2PDQA

Human aldose reductase mutant c303d complexed with uracil-type inhibitor.
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
315
structure length
315
Chain Sequence
ASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSDTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Merging the binding sites of aldose and aldehyde reductase for detection of inhibitor selectivity-determining features.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Aldose reductase
total genus 101
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2007-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2pdqA00
4JQ3A 2NVDA 4PUUA 3U2CA 3EB4A 2PDCA 2FVLA 4DBUA 4XZLX 4GQ0A 2FZBA 1X97A 4WGHA 1Z8AA 2VDGA 3D3FA 4LBSA 3R7MA 2ISFA 4ASTA 1RY8A 4GIEA 2BGQA 3BCJA 2QXWA 1RY0A 4GA8A 4FAMA 3H7UA 3GHSA 1AH4A 3LEPA 1SM9A 3LD5A 1PWMA 4JQ4A 4XZHA 4FA3A 2ACUA 1FRBA 3N6QA 3UZWA 4DBWA 3BUVA 3UYIA 2PF8A 1XJBA 3LQLA 4Q3MA 4PMJA 3COTA 3ONCA 3QKZA 2PDPA 3FJNA 4YU1A 4FALA 4YVXA 4Q7BA 2PD5A 1IEIA 1EL3A 4JQAA 4XZIA 4GACA 4DZ5A 2J8TA 3MB9A 4IJRA 2I17A 3VXGA 4WRHA 3EB3A 2ACQA 2PFHA 1OG6A 2IKIA 4XO7A 2PEVA 1X98A 3B3DA 2C91A 2HV5A 2IPWA 3WCZA 4EXAA 5M2FX 1JEZA 2DUZA 1AZ2A 4QR6A 3UG8A 2BGSA 1HW6A 1ADSA 1MI3A 2IKHA 4GABA 2PDFA 2HVOA 3S3GA 3G5EA 5JH2A 3FX4A 1M9HA 3M4HA 1LWIA 1T41A 4L1XA 2PDHA 5LIUX 1Z3NA 4EXBA 3BURA 3LQGA 4XAPA 1ZGDA 2PDJA 4XK2A 4JTDA 2PDQA 3UFYA 2PDIA 3RX4A 4YS1A 1YNPA 3R94A 3O3RA 4YVVA 3CAQA 2PZNA 3DOPA 4WDUA 5AZ0A 3F7JA 4JIIX 3RX2A 2FGBA 1A80A 1EKOA 2R24A 3Q67A 1C9WA 3H4GA 3GHUA 5HNTA 2I16A 3G1RA 3H7RA 3EAUA 2PDUA 1IHIA 2PDLA 1PYFA 5LIWX 4AUBA 2HDJA 4PR4A 4IJCA 2HE8A 4JIRA 2PDYA 4H8NA 4LAZA 4QBXA 1RALA 3LZ3A 1AZ1A 2PDGA 3LZ5A 2PDKA 4R9OA 3MC5A 2WZMA 1UR3M 4H7CA 3LN3A 4NKCA 4JTAA 4PRTA 2BP1A 3WBWA 2ACSA 1X96A 3GHTA 3UZXA 5HA7A 3WBYA 3WBXA 4JTQA 3ONBA 1MRQA 3Q65A 3ERPA 4QX4A 3CV7A 3GUGA 4IGSA 3M64A 2IPJA 1S1RA 2INEA 2IKJA 4RPQA 2PD9A 3M0IA 4LB4A 5AZ1A 2R9RA 2FZDA 3LNMA 1AFSA 4WDTA 2HEJA 1Q5MA 4GCAA 1ZQ5A 3BV7A 3LENA 4XO6A 