2PDQA

Human aldose reductase mutant c303d complexed with uracil-type inhibitor.
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
315
structure length
315
Chain Sequence
ASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSDTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Merging the binding sites of aldose and aldehyde reductase for detection of inhibitor selectivity-determining features.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Aldose reductase
total genus 101
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2007-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2pdqA00
2PDNA 3V0SA 5LIXX 4JQ3A 2PDPA 4JTDA 4XO7A 3Q65A 3V36A 2IS7A 2C91A 3UZXA 2P5NA 4PR4A 1C9WA 3RX3A 4G5DA 3EB4A 1Q5MA 4JQ4A 3V0TA 2DV0A 3V35A 1VP5A 1YE6A 3UG8A 5M2FX 4ASTA 2F38A 1PZ0A 5HNTA 1T40A 5HNUA 4OTKA 2ACQA 2J8TA 2PDJA 3DN5A 4ZFCA 1IEIA 2PDGA 1LWIA 3UYIA 4IGSA 3CMFA 1EKOA 3G5EA 3KRBA 4GQGA 3UWEA 3R7MA 2VDGA 4JTAA 3VXGA 1J96A 3GHRA 1M9HA 2PDKA 2PDMA 3GHTA 3C3UA 4PRRA 2PEVA 4LBSA 2PDIA 1T41A 3FX4A 1Q13A 4ICCX 5HA7A 3LQGA 4LAZA 1AH3A 4LAUA 1PWMA 2ACUA 4WEVX 4F40A 1MRQA 3B3DA 3UP8A 4PMJA 4LB4A 2HVOA 3WBWA 3CV6A 4XZIA 2A79A 2QXWA 1XJBA 4Q3MA 3UZWA 2ISFA 4QX4A 3UFYA 2IQ0A 2INZA 3ONBA 1RY8A 2PD9A 4FZIA 4XZNX 4PRTA 1US0A 3UGRA 1HQTA 3ERPA 4NKCA 4FAMA 2ACSA 1X98A 2FGBA 4IJRA 5LIUX 2HVNA 3WBYA 4GABA 2BGSA 1QRQA 4HMNA 5LIYX 2IPJA 3O3RA 2PFHA 3M0IA 4WDXA 1PZ1A 2INEA 1ZUAX 3UZYA 1Z8AA 3H7RA 2IKGA 3LN3A 5DANA 3LUTA 3H7UA 3R43A 2FZ8A 1Z3NA 2PDFA 4H8NA 1RALA 3CV7A 2PDWA 4JIRA 4HBKA 4DZ5A 2ACRA 5LIKX 4DBWA 2BGQA 3LZ3A 3UZZA 4XZLX 4PUWA 3GUGA 3S3GA 2IKJA 3BUVA 1IHIA 5JH1A 4GIEA 1R38A 4YVVA 3G1RA 2BP1A 1Z9AA 1EL3A 5AZ1A 3RX2A 4WDUA 1ADSA 2ALRA 3RX4A 3D3FA 2DUXA 3M4HA 5LIWX 3BV7A 1MI3A 1SM9A 3EAUA 2CLPA 2IPWA 1LQAA 2I17A 4JQ1A 4YVXA 3F7JA 3CASA 3P2VA 1UR3M 2IKIA 3WCZA 3LBOA 4JIHA 3ONCA 2DUZA 4LB3A 1PYFA 3N2TA 2PDXA 3R8HA 3LENA 4GA8A 1QWKA 3BURA 3LQLA 3LEPA 3M64A 4JTQA 3FJNA 1HW6A 3H4GA 4QBXA 2HEJA 1ZGDA 4L1WA 1JEZA 2R24A 1S2CA 2F2KA 1S1RA 3R94A 4Q7BA 1ZQ5A 4XVDA 1K8CA 4WGHA 1AZ1A 2HE8A 3V0UA 3BCJA 2FVLA 1GVEA 5AZ0A 2HV5A 3LD5A 2R9RA 4DBUA 1A80A 3DOPA 4QR6A 2AGTA 2NVCA 4JTCA 4WRHA 3R8GA 4YVPA 4XZHA 4MHBA 3CAQA 1AH4A 1EF3A 5JH2A 2IPGA 2PDCA 3NTYA 4JTRA 2NVDA 2PF8A 2HE5A 1S1PA 1OG6A 3N6QA 2PDYA 4XK2A 2FZBA 4LBRA 4WDTA 4GQ0A 2FZ9A 3GHSA 1VBJA 4L1XA 4YS1A 4JQ2A 3U2CA 3COTA 2PDUA 4EXBA 2FZDA 4DBSA 1YNQA 2IPFA 2PD5A 3EB3A 1PWLA 4YU1A 4RPQA 4I5XA 4IJCA 3LZ5A 1XF0A 1YNPA 1YE4A 1Z89A 1MZRA 3MC5A 4JQAA 2IQDA 4PUUA 1EXBA 4FALA 4R9OA 2IKHA 2PDQA 3R6IA 2PZNA 2I16A 3QKZA 2WZMA 1X96A 3CAVA 3LNMA 4H7CA 3O0KA 4EXAA 2HDJA 1RY0A 4FA3A 4JIIX 1AH0A 1FRBA 2PDHA 2PDLA 3WG6A 2PDBA 3MB9A 1AZ2A 4AUBA 3T42A 4GACA 3WBXA 1AFSA 4XZMX 5KETA 3Q67A 3R58A 1X97A 4WDWA 2WZTA 4XVEA 5C7HA 1XGDA 3GHUA 4GCAA 1S2AA 4QXIA 4XAPA 4XO6A 1ZSXA
chains in the Genus database with same CATH superfamily
1R87A 4CKQA 2CLFA 4JICA 1H7RA 1EJRC 2Y62A 3PC0A 5ECVA 3M9YA 3WLKX 2PBOA 2Z2AA 3T07A 2H3DA 4OBSA 1PL9A 2ZTKA 2ZC1A 3EB4A 3EPNA 1K7EA 2Z28A 1EPXA 4GX9A 3DU0A 3UR5A 1VP5A 5G4HC 4K8HA 4YL2A 1V6UA 5LNWA 3VNMA 2PSNA 3QGVA 5C9RA 2XZ9A 1EYEA 5D4YA 5JXQA 3FVDA 1EP1A 2OTDA 3W74A 2VEMA 3ZO9A 1A5KC 2B4GA 4UFJA 1I2RA 3QMSA 3VKBA 1RH9A 4LAOA 1FHDA 3TOYA 2PMQA 1YMYA 4S3KA 1DJYA 4IGSA 1I2QA 4IPJA 1CEOA 4K37A 2ZRXA 1GOWA 2YDRA 1TPVA 4ORIA 3CWHA 4GQGA 1M65A 2HNHA 2CZEA 1CGWA 1A47A 3WJZA 5HWNA 4F2UA 3QBUA 4U2YA 1I0BA 4C6IA 1IZCA 1JAKA 1A4MA 3NM1A 5AVHA 3BSHA 3OBKA 4GQQA 5AECA 2REQA 4HU4A 3VNJA 4AMCA 2QCDB 4GKLA 1J0ZA 2J88A 4DAIA 3ICJA 2ESCA 1UD2A 4CD5A 1MXGA 5HNNA 4P2VA 3UP8A 3S8HA 5H91A 4UFHA 1W9UA 2WOQA 4I5UA 1YTEA 4HA0A 2OEMA 1IXQA 3S6TA 1UC5A 1KO0A 4UOJA 1E0XA 5AC5A 3EEZA 5G2IA 4H2HA 4PRTA 2GJPA 2QPXA 1E0VA 4D6FA 5J04A 4XWUA 1BWLA 5G4EA 3Q37A 4KEMA 1DWFM 2HNEA 3MUXA 3MZNA 7ENLA 2ZQ0A 3BG9A 4AEFA 4JYEA 3SRDA 3AJXA 4GABA 1X6LA 3N29A 1NOWA 1DKWA 1PZ1A 2FFIA 5T9BG 2UY3A 3PANA 2QCGA 3H7UA 1RD6A 3L4UA 3PJTA 3R13A 3AJ7A 3IGHX 3H2AA 2P10A 4LBUA 3TJLA 3FNDA 2VQUA 5J5DA 4PGLA 3L4XA 3W75A 5BXSA 4X9YA 2Q8LA 1EJUC 1ITQA 3S6DA 4LYKA 3YPIA 3KL3A 2JIEA 2XGBA 4XZBA 3KDOA 3PTKA 2DUXA 2GVGA 5CCZA 1V0LA 1FCUA 2G0WA 5IDZA 1S39A 3CUZA 3UWYA 4DF2A 1GQNA 2X42A 1DHPA 3BSGA 1P7TB 3IJ9A 4BI7A 1V6TA 2CLIA 4GQBA 4C6MA 3AYVA 5HWJA 1HT6A 4S1FA 2G8ZA 4JTIA 5FF7A 1Y5XA 1IXOA 2FYMA 3HG2A 1R9XA 1JCYA 1F5ZA 3BLFA 2PDXA 4C1NA 2WJZA 4KCVA 1AK5A 1Z48A 3RM8A 3OU8A 4CD7A 4AWTA 2PTYA 4AIUA 3WQFA 1GUVA 2PF0A 1KFCA 3G3MA 2AMGA 2J9YA 5C71A 3W88A 5G2HA 2CW6A 1FDZA 1SQ7A 1TJ0A 3EB2A 1FWRA 3LTYA 2CXGA 4PL2A 3VDAA 1MW3A 1BRLA 1G7VA 2CLEA 4QJ3B 4ZB0A 3OP2A 2DT3A 2EG7A 4W9TA 3TC7A 1GVEA 1KQZA 1TCMA 5A3HA 4GE8A 2GQAA 3ARWA 3KOYA 5HPOA 4JGDA 4PN2A 3NYDA 2ZICA 3MUY1 4KWOA 3XISA 1UA3A 5E6YA 4UQDA 3V3WA 1AH4A 2XDFA 2P3EA 4H3DA 2VZSA 2E0PA 1PPIA 5JH2A 4FNRA 4PUMA 1A49A 3UPBA 3EOLA 2RJGA 3BAJA 1CYGA 5E93A 2E5DA 3N2BA 4DZIA 5HINA 3G77A 4O4WA 3MUAA 2PTWA 4LSBA 3CU2A 5I24A 4NNAA 4TX8A 2XIOA 5EFFA 3N6HA 3TW9A 3VFCA 5CZKA 1OC5A 5AC6A 4JQ2A 1VFLA 4MNJA 4H6QA 1OFOA 3ANUA 1Q6LA 2EGZA 