4U9ZA 2PJ2A 1VIXA 1TXRA 2AFMA 4X2TA 4ZX8A 1YLEA 3PP9A 1RO5A 5F49A 4CYNA 3PEIA 4OC1A 4XNHB 4YGOA 4KUBA 2V8VA 2ZOFA 4JXQA 1TKFA 3VWDA 3WC6A 1TIQA 4A37A 4CRYB 3SI2A 1DTDA 2ZEHA 3S9MA 2VL1A 4LUAA 4KVXA 3SI0A 3S6FA 3JTKA 4MFZA 4RS2A 4R3LA 2AFZA 2QECA 4JZ0A 1K4JA 3F5BA 3W6XA 4MHNA 3ZZIA 5LYLA 4AB7A 2Z3NA 3TX8A 2YNEA 4B5OA 2RB7A 1DE4C 2P6GA 1KWMA 1ZO0A 3D66A 2POKA 3EFAA 3ISXA 1MJAA 1Q7LA 3D68A 4LQ6A 3FF3A 4OC4A 1CPSA 2I3CA 2IQ6A 3FBUA 3MGDA 4E2AA 1I12A 4OLLA 5F48A 4MFPA 5AG7A 4PK2A 5G21A 4TWEA 3PB8X 1PYTB 3S6HA 1YQEA 4O23A 1VHOA 4BD9A 2EO8A 2JEVA 3GUXA 5CNPA 1F2PA 5DWMA 5A27A 3K9TA 2HV2A 5C88A 5IV0A 3A9LA 3MN8A 4CGPA 3FX6A
chains in the Genus database with same CATH topology
1YR0A 2DPTA 1MJ9A 4B14A 2QMLA 4Q36A 2ATRA 4MFJA 2YGWA 5E96A 3IGRA 4KLVA 1VHSA 1LRZA 2CY2A 2O28A 3IU2A 4OADA 4KOWA 4UCMA 5DWNA 2R8VA 1I1DA 4JWPA 1SQHA 2J8NA 3G3SA 3PZJA 3TE4A 4UFVA 4CRZB 2FIWA 1VKCA 2Z10A 2G0BA 4XNHC 2IL4A 1Q2DA 3TOBA 3TFYA 1IIDA 3H5ZA 2KCWA 3KKWA 4XPKA 1S7LA 2G3AA 1J4JA 2J8RA 2B3VA 4BBHA 2Q4YA 2Z0ZA 3K9UA 4HKFA 3EXNA 2VQYA 1MK4A 3CXQA 2YNCA 4KOTA 1NE9A 4NSQA 4PK3A 4C7IA 3B8GA 1M4GA 3R1KA 4X5KA 4KOYA 2FT0A 2I79A 1WWZA 3F8KA 2AJ6A 1KUYA 5G20A 1Z4RA 4R9MA 2B5GB 2FXFA 1M1DA 4NEXA 2OU2A 3TO6A 1Q2YA 4CGLA 3D3SA 3W6SA 2R7HA 1Y7RA 3R9EA 4A95A 2ZW6A 2Z11A 2Z3KA 4JD6A 2FIAA 2GIVA 3S6KA 4UWJA 1S60A 4J3GA 4MFLA 3E0KA 2OZGA 1BOBA 2C27A 5AG5A 3RYOA 2VEZA 3SXOA 4KZTA 4ORFA 4NCZA 2B4DB 2ZW5A 3CXSA 3W91A 4B10A 2A4NA 1KZFA 4CAEA 4KUAA 3DDDA 2ZW4A 1M4DA 2OB0A 1V0CA 4MFQA 3V8IA 2RC4A 4PSXA 5BWAB 2FCKA 2PC1A 3CXPA 5J8CA 1Z4EA 4R3KA 1Z9UA 4E8OA 2QIRA 4AG7A 2X7BA 3DSBA 2G3TA 3GKRA 4A33A 4AVBA 1B87A 2VZYA 3I9SA 4UFWA 2Q4VA 1QSNA 2D4OA 2GANA 3H4QA 5F47A 1YVKA 4JXRA 4U9YA 4JJXA 1S3ZA 1PUAA 4M85A 5AGEA 4B5PA 1S5KA 4ZBGA 1M4IA 2R98A 2B4BA 1M44A 2B3UA 3PGPA 4CAWA 3D2MA 3R9FA 4YRHA 2CXAA 4Q38A 4GS4A 2PSWA 2EVNA 4KSAA 1QSMA 3QAHA 4CGOA 2Y0MA 1Q2CA 5A28A 2GE3A 4MI4A 4YFJA 3I3GA 3C26A 4B13A 2DPSA 2BL1A 3TO9A 5IB0A 1Y9KA 2OZHA 1RXTA 4UFXA 4AVCA 3BJ7A 1PU9A 4A31A 4H6UA 3BLNA 2FS5A 4KLWA 4KOSA 3DR6A 5JPHA 3D8PA 3WR7A 4CAVA 4KS9A 4U5YA 2I00A 4QB9A 1XF8A 4II9A 2P6EA 4MFKA 2OH1A 4MBUA 4R87A 2F5IA 2PDOA 4QUSA 3FXTA 4CS0B 2Q0YA 1CM0A 3N7ZA 1S7FA 1QSRA 1QSOA 3R9GA 4AVAA 3R95A 3NE7A 3A9LA 4XPDB 2K5TA 2Q7BA 2JLMA 3T90A 5HMNA 4R57A 4K30A 3IWGA 3EC4A 4OAEA 5EC4A 3R96A 4CGNA 4IUSA 2VXKA 2Q44A 4C2XA 2OZUA 2ARHA 4MJ8A 2PR1A 5EBVA 1IYKA 1P0HA 3JUWA 4KOVA 5ISVA 4IF5A 3FB3A 1BO4A 3DR8A 5AG6A 2PR8A 1L0CA 2AE6A 1UFHA 1NMTA 1XMTA 4EVYA 4BMHA 3EO4A 2BEIA 1U6MA 4FD4A 1B6BA 1MJBA 4QC6A 2EUIA 4B12A 3G8WA 3TO7A 5KTDA 4I49A 1I21A 2P0WA 2D4PA 2Z3LA 1Y9WA 2BSWA 2Z3OA 3P2FA 2Q04A 3FYNA 3P2HA 2WPXA 4CYPA 4XPLA 4UCNA 4RI1A 4KSFA 2P6FA 5H84A 5AG4A 4H6ZA 4HNWB 3JVNA 2CNMA 1YVOA 2JDDA 2R1IA 2WUUA 4A2ZA 4XPDC 2YNCC 4UWIA 4MHDA 4PV6A 4FD5A 3ZJ0A 5IX3A 3FNCA 1S7NA 2PRBA 3LODA 1ON0A 4AG9A 4UBRA 2JDCA 