1XF0A 3RX3A 3DN5A 2IKGA 2FZ8A 5C7HA 4XZNX 3C3UA 4HBKA 1R38A 3R58A 3UWEA 3UP8A 4PRRA 4ZFCA 5LIYX 1HQTA 4GQGA 2DUXA 1J96A 5LIKX 2HE5A 4HMNA 2DV0A 1LQAA 1S2AA 1EXBA 1VP5A 4F40A 3UGRA 5HNUA 1VBJA 4LB3A 1AH3A 1Z9AA 1ZUAX 4FZIA 1YNQA 3T42A 2IPGA 2F38A 4WDWA 2FZ9A 1YE4A 3R8HA 4OTKA 1Z89A 1Q13A 2PDBA 4XVEA 3LBOA 2HVNA 2PDXA 2INZA 1XGDA 4G5DA 3P2VA 3CV6A 4WEVX 5DANA 1K8CA 4ICCX 2ACRA 3R43A 4JQ2A 1S1PA 2IS7A 3CAVA 1US0A 2IQ0A 4JTRA 1EF3A 4JTCA 3V35A 3UZYA 2AGTA 3R6IA 1GVEA 4L1WA 3CASA 4JQ1A 2NVCA 1PZ1A 3KRBA 4YVPA 3R8GA 4XZMX 3V0UA 4LBRA 2A79A 4PUWA 2IQDA 1QWKA 1PWLA 1MZRA 3N2TA 1PZ0A 2P5NA 4JIHA 3NTYA 2ALRA 2IPFA 3GHRA 2CLPA 1AH0A 3WG6A 1ZSXA 4MHBA 2PDWA 4DBSA 2PDNA 5LIXX 3LUTA 3O0KA 4QXIA 1QRQA 1S2CA 3V36A 2PDMA 4LAUA 5KETA 3CMFA 1YE6A 3V0TA 2WZTA 2F2KA 1T40A 4WDXA 4I5XA 5JH1A 4XVDA 3UZZA 3V0SA
chains in the Genus database with same CATH superfamily
4M7SA 1DJGA 2YCKX 4GYKA 1CEOA 3B9OA 1SPQA 2HRWA 4M1BA 3W82A 1TE6A 4IP7A 3TIMA 3UG4A 3EOUA 4MB5A 1S2VA 4OBTA 1GT8A 2BV9A 4N6EA 2TAAA 4JFSA 1IXOA 5BXTA 3L4TA 4NG3A 2EPMX 2AAAA 1VEPA 1ISYA 2ZX7A 1E70M 1BKSA 2XVLA 4XAFA 1R9YA 5CBIA 2C13A 2D3NA 2B81A 4B4HA 1XPYA 5DN1A 4K1GA 1AW5A 2ZICA 1PXGA 1OK6A 4C6NA 4XZBA 3TC3A 4F2UA 4YN5A 1SM9A 3W86A 1DPMA 2PF0A 2YCLA 1UKOA 4MWAA 3QZAA 4HMEA 4LUTA 4XAYA 3GE7A 3S4TA 4RK8A 5D33A 3E74A 7TIMA 4AG0A 4DI9A 4FALA 1XFBA 5LNVA 3BV4A 3K4DA 2QCGA 3W7LA 3BQ6A 1TJ2A 1JYVA 4HJWA 5D9NA 5B7YA 3LPFA 1XLHA 2V0TA 2V5DA 2IQTA 1QBBA 3PFMA 3LHUA 1X98A 3LHZA 3R8RA 3GDKA 1TR1A 4HYVA 4I9MA 2XFWA 2XSAA 3WF2A 5ECVA 3WK0A 1W3KA 1PKNA 2Q02A 3WQFA 3EYPA 3EWWA 4Y9OA 3SRKA 4H4IA 3CH9A 2OEMA 4CQ9A 1YNYA 4C7DA 1DHKA 1TE1A 1WX0A 3LRLA 2GYIA 5BROA 2OZ0A 3G5EA 4S3EA 3IUHA 1ZBKA 2ZE0A 1I60A 4H9UA 3MBFA 3VX1A 5HMFA 1W9VA 2WMIA 2NX1A 4B5UA 3W22A 1OK4A 4XK2A 2XINA 5CJNA 2VVSA 1TFVA 2VQUA 4LVBA 1TA3A 3FN9A 1F3WA 1W9UA 4JNZA 1KFEA 4O1CA 3WBAA 1V3IA 3H7VA 4L4MA 3PBGA 1EYWA 5BOFA 3AUJA 1XICA 1EKOA 1EB3A 1JCJA 5BCAA 1JXJA 3ZWSA 4U33A 5EBAA 3AO0A 1O12A 1W56A 3DHPA 