4IPPA 4JDBA 5LSMA 4A35A 4KFPA 4UC5A 3LSBA 1X8FA 1QU4A 4RW3A 1M5WA 2PP1A 2A21A 4ENLA 1F76A 3NQ8A 3EA3A 1DQXA 4PMNA 3WBEA 2WZHA 4GYJA 2VDHA 1XBYA 3GXNA 2PZNA 1UR8A 3RR4A 2HDJA 3NQ6A 1IR2A 2VO5A 1JCXA 1FRBA 3VC5A 3G0XA 1JFXA 4Q4SA 1JPMA 4L6OA 3IAPA 1DP0A 5D09A 3W86A 1WAUA 1TPUA 1BQCA 2FHFA 2WLZA 5FF2A 1Q4NX 3DESA 1X97A 3T6CA 3VIPA 2DQWA 1MW2A 2XFFA 1LDCA 3LGGA 3XIMA 3WMBA 1YEYA 2VDIA 4X3ZA 1V6XA 2YL5A 5I3DA 4IWWA 4JQ3A 1RUSA 3UGVA 4PMVA 4IL2A 3S5OA 3NXFA 1M7OA 2YL9A 3U4AA 2WKLA 3TSDA 3W7OA 1C9WA 3RX3A 2QMKA 5CEWA 3NQEA 1L6GA 1NFBA 3AIBA 4JQ4A 2YA2A 1ITCA 4HKPA 2UY5A 1MWOA 3M0KA 5B7ZA 1JJKA 1WXZA 4GO9A 2ZX5A 4HJWA 4MFDA 3LDVA 4IIFA 2QT3A 4MAVA 4QAIA 2J8TA 1KFJA 2WWDA 3VOFA 3QHMA 1PIGA 3WUGA 1DHKA 3FSTA 4QJ5B 3NQCA 2VCAA 3POHA 4FNTA 1M03A 4F0RA 4DJDD 3LGDA 4GPNA 3FN9A 3U7BA 4J3XA 2Y6ZA 2YPIA 4GC3A 1M9HA 1C7TA 5AHNA 1UKPA 1XHGA 2EEXA 1IT7A 3L2LA 5CAKA 1Q4WA 4B92A 1K9TA 1Q6OA 2PDIA 3T0AA 4L64A 3H70A 2ISVA 4Y9MA 4XSMA 4PCNA 4Q7IA 4LAZA 4PYSA 3VIFA 2YA0A 4WEVX 4WHBA 1UBSA 1UH2A 3CYJA 1TV5A 3AMKA 2A79A 4ATDA 2QXWA 1I2PA 4LV9A 3O0FA 3KEHA 1IEQA 1FDJA 4DEFA 4QEEA 1ZRQA 2RUSA 4F9JA 3R0KA 5F4WA 3MU7A 3I3EA 2BZNA 3AIUA 1Q6FA 4Y9PA 4AH7A 1ICQA 2I57A 1QBAA 3BOXA 5FIPA 4FAMA 1LOQA 3U9IA 3BW4A 4AY8A 4D8AA 3PFMA 2W27A 1O4UA 1FBAA 3WEMA 4Q8VA 1GJPA 3RF9A 2BGSA 5TAOA 4O1CA 3LRMA 1GORA 1QW9A 3TWAA 3H55A 1TFVA 3SRHA 4IP4A 5AYXA 2VCBA 3E02A 1W1B1 2OPJA 3A6OA 1JQVA 4H8NA 1XLLA 4IXXA 4JR5A 2C7FA 3FHQA 4JIRA 3H2MA 3R11A 4Z17A 3H2EA 1U2YA 3KP0A 2XVPA 4O0QA 3GUGA 2E6FA 4PEEA 4YVVA 1OGSA 1EOMA 4ZOEA 1AW5A 1EL3A 4K8GA 1QXLA 3LB0A 4WSHA 3PJUA 2TAAA 2W61A 1ZZMA 4GNVA 3WNNA 2ZX9A 3MS8A 1POJA 3LCGA 4YYFA 1AD4A 4J7RA 3O07A 3STEA 3BLOA 2WSRA 1H50A 3UWZA 2IPWA 2A7NA 1TJ2A 3EWDA 4W8AA 4PFMA 1KXVA 3HZ3A 4PEKA 3UXIA 3H8AA 3P2VA 2J7EA 2VI0A 4R7WA 3LOTA 1E4NA 4HZ6A 2NLYA 4AZGA 1PJ9A 1KXQA 1EDTA 5JUVA 2VUYA 2V81A 4RX0A 4DJDC 1DJGA 3STCA 1UD5A 1GEQA 1BXNA 4UTIA 1TV3A 4NJIA 3WLNA 3CK5A 1IQ8A 3K1GA 3SIMA 4B5SA 4V33A 1FWDC 5EU9A 4S3CA 3HN3A 2Y24A 1MW1A 4WGXA 3NQBA 3LLFA 2OO0A 4KMQA 3SBFA 4NYYA 5B80A 3O6DA 4QLKA 5CSYA 3MP4A 1HUVA 2V5LA 1JIBA 3GXPA 3M0YA 1X1ZA 3O1NA 2OWWA 2WWCA 1TPEA 1CLXA 4AZ7A 1R3VA 2DIEA 1KC7A 4F8XA 1UP3A 3KBMA 2GGJA 3FHAA 2GJRA 8XIAA 5K4XA 1VBRA 1PAMA 3CZ8A 2BASA 4GI4A 1HL8A 1JI1A 4U28A 2D2HA 3AXMA 1JCLA 1G6CA 4KS0A 4P5UA 1GOXA 2HV5A 1EUNA 2QNEA 4UZSA 2Q3RA 1ICPA 1W1TA 4R27A 3OB8A 1YADA 1JI2A 1UKQA 4Q4MA 1P0DA 1RR2A 1UOZA 5G1MA 4JTRA 3L66A 4YLWA 2I5QA 3E74A 1W31A 3N6QA 3POCA 1FHLA 4A8RA 3WLLA 4EANA 1E0UA 1KLYA 1OD0A 3E2SA 3H4WA 2J9ZA 1YPXA 2IXUA 2WMIA 3W2NA 3MQTA 1JGIA 4ZTXA 4PMYA 1P0KA 1IWPA 1VQTA 2XISA 1JD7A 2YCLB 1W1A1 4GVFA 2GJNA 1LLZA 1NWTA 3N6JA 4IFKA 3MV01 4YS1A 4NP7A 1UJPA 4W5UA 3OQ8A 1UR9A 2PDUA 5E09A 2WJEA 3W2KA 4DBSA 4PB3A 1OVDA 3GVVA 2QCLA 1B3ZA 1NIUA 3HQ1A 2FDMA 4JKKA 3FA5A 5FJTA 5KSWA 3G6LA 2WNWA 3HBLA 4YHEA 3STFA 5HQMA 1YNPA 1UZ1A 3MC5A 4W87A 2O7SA 4PUUA 1EXBA 3E0WA 3PP7A 1G4SA 3LCLA 4E38A 2IKHA 3DFNA 4S3FA 3WENA 4F48A 3ARQA 2Y7EA 4EXAA 2Z0IA 2DFAA 1DXEA 2W0UA 1KA9F 1O5RA 4B5TA 3VGGA 4UTJA 1KGXA 7TIMA 3S1GA 4H7ZA 1QNOA 1VENA 1J2WA 1FWAC 4Q4KA 3QZEA 3KOWA 2BY2A 3WDHA 4LFYA 4W4QA 3MI2A 3L5LA 3W7MA 3DCPA 3A47A 3LHYA 3SO7A 5C9UA 1Z32X 3WNOA 1XCWA 4A29A 3VMPA 3E5PA 3VD7A 1SO3A 4S2BA 4GXWA 2KX9A 2I9EA 4XAZA 2I1OA 5CJ5A 2ZZ2A 3U2OA 4MGGA 4KGLA 3FXYA 5HNRA 3UZXA 1RZMA 5ABFB 3CM4A 3K2GA 2F8QA 2WMKA 3LM7A 1RJQA 4KFNA 1WKEA 3C56A 1OIMA 1J6PA 3MHUA 3H12A 1BGAA 5I23A 5AVNA 4GI9A 3E9AA 4A8NA 1VCFA 1UC4A 4Z0JA 4WOZA 4M1RA 3E6EA 1WYIA 1XH2A 2OKOA 4C6QA 2R14A 2FH8A 1XX1A 4BQ3A 5HK4A 1GG0A 4CQCA 1UCWA 3N04A 4D6DA 1V3IA 4NUWA 4GGHA 2VR4A 2DVXA 2G3NA 3VX0A 1UBPC 4A3UA 1EKOA 4GY0A 4D1JA 1VPXA 2YSWA 4IQEA 3LS9A 1E5NA 3QQWA 2J62A 4LPCA 3GHRA 5AYYA 3VIHA 3W7CA 2NT1A 4Q22A 2GGIA 2BSLA 1G94A 2YJQA 3WUBA 3UERA 3TFCA 2CZVA 4DBEA 3VZXA 1BF2A 3KDNA 4HZMA 5GQBA 2HMCA 1XV8A 2FTWA 2VP8A 3D6NA 4C65A 1THFD 2J9XA 4I90A 1V3MA 2NT0A 2VR5A 2ZXDA 4MB4A 3BK0A 3PFRA 1MMFA 1V8EA 1W3LA 4UOQA 4TU1A 2ADAA 1RVKA 4BQ5A 3THUA 4C90A 4UFKA 3HTWA 1XQKA 2J7GA 3ONBA 3QH2A 2Y5SA 3EYPA 3NIYA 4ADSA 1W2VA 3ZR6A 3MKKA 1NP2A 5LXXA 3AWOA 1W1PA 4G2DA 1QW8A 1W5OA 4JX4A 3VX1A 1E4IA 3VKCA 2CESA 1BSIA 1RAKA 2A3EA 1QRQA 1VEMA 3S47A 3TXZA 2V82A 3GDLA 3WLHA 1TPWA 3NVDA 2FHBA 3HFTA 4LAMA 2BOGX 2Y8KA 3G1SA 4RE2A 3S2NA 4TMBA 1WB0A 3I65A 5FL0A 3MSYA 1RCOB 1RALA 3IEBA 2V8ZA 4BF7A 2OYKA 1V02A 4BWLC 3KRZA 3RIKA 4YNGA 1J9YA 5BYWA 1TTPA 3SCWA 4FF7A 1UQYA 3BAXA 2A85A 1MDRA 3VD5A 1FTXA 1A5UA 4UTLA 4OBTA 4NASA 3WQEA 3W7EA 1CGUA 5IFPA 4QSHA 3S5YA 2AOSA 3RX2A 3LRKA 3VMOA 1O5QA 3STPA 3VOIA 2GSEA 1DIDA 3GXFA 4N6EA 4HPGA 1LQAA 2DY3A 4G9PA 3G1YA 1TWIA 3JW7A 4N42A 1OYAA 1PUDA 3LBOA 4WLCA 1IXNA 2DSUA 1ICSA 2OLSA 1UUMA 3C2EA 1B3WA 3AZSA 4UTWC 4IMCA 5A95A 2HK0A 1TTJA 4BQ2A 1OF6A 3HGJA 5EMMA 1ZENA 4UMBA 3UETA 1VHCA 2GOUA 3LHUA 5I77A 3EA2A 1G69A 2VURA 3VZYA 2HEJA 4IIHA 1A5BA 4QE5A 4GZ7A 3IV8A 4C6OA 1E72M 4UMCA 3R94A 4ERGA 1FCVA 2O56A 4D71A 3ARPA 1EPVA 1EQPA 3M43A 1GVSA 2OVLA 2PTDA 1ZJHA 2XWEA 2WNNA 3GTIA 4O50A 4P7RA 2BVTA 2Z27A 4ZO7A 2ONEA 3FYPA 