1OZPA 4A30A 2WPWA 4B11A 4B5PB 3FRMA 2HQYA 3QB8A 3IWEA 4UCPA 4QVTA 4Y49B 4C68A 2CNTA 4L89A 4CAFA 1YK3A 5H86A 3OWCA 3SHPA 3EY5A 3TTHA 2PQ8A 5G1ZA 4F0XA 1CJWA 4F0YA 3TT2A 2J8MA 3DNSA 4NXYA 3UY5A 4CAXA 2NMTA 1KUXA 5C82A 4C7HA 4JLYA 2CNSA 5G22A 4CYQA 2REEA 2FL4A 4NF1A 1R57A 4MY3A 4KOUA 3GYAA 2FSRA 3D2PA 4A32A 4LX9A 4ZGYB 2BUEA 2Z3MA 3TCVA 5KTCA 2HUZA 4PSWA 1XE4A 1YREA 4E0AA 2YNDA 5F46A 2FE7A 2B58A 3F0AA 2B5GA 1XIXA 1N71A 2VI7A 2WSAA 2REFA 1P4NA 2ZPAA 4DNCA 3SXNA 4F6AA 4HNXB 5I0CA 5KTAA 4FD6A 1KUVA 3IU1A 4M3SA 1WK4A 2Z3PA 4ONUA 5GCNA 1YX0A 4KVME 5FVJA 4MY0A 2DXQA 1IB1E 5JQ4A 4KVOE 4CYOA 4KORA 2ZXVA 3TOAA 1YGHA 4QBJA 4KOXA 4Y49C 2B4DA 1FY7A 5J8FA 2H5MA 3T9YA 4HNYB 1NSLA 4UA3A 1QSTA 1IYLA 1IICA 3S6GA 2VBQA 2ZW7A 2VZZA 3GY9A 3LD2A 3BJ8A 4L8AA 5G21A 4FD7A 1XEBA 4CGMA 5HH1A 4C2ZA 4C2YA 4H89A 1S7KA 3VWEA 1GHEA 4U9ZA 1YLEA 3PP9A 1RO5A 5F49A 4CYNA 4XNHB 4YGOA 4KUBA 4JXQA 3VWDA 1TIQA 4CRYB 4LUAA 4KVXA 3S6FA 3JTKA 4RS2A 4R3LA 2QECA 1K4JA 3F5BA 3W6XA 3ZZIA 4AB7A 2Z3NA 4B5OA 2YNEA 2P6GA 1ZO0A 3EFAA 1MJAA 3FBUA 3MGDA 4E2AA 1I12A 4OLLA 5F48A 4MFPA 5AG7A 4PK2A 3S6HA 2JEVA 5CNPA 5DWMA 5A27A 2HV2A 5C88A 5IV0A 3FIXA 4CGPA 4MFZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YR0 A;  1MJ9 A;  2QML A;  2ATR A;  5E96 A;  3IGR A;  4KLV A;  1VHS A;  1LRZ A;  2CY2 A;  2O28 A;  4OAD A;  4KOW A;  5DWN A;  2R8V A;  1I1D A;  4JWP A;  1SQH A;  2J8N A;  3G3S A;  3PZJ A;  3TE4 A;  4CRZ B;  2FIW A;  1VKC A;  2Z10 A;  2G0B A;  4XNH C;  2IL4 A;  1Q2D A;  3TOB A;  3TFY A;  1IID A;  2KCW A;  3KKW A;  4XPK A;  1S7L A;  2G3A A;  1J4J A;  2J8R A;  2B3V A;  2Q4Y A;  2Z0Z A;  3K9U A;  4HKF A;  3EXN A;  2VQY A;  1MK4 A;  3CXQ A;  4KOT A;  1NE9 A;  4NSQ A;  4PK3 A;  3B8G A;  1M4G A;  3R1K A;  4X5K A;  4KOY A;  2FT0 A;  2I79 A;  1WWZ A;  3F8K A;  2AJ6 A;  1KUY A;  1Z4R A;  4R9M A;  2B5G B;  2FXF A;  1M1D A;  4NEX A;  2OU2 A;  3TO6 A;  1Q2Y A;  3D3S A;  3W6S A;  2R7H A;  1Y7R A;  3R9E A;  2ZW6 A;  2Z11 A;  4JD6 A;  2FIA A;  2GIV A;  3S6K A;  4UWJ A;  1S60 A;  4J3G A;  3E0K A;  2OZG A;  1BOB A;  2C27 A;  3RYO A;  2VEZ A;  3SXO A;  4KZT A;  4ORF A;  4NCZ A;  2B4D B;  2ZW5 A;  3CXS A;  3W91 A;  2A4N A;  1KZF A;  4KUA A;  3DDD A;  2ZW4 A;  1M4D A;  2OB0 A;  1V0C A;  3V8I A;  2RC4 A;  4PSX A;  2FCK A;  2PC1 A;  3CXP A;  5J8C A;  1Z4E A;  4R3K A;  1Z9U A;  4E8O A;  2QIR A;  4AG7 A;  2X7B A;  3DSB A;  2G3T A;  3GKR A;  4AVB A;  1B87 A;  2VZY A;  3I9S A;  2Q4V A;  1QSN A;  2D4O A;  2GAN A;  3H4Q A;  5F47 A;  1YVK A;  4JXR A;  4U9Y A;  4JJX A;  1S3Z A;  1PUA A;  4M85 A;  4B5P A;  1S5K A;  4ZBG A;  1M4I A;  2R98 A;  2B4B A;  1M44 A;  2B3U A;  3PGP A;  4CAW A;  3D2M A;  3R9F A;  4YRH A;  4GS4 A;  2PSW A;  2EVN A;  1QSM A;  3QAH A;  2Y0M A;  1Q2C A;  2GE3 A;  4MI4 A;  4YFJ A;  3I3G A;  3C26 A;  2BL1 A;  3TO9 A;  5IB0 A;  1Y9K A;  2OZH A;  1RXT A;  4AVC A;  3BJ7 A;  1PU9 