4ZOBA 4HA3A 4HPGA 2DZVA 1CXIA 1S38A 3ZJ7A 3TA6A 1XYMA 1R7OA 2DSVA 1EGMA 3FJLA 4UR9A 4TO8A 1SMAA 1H7RA 3LHTA 3I3BA 5CPSA 4KWOA 4JPGA 4DZHA 4PBEA 2PTZA 4UIOA 1NTHA 3TA9A 4GX8A 2RFGA 4HK5A 3LGDA 3C56A 3MUY1 1DL3A 4RXGA 4AC1X 2J79A 5HK4A 3Q37A 3HQ1A 1VFMA 3UA4A 3NG3A 4A2SA 2W61A 4H9TA 1LT7A 3K1GA 1A5UA 3TYCA 1ELSA 3F03K 4QX4A 2BOEX 3GUGA 3JW7A 1KM4A 3OP2A 2FTWA 2NV2A 3DHUA 4DEFA 1NOUA 1U1JA 3L2IA 3TYEA 4E4UA 3C3NA 5KTLA 1AFSA 3TQVA 2HEJA 1TWSA 4A3QA 3W2JA 2YGYA 1M7PA 4QLKA 3W6YA 3W87A 4JZ5A 2IXUA 2YDQA 3EBVA 5A6KA 1UR4A 2GZXA 5A6BD 1M7OA 1XG3A 1GTEA 3APTA 5C7HA 1Q2SA 4XZNX 1D3GA 2QCDB 1TR9A 3W0KA 1UASA 3L68A 3TC6A 1KRBC 2I5IA 1O60A 5HR7A 5HINA 4ADSA 2RDUA 2A7PA 2WMKA 2DZTA 5HOSA 4HMNA 2ADAA 4UR8A 1X6LA 3KHJA 1RSCA 3R11A 3O05A 2QV4A 2VC5A 3E12A 4HKPA 3E0WA 3M5YA 4IZGA 2QHAA 1RBOB 1FTXA 1PB0A 2V2HA 4IIEA 7ENLA 3KOFA 3KM8A 4Q6JA 3PBVA 2FMOA 3KRSA 5LA2A 4IF2A 2ZADA 1VD6A 3DESA 2OWXA 1VLWA 2E5BA 3A13A 3KFTA 3QR0A 4A4AA 3E2VA 2PP3A 3PWAA 2CKRA 1UG6A 1W3NA 4KRUA 3L7RA 4ZSUA 2VRQA 1NWSA 4CNUA 3L5MA 6REQB 2Y8UA 3KBSA 3HTWA 2QEZA 1VFUA 4LH8A 1EF3A 4IFOA 4OT7A 4IMGA 3LB0A 1JZ3A 2WNQA 1LBMA 3KW3A 2PLCA 1H2JA 2NVCA 3VZXA 3S2NA 1A53A 4BF7A 3CHEA 4XD5A 2DZUA 2XVNA 5I09A 1TPWA 2ZX5A 3VDAA 2YL8A 2EPHA 2GQ3A 1KFBA 3H4XA 1VJZA 1UC5A 2RDXA 3MO7A 1EZ2A 3T8LA 3ITVA 1TREA 4R5EA 1PPIA 3BVJA 4QROA 3CMFA 4JNMA 3O8AA 3JZEA 5F4WA 1FWJC 1OADA 2ZKMX 4N9BA 2J8FA 5LNSA 4QNWA 3WLQA 4G7FA 1DTNA 2FB2A 3HPSA 3VMPA 4L4OA 2QVNA 1Q6LA 3GQYA 1GJWA 4MY9A 3N11A 2C71A 3BCFA 1V3MA 3C0LA 4JX5A 3CPRA 1Z8AA 3H24A 3W9ZA 1RBAA 3FA5A 2JQXA 4M24A 4M51A 4O8RA 5CSSA 1KRMA 4GIEA 4OOZA 3B8TA 3I10A 5BOOA 1SQ7A 2J25A 2EKGA 1UD3A 4FAMA 1VYPX 4JTSA 3QPYA 1RLDA 4OU1A 1PSCA 4AD0A 3E49A 4GCXA 2J7DA 2VEFA 2OODA 1LORA 3G8RA 4QQUA 1R85A 1E4IA 3FJ6A 1F4AA 3HQPA 2DT1A 2FHCA 1W32A 3VA8A 3W6LA 4S38A 2OLAA 2ZC1A 1W3LA 1NP0A 3QMTA 3WH6A 3UGVA 3BAWA 3C0QA 4RE2A 2YCLB 3N3TA 2D2HA 2REQB 4WSJA 5GVJA 2CBIA 4TU1A 2GUBA 1FWHC 1I8JA 1SW0A 2TMDA 1EIBA 2CZFA 3DXIA 2WVVA 1EP2A 4Q8VA 