4IUGA 3LX9A 4AD1A 4KF1A 1E55A 2J25A 3PUOA 4HNNA 1XICA 3GR4A 3LD5A 1LL7A 1WOBA 3GWQA 2B7PA 3T2QA 3I4KA 3ZFHA 1XLFA 1QAPA 1JNEA 3BICA 4JTCA 4AC1X 3PUDA 1NQKA 2B0MA 4MM1A 7A3HA 3W73A 3M0VA 4ORMA 4M1BA 2OZ0A 3U5YA 1FWSA 3ZJ6A 4KRTA 3U48A 1V0KA 1V0NA 1XBXA 1H63A 1ZJIA 1VHNA 1K8XA 4B2DD 1N7KA 4RJEA 3D0CA 2Y61A 4O28A 2FZ9A 2FGLA 1OABA 1P43A 1ISVA 4D8LA 4AY1A 2Y4SA 4M8UA 3QQ0A 3G0UA 5CG0A 4CNTA 3CAWA 3CPRA 1S5NA 3PF3A 2QGHA 1TJ1A 4C1LA 4IX0A 1WCGA 2Z29A 4ADTA 1MNZA 2E8YA 1KM2A 4RNFA 2GFTA 3WLSA 5TD4A 2PA6A 4GIYA 1EJ7L 5E0FA 1RY0A 1WZAA 5C9WA 2Q6ZA 3ZXWA 4GY7A 3WLQA 3LTPA 1REQB 2QJJA 2TODA 3N4EA 4C5YA 2CITA 3FYOA 4JD4A 2R1MA 4JHMA 3UVIA 4GD0A 1DE5A 3SSJA 4QRNA 2VEPA 4WXZA 2PZ0A 1VFUA 1S2AA 1AL7A 2OZ8A 3LCHA 3L68A 4I6KA 1TA3B 4HU3A 1ZAJA 3IK2A 2MNRA 1GJWA 2WVVA 5LIXX 4MWAE 3MVTA 2ZXBA 1C9DA 3PBVA 1LROA 3IACA 2QVHA 3LPFA 4IP7A 1FUYA 3TYZA 1AQ0A 1OCQA 3OA5A 1SJAA 1CNVA 1XDMA 5HXMA 3LV5A 5JVLA 2ZA2A 3GZAA 3OZYA 4AWEA 3RITA 1A53A 3DAQA 2X0SA 3W1LA 4HD5A 2YKKA 4Z2IA 1RP9A 3SUTA 3THAA 3TN3A 2I9UA 3PZ9A 3UWVA 4QLLA 4WKFA 1M1BA 3H21A 3LNPA 3EMCA 1WBJA 1K6AA 3UYIA 4FI4A 4R88A 1NDWA 5I07A 2X05A 1ZBWA 5D2XA 3NOEA 1GHSA 2R82A 3ALFA 1WDRA 2PWVA 1HTIA 1DJXA 5CQ1A 3TMLA 2TRSA 3QPEA 3L2MA 3P0XA 3WFLA 3FX4A 3PZOA 1V6YA 2WHMA 3E49A 4AZ5A 1NWUA 3DIPA 1MRQA 5CC6A 1UD8A 1FCQA 4CD8A 5F2MA 1YDVA 3JRKA 2DZTA 1H7OA 1T96A 2ANUA 5PTDA 4XG1A 4DNMA 3CHVA 3RLHA 1VFMA 3B8DA 5KZ6A 2PCQA 4HYRA 4KFOA 4DRSA 2NLIA 4DVOA 3II1A 3NL5A 2XH2A 1DIOA 1U5JA 4US5D 1E73M 2E67A 4M51A 2ISDA 1OFQA 3GTFA 4ICMA 5BU9A 1W9BM 4LH8A 5LIUX 4PRWA 3ITGA 2GL5A 5DMLA 2HVNA 3R89A 1HKJA 2NXIA 1JPDX 2FZNA 4OBRA 1VKFA 4MDPA 5G1YA 3DHUA 4LF2A 1Z8AA 1PX3A 2MUCA 2DW6A 3P3BA 3VCNA 3LM3A 4V1YA 1U30A 3TJXA 3NGFA 1CI1A 4DBWA 4UTHA 1BTMA 4HSNA 1GPFA 2BGQA 1J4EA 4EACA 3W6MA 3UD6A 4IGNA 3KE0A 1RCXB 4DM1A 1NJJA 4FXRA 2ZZ7A 4YHGA 2F6XA 3CLMA 3ARTA 4NAFA 3CZJA 1X39A 3MUZ1 2OG9A 3UJSA 3MT1A 4HT3A 1YBQA 1CLVA 5K4ZA 1XRVA 1QPQA 4W93A 1CXEA 3C0SA 2WVSA 3PTDA 4NIRA 4HSOA 3N12A 2CYGA 4NAFB 3S1UA 5CSSA 3R8RA 4JOMA 1WDDA 3PB2A 2VJXA 3W7RA 1S46A 3W25A 1O6IA 4F79A 2F9RA 3GO2A 2XVGA 4EPBC 1PKYA 4JTQA 1OF8A 3NQDA 3TCSA 1R7OA 3M1ZA 1YIXA 3NDZA 1BYDA 4YTTA 1XWYA 2C14A 2VFIA 1DJIA 5C2XA 2QYGA 3GY1A 4HK5A 3DC0A 1EOKA 4GC4A 4AZ6A 3HPAA 3T55A 8XIMA 4V2XA 3LLDA 3WDRA 3VVGA 1C8YA 2X1IA 5H8UA 3F4DA 3RJYA 2CHRA 3N2XA 3O15A 4I7UA 2X0HA 3W7QA 3N2CA 5BROA 1LBMA 4KWSA 3BAYA 4CVWA 2POZA 2X8RA 5M1TA 3A64A 3NO3A 1UWIA 4B90A 5E70A 3BMWA 4Q8QA 2O92A 5AHMA 3GNPA 3ABOA 3F4WA 2J8GA 1DQUA 1ZP4A 4WKHA 1H09A 4BCEA 4IFKB 3WYZA 2ZUTA 4Y96A 5EY5A 3B0UX 2HPIA 3A3XA 2GGEA 4YCOA 4AD4A 2RJHA 1K7XA 1JPIA 1XIHA 4DHGA 4NG3A 5XINA 3W70A 1V51A 2V5DA 3N13A 4U5KA 4D9PA 5AHEA 2Y7GA 5E6ZA 1XH1A 3FAWA 3TYUA 3H26A 3PG8A 1CGYA 1UROA 1O1ZA 3PWIA 3TMQA 1GQKA 2VXNA 1M7JA 4ZQRA 1W8SA 3H2CA 2VHLA 4FLSA 3LV6A 3SQLA 1DIEA 1FKXA 4LVAA 3D46A 1RQBA 1LLOA 1W54A 1UR4A 3W72A 4UUIA 3T8QA 3QQ1A 4E8DA 4U5IA 1BVNP 3UCDA 4MKVA 4NJHA 3H53A 4RKAA 4JIIX 4GYPA 1B30A 2VRKA 1Q2SA 4HA1A 5FACA 3WG6A 3GDKA 3OIHA 1MQPA 3QM3A 3FXGA 3T42A 2NQZA 1Z41A 3TW7A 3IRSA 1DTNA 4I9AA 1GKQA 4E6MA 1AFSA 3UBPC 3B04A 4O17A 3RFAA 3TJ4A 2E5BA 3GW3A 1MW0A 3VABA 1L8PA 2WO5A 5I09A 2GYIA 5C7HA 1P6BA 4PL1A 3VD3A 3TCEA 4CNUA 1Q45A 4MWAD 1VS1A 5LGXA 1HJXA 1M3UA 3GH4A 4A6GA 3B0PA 5DX7A 4ZOAA 4MOZA 3OYXA 3AYSA 1AMYA 4B15A 2YA1A 1PVNA 2V0TA 1AQMA 5T9CE 5DT7A 5D03A 5IDIA 1KBIA 4EVZA 3W7DA 3NO5A 4P8UA 2J4GA 2DSKA 4DF0A 3CQHA 1BXBA 3NPXA 2E8ZA 5BOOA 2PRLA 1SR0A 1RP8A 3ZYZA 5A8NA 2DZVA 2C1HA 1QHPA 4A22A 4QITA 4H4IA 1QNSA 2G4FA 4W89A 1IEIA 3BW3A 4HN4A 3RMEA 4DQWA 2GJXA 4QDMA 5FAGA 3DHDA 1W1ZA 3EWCA 1SW0A 3UWEA 2J27A 1FWEC 3ABZA 3LRLA 1GEHA 2VDGA 3SN0A 1UHVA 4C91A 1SGJA 2NWSA 2A3CA 4QQ3A 5I7GA 4LVDA 1AW1A 1WKYA 3P84A 1IXPA 2VEKA 3ARSA 4ILSA 3LQGA 2ZRZA 1HKMA 3QXBA 1TVLA 2ACUA 5D9OA 1BF6A 1ZU8A 4H1ZA 2YXOA 5D2TA 3ZOAA 3TIMA 3CV6A 3I6RA 3T4CA 2EPOA 1SMAA 4QE1A 2R1PA 4DUOA 1W9XA 5I6SA 2EKGA 2ATSA 1QWGA 2XSBA 1JZ7A 3GVQA 4ATLA 2QMJA 4JNZA 1RY8A 3WK2A 2YW4A 4K7VA 5C54A 1XLJA 4BI6A 2YYUA 1B9ZA 1W5MA 3WLMA 4DWDA 2NXGA 4GK8A 1OBAA 1QK0A 1AODA 3DZ1A 4RZ6A 3G24A 1YPIA 3C6CA 3LBMA 3PVFA 2OKTA 2AAAA 3TH6A 1G1YA 2YDQA 1XIGA 1XIDA 3QC3A 3M0IA 2XTKA 3UYCA 5CSUA 1GNXA 3VGBA 3M46A 1VPYA 4GI6A 1YDOA 3A5FA 4CQ9A 4N9EA 4GHRA 2C0HA 1XP3A 4AIOA 3IPWA 2EPKX 3EWUA 4OV9A 3S3GA 5FA5A 1HJUA 1KXHA 1R38A 1VIZA 4DJFC 4DUWA 3VIMA 1NOFA 5DT5A 5D2YA 3M4HA 1WUFA 4J28A 1P5BA 1F07A 1W37A 4QM1A 3E96A 3ITYA 3EAUA 1QHZA 3PWGA 1IV8A 2PB1A 3DG7A 4YVXA 2EKCA 4M0XA 1B0IA 3OG3A 4ZA0A 3FGCB 1K70A 1JQXA 1WA3A 3B97A 3WLOA 1Q63A 1TZ9A 3CAKA 4GWEA 2OB3A 3N2TA 4NF7A 5L6UA 1ME7A 5EPDA 3PS7A 1P7TA 1QPRA 4HOXA 4RNHA 1PEZA 5K9CA 1ITXA 2DZAA 3NQ7A 2YFOA 3N3TA 4DWSA 3TYCA 5KINA 3QTPA 1J93A 2AL2B 2OLAA 1S2CA 3MUCA 3MBDA 3N2MA 4TIMA 2PWGA 4PZVA 2BB0A 4BZYA 1VBUA 2ISWA 3V1PA 3VUSA 4GUIA 1KM3A 4WZHA 3W83A 3D47A 4A2RA 1W3KA 3BOFA 1QHOA 2Z1VA 2E25A 2QKFA 1UIPA 3GNNA 3ANVA 4ZSTA 3NFUA 4M81A 1Y65A 1VEPA 4UTMA 2JGQA 3XINA 2I7GA 1GOMA 4XD6A 3KHJA 3SUSA 4F66A 1UH3A 3UZJA 3SCSA 1OT2A 1XRFA 1NDVA 4ZZ9A 