A;  4H6U A;  3BLN A;  2FS5 A;  4KLW A;  4KOS A;  3DR6 A;  5JPH A;  3D8P A;  3WR7 A;  4CAV A;  4U5Y A;  2I00 A;  4QB9 A;  1XF8 A;  4II9 A;  2P6E A;  2OH1 A;  4MBU A;  4R87 A;  2F5I A;  2PDO A;  4QUS A;  3FXT A;  4CS0 B;  2Q0Y A;  1CM0 A;  3N7Z A;  1S7F A;  1QSR A;  1QSO A;  3R9G A;  4AVA A;  3R95 A;  3NE7 A;  4XPD B;  2K5T A;  2Q7B A;  2JLM A;  3T90 A;  5HMN A;  4R57 A;  4K30 A;  3IWG A;  3EC4 A;  4OAE A;  5EC4 A;  3R96 A;  4IUS A;  2VXK A;  2Q44 A;  2OZU A;  2ARH A;  4MJ8 A;  2PR1 A;  5EBV A;  1IYK A;  1P0H A;  3JUW A;  4KOV A;  5ISV A;  4IF5 A;  3FB3 A;  1BO4 A;  3DR8 A;  2PR8 A;  1L0C A;  2AE6 A;  1UFH A;  1NMT A;  1XMT A;  4EVY A;  4BMH A;  3EO4 A;  2BEI A;  1U6M A;  4FD4 A;  1B6B A;  1MJB A;  4QC6 A;  2EUI A;  3G8W A;  3TO7 A;  5KTD A;  4I49 A;  1I21 A;  2P0W A;  2D4P A;  1Y9W A;  2BSW A;  3P2F A;  2Q04 A;  3FYN A;  3P2H A;  2WPX A;  4XPL A;  4RI1 A;  2P6F A;  5H84 A;  4H6Z A;  4HNW B;  3JVN A;  2CNM A;  1YVO A;  2JDD A;  2R1I A;  4XPD C;  4UWI A;  4MHD A;  4PV6 A;  4FD5 A;  3ZJ0 A;  5IX3 A;  3FNC A;  1S7N A;  2PRB A;  3LOD A;  1ON0 A;  4AG9 A;  4UBR A;  2JDC A;  1OZP A;  2WPW A;  4B5P B;  3FRM A;  2HQY A;  3QB8 A;  4QVT A;  4Y49 B;  2CNT A;  4L89 A;  1YK3 A;  5H86 A;  3OWC A;  3SHP A;  3EY5 A;  3TTH A;  2PQ8 A;  1CJW A;  4F0Y A;  3TT2 A;  2J8M A;  3DNS A;  4NXY A;  3UY5 A;  4CAX A;  2NMT A;  1KUX A;  5C82 A;  4JLY A;  2CNS A;  2REE A;  2FL4 A;  4NF1 A;  1R57 A;  4MY3 A;  4KOU A;  3GYA A;  2FSR A;  3D2P A;  4LX9 A;  2BUE A;  3TCV A;  5KTC A;  2HUZ A;  4PSW A;  1XE4 A;  1YRE A;  4E0A A;  5F46 A;  2FE7 A;  2B58 A;  3F0A A;  2B5G A;  1XIX A;  1N71 A;  2VI7 A;  2REF A;  1P4N A;  2ZPA A;  4DNC A;  3SXN A;  4F6A A;  4HNX B;  5I0C A;  5KTA A;  4FD6 A;  1KUV A;  4M3S A;  1WK4 A;  4ONU A;  5GCN A;  1YX0 A;  4KVM E;  5FVJ A;  4MY0 A;  2DXQ A;  1IB1 E;  5JQ4 A;  4KVO E;  4KOR A;  2ZXV A;  3TOA A;  1YGH A;  4QBJ A;  4KOX A;  4Y49 C;  2B4D A;  1FY7 A;  5J8F A;  2H5M A;  3T9Y A;  4HNY B;  1NSL A;  4UA3 A;  1QST A;  1IYL A;  1IIC A;  3S6G A;  2VBQ A;  2ZW7 A;  2VZZ A;  3GY9 A;  3LD2 A;  3BJ8 A;  4L8A A;  4FD7 A;  1XEB A;  5HH1 A;  4H89 A;  1S7K A;  3VWE A;  1GHE A;  4U9Z A;  1YLE A;  3PP9 A;  1RO5 A;  5F49 A;  4XNH B;  4YGO A;  4KUB A;  4JXQ A;  3VWD A;  1TIQ A;  4CRY B;  4LUA A;  4KVX A;  3S6F A;  4RS2 A;  4R3L A;  2QEC A;  1K4J A;  3F5B A;  3W6X A;  3ZZI A;  4AB7 A;  4B5O A;  2P6G A;  3EFA A;  1MJA A;  3FBU A;  3MGD A;  4E2A A;  1I12 A;  4OLL A;  5F48 A;  4PK2 A;  3S6H A;  2JEV A;  5CNP A;  5DWM A;  2HV2 A;  5C88 A;  5IV0 A;  3FIX A; 
#chains in the Genus database with same CATH topology