4IX0A 4ERIA 1ONEA 2GGEA 1WZLA 3GFXA 1UP3A 2WK2A 3PBWA 2FGLA 3PBYA 4WGXA 1LOLA 5C2GA 1VAHA 1LLWA 4Z2LA 4ZB5A 1C93A 4EXQA 4GZEA 4KWUA 2YDAA 4REQB 1A4LA 4DZAA 5CQ1A 1ZAJA 4G9PA 4AZHA 4C6QA 3IVTA 4IL0A 1BGAA 2F61A 1E56A 4DF2A 1BYCA 2VFIA 3O06A 1LRQA 4FPSA 5T9BG 3UFYA 3NQ2A 4ZOAA 3E02A 4EWND 4NRRA 4Y7EA 1WUFA 4UTTA 3NGJA 3M0MA 2PZNA 4WDUA 3F7JA 1L9WA 3UA3A 4GNKB 3K46A 1X8FA 6TIMA 5KINA 1UCWA 1XYZA 3FEQA 4O0QA 1K77A 1C9WA 3QTPA 3C2RA 4TV6A 3TDFA 3N19B 3S1WA 3IJ6A 3ITYA 1XUUA 1IHIA 1DE6A 3E0VA 2WCSA 3SURA 2DZWA 1GNXA 4Q33A 2PWDA 4RZBA 3SCUA 1BHGA 1I6NA 4JFWA 1Q7ZA 2GOUA 2OSXA 3V1PA 4H8NA 5A8NA 2PPGA 1J5SA 4IQDA 3N14A 3NPVA 3TEVA 4UCFA 2VWSA 2Z1VA 4FEZA 3SR7A 3SQMA 1ICSA 2CLKA 1QI3A 1US3A 5TIMA 1XSJA 1TUFA 3NA8A 2YLAA 1LRNA 1RPXA 3WZ0E 3DIPA 4JYEA 3UETA 3T05A 1FWTA 1BXNA 1MEWA 3KCLA 4D6IA 3AZSA 5J5RA 2ZA2A 2PLKA 4CU8A 2Z27A 4LB4A 4P61A 5AC5A 2R9RA 3ZXWA 1AQHA 1W1PA 2X0SA 4P7RA 4TX6A 4A3YA 1X6UA 4S3BA 3N15A 3UCDA 1UUOA 2XJ7A 3W81A 3HG2A 1EJRC 3I65A 2GVEA 3G6MA 3IJ9A 3WLMA 1G9HA 3CHVA 5M1TA 3TJLA 4QJ4B 3AXKA 3MKVA 3ANUA 3DG7A 2P3EA 5C70A 5C9RA 3SQLA 4PUMA 2E09A 4IPPA 4DB7A 5TAOA 2VI0A 4A6GA 2J74A 3W2MA 1KWKA 5CPOA 3NR0A 3FNDA 3WKZA 3OVGA 4DJDD 5HNUA 4QIUA 4FZIA 4BCEA 2DQXA 4AVOA 3TOYA 4YPJA 2DT3A 5A2CA 3IPWA 1SMDA 2XWDA 1GYLA 3TYAA 3VNYA 1AVAA 5GJMA 3NQ8A 3ZVHA 4WF7A 3CGTA 4JYFA 3VYLA 4PUEA 2VUYA 5FKYA 3WNLA 1UB3A 1C7TA 2ASHA 3Q94A 4G1KA 4RPPA 3WEZA 3EKZA 3A3WA 4GY1A 1YADA 3M41A 3S1GA 1IGWA 1Q3NA 3S1UA 4M80A 5SWUA 2YFOA 1ZZMA 3IGUA 1EGZA 2UY5A 1J79A 4CCDA 3HJZA 3L23A 4JFVA 1I2RA 5GJPA 4O1AA 2G96A 3W26A 2C79A 3RF9A 2E9MA 2NQJA 1VKFA 1IWBA 3KTXA 5I3IA 4U2ZA 4FLQA 4DO6A 4JYDA 1MQRA 1PWLA 3QGKC 3P61A 1XCWA 2CU0A 2KX9A 1CENA 3UCQA 4C6EA 1E1CB 3WENA 1EJTC 1VFFA 4RL3A 2PDWA 2VZSA 4A8NA 1HN1A 4R7WA 1QUMA 2I57A 2VD9A 3QW3A 3UXAA 5I3GA 4QXIA 4PBFA 2Y63A 3WJWA 1N8WA 4DZIA 1OX4A 2DW7A 2OKTA 3VKKA 2XN0A 3MTWA 2XDFA 3LLDA 5JH1A 5A8QA 4LJ3A 1I1XA 1Y5XA 4Q4SA 4AH7A 2PP0A 3UR8A 3W7CA 3PTKA 1Z48A 3URBA 4F48A 2D1ZA 1RVGA 