2JGYA 3ISIX 1A5OC 2PDCA 1JUBA 1TWDA 1W3HA 3NCOA 3TZNA 2QR6A 3B4YA 3FA4A 4HHPA 5KEZA 2NSOA 3TQKA 6A3HA 3PZTA 4LUYA 2V3FA 1A0CA 2D3NA 4GISA 3RNDA 1MEWA 4HPJA 5D2VA 1SW3A 4GQ0A 1BG4A 4PCPA 1QCWA 4RDVA 4X61A 1V0MA 2EO7A 3SI9A 3GHSA 3KW3A 1JDCA 1TE6A 4WSKA 4LGXA 2C8NA 4Z2JA 1ECEA 4ZFMA 2GDUA 4O8AA 1ZJBA 5AKQA 4INFA 1T5AA 4HPNA 4I5XA 3B0VC 3UY7A 2YGYA 3BZGA 2DSWA 4YN5A 2VFHA 5I79A 2IQDA 2E68A 1U33A 2D1ZA 4BHYA 1Q6DA 2H90A 4BR1A 3REQB 4QE4A 4ML4A 2WZMA 2WLYA 3CUFA 1WZMA 5I00A 4UTFA 3WK1A 5F2LA 3E0IA 4KPLA 4Q33A 2YLAA 3PG9A 3KRSA 2G3FA 1UPPA 1KFBA 3MB9A 4DXVA 5I0DA 4PB4A 1H5YA 2VR2A 3PZGA 2EF9A 3TYDA 3S46A 3GYEA 4L4PA 3VMNA 1UZ4A 2OEJA 5KETA 3APTA 5A2CA 5CH9A 2ZDRA 4WCJA 2YW3A 3NDYA 2GUYA 4FP1A 1GT8A 3PSVA 4K2SA 1VCGA 1IGWA 4MF4A 4XO7A 2V2CA 4WD0A 2IS7A 3KOXA 4I6VA 1E71M 3G1VA 2JK2A 3T05A 1C90A 1FWTA 4IQJA 1DWJM 3DXIA 5K3VA 3UXDA 2CBUA 2WC4A 5ABHA 2WMFA 1R9YA 1SFSA 3QV7A 4LF1A 5JQ9A 4AD3A 3KOZA 1IYXA 1VRXA 4AYGA 4QS6A 4FNUA 1H62A 3BPWA 2OOFA 3TN5A 3AU6A 5HNUA 4MZ8A 5G2WA 3GB6A 2Y88A 1PKMA 1W8GA 1DL3A 5DRCA 4GH3A 3G18A 4CNOA 4ZMGA 4K38A 4UQ9A 1XLIA 3PZVA 4H19A 4Y8FA 3VIJA 1M53A 2Z6IA 1YTKA 1XUZA 4WSJA 1ONEA 3TYBA 1YXYA 2X2GA 3N73A 1E3ZA 5E1QA 3LSCA 1Q8AA 4JDYA 3I7SA 1ECQA 2X7VA 1NDZA 1J12A 2PWDA 4Q8PA 1U1UA 5HA7A 3V4BA 1P6WA 4L4OA 5DMNA 3PZQA 1A5NC 3KAOA 1TIMA 3P81A 1DJHA 4TTUA 3UA4A 2VMFA 3GVGA 3ZJ7A 2OJPA 5GNXA 1Z6KA 1ZBVA 1XDJA 1XJBA 1V93A 5FJJA 1V4YA 1HJSA 2WJFA 3VNLA 2D2JA 1FXQA 4JPGA 2OEKA 3PN8A 2VX5A 4CEUC 4LS0A 2WANA 1OFEA 2CLLA 3MMTA 4RZ5A 5H8PA 4XAGA 1LRQA 1FWWA 4C6FA 1F61A 1TV4A 3W7PA 1YRRA 2ICSA 4L6HA 4LQ1A 3TR9A 1V3KA 3R0UA 5HJYA 1U1HA 3AUJA 1MSSA 3SJ3A 3RR1A 4HMNA 3V5FA 4XKYB 4AIEA 1GVRA 4XIMA 5ABGA 1ZUAX 4Q8NA 3H7RA 4LS1A 2QCDA 5DANA 2CLMA 2ZVIA 2X1UA 4PTXA 1BHGA 1TE1A 1AVAA 4UNLA 3WNLA 3WQOA 4DPPA 3CV7A 1KKRA 3S9ZA 3SCUA 6REQB 3U6WA 4W85A 4DPQA 1X6NA 2YB1A 5DELA 4LCSA 4B16A 1H49A 3OTRA 4UTWA 5IHRA 4GLEA 3PAOA 3M47A 1E3XA 2PS2A 4XAYA 4IMFA 4KH2A 1BAGA 2OO6A 1ZALA 1VCVA 3BV7A 1UMYA 1X7FA 3QZ6A 1UWAA 3W7NA 2BNJA 3TLLA 1UUOA 1M04A 3F7JA 4V28A 5F1VA 1JPHA 3B05A 3VGHA 4LXFA 4PSPA 2HISA 1WX0A 3HURA 4I3GA 3HG3A 2A4AA 4K1WA 4W88A 3EA1A 4DYJA 1OWQA 2P50A 4QG9A 2E7FA 4NRSA 2J79A 3DHFA 3QY6A 1K8ZA 1BSLA 2PURA 4HOZA 4H6RA 1MRAA 1R5YA 1N2VA 3OZMA 4QBXA 4J3TA 1YDYA 1E9LA 5T26A 5A8OA 2A3BA 5FEZA 1J2BA 1XFBA 4WXYA 3CPGA 3HPFA 3QV9A 3TX9A 3DECA 4PCTA 4W7UA 3VA8A 1YXDA 2G5WA 3OG2A 1E15A 1JULA 1K8CA 4M19A 3CO8A 3TAOA 2R1LA 2BLEA 3V0UA 1O1HA 2QF7A 5DMMA 2O0TA 3QY7A 5AZ0A 3W9ZA 1TMHA 3V1HA 2NX3A 4GZEA 1XLBA 3W27A 4QR6A 1QFEA 4X22A 2VZUA 3S1WA 2VZOA 1VYPX 3APGA 2J75A 4B5UA 4C1NB 2VGBA 3AALA 1CDGA 1B4KA 2VD9A 2VD8A 3IWPA 3HQOA 4FNQA 5CPSA 5REQB 3H23A 2C6QA 1TX0A 3G1AA 2VQTA 7TAAA 1TV8A 2C19A 3W1MA 2V5JA 2EHHA 1S1PA 1OG6A 3GNOA 3H4XA 1P48A 4E0CA 2W91A 3O05A 3PM6A 5C8BB 1RLCL 1XDLA 4NILA 4MPQA 2P8CA 3GIQA 4UR8A 3VM7A 4ZR8A 2P0OA 4NZ1A 3K5XA 1JF5A 1KNWA 1NDYA 1E6QM 1JPKA 1XYCA 9XIAA 2ZXQA 3ZT7A 3FJLA 4AZIA 3T9PA 3WMLA 4I7WA 3V18A 2YBTA 2AAMA 5GJMA 3QLLA 2NQJA 4WIWA 4N9CA 3N3MA 3B8SA 3CQ0A 4YU1A 1PWLA 5BMXA 4RPQA 4JN6A 3RK8A 2DSZA 4HP5A 1XYZA 3VNIA 3O8AA 5C5YA 3VDBA 1P0BA 3VKAA 4JQAA 2DJLA 1XIJA 2C16A 4XBKA 1F6PA 4POCA 3WELA 2IMRA 5BWAA 4V1XA 4BJHA 1DWHM 3LNMA 3PBMA 4PUJA 5K7JA 1CGVA 4JKMA 3GNXA 3RAOA 1TWSA 1VYRA 1EWEA 1DWIM 1ZL1A 2PDLA 4TV5A 2VCCA 1EEPA 3KVKA 5HJXA 3W2MA 4R9XA 1T8XA 4GJ1A 4D6IA 3KBJA 1OFRA 4KWVA 3GLCA 2FIQA 3IJ6A 1UD3A 4B2DA 4XZMX 5DCDA 1PE1A 1N82A 3TQVA 1EBHA 1RXOB 3EDFA 3N11A 2GWNA 1PCWA 1KW1A 3W7LA 1KLZA 2ZKMX 4RE4A 1FH8A 3DYOA 3SCOA 5EKYA 3S1VA 3KM8A 3WFAA 5AC4A 3MSRA 3DFYA 3FDKA 3UPMA 3U5UA 2P5NA 1FOBA 3GRIA 2OYLA 3KP1A 2EJAA 4OHQA 1A4LA 1K3UA 3W02A 1Q5MA 2WQPA 4AXNA 2J77A 2XYLA 3EX2A 4WJXA 1D9EA 1SW7A 2DV0A 3WNKA 3BVJA 4AVNA 1LJYA 1VZWA 4WJEA 3ZLHA 1BWVA 1JRCA 3CT7A 2HRWA 3TFXA 3WMCA 3T78A 4QCFA 3CHFA 1UR1A 4P7OA 1KBJA 1AG1O 1IWAA 1XYLA 4IFOA 4AD5A 4GG9A 3AHVA 3W29A 3RLVA 4OV4A 1RK5A 2RDTA 4FS9A 5D33A 3W28A 3G3DA 3EOUA 3AFBA 3RN6A 5JBDA 1XIFA 2Y8VA 3IJQA 3NSMA 4QQUA 3GTXA 4YWSA 2JEQA 2ZZ6A 3U3HA 3MA8A 4OJYA 2H6RA 1KRMA 3KTCA 1GVOA 3G0SA 2QJGA 2V5CA 3HPSA 4Q4OA 2V30A 4HOWA 4O18A 4ZOBA 4OU1A 4LVBA 1PIFA 3TXVA 4EE9A 5E9AA 4MUPA 4F4RA 1EZWA 3SUUA 2BV9A 1RPKA 3WBWA 1TREA 6XIAA 2CEQA 4Z08A 1EBGA 3ZWSA 4GFIA 1BQGA 1TTIA 7REQA 1BYCA 2YXGA 3P6LA 4QX4A 3SDOA 3VNDA 3W24A 2Q8ZA 4NI8A 3M6YA 1IE7C 2WYSA 2INZA 4DJEA 3VFLA 2R8WA 1L8NA 4XZNX 2SFPA 3KBVA 5BOEA 1KRBC 1JZ2A 2HQAA 7REQB 3BMVA 2XHYA 4OFCA 3S2LA 5CPOA 5BXPA 2CETA 4AIBA 2BHUA 4UFLA 5HMDA 4AXKA 2FDSA 3ATYA 1KM1A 3A4XA 3AISA 2HVMA 4HNVA 2CBVA 1JZ4A 3C8NA 1EO7A 1K6WA 3VE7A 2F7FA 3VILA 2F2HA 1W2PA 1ZPTA 4PC8A 5C2CA 1C92A 3CB3A 4X2RA 4PUWA 4W8BA 1SZGA 4D6JA 2RHGA 1SFJA 3ABQA 4Y9OA 2BP1A 3KXQA 4HIBA 3GE7A 3WF1A 2RAGA 1ADSA 3ZT5A 1TZ7A 2WNZA 3R10A 2L5HA 1PV8A 4O0KA 2DVUA 3GXMA 1LQ0A 1SM9A 4NY2A 1S5WA 3U0HA 4RZ4A 2I17A 6XIMA 4K1GA 2DZBA 3CZLA 3NL3A 1F73A 3HPXA 3MWAA 2FZMA 3GD6A 4CCCA 4JEJA 3MTWA 4OVXA 5C2GA 1CXKA 2PGWA 1OX4B 3WDQA 3P60A 4WX2A 3CIWA 1OGGA 4CQBA 3IVSA 1OQFA 1LP6A 3LENA 1XPGA 1N8WA 