 1TF8 A;  2ZEF A;  1ZG8 A;  1YR0 A;  2DPT A;  1MJ9 A;  4OIW A;  4B14 A;  2EWB A;  2QML A;  2V8G A;  4Q36 A;  3BI0 A;  4EFD A;  3PFE A;  2ATR A;  4NGT A;  4MFJ A;  2YGW A;  5E96 A;  3IGR A;  4KLV A;  4DYO A;  1VHS A;  4PPZ A;  5I4M A;  2ZEO A;  1LRZ A;  2PJA A;  4F9V A;  3GLJ A;  2CY2 A;  1ZLI A;  2O28 A;  3H8E A;  3IU2 A;  1YME A;  2XEI A;  1CG2 A;  2O53 A;  4R8F A;  4OAD A;  4KOW A;  4UCM A;  5DWN A;  3KZW A;  5THW A;  2R8V A;  1I1D A;  3KHZ A;  1SQH A;  3HUV A;  4JWP A;  2J8N A;  2NSM A;  1XFO A;  3G3S A;  3WC5 A;  5JM6 A;  5LRK A;  4PQA A;  3PZJ A;  3TE4 A;  4UFV A;  1Z5R A;  4CRZ B;  4P45 A;  4OME A;  5CBM A;  2FIW A;  1VKC A;  2Z10 A;  2F8H A;  3S9L A;  2G0B A;  4XNH C;  2IL4 A;  3H8F A;  1Q2D A;  1XMB A;  4P4I A;  3TOB A;  4P4B A;  3BHX A;  2PIY A;  3KQX A;  1JQG A;  1IID A;  3TFY A;  3H5Z A;  2KCW A;  5IB9 A;  3KKW A;  3PBE A;  4XPK A;  4ZX9 A;  4UIA A;  1S7L A;  2G3A A;  1J4J A;  2J8R A;  4OC3 A;  8CPA A;  2B3V A;  3IO1 A;  2Q4Y A;  2PVW A;  2Z0Z A;  4BBH A;  2GLJ A;  1ARL A;  3D4U A;  3I1U A;  1IY7 A;  3K9U A;  4HKF A;  3EXN A;  2VQY A;  1MK4 A;  3CXQ A;  2NYQ A;  2YNC A;  2C1C A;  6CPA A;  4KOT A;  2BCO A;  1NE9 A;  1X12 A;  4NSQ A;  4PK3 A;  3PB7 X;  3WAB A;  3V38 A;  4C7I A;  2EK9 A;  3B8G A;  1M4G A;  2PJ7 A;  3R1K A;  3PB9 X;  4OC2 A;  4X5K A;  4KOY A;  3SJF A;  4WWV A;  2FT0 A;  2I79 A;  1WWZ A;  3F8K A;  2AJ6 A;  1KUY A;  2ZEE A;  5G20 A;  1Z4R A;  3B3W A;  4R9M A;  2B5G B;  2FXF A;  2ODF A;  5LYF A;  1M1D A;  1VGY A;  3L2N A;  2F7V A;  3B3T A;  4TNU A;  4NEX A;  2OU2 A;  3TO6 A;  1Q2Y A;  1Y7E A;  3D3S A;  3JRU A;  2R7H A;  3W6S A;  3LWU A;  4CGL A;  3NH8 A;  1Y7R A;  3RBU A;  3V7Z A;  2C6P A;  3D7G A;  3R9E A;  4A95 A;  1CP7 A;  2ZW6 A;  2PVV A;  2Z11 A;  4GM5 A;  4NFR A;  2Z3K A;  1AUG A;  2C6G A;  2FIA A;  4JD6 A;  2DEA A;  2GIV A;  3FIX A;  3S6K A;  2PRQ A;  4UWJ A;  1S60 A;  4PXE A;  1ZLH A;  4J3G A;  4NJR A;  3RZA A;  4MFL A;  2PJ5 A;  4FAI A;  2PJ8 A;  3E0K A;  1IOF A;  2JEW A;  2OZG A;  2AFS A;  5HVG A;  1BOB A;  2C27 A;  5AG5 A;  3RYO A;  2VEZ A;  1GYT A;  3IEH A;  3SXO A;  4KZT A;  4MHY A;  4ORF A;  4NCZ A;  2B4D B;  2ZW5 A;  2EK8 A;  3CXS A;  3W91 A;  1CPX A;  4B10 A;  2A4N A;  3SJX A;  1KZF A;  1X10 A;  3MRU A;  4CAE A;  4KUA A;  3DDD A;  2ZW4 A;  1Y0Y A;  4MCR A;  1LAP A;  2OB0 A;  1M4D A;  1V0C A;  4MFQ A;  1LFW A;  2RC4 A;  4PSX A;  3V8I A;  2ABZ A;  5HVF A;  1Z8W A;  1M4L A;  1ELM P;  5BWA B;  2CF4 A;  4IHM A;  3VH9 A;  1XOV A;  2FCK A;  2PC1 A;  2Q51 A;  4NGS A;  3CXP A;  5J8C A;  4IK2 A;  1Z4E A;  1TKH A;  4R3K A;  1UWY A;  1Z9U A;  2PJ6 A;  4E8O A;  2QIR A;  2GU2 A;  2PJ3 A;  4AG7 A;  2X7B A;  2PJC A;  1XBU A;  3SJG A;  3DSB A;  2G3T A;  1YW4 A;  3GKR A;  2AFW A;  3SJE A;  4A33 A;  2JBJ A;  4AVB A;  4ZY1 A;  3T8W A;  4MCS A;  3IIB A;  4F8Z A;  1B87 A;  2VZY A;  3SI1 A;  1TF9 A;  1PCA A;  3PRT A;  3I9S A;  4UFW A;  3IWW A;  2Q4V A;  5K8N A;  1QSN A;  3LMS A;  2D4O A;  7CPA A;  2GAN A;  3H4Q A;  4HPS A;  5F47 A;  3HLP A;  1YVK A;  4JXR A;  3B3V A;  4U9Y A;  4JJX A;  1YW6 A;  1S3Z A;  1PUA A;  4M85 A;  4P10 