3FFSA 4A21A 2VEIA 3T0CA 1O94A 4XUYA 5CC5A 3WDJA 1DBTA 5AYIA 1FFRA 1NWSA 1CX9A 1T0OA 1FXPA 4UQBA 3NPWA 4JNYA 5AC8A 4GBDA 1K9EA 5FAJA 1KM0A 2G3IA 4B5VA 2PBGA 2C71A 3CQIA 4EPDC 4CU8A 1LOLA 4L9XA 1ZQ5A 3TU9A 1WO2A 4JIEA 1FA2A 4HMDA 5A94A 3L2IA 5LNSA 1XBZA 3TW6A 2G97A 4NZ5A 3VIOA 1ZP3A 5I3FA 3DI0A 3C52A 1QATA 4H9UA 1R86A 2TYSA 1L6SA 5A8PA 1H41A 1H3GA 3R2GA 2WJDA 4X0NA 3TTOA 4DBUA 1A80A 2R91A 4URIA 1EC9A 3B8TA 3SFKA 1E6NA 3T0BA 1TPC1 3IGSA 5EB8A 3WQPA 3T44A 3HGOA 2ZZ4A 4IPLA 2Q71A 3WBAA 2HE5A 2ZBTA 3JZEA 4CNPA 2ZADA 3BO9A 5FESA 3UNTA 3OW1A 2XVLA 2Z25A 1L2UA 3TZFA 1VR6A 2KAUC 4GMEA 1XD0A 2EXOA 1MO0A 1F74A 4MJMA 4HQVA 3THDA 4H00A 1HP5A 2PP0A 1HKKA 3FCPA 2PC8A 4DWSD 2X41A 4C6KA 4NU7A 4EAYA 3BL3A 5LZLA 4Z1YA 1YHTA 1XL9A 4LNCA 2BMBA 1I4NA 3N9KA 3SM0A 3CL7A 3GDBA 3T1GA 3F4NA 2HWGA 4LVFA 4EF9A 3GM8A 4J3UA 1TV2A 1IF2A 4KCTA 1SO5A 4MYAA 4PTWA 4ONVA 1FH7A 2C15A 3H24A 3URQA 2Z2UA 1EDGA 1EJTC 3ECQA 3OPSA 3F1QA 2PDBA 4NYUA 3BXWA 1VLWA 3URNA 4CU7A 4CCDA 1W5PA 1D2KA 3CH9A 4KIRA 1TWWA 4GNKB 1IIGA 2YCLA 3K13A 5MF5A 3LI1A 4LEQA 2ZCGA 3PTMA 3UJEA 3R58A 3NA8A 3E12A 3CH0A 4G7FA 3PSWA 3TC3A 2XINA 2EG6A 1H1YA 4YXGA 4LU0A 5DEZA 1I6NA 2XN0A 2PDNA 2VTFA 1XGZA 1D7KA 4E2VA 4OZOA 3Q65A 2EAWA 3A4AA 3OVGA 4JZ5A 3CMGA 4UR7A 3GIPA 4GGBA 1EGZA 1JZ6A 1WBHA 5CPNA 1TPDA 3AIEA 1CWYA 4KRZA 3RXZA 1ZHAA 1M7PA 1W9VA 2YB4A 3V35A 5HANA 4F0MA 3O7UA 3DFOA 5M2FX 1UASA 1XPYA 2ZDSA 1XKJA 3GIYA 1SMDA 1KXTA 5JIWA 4KKXA 1AQHA 4ERAA 3N19B 1FWNA 3LHZA 1X38A 3WFZA 4ZO8A 2IUZA 1P0EA 1TR1A 5H1WA 4JIQA 4BEUA 3WD3A 3AOFA 3EZ4A 2JE8A 4GCXA 1V77A 2GGHA 3JU2A 4LY4A 1QNQA 1V7AA 1ZS2A 4KEVA 1EGMA 3AAMA 1J0HA 4C5ZA 4PRRA 4QTGA 5D9NA 3RGTA 4LUSB 4ZEPA 1ONWA 4MZYA 4GYFA 5ABFA 4AZHA 4C6NA 2XIMA 2D23A 3WQWA 5IHSA 4C6EA 3SAZA 4LAUA 5IBXA 2ZRVA 1ODUA 3FYYA 4UTKA 4W84A 3MHGA 4MY1A 2HVOA 4JBRA 1VD6A 2DIKA 1XG4A 3RPDA 1JDFA 4JTKA 3L9CA 4KCUA 4DLFA 4C6JA 4OOZA 4HCHA 3PULA 2PD9A 3LXBA 2HS8A 2YR1A 4IMEA 1RQEA 2B7QA 3WN6A 3IIXA 2XSAA 1E51A 4JCMA 4NKCA 3SCTA 1A5LC 4Q8OA 3MY9A 1QI2A 3T2OA 2AL1A 1U83A 3CNYA 1A5CA 1LOSA 2NZLA 8CGTA 1KM5A 2DZSA 3PR2A 4JTLA 3W7KA 2CBJA 1C29A 2GVLA 5C6MA 2D2GA 3O3RA 3CT2A 5CGQA 3GBEA 1PX4A 4JTHA 3A24A 4S3EA 1PKNA 3ITLA 4WK9A 1XLAA 3AICA 3NPUA 3MUIA 4I8YA 3WUFA 1AQFA 2YOCA 3N25A 5LIKX 1P6CA 1QNPA 3GG7A 4HNTA 5CPQA 3B06A 4XZLX 3WZ0E 2OSYA 3WLPA 3TNOA 3BUVA 1PSCA 4ERIA 2DJXA 1JD9A 4C60A 3MJYA 5AHIA 9XIMA 2ALRA 3D3FA 3EOEA 2Q01A 1NEYA 1XIBA 4MJZA 2DT2A 2ABAA 3BTNA 5CZ0A 3T0DA 1XLCA 1J8VA 3SCVA 2C13A 7CGTA 1GK8A 4V27A 4JFSA 5EFDA 4JQ1A 2CFFA 1Q8JA 3B0YA 3INPA 3QZAA 2WKJA 3CASA 3W87A 1H5VA 3L23A 4UCFA 2GGGA 3WCZA 4K8EA 8A3HA 3GTHA 1S2VA 2RH9A 1AUSL 3UF9A 1I9CB 3ZSSA 1QWKA 2NW0A 3BURA 4OUIA 4BWLA 2W63A 3UPWA 2X40A 1K7FA 3WNPA 3TOPA 4F0SA 4L1WA 1JDDA 4J2PA 2F2KA 2QIIA 4IG2B 1QW7A 5CSRA 2ON3A 3AZTA 5HULA 4RE3A 4CEXC 5HMEA 4Q7BA 2PC4A 3VNKA 1LZOA 4E2OA 1R2SA 4RCXA 4R5EA 5K9DA 2WVTA 1CB7B 1LUCA 4G1NA 4HTBA 1DYSA 4QG6A 5DBUA 1HX0A 2GUUA 3K1DA 2QJIA 2QZRA 1TV7A 1A5AA 3VD9A 3ARVA 1U22A 4PE8A 4GYPC 3MKVA 4PCFA 3L21A 1V5XA 1S2UA 3LLXA 3UXLA 3NEHA 2ZZ1A 3W85A 3W1AA 2W3ZA 4YVPA 4HCLA 7XIMA 3T2PA 4C6PA 2QUVA 2NV1A 3QV6A 4LWWA 4JFWA 2PU0A 2IPGA 4F0KA 3RRXA 2IXVA 3WDPP 3SQMA 1R3YA 3RM4A 4ZL1A 2PDYA 1ZJAA 3MJMA 1REQA 3EKGA 3QRHA 3WF2A 3TDFA 2Z1BA 3AXKA 2FPYA 2WC3A 1XC6A 2B7NA 2D24A 3NXLA 3QOMA 2QCHA 2VC9A 3OLEA 3AS2A 5CBJA 4EXBA 1EGVA 3HQNA 1FH9A 5D37A 1JYNA 5TF0A 3VOJA 3ZJKA 4LY8A 3GC2A 4IJCA 5MKGA 2CLHA 1TUXA 5EL1A 1MZRA 5DF0A 3DUGA 1H11A 4GKTA 4C6DA 1GZGA 4ACYA 2MANA 1MQRA 3R6IA 5H2ZA 2OXNA 3QSTA 3THQA 4RDYA 2BBFA 3A3HA 1GOIA 1ZTVA 2PRHA 4DNHA 4FO4A 4Z2GA 1EWDA 4XSLA 3QR3A 1A3XA 1X1NA 2KZHA 4QISA 4XD5A 4Y8EA 1GQLA 3GK0A 1EP2A 1UR0A 1MDLA 3D5HA 1F8IA 3URAA 3BGJA 3Q67A 4XTDA 4QIUA 3G1FA 2QAPA 4CQDA 4R3UA 1Q6EA 1VH7A 3O9NA 1TPB1 4UQAA 1PHWA 2CC0A 3R4IA 1V6WA 1WXJA 2EPMX 1SZFA 3W53A 5AHFA 4MVAA 4FR6A 1OG0A 1PTAA 3B9NA 3HV8A 3ZT6A 1RSCA 1Y8BA 1E1EA 1G4TA 1OZQA 3ATZA 3BOLA 1W0MA 4G5DA 3NGJA 1HL9A 4Z2LA 1JF6A 1PYMA 3WL1A 5LA2A 2OFJA 4MWAC 1TYGA 1J79A 1PIIA 1FDYA 1ZB5A 2F38A 4IPNB 4L4MA 4ZO6A 2GDVA 3IGXA 1MXDA 3UA3A 3DH7A 3NURA 3DERA 4YIWA 1EO5A 3OVPA 4EK7A 1EJWC 3H2OA 5T8GA 1XM3A 2VRJA 3N4AA 2HXUA 3W71A 1KV8A 4QJ4B 3TN4A 2FLIA 3CMFA 3SEPA 2DPEA 2VRQA 4FK9A 1WQ5A 5D38A 4GBUA 1SJDA 2ZOXA 3VXGA 1ENUA 1XKYA 3BLKA 3NR0A 4H9TA 1QI3A 1MUCA 2A3AA 2V3DA 4L80A 1UKTA 1KBKA 4CUCA 4F3HA 2D3LA 2D2OA 2FH6A 1S3HA 3S2JA 3TVAA 3KBNA 4GUGA 2OT0A 4LC8A 2PUZA 3AU2A 4XX6A 4C7FA 4IM4A 4ZQNA 5SWUA 4N9DA 3QPYA 3IJ7A 3TTEA 4DI9A 3QLDA 1E0TA 3UZWA 2WM1A 2YCKX 4NQ1A 2XH0A 2XWDA 3SJNA 1OB0A 3WUEA 4D8ZA 1LBFA 3C0LA 4I9TA 4XQ6A 3QFWA 4LC6A 3ZR5A 2V5KA 2V63A 2QULA 4Q32A 4AHPA 1HQTA 4MAZA 4XV0A 1B57A 4UXDA 4GY1A 3MDWA 3HG4A 1M7XA 1I1XA 3DKLA 1YBQB 4HPHA 3QR1A 2O9PA 1F6YA 2FB3A 1JRBA 1V7YA 4B4FA 5LA1A 5I3IA 4A4AA 5EBUA 3S83A 3FA3A 4JCLA 1VBHA 4WDXA 1I0DA 1Y5VA 3ABXA 3UWWA 3RMJA 1N55A 3W1QA 4PMZA 2QDDA 1NH6A 2FZ8A 4B9ZA 3SCNA 3LTSA 3DBNA 3P74A 1OY0A 2ACRA 2HPMA 3UG5A 2YDSA 3QY8A 1KM4A 3NWRA 1IEWA 6PTDA 2DH3A 1WDPA 2BG5A 3HJZA 1UJQA 3AI0A 3VO0A 4M56A 3WH7A 1LL6A 3CUJA 3IS4A 3W7GA 4K39A 3I4EA 3V5OA 3GSMA 5E5CA 1TO3A 2ZUVA 2XN2A 1QT1A 4LUIA 2GUBA 3GZ3A 2CERA 4CN6A 1EIXA 3W3OA 4H8VA 5HBFA 5FJPA 5FOOA 3SGUA 4MB5A 3C86A 3W26A 1KCZA 1Z44A 1LWHA 4F2TA 1UPMB 4DB7A 3QVQA 1SJCA 1XLMA 1WZLA 2QAFA 2QVNA 5EGRA 3QV8A 2ALDA 1SPQA 1E5JA 2QCCA 4GX8A 1NFPA 4KIEA 1S3TC 4IMDA 4ZCWA 4M29A 4DZHA 3ANYA 4GA8A 4PUDA 1XH0A 1W9DM 4NZFA 4R7OA 3VM5A 2DZXA 4FHAA 1GVFA 5C7VA 4HYVA 5KZMA 2Q09A 3ITCA 2ZE3A 3UG3A 3DBPA 4HHHA 1PTDA 4R7JA 1DJQA 4JS3A 2VOTA 3JVAA 3H4GA 3UEQA 2VT0A 3VTRA 2R24A 4QP0A 2DGAA 2QDEA 3C2FA 2CWXA 1QTWA 4WJ8A 3KS5A 1WE5A 1WPCA 4Q8MA 1W3NA 1VAHA 1B5TA 4WGHA 2Z1KA 1AZ1A 2XN1A 2G41A 2VFGA 3BCJA 2FVLA 2ABBA 1B3YA 3DFTA 4ATWA 3TN6A 3OLIA 4H9XA 2TSYA 1EC8A 4AD2A 2GQ3A 3W1NA 2FQIA 2CNCA 6CGTA 1Z69A 5F2GA 2NUYA 3IVUA 1DQWA 1OSEA 4NZ3A 3R8GA 3TQPA 1J0KA 5F4SA 1K4GA 3BGAA 3NEVA 4TX9A 3C4UA 3W6YA 1IGSA 4MKNA 4JEQA 1LYXA 2PF8A 2VL4A 4ZB5A 1XYAA 4FOJA 2C0AA 2YLLA 2FZBA 4JTSA 1E6PA 1IIHA 4HNUA 4QLJA 1DOSA 4B3ZA 1HJVA 3F4VA 1YTDA 4Q8TA 3R12A 5DN1A 1L6FA 3RPMA 2BX7A 1K8YA 3TQ0A 2FGZA 5FD0A 1EJVC 3CMJA 3BLEA 2GVEA 2EJ1A 4LYQA 4LUJA 1X6UA 2PD5A 3TR2A 1E0WA 4AWSA 2JALA 4L9YA 1WXYA 1WDSA 3BMXA 5TNVA 4MB1A 4FF5A 1XF0A 1T6MA 3PPCA 4PA8A 3GAKA 1R46A 1HIZA 3DG6A 4FALA 3BLDA 2ZX7A 2QJMA 4UNIA 3QKZA 1BTCA 4ES4A 3P5ZA 4H6KA 3Q94A 3ID7A 3FEMA 5FF4A 2WM0A 4LJ3A 1CIUA 3HFYA 3TSBA 1CXHA 2DSVA 5D05A 3PPFA 4JHZA 3APYA 2VELA 3E2RA 1H7PA 3MCNA 4DYEA 3REQA 3O06A 2NV9A 2ZVRA 3LK6A 3G8EA 4JX6A 4NNCA 2YZRA 3NG3A 2GJXB 2ZWYA 3SW6A 4ACZB 3IIZA 4YTSA 4GCAA 1KQYA 4QEHA 2E6AA 4WY0B 1I75A 3WF3A 2JKEA 2CLKA 1PXGA 3TC6A 3V36A 2W62A 1B2YA 5AY7A 1GW9A 1KD0A 2CWNA 1GQJA 1PBGA 2JFEX 2QCMA 2OSWA 4YTRA 1Q6GA 3NPVA 5CZTA 3VCRA 2HZGA 4WY0A 4TO8A 3NSNA 1M68A 2Z4GA 5FF0A 1S5MA 3ZSTA 3KZPA 2WCAA 4IIEA 3IIPA 3SY8A 4JXCA 1O5KA 2DT1A 5A69A 4H9MA 3KBWA 3VOCA 1LCOA 2WZIA 4P7LA 1JCNA 2XU2A 4ECLA 1YLVA 5IFTA 3E1F1 2PWFA 4JYDA 4HB7A 4NVTA 4DO5A 3KVJA 1QI5A 1SVDA 3PY2A 2J7DA 2XGZA 1T7LA 4JTAA 2J7HA 1FY6A 2VGIA 1CW2A 2EPNA 4EKJA 3RU8X 1DVJA 4LBSA 4GNJA 2OSXA 4U2ZA 3VI2A 5HR6A 2OU4A 4MB3A 3LGEA 1ALDA 3K4DA 4JY8A 3SB0A 3W00A 1Q13A 3WQ5A 1NARA 1GKRA 2OX4A 3QYSA 1AH3A 1F9CA 2FJKA 4HK7A 4S3BA 3NAVA 3AS1A 4O1FA 2QJHA 3WMSA 1IR1A 4PTVA 3W1PA 2VZTA 1Y7VA 3GYCA 4PTDA 1RVGA 1XBVA 4ZE5A 2I5IA 3ES8A 4RE0A 4LUTB 4O8RA 5C0QA 5M03A 1EX1A 1JFHA 2PWHA 3E0VA 2Z24A 1QK2A 4PBEA 2JF6A 4B9YA 2PAJA 1FHVA 2BY1A 1LF1A 3DHPA 4CN4A 2ACSA 2D0FA 3W2UA 3IIVA 5AFDA 1R3QA 4K7YA 4M82A 3AZRA 3W1RA 2ZZ3A 3QN3A 4F0LA 5JIPA 3N9RA 1VLIA 3CIXA 3S2CA 5AN7A 4KRUA 4A3HA 3TUUA 2H8ZA 4EOUA 3JS3A 1Q3NA 1V79A 2PRMA 5FSEC 4RLIA 4P8XA 3L5AA 2OZ3A 2QCFA 3SFWA 3VCCA 1JXJA 5HATA 4IQDA 5KTLA 2CXEA 2V69A 4QSFA 5DLCA 1E4MM 1ODZA 1OYCA 2Z00A 4YTQA 5C9ZA 3F4CA 4EF8A 4XKYA 5AHLA 5FEWA 2XH7A 3BC9A 4AVFA 3QF0A 1A0EA 3NJ3A 1Z9AA 2G3MA 5JMUA 4FNSA 1FWFC 4N2YA 3NDOA 2HXTA 2X0YA 1I8JA 3G1XA 3OGRA 3S42A 4TQTA 3EDDA 1TTQA 1L2QA 1Z42A 4MY8A 3B9AA 3CBWA 4JYFA 2Y89A 4GVIA 1OCBA 4UFMA 2G4JA 4LOCA 3M6DA 3IANA 3E3HA 1SU5A 5LHFA 1VF8A 3UJRA 2C18A 5LKYA 3H2NA 2R6OA 4JIHA 3ONCA 5K9XA 5G1TA 5U7SA 1HXJA 1VPQA 2VUNA 1D3CA 3M5YA 3J7HA 1SFTA 2X2YA 2XFYA 4ZXLA 1B54A 2CKRA 2HTMA 2V5BA 4P8VA 3H54A 1E6RA 2Y7FA 4DIAA 3M64A 2PLKA 3CEPA 5H6HA 5D02A 5FI8A 3FJNA 2OWXA 5HOSA 4LX4A 2BFGA 1OC7A 2ZUSA 1BGGA 5F4XA 3TK7A 5CLWA 2Z1XA 3MANA 5MHBA 5E9XA 2H3BA 2QUUA 3OOQA 4KWWA 5DRIA 3IGUA 3OBAA 2XIQA 3WEOA 4Y9AA 1XLGA 3GU9A 4B4HA 2WZEA 3K8MA 4UZUA 3SCQA 4LYPA 1RV8A 2CZFA 3CL6A 2R9RA 2O55A 5A2AA 3IIOA 4W7VA 2BDQA 1O60A 4WQ6A 3IJ8A 3NQAA 3FW6A 1C8XA 2GZXA 4RXGA 4R53A 2ZX6A 3BW2A 1HP4A 3EWZA 4DELA 1O12A 2WSKA 3ABSA 1UG6A 1ISYA 1EF3A 1A50A 1LT7A 4XB3A 3WK3A 1XRSA 3GUWA 5AB3A 1L6YA 3CIVA 4WKAA 3GFXA 3GFZA 4H8UA 3CPUA 4FLOA 2Z1SA 1KBBA 2WV8A 1R47A 1G9HA 3EDJA 1A5MC 4LTSA 5BU6A 1XG3A 1DORA 3W2JA 1TQXA 2WKGA 3WY1A 2FZDA 3F2DA 1YNQA 4UQCA 2IPFA 1SO4A 4HVXA 2XPKA 4IGMA 3W2LA 4MIMA 1OD8A 2AQVA 1UW9A 4UTUA 2GK1A 2VYOA 2ATMA 2G50A 3MDUA 1YE4A 3C0JA 1LM1A 3W7JA 2R1KA 4Z2KA 4UFIA 3O6CA 3FY1A 2I16A 1KV5A 2VEGA 3MMUA 5BXRA 3EKZA 3CAVA 3H2FA 1MUWA 1CECA 4U31A 4Y90A 1R7AA 2A2IA 4R85A 1NVMA 3F03K 1XSIA 2CZDA 5GVJA 3AMDA 1J0IA 1VFTA 1DXFA 4C6CA 2DVTA 3KLKA 4GO8A 2WCSA 1PKLA 3ZVHB 4DZAA 1W6TA 4CD6A 1XIEA 5CG7A 1Q2RA 2F6UA 2G95A 3TNBA 4NXSA 3E0FA 3A23A 3NUKA 3L5MA 1F4HA 4KT2A 3S5SA 3SUWA 1HZYA 2X7WA 2E40A 5A5WA 1W3JA 3USZA 3BLPX 2BTMA 5HJLA 2PE4A 3KTSA 2J7FA 3IARA 1J0JA 3L7RA 4NZ4A 5KZEA 2TMDA 2WSYA 5AC7A 1PZ0A 5HNTA 5I3JA 1OFPA 4XZWA 3LMYA 1BFNA 1J6OA 3SGGA 2FTYA 1ZLPA 2DP3A 2YCIX 5CC7A 4LUTA 4O0ZA 3SRKA 1FWCC 3UG4A 4W5ZA 1UWUA 3RJXA 3GU1A 3TA9A 1EFZA 1EC7A 4O1BA 1R9ZA 3T0TA 1GOKA 1EP3A 3NZPA 1KRCC 2FPVA 1XINA 2F84A 4D1IA 4AFYA 3FEQA 4PMQA 1W3IA 3S2MA 4KEUA 1RCQA 1KFLA 5A6SA 1E9ZB 4XD3A 4AZCB 1A0DA 1B31A 1V03A 1OC6A 2QUMA 1W5NA 3QMRA 2PCEA 3GG8A 1F7BA 1Q7ZA 3WQGA 4IIBA 3S4TA 2ZUWA 4XUGA 3FK4A 4LB4A 3G22A 3CZKA 1SYTA 2CKSA 4S3GA 2PGRA 4XZIA 1OK4A 3NL6A 4AZCA 3BWWA 4M6VA 5F7UA 4FB7A 3UFYA 4EP8C 2IQ0A 3ALGA 1W56A 2ZUMA 1V3HA 3CUHA 3RO8A 1GYMA 3LERA 4LVGA 1B3VA 2WK2A 3QKEA 5E0KA 1EF2A 