A;  2ZEP A;  1EE3 P;  5AGE A;  4B5P A;  1S5K A;  4NGQ A;  4ZBG A;  1M4I A;  2R98 A;  2B4B A;  3CDX A;  1M44 A;  1HDU A;  2B3U A;  4ZYQ A;  3PGP A;  4CAW A;  3D2M A;  3R9F A;  2WZN A;  4X3R A;  4YRH A;  1NSA A;  2CXA A;  3FED A;  4NGN A;  4GS4 A;  4Q38 A;  4AXV A;  2PSW A;  2ZED A;  1ELL P;  2EVN A;  2OOT A;  4M6H A;  4KSA A;  1QSM A;  4UEZ A;  3QAH A;  1ZG9 A;  4MMO A;  4CGO A;  2Y0M A;  1Q2C A;  3NH4 A;  3NFZ A;  1HEE A;  5A28 A;  2GE3 A;  4MI4 A;  2RFH A;  4YFJ A;  1ARM A;  3I3G A;  3KQZ A;  3C26 A;  4OC0 A;  4G1P A;  4RUH A;  1Y0R A;  4B13 A;  2DPS A;  2BL1 A;  3TO9 A;  5IB0 A;  1CX8 A;  1Y9K A;  4P6Y A;  3PB4 X;  2OZH A;  3WC7 A;  1RXT A;  4IAV A;  4UFX A;  3CPX A;  2QVP A;  3NH5 A;  4H2K A;  3GB0 A;  1Z8T A;  3BJ7 A;  4AVC A;  1PU9 A;  5JGF A;  4A31 A;  4H6U A;  3BLN A;  2FS5 A;  4KLW A;  3CPA A;  4KOS A;  3DR6 A;  4DUK A;  1A2Z A;  5JPH A;  3IJ3 A;  3D8P A;  3WR7 A;  4CAV A;  4MHP A;  4KS9 A;  2HB6 A;  4U5Y A;  4M6G A;  1LCP A;  2I00 A;  4WJB A;  4QB9 A;  2Q7S A;  4P4J A;  1XF8 A;  5DS0 A;  3CZX A;  4II9 A;  1XRY A;  2P6E A;  4R7M A;  1IGB A;  1IU8 A;  2GRE A;  4MFK A;  5HVH A;  4K3N A;  2OH1 A;  4MBU A;  4R87 A;  5LYI A;  2F5I A;  2PDO A;  4PXB A;  2PE3 A;  3WT4 A;  4QUS A;  5K8M A;  5EMI A;  3D67 A;  4B6Z A;  3FXT A;  4CS0 B;  2QYV A;  2Q0Y A;  2C6C A;  1Z8L A;  1F2O A;  4P4E A;  2GFQ A;  1CM0 A;  3N7Z A;  1S7F A;  1QSR A;  4NGP A;  1QSO A;  3R9G A;  4AVA A;  4EWT A;  3R95 A;  2AFX A;  3NE7 A;  1QQ9 A;  4XPD B;  3D7F A;  5ELY A;  4PXC A;  2JBK A;  2K5T A;  2Q7B A;  2JLM A;  3T90 A;  1IOI A;  5HMN A;  4R57 A;  2PCU A;  4K30 A;  4RN7 A;  3IWG A;  4MXU A;  1Z2L A;  3DLJ A;  1BPM A;  3EC4 A;  4OAE A;  4LQG A;  5EC4 A;  3R96 A;  5HXD A;  4CGN A;  4NGM A;  3QNV A;  4IUS A;  2VXK A;  4Z65 A;  2Q44 A;  4Q7A A;  4C2X A;  3RNZ A;  4DJL A;  1XJO A;  2OZU A;  2ARH A;  4MJ8 A;  2ZEL A;  2PR1 A;  1QMU A;  5EBV A;  1IYK A;  1P0H A;  2BOA A;  3JUW A;  4KOV A;  5ISV A;  4IF5 A;  1CBX A;  1BO4 A;  3FB3 A;  3DR8 A;  4X8I A;  5AG6 A;  2PR8 A;  1L0C A;  2AE6 A;  2PJB A;  3NE8 A;  4OC5 A;  4NJQ A;  1UFH A;  3H8G A;  1NMT A;  3PBB A;  4NGR A;  1XMT A;  4EVY A;  2AFU A;  1OBR A;  4BMH A;  3N5F A;  3EO4 A;  2BEI A;  2PJ1 A;  1U6M A;  4FD4 A;  1B6B A;  1MJB A;  4YU9 A;  4QC6 A;  4EME A;  1YLO A;  2EUI A;  4B12 A;  3G8W A;  3TO7 A;  5KTD A;  4I49 A;  1I21 A;  2IMO A;  2P0W A;  2D4P A;  2HC9 A;  2Z3L A;  3IC1 A;  1Y9W A;  2BSW A;  2Z3O A;  4MCQ A;  3P2F A;  2Q04 A;  3FYN A;  3P2H A;  3TC8 A;  2WPX A;  3RO0 A;  4CYP A;  4XPL A;  5CPA A;  4ZY0 A;  2CIJ A;  4UCN A;  3FEE A;  4RI1 A;  4ZI6 A;  4KSF A;  2P6F A;  5H84 A;  5AG4 A;  3CT9 A;  3BXM A;  4P4F A;  4F9U A;  1R43 A;  4H6Z A;  4HNW B;  3JVN A;  4MRI A;  2CNM A;  4CPA A;  4W9Y A;  1YVO A;  2JDD A;  2R1I A;  2WUU A;  4A2Z A;  1FNO A;  4UEF A;  4XPD C;  2V8H A;  2YNC C;  2O4H A;  