3PZUA 4J4KA 2O9RA 4PBFA 3MMWA 4V15A 3O6YX 2NXHA 3G6MA 1S5VA 1AJ2A 2VC5A 1FFQA 4Q8UA 2O4MA 3GDRA 2NUWA 5EA9A 4D72A 3MPGA 3CL8A 3LUTA 4J3VA 3BZJA 3KS6A 3MWCA 2PTZA 5JBEA 4RL3A 3C61A 2UBPC 2CHOA 4HPXA 4IQLA 4L9ZA 3NQFA 4HSHA 3BQ6A 3GG1A 1PB0A 4KESA 4TV6A 2IKJA 5JH1A 2Y7DA 2HSAA 1UKOA 1OX6A 2OYMA 1OK6A 1TUFA 4NJJA 2J7BA 3F2BA 3MMDA 4EPEC 2QUNA 1EEXA 1HJWA 1Y5WA 3RUBL 4DJEC 4JX5A 5J5RA 4L1GA 4IFRA 2OQHA 2V6AA 2NQ5A 4DAFA 4KGJA 4U4MA 3GQYA 1MI3A 5FF3A 3KTXA 2C1GA 4GYKA 4XKMA 3M7WA 3GR7A 4X63A 2Q3OA 3E2VA 2YIHA 1LL4A 4WR3A 2IKIA 4BI5A 1GTHA 3B8WA 2JKPA 4I9JA 2J13A 4FMVA 1OM0A 4O1AA 4RNJA 2OWCA 2E9BA 3EEGA 1IEVA 4PCSA 1B3XA 3AXHA 1GJUA 1CGXA 1RLDA 5ENLA 1AL8A 4ADUA 4NAEA 2R1NA 4GXMA 4YJ5A 3LQLA 3WKZA 5CBIA 4Y7EA 2E6YA 3W1TA 2YCEA 7ODCA 1LWJA 1ZAIA 3ZIZA 1EZ2A 1ONRA 1VJZA 1US3A 1H1ZA 3EXTA 2W6RA 4KQNA 3MHFA 4KW2A 2BXZA 3GTNA 3CWNA 3HG5A 2D20A 2D0GA 1VJIA 3DFQA 4H6EA 4DXKA 3A3WA 2YL6A 1WDQA 5CZSA 3NNTA 4HTYA 4N9BA 3CJPA 2BHYA 4O53A 2CU0A 4QG8A 4US6A 3SY1A 2J47A 4YMZA 4MLJA 4L7ZA 3KVMA 4PUEA 1XUUA 4BK9A 3OZPA 4DJED 1NWRA 3HQPA 3IK4A 1TELA 3G2GA 6TIMA 4MJ4A 4PUNA 2JBMA 2YFNA 4O54A 4Q8WA 2YYTA 2FMOA 4DO7A 2QV5A 4O1DA 1CT5A 2XFRA 4JIPA 5HUPA 3QPZA 3UW6A 4UTTA 1NTHA 3FV9A 2BOEX 4ROQA 1EIBA 3M0LA 1DTUA 1IZKA 1PDZA 3UJFA 3VKJA 1XS2A 2RKXA 4L1XA 4CLMA 3KL0A 2BVDA 4LCRA 4PMDA 1Q6RA 1JVNA 3ZVHA 2JIWA 2Z26A 4MWAA 2QPUA 5I5RA 3LPPA 3MZ2A 4HU8A 3LY0A 2DZWA 1YX1A 1VYSX 1Z7AA 3W84A 1X8CA 3EOOA 1Q6QA 1U5HA 2ZA1A 1XI3A 3WQVA 2WSQA 2DZPA 3OIXA 1GHRA 1TQJA 4MG4A 1PS9A 3KVLA 3M5ZA 5XIMA 4M6PA 2YX0A 4HU0A 4J3SA 4O4VA 1DXIA 1BVWA 3WJYA 2FJUB 1OGBA 3A4WA 3DC8A 2RDWA 4IISA 2A1YA 1ZY9A 3WBXA 1OFBA 6ENLA 4MMWA 3BV4A 3TLQA 4FIRA 5LYRA 1R3RA 4XVEA 2YL8A 2VC6A 3RLGA 2IQTA 2DUAA 1LQ2A 3I10A 3MKCA 3GS6A 2ZTJA 3OVQA 4D6EA 1JCTA 1FX6A 3ITTA 2WMHA 3C2OA 5FKYA 3AUOA 3CV2A 4OQVA 4IICA 3KZSA 2DW7A 1JCMP 3NQ2A 4ZQCA 3UG8A 1H7NA 4XAFA 1W32A 3AS0A 3GKAA 5D8ZA 1ISXA 1XLKA 2EPHA 4H7VA 1BG9A 1VFFA 2QF8A 1OYBA 3NZGA 4TUFA 3FJ4A 1GKPA 4NT0A 1YPFA 1RQHA 3HPZA 3WQ4A 4X9SA 2F61A 1V08A 1S2TA 4FR1A 3QGKC 2BY3A 1O68A 3VDGA 4E8CA 3L4YA 4IH3A 3JZUA 1EUAA 2PEVA 3MCMA 3TKFA 2E77A 4ICCX 4CCZA 1E56A 4TX6A 3PBUA 1OFAA 1HKIA 5CXPA 5FEPA 2Z7GA 1NU5A 3AROA 5CGTA 3UVAA 4MSSA 2D22A 1Q7QA 2H8XA 3GR8A 2OODA 3LI0A 4LUSA 2ISFA 4E4FA 1C7SA 1HO1A 3SSZA 1TSIA 5FJOA 3KBSA 2FB2A 1ISZA 3S9YA 1PCKA 3PTQA 3EOSA 3LBCA 3PUGA 1KCKA 1QPKA 3DGBA 4L5ZA 5ABTA 4TTGA 4RUBA 4NZJA 3ZLGA 4QGCA 2WHKA 4IX2A 1XYMA 3CXOA 3LCWA 3WJSA 3DENA 2A6NA 2INFA 3NVTA 1F3WA 3CTTA 1JGMA 1L6WA 4GIAA 2VWTA 1CZ1A 3TEVA 2G37A 3M0XA 1N8FA 1D7FA 5LXEA 1FWIC 3VPLA 3KX6A 3KWSA 4MNLA 4JN7A 2BXVA 4CN1A 2J24A 2XVKA 3CYVA 3MYPA 3LCFA 1QNVA 3V16A 4YYCA 2UY4A 1Z3NA 1CLKA 1KFKA 4GFSA 1BKSA 3ES7A 1JYVA 2ZE0A 3CO4A 4DN1A 1G7UA 2VFFA 4HBKA 3PAJA 3M5VA 3SRFA 3VNZA 4DZ5A 1NP0A 2CBIA 2J74A 3UZZA 2WAGA 1FWBC 1Q85A 1IHIA 1TJPA 2QS8A 4ZGYA 2B7OA 2V38A 4DF1A 2ZWZA 4M6UA 2X30A 4OUEA 4U33A 4RDZA 2VX4A 4N7QA 4ZVJA 4IMAA 1DE6A 3DFPA 3V5CA 3TYEA 3CV1A 3W07A 1OEPA 2ZRWA 2OOGA 4PODA 3GX9A 3GH5A 2G3JA 3FS2A 1RK6A 2QHAA 2PTXA 3SN4A 3VIKA 4PBGA 4CNNA 4LCQA 1UR3M 4A8LA 1GYNA 4TVUA 3AYTA 3S1XA 5I3GA 1QOXA 4DYKA 1DIKA 2RGLA 3R8HA 1PHQA 1TPFA 2D0HA 2W5FA 1O66A 1XW8A 2WSPA 1UWQA 1PO9A 3ENLA 3NQMA 2P1FA 3P0WA 4JNMA 3LEPA 1HW6A 3KUMA 3WDIA 2PU1A 5D9MA 4AF0A 4N02A 3DFSA 1SUXA 3PPGA 3OODA 3DG3A 3UCQA 1KTNA 1LRNA 4J2MA 2YDAA 1R30A 1GVYA 2J66A 3EX1A 5C55A 3TP4A 1JYXA 4DM2A 1J10A 1I2OA 4Y6GA 4IPIA 4HCDA 1SFLA 1K77A 3O6AA 3WJXA 1BXCA 2VENA 2NX1A 4NJGA 4N0RA 3ZR4A 2NX9A 1NAL1 1TPH1 2NQLA 4KCWA 3C3NA 2NVCA 4WRHA 4ZODA 3W6LA 4U3CA 4MHBA 5A8MA 3VU2A 1TRDA 3CHEA 2OQLA 3IAQA 2VFEA 4Q7NA 1FQ0A 4J3ZA 1K1DA 3F2CA 3TAKA 2HBVA 4M5PA 4X0VA 4QROA 3TTQA 2WBGA 2NUXA 1SZNA 3BE7A 2WHLA 3KCLA 4AU0A 4WDTA 1RJPA 4ZQPA 1QO2A 3FAXA 3PZMA 3MO7A 1G5AA 2HCVA 1SJBA 5BXTA 5JU6A 3DFHA 1EJXC 2VZVA 4UB9A 4B3LA 4MKSA 4S38A 3LMZA 3EDKA 4HA4A 2VNCA 1VJSA 4MJ2A 1B1YA 1XISA 2WNQA 3UXAA 1XXXA 2PI6A 3EBVA 2WMIB 1EA9C 3ORWA 3LPGA 4U3AA 4DX3A 4ALDA 2XVNA 3CHCA 3RG6A 4P7QA 4ZQOA 4BKNA 4R9OA 5EMYA 2A5HA 3WLJA 1JZ5A 4PFHA 3RCMA 4S23A 3PBWA 4Z1DA 1EHNA 5HMFA 4REQB 3HO8A 2ZUUA 5MKGB 3WH5A 2A6LA 3RDKA 4DY1A 2XH4A 3VZZA 1O5XA 1BD0A 3EMQA 2VWSA 2NQHA 1UP2A 3O2LA 1TRIA 4L4LA 3LG3A 3R0DA 4O57A 5D2WA 5GNYA 4G56A 5HQLA 3G8RA 3B9OA 1VFOA 1XCFA 4HNCA 4IGHA 5A6TC 4JTFA 1GCYA 1EJSC 1HKWA 2AQWA 4R34A 1XRTA 1DV7A 4IL0A 4IMGA 3C5QA 1QNRA 3NZQA 2J8FA 3URBA 3Q58A 2POTA 5F1UA 1ADDA 1YE6A 3AYRA 3CZEA 3WF4A 3FIGA 9CGTA 5A2BA 4MYXA 1NM9A 3IJDA 2I14A 4KETA 1W1VA 3VKKA 2E09A 5CJNA 4O11A 3ZZ1A 3B8IA 4FPSA 3ZJ8A 4H9YA 3HOJA 3CHDA 4DWSC 4EWJA 3EDEA 2E4TA 3P7YA 4A2SA 3D3AA 4CGTA 1XLHA 1FP8A 3B8VA 1ZNNA 4MUZA 4ZENA 2VKZG 2E1WA 3MP5A 3TE9A 2B81A 4DJFD 3C3UA 1BVZA 5BW6A 1MZHA 3QHNA 2ZC8A 5BMWA 5A8GA 3WQCA 4ZXOA 1FWGC 1GZ1A 3OHIA 3IUIA 3UZ5A 4OKDA 1GWJA 1LRTA 4F40A 1WV2A 3TTYA 4PMJA 1J01A 5A6AA 1O7AA 3B03A 1MEHA 4O52A 1V3LA 1QI0A 1L0PA 3M7SA 3OGVA 3LA4A 2D73A 3AXXA 3H7VA 4UBPC 3KCOA 4O10A 4L6DA 1YYAA 2BWGA 3CB8A 1KCLA 2CCRA 3B0XA 4FZIA 1CXLA 5DBTA 1ZBCA 1I1WA 4ML9A 1NF0A 1BEUA 3ERPA 3P80A 1UWRA 3EWYA 2XM2A 1OADA 1HNYA 4RV3A 1MXSA 3ARYA 4NX0A 1RPXA 1XYFA 2V68A 2VX6A 3OA3A 5CJMA 3VDCA 3WJWA 4AWUA 3GVWA 1GYLA 1WZKA 2XIJA 3QW3A 4FNPA 3WBYA 2OGYA 3L4WA 5LIYX 3TSMA 1SZRA 1WDWA 4AX6A 2PFHA 4BF5A 3K30A 3NQGA 3UZYA 2INEA 3LYEA 1IEXA 3A9BA 1DWGM 3UJ2A 4A05A 4H01A 1ONXA 1OX5A 4OE7A 2EG8A 5ECUA 3A5VA 4NSBA 3LCIA 1H60A 2FPTA 5EMLA 5I06A 3ABRA 1YXCA 3VUPA 5D04C 2FFCA 2PGEA 1KGUA 1W9PA 1ZBKA 1KKOA 5B7YA 2AKMA 2DORA 3W0KA 4IXHA 2J78A 1QOQA 3L12A 4Z42C 3GXIA 4IUOA 5DFAA 1PZ3A 1R0MA 1JUEA 5AZ1A 1MUMA 4WDUA 4BEQA 3FKRA 4GRSA 1FWJC 4DI8A 4FXJA 4X60A 5HMSA 1OX4A 4NX5A 1H0GA 1HGYA 1V6VA 5DY3A 2ZRYA 3EX4A 2O4QA 3CUXA 5CAHA 3GDMA 5HAOA 4UQEA 4J3WA 3LHTA 1XQLA 2AMXA 4PMRA 4F9DA 4O12A 4PMUA 4LAKA 3VNYA 3GNDA 1Q7MA 1NSJA 2FVMA 2XM1A 1H61A 4L61A 1WKDA 4O14A 4EPKA 1WNOA 3NO1A 1QOPA 1E9IA 3ITOA 1AJ0A 4ZQMA 3STGA 3M41A 3THCA 4S39A 1JEZA 1XLEA 2WHJA 4DLMA 1OCJA 4QNWA 3BLLA 1H7WA 1YDNA 3W23A 4LRSA 1O95A 2QV4A 3P93A 5KITA 2E6DA 2QEZA 5GPRA 3KL5A 4WY0F 7PTDA 3W38A 2P3ZA 3R1ZA 1UUQA 4I9MA 3EX6A 1RBLA 3Q45A 1QMLA 5XIAA 4PB5A 3R79A 2WXDM 1TX2A 5HQEA 4WF7A 3U4FA 4H9VA 1G4PA 5CBBA 2BY0A 4QDPA 4DBDA 3M44A 1R3SA 4D2JA 5LA0A 3GFYA 3CZGA 2GVJA 4UMAA 4W8LA 4RK8A 3L0NA 3A4JA 4YWIA 3WQ6A 1NY1A 4J9JA 3U7VA 2ZXAA 5BRPA 4E2BA 4REQA 1SSDA 4QAWA 4JTGA 4G1KA 4F2BA 3M07A 4OGZA 6TAAA 1WOAA 1HVXA 3L0KA 4EAMA 1MVYA 1IT0A 2Y70A 4LBRA 3UWQA 2Q02A 4M7TA 2DU2A 4WUIA 3GXDA 3BG3A 4AEOA 2P8BA 3HM7A 5HDRA 1TG7A 4DJFA 3S9IA 3T4WA 2B31A 2V2HA 3JR2A 5BOFA 1RBOB 4K6AA 3W81A 3FVMA 1G0CA 2W9MA 3LPOA 3VK5A 3I7RA 4D6HA 4P61A 2EQDA 2NQ9A 1RA5A 1KWKA 4N4PA 3LZ5A 1EYWA 2QDGA 4J1OA 4G8TA 1Y0EA 3BG5A 1OCNA 4AG0A 3ZM8A 3U2EA 1KTCA 3WH9A 3C2VA 3W37A 4E3TA 3SECA 1G4EA 1UOKA 3O0KA 1DJZA 4C7DA 3C2YA 3MP3A 4Q4PA 1M01A 4B5NA 2PDHA 1H1NA 4AZBA 3FJ6A 1AZ2A 4AUBA 4PTMA 2E9MA 2H9AA 5HR7A 4JAWA 3WD0A 3USBA 3HF3A 2ASHA 3W4RA 3VKDA 5F2IA 2WZTA 1XGDA 1I2NA 1K02A 4Q4QA 3PUEA 4XO6A 5CGMA 3ELFA 4I8DA 3WLTA 2H9AB 2BHZA 5LNRA 1AJZA 5DQPA 3BSMA 4GZJA 3C8FA 4AYSA 4NRRA 3E2QA 1D8WA 1KR0A 3W01A 5EMUA 3GC5A 4CNSA 1CBGA 3DX5A 3W7HA 2VC7A 4IIGA 2IW0A 2O7QA 5I2UA 3TONA 4DO4A 1XD1A 4OTKA 1NELA 5TIMA 2GPTA 3DN5A 1E4LA 4ZE4A 3BANA 5E0CA 3RO6A 1PZ2A 4BY3A 2E9LA 3MBFA 1LWIA 1H4PA 3W7IA 4M80A 1R85A 4AD0A 2C1IA 5IBXC 4AY7A 4HNOA 3P82A 4G6CA 3N9SA 1TCDA 4PUKA 2ZIDA 3VAVA 3KRUA 3VD4A 1J96A 3LHVA 4A3QA 2Z1WA 3AXIA 3WD1A 2BVYA 2PDKA 2NWRA 2I56A 3H6OA 3SADA 3ARUA 1K9DA 1U1JA 5HPCA 3WD2A 3NOYA 1T99A 5FCZA 4MADA 1KBLA 1J5TA 1T41A 3BARA 3M5XA 3CEUA 1EQCA 4XBSA 3UR8A 4C6BA 1Q65A 5M3WA 3L4TA 1QDSA 3L0GA 1VC4A 3KCJA 1CENA 3HJEA 2Y8UA 3S6OA 4KWUA 2JF7A 4MPKA 1C91A 2DQXA 1I45A 1R3WA 4X2PA 2Y1HA 1N8IA 1F8MA 4MY9A 1GW1A 5TQLA 1V02E 4YPJA 3UWUA 3P67A 1UKSA 1E43A 1UA7A 1UYQA 1ME8A 3ITXA 5A6BA 3PHAA 1W3TA 2I5GA 3BAKA 4LEFA 3N14A 2OMAA 1XLDA 3IRDA 1US0A 3WF0A 3WLIA 2Z7KA 3UGRA 5A8QA 3MSDA 4LRTA 3WEZA 4O13A 2NVAA 2VVSA 1KFEA 1UP0A 3ME3A 3AC0A 4AC7C 3DDMA 2QGYA 5RUBA 3PZIA 4I7VA 5U4NA 4KEZA 2WPGA 3DI1A 4JTUA 3VYLA 3LN3A 1QVBA 1W1IE 3GH7A 2DT0A 4B3KA 4YCPA 1G01A 4O15A 3B40A 4S3AA 5BCAA 1VGAA 3CWOX 3LZ3A 3L4VA 3OQEA 1DEDA 1W5QA 1PDYA 1E70M 4AHOA 5BZAA 1D8CA 8RUCA 4IJBA 1DWAM 3G1RA 5IOBA 5KMYA 3UNDA 4HNLA 3ZMRA 2OCZA 3OVRA 1ADOA 5CPLA 5C9XA 4GXPA 4XTIA 3HGRA 2CLPA 4QFUA 5AYZA 3UY8A 2OLHA 4EXQA 3I6EA 1LT8A 4I5RA 3LCXA 1YW1A 4HMCA 3VC6A 5EMJA 4K36A 4BQ4A 5DMYA 1NOUA 5C70A 4AF0B 2DUZA 3EGJA 1JAEA 1KR1A 5KZDA 1LG1A 4IG2A 4S2CA 8TIMA 2PP3A 1UZHA 4GI8A 4A8IA 1K4HA 1P4CA 3CTLA 1EHAA 2Y5EA 3IJLA 3HMCA 5D32A 1GTEA 3A9IA 3OO2A 4E5TA 3ZS4A 3PWAA 4Z1BA 3OHMB 3P62A 3SUVA 3DGRA 3S0CA 5IXEA 2DZUA 1ZGDA 4JL1A 4NZCA 1JDAA 3SZ8A 4D6CA 3BH4A 4P8WA 2PPGA 4E2DA 2BGNE 3M16A 1S5TA 1P1XA 3GW0A 3MI3A 4U10A 3BAIA 3ZQ9A 4TVDA 1Q66A 5JBFA 1UR2A 4MTVA 5AYBA 2HE8A 2V2DA 4AX7A 1ZCCA 1V3JA 3TTSA 3SY5A 4XZ9A 3HA1A 4TR9A 2ZFAA 3AHYA 4US5A 3TWBA 1WAWA 2C3ZA 4JKLA 4LALA 2YXXA 4XZHA 2V3GA 2GQ9A 1KB3A 4AHQA 3E0LA 3M0ZA 1CPUA 1FP9A 3P14A 3P5YA 4GIRA 1JXKA 1GZJA 3NSXA 5EMKA 1E1CB 5I02A 3T7VA 5G5IA 3SGZA 2XZ7A 3MYOA 1PTGA 3IUHA 1JG9A 3N4FA 1KTBA 1NQ6A 1XSJA 1B3OA 4IP5A 4ACZA 2NSXA 2W67A 2VGFA 2WMGA 2WC7A 2W92A 4FOKA 1YQ2A 2X1RA 1OZMA 2A0NA 3OLDA 4CVUA 1E1CA 2P76A 3EB3A 3NM3A 3WL0A 1UZDA 2CLOA 2XGIA 5K2ZA 1F4AA 4ICNA 1QR7A 3WIJA 4B91A 2W79A 1J5SA 1AD1A 2VOMA 3F5KA 1XR2A 3CUIA 3S5NA 1Z89A 3WH6A 5A6MA 1RJRA 1KCXA 2YCJA 1JUKA 5EBAA 4Z1AA 1BLIA 2E1DA 3SIZA 2PDQA 5HWMA 3BJSA 2YBUA 2AKZA 1TMLA 4H7CA 4L65A 1E6XM 1QBBA 2XFWA 4J5NA 4LANA 3EXRA 3AQUA 3JUGA 1OHLA 2CHNA 4AAJA 4ZBCA 3I3BA 4IT1A 3QHOA 4HYWA 4GACA 3SQSA 1P0NA 2FHCA 3N17A 2O9TA 5CZJA 2ISSA 2RDXA 2BVWA 1JYWA 3W22A 3SCPA 2OGJA 1JCJA 4GINA 1GVIA 4OT7A 4A3RA 3UQNA 2G96A 2OELA 2P88A 2VX7A 2J7CA 1FHUA 1A3HA 5TBOA 2Y5JA 5BRQA 4H2CA 1G67A 4N6FA 3V0SA 1TVPA 3N34A 3V7PA 4JTDA 4AMAA 2RDUA 2C91A 3WLRA 4J35A 3VDHA 3TROA 3HGSA 1XCXA 4PR4A 3M0HA 5IM51 1MQQA 1US2A 4WOQA 4M24A 5J8LA 3QSRA 3MVIA 3V0TA 4QS5A 1UMLA 5T91A 4GQRA 5M5DA 1XIMA 1LTDA 3FKKA 1FVPA 3KFTA 1H51A 1RBAA 1T40A 1TR9A 3I3DA 1JNDA 3CUGA 5FL1A 3HMJG 2ACQA 4RDWA 1DJWA 2PDJA 3DYMA