3B2Y A;  4UWI A;  3D7H A;  4MHD A;  4PV6 A;  4FD5 A;  4ONW A;  3LAC A;  3ZJ0 A;  5IX3 A;  1LAN A;  1S7N A;  3FNC A;  2PRB A;  3LOD A;  1ON0 A;  2PIZ A;  4AG9 A;  4FBE A;  4JYW A;  4UBR A;  5F09 A;  2PJ9 A;  2JDC A;  2V8D A;  3D7D A;  1OZP A;  4A30 A;  2WPW A;  4B11 A;  4B5P B;  3FRM A;  2HQY A;  3QB8 A;  3IWE A;  3FH4 A;  1YSJ A;  3K2K A;  4UCP A;  4QVT A;  3NA6 A;  4Y49 B;  4C68 A;  2CNT A;  4L89 A;  4CAF A;  1YK3 A;  5H86 A;  3OWC A;  4UF4 A;  3GIU A;  3SHP A;  3KHX A;  4FWU A;  3EY5 A;  3TTH A;  2PJ0 A;  2PQ8 A;  5G1Z A;  2GLF A;  1AYE A;  2CTC A;  3FMC A;  4YWY A;  1CJW A;  4F0Y A;  1AMP A;  4F0X A;  3TT2 A;  5JH9 A;  3B35 A;  2J8M A;  3S9N A;  4MCP A;  1LAM A;  3DNS A;  4NXY A;  1BAV A;  3UY5 A;  4CAX A;  2NMT A;  5K8O A;  1KUX A;  5C82 A;  4C7H A;  1FT7 A;  4JLY A;  4R76 A;  2CNS A;  5G22 A;  4BIN A;  4CYQ A;  2REE A;  4KSI A;  1H8L A;  5LRJ A;  1F57 A;  1RTQ A;  2FL4 A;  2PJ4 A;  4NF1 A;  3KR4 A;  1R57 A;  4MHZ A;  4FUU A;  4MY3 A;  1CP6 A;  3KGQ A;  4KOU A;  5J1Q A;  2XEF A;  1LOK A;  5LYD A;  3GYA A;  2FSR A;  3FJU A;  2OR4 A;  2FVG A;  3D2P A;  4A32 A;  2ZEM A;  4LX9 A;  4ZGY B;  5LRG A;  3KL9 A;  5K8P A;  2BUE A;  2Z3M A;  3DGV A;  3TCV A;  5KTC A;  1BPN A;  2HUZ A;  4PSW A;  3KAS A;  2ZEN A;  3BI1 A;  1XE4 A;  1YRE A;  1Z8X A;  4E0A A;  5JQ4 A;  2YND A;  1JWQ A;  2FE7 A;  3QAY A;  2G9D A;  2B58 A;  2QJ8 A;  3ISZ A;  5F46 A;  1R3N A;  3F0A A;  2Q43 A;  2B5G A;  4A94 A;  1XIX A;  5D29 A;  1N71 A;  2VI7 A;  4OP4 A;  2WSA A;  3IFE A;  2REF A;  1P4N A;  2ZPA A;  2BO9 A;  3SXN A;  4A39 A;  4OKO A;  3FEC A;  4DNC A;  4F6A A;  4HNX B;  5I0C A;  5KTA A;  4M6I A;  4FD6 A;  3B3S A;  2J9A A;  1KUV A;  3RAM A;  2ZEG A;  3PFO A;  3IU1 A;  4M3S A;  2ZOG A;  1HDQ A;  3FVL A;  4UEE A;  1WK4 A;  2Z3P A;  4PXD A;  4ONU A;  5GCN A;  4P44 A;  1YX0 A;  1ZG7 A;  4KVM E;  5FVJ A;  3PB6 X;  4MY0 A;  4A38 A;  2DXQ A;  1IB1 E;  2Q4Z A;  3KR5 A;  4UIB A;  3VAT A;  2XEG A;  3KI9 A;  4KVO E;  3VAR A;  4CYO A;  4KOR A;  2IJZ A;  2ZXV A;  4OID A;  3TOA A;  1YGH A;  4QBJ A;  4KOX A;  4Y49 C;  2B4D A;  1TKJ A;  1FY7 A;  3B3C A;  5J8F A;  2H5M A;  3T9Y A;  4ZY2 A;  4HNY B;  2EBJ A;  1NSL A;  4UA3 A;  1QST A;  1IYL A;  1IIC A;  3S6G A;  1BLL E;  2VBQ A;  2XEJ A;  2VZZ A;  2ZW7 A;  3GY9 A;  3BJ8 A;  3LD2 A;  4GXH A;  4L8A A;  2CTB A;  2WYR A;  3B7I A;  4P4D A;  2AFO A;  2V77 A;  4FD7 A;  1XEB A;  4CGM A;  5HH1 A;  5D8N A;  4R6T A;  2ANP A;  4C2Z A;  4C2Y A;  4H89 A;  1S7K A;  1VHE A;  3VWE A;  1GHE A;  2DF5 A;  4U9Z A;  2PJ2 A;  1VIX A;  1TXR A;  2AFM A;  4X2T A;  4ZX8 A;  1YLE A;  3PP9 A;  1RO5 A;  5F49 A;  4CYN A;  3PEI A;  4OC1 A;  4XNH B;  4YGO A;  4KUB A;  2V8V A;  2ZOF A;  4JXQ A;  1TKF A;  3VWD A;  3WC6 A;  1TIQ A;  4A37 A;  4CRY B;  3SI2 A;  1DTD A;  2ZEH A;  3S9M A;  2VL1 A;  4LUA A;  4KVX A;  3SI0 A;  3S6F A;  3JTK A;  4MFZ A;  4RS2 A;  4R3L A;  2AFZ A;  2QEC A;  4JZ0 A;  1K4J A;  3F5B A;  3W6X A;  4MHN A;  3ZZI A;  5LYL A;  4AB7 A;  2Z3N A;  3TX8 A;  2YNE A;  4B5O A;  2RB7 A;  1DE4 C;  2P6G A;  1KWM A;  1ZO0 A;  3D66 A;  2POK A;  3EFA A;  3ISX A;  1MJA A;  1Q7L A;  3D68 A;  4LQ6 A;  3FF3 A;  4OC4 A;  1CPS A;  2I3C A;  2IQ6 A;  3FBU A;  3MGD A;  4E2A A;  1I12 A;  4OLL A;  5F48 A;  4MFP A;  5AG7 A;  4PK2 A;  5G21 A;  4TWE A;  3PB8 X;  1PYT B;  3S6H A;  1YQE A;  4O23 A;  1VHO A;  4BD9 A;  2EO8 A;  2JEV A;  3GUX A;  5CNP A;  1F2P A;  5DWM A;  5A27 A;  3K9T A;  2HV2 A;  5C88 A;  5IV0 A;  3A9L A;  3MN8 A;  4CGP A;  3FX6 A; 
#chains in the Genus database with same CATH homology
 1YR0 A;  2DPT A;  1MJ9 A;  4B14 A;  2QML A;  4Q36 A;  2ATR A;  4MFJ A;  2YGW A;  5E96 A;  3IGR A;  4KLV A;  1VHS A;  1LRZ A;  2CY2 A;  2O28 A;  3IU2 A;  4OAD A;  4KOW A;  4UCM A;  5DWN A;  2R8V A;  1I1D A;  4JWP A;  1SQH A;  2J8N A;  3G3S A;  3PZJ A;  3TE4 A;  4UFV A;  4CRZ B;  2FIW A;  1VKC A;  2Z10 A;  2G0B A;  4XNH C;  2IL4 A;  1Q2D A;  3TOB A;  3TFY A;  1IID A;  3H5Z A;  2KCW A;  3KKW A;  4XPK A;  1S7L A;  2G3A A;  1J4J A;  2J8R A;  2B3V A;  4BBH A;  2Q4Y A;  2Z0Z A;  3K9U A;  4HKF A;  3EXN A;  2VQY A;  1MK4 A;  3CXQ A;  2YNC A;  4KOT A;  1NE9 A;  4NSQ A;  4PK3 A;  4C7I A;  3B8G A;  1M4G A;  3R1K A;  4X5K A;  4KOY A;  2FT0 A;  2I79 A;  1WWZ A;  3F8K A;  2AJ6 A;  1KUY A;  5G20 A;  1Z4R A;  4R9M A;  2B5G B;  2FXF A;  1M1D A;  4NEX A;  2OU2 A;  3TO6 A;  1Q2Y A;  4CGL A;  3D3S A;  3W6S A;  2R7H A;  1Y7R A;  3R9E A;  4A95 A;  2ZW6 A;  2Z11 A;  2Z3K A;  4JD6 A;  2FIA A;  2GIV A;  3S6K A;  4UWJ A;  1S60 A;  4J3G A;  4MFL A;  3E0K A;  2OZG A;  1BOB A;  2C27 A;  5AG5 A;  3RYO A;  2VEZ A;  3SXO A;  4KZT A;  4ORF A;  4NCZ A;  2B4D B;  2ZW5 A;  3CXS A;  3W91 A;  4B10 A;  2A4N A;  1KZF A;  4CAE A;  4KUA A;  3DDD A;  2ZW4 A;  1M4D A;  2OB0 A;  1V0C A;  4MFQ A;  3V8I A;  2RC4 A;  4PSX A;  5BWA B;  2FCK A;  2PC1 A;  3CXP A;  5J8C A;  1Z4E A;  4R3K A;  1Z9U A;  4E8O A;  2QIR A;  4AG7 A;  2X7B A;  3DSB A;  2G3T A;  3GKR A;  4A33 A;  4AVB A;  1B87 A;  2VZY A;  3I9S A;  4UFW A;  2Q4V A;  1QSN A;  2D4O A;  2GAN A;  3H4Q A;  5F47 A;  1YVK A;  4JXR A;  4U9Y A;  4JJX A;  1S3Z A;  1PUA A;  4M85 A;  5AGE A;  4B5P A;  1S5K A;  4ZBG A;  1M4I A;  2R98 A;  2B4B A;  1M44 A;  2B3U A;  3PGP A;  4CAW A;  3D2M A;  3R9F A;  4YRH A;  2CXA A;  4Q38 A;  4GS4 A;  2PSW A;  2EVN A;  4KSA A;  1QSM A;  3QAH A;  4CGO A;  2Y0M A;  1Q2C A;  5A28 A;  2GE3 A;  4MI4 A;  4YFJ A;  3I3G A;  3C26 A;  4B13 A;  2DPS A;  2BL1 A;  3TO9 A;  5IB0 A;  1Y9K A;  2OZH A;  1RXT A;  4UFX A;  4AVC A;  3BJ7 A;  1PU9 A;  4A31 A;  4H6U A;  3BLN A;  2FS5 A;  4KLW A;  4KOS A;  3DR6 A;  5JPH A;  3D8P A;  3WR7 A;  4CAV A;  4KS9 A;  4U5Y A;  2I00 A;  4QB9 A;  1XF8 A;  4II9 A;  2P6E A;  4MFK A;  2OH1 A;  4MBU A;  4R87 A;  2F5I A;  2PDO A;  4QUS A;  3FXT A;  4CS0 B;  2Q0Y A;  1CM0 A;  3N7Z A;  1S7F A;  1QSR A;  1QSO A;  3R9G A;  4AVA A;  3R95 A;  3NE7 A;  3A9L A;  4XPD B;  2K5T A;  2Q7B A;  2JLM A;  3T90 A;  5HMN A;  4R57 A;  4K30 A;  3IWG A;  3EC4 A;  4OAE A;  5EC4 A;  3R96 A;  4CGN A;  4IUS A;  2VXK A;  2Q44 A;  4C2X A;  2OZU A;  2ARH A;  4MJ8 A;  2PR1 A;  5EBV A;  1IYK A;  1P0H A;  3JUW A;  4KOV A;  5ISV A;  4IF5 A;  3FB3 A;  1BO4 A;  3DR8 A;  5AG6 A;  2PR8 A;  1L0C A;  2AE6 A;  1UFH A;  1NMT A;  1XMT A;  4EVY A;  4BMH A;  3EO4 A;  2BEI A;  1U6M A;  4FD4 A;  1B6B A;  1MJB A;  4QC6 A;  2EUI A;  4B12 A;  3G8W A;  3TO7 A;  5KTD A;  4I49 A;  1I21 A;  2P0W A;  2D4P A;  2Z3L A;  1Y9W A;  2BSW A;  2Z3O A;  3P2F A;  2Q04 A;  3FYN A;  3P2H A;  2WPX A;  4CYP A;  4XPL A;  4UCN A;  4RI1 A;  4KSF A;  2P6F A;  5H84 A;  5AG4 A;  4H6Z A;  4HNW B;  3JVN A;  2CNM A;  1YVO A;  2JDD A;  2R1I A;  2WUU A;  4A2Z A;  4XPD C;  2YNC C;  4UWI A;  4MHD A;  4PV6 A;  4FD5 A;  3ZJ0 A;  5IX3 A;  3FNC A;  1S7N A;  2PRB A;  3LOD A;  1ON0 A;  4AG9 A;  4UBR A;  2JDC A;  1OZP A;  4A30 A;  2WPW A;  4B11 A;  4B5P B;  3FRM A;  2HQY A;  3QB8 A;  3IWE A;  4UCP A;  4QVT A;  4Y49 B;  4C68 A;  2CNT A;  4L89 A;  4CAF A;  1YK3 A;  5H86 A;  3OWC A;  3SHP A;  3EY5 A;  3TTH A;  2PQ8 A;  5G1Z A;  4F0X A;  1CJW A;  4F0Y A;  3TT2 A;  2J8M A;  3DNS A;  4NXY A;  3UY5 A;  4CAX A;  2NMT A;  1KUX A;  5C82 A;  4C7H A;  4JLY A;  2CNS A;  5G22 A;  4CYQ A;  2REE A;  2FL4 A;  4NF1 A;  1R57 A;  4MY3 A;  4KOU A;  3GYA A;  2FSR A;  3D2P A;  4A32 A;  4LX9 A;  4ZGY B;  2BUE A;  2Z3M A;  3TCV A;  5KTC A;  2HUZ A;  4PSW A;  1XE4 A;  1YRE A;  4E0A A;  2YND A;  5F46 A;  2FE7 A;  2B58 A;  3F0A A;  2B5G A;  1XIX A;  1N71 A;  2VI7 A;  2WSA A;  2REF A;  1P4N A;  2ZPA A;  4DNC A;  3SXN A;  4F6A A;  4HNX B;  5I0C A;  5KTA A;  4FD6 A;  1KUV A;  3IU1 A;  4M3S A;  1WK4 A;  2Z3P A;  4ONU A;  5GCN A;  1YX0 A;  4KVM E;  5FVJ A;  4MY0 A;  2DXQ A;  1IB1 E;  5JQ4 A;  4KVO E;  4CYO A;  4KOR A;  2ZXV A;  3TOA A;  1YGH A;  4QBJ A;  4KOX A;  4Y49 C;  2B4D A;  1FY7 A;  5J8F A;  2H5M A;  3T9Y A;  4HNY B;  1NSL A;  4UA3 A;  1QST A;  1IYL A;  1IIC A;  3S6G A;  2VBQ A;  2ZW7 A;  2VZZ A;  3GY9 A;  3LD2 A;  3BJ8 A;  4L8A A;  5G21 A;  4FD7 A;  1XEB A;  4CGM A;  5HH1 A;  4C2Z A;  4C2Y A;  4H89 A;  1S7K A;  3VWE A;  1GHE A;  4U9Z A;  1YLE A;  3PP9 A;  1RO5 A;  5F49 A;  4CYN A;  4XNH B;  4YGO A;  4KUB A;  4JXQ A;  3VWD A;  1TIQ A;  4CRY B;  4LUA A;  4KVX A;  3S6F A;  3JTK A;  4RS2 A;  4R3L A;  2QEC A;  1K4J A;  3F5B A;  3W6X A;  3ZZI A;  4AB7 A;  2Z3N A;  4B5O A;  2YNE A;  2P6G A;  1ZO0 A;  3EFA A;  1MJA A;  3FBU A;  3MGD A;  4E2A A;  1I12 A;  4OLL A;  5F48 A;  4MFP A;  5AG7 A;  4PK2 A;  3S6H A;  2JEV A;  5CNP A;  5DWM A;  5A27 A;  2HV2 A;  5C88 A;  5IV0 A;  3FIX A;  4CGP A;  4MFZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...