1FWBC 4W87A 1A5AA 1PL9A 2BY2A 3WFAA 1GOQA 4NYYA 4UQAA 4JKKA 3OYZA 2OVLA 1V7AA 3N4EA 4PUKA 4UUIA 4WJXA 3SCTA 1AW1A 3E0IA 1QI4A 1XLEA 2QXWA 4XIAA 1VFSA 3S46A 3IJLA 3UCCA 3NYDA 3P74A 3UG5A 4CNPA 3O07A 1KCKA 1O68A 1V08A 2C0HA 3C86A 1B3WA 3LD5A 5HBFA 4XZ9A 5DT7A 4FNTA 1FOBA 5LNRA 5FL1A 2CYGA 2INFA 1DJQA 1XJBA 4UBPC 5G1MA 3FSUA 8CGTA 1XLBA 1EOMA 4YU1A 5IRPA 1B0IA 1M01A 3KBWA 1GKQA 4E4PA 4XSLA 3IEBA 2PD5A 1KTBA 3BC9A 3M7WA 3ZJ6A 1BYAA 1AD4A 3ZT7A 1P6WA 2VP8A 3ARXA 3WCZA 2WXDM 3MT1A 3DERA 4UNKA 1YTEA 2J7GA 2DDXA 1N7KA 4AEOA 3G1YA 1J93A 1GQIA 2JK2A 1K1DA 1AZ2A 3BH4A 1HNYA 4L4LA 2Y85A 3VNDA 1NEYA 1GQNA 3KBMA 1KGUA 1QJWA 1UH3A 4HN4A 2DSZA 3ARWA 3RILA 3AUOA 5ECUA 1VRDA 2QUTA 2PRMA 1JG9A 5AN7A 3K8MA 4Z1CA 2BMBA 3TVAA 3NSXA 3CTTA 4WY0A 1T41A 5FI8A 5C9ZA 4NZFA 4L65A 3OQEA 5C54A 3EX4A 3KBVA 1XYAA 3MSYA 3NQ7A 1JD7A 3ITLA 2PTXA 2Z2AA 2R1LA 2IW0A 4NIRA 1NARA 3BAIA 3ID7A 3N4AA 3MSDA 3B03A 4DF0A 2PRLA 1AA1B 5LA1A 2WANA 4RNFA 2VCBA 4QG9A 2JGQA 3G18A 2AQVA 2BOFX 3SO7A 3G3MA 4DX3A 1KR0A 3PBMA 2A7NA 1H60A 4C6MA 4HIBA 4LAZA 4ZXOA 4TTGA 1VEMA 1BXBA 5HR6A 4TMBA 3TR9A 1CGXA 3W76A 4LVAA 1K6WA 3VDBA 3PJUA 3NQAA 4AWEA 3WQDA 3B8IA 3ZR4A 2BS9A 4MB4A 1M3UA 3WD2A 2OSWA 3LN3A 1XH1A 1KM1A 3CXOA 4IXXA 1CGVA 3WNMA 4BKNA 4BF9A 1O66A 3FY1A 2DVTA 4QLLA 1X96A 3O6DA 2PU1A 1E3ZA 4M1RA 1F3XA 4NAFA 4CU6A 2NXIA 3VFLA 4JTHA 1LDCA 3VOJA 4IJBA 2IPJA 4J5NA 5IBXA 3SAZA 2INEA 1N55A 1TPB1 2PD9A 1A4MA 4GYFA 3MYOA 2P0IA 5FJJA 1KV5A 4ZA0A 3QC0A 1ZQ5A 3LENA 1GHRA 3GU9A 2DSUA 3CMGA 3VKDA 1O95A 3GNNA 5AVHA 1K3UA 2VZOA 3K8LA 1Y65A 3G1XA 1W3TA 2H9AB 1ZJIA 4FXFA 4CVWA 1OM0A 5LIKX 4WVXA 1FWRA 2CLOA 2XFRA 5EY5A 1IWPA 3RYSA 2AMXA 1KXQA 3J7HA 1D8WA 1W1ZA 2DV0A 3UZJA 1V4YA 3ABOA 4FLRA 4PEKA 3HGRA 2O55A 2V6AA 1UMLA 4HNTA 4KPLA 2O7QA 2X40A 3GAYA 4L4PA 5A95A 4J3ZA 2F38A 4DN1A 3K30A 3GD6A 3VIMA 3IK4A 3IIOA 5F7UA 1SVDA 3WDJA 3EOLA 4O15A 1DWAM 2C6QA 3VGGA 2J75A 4J4KA 2XZ9A 5I5RA 3MMWA 4HZ6A 4IPJA 1K9TA 3L2MA 3DKJA 3LPGA 2AMGA 4EPDC 3OTRA 7XIMA 3KTSA 4WEVX 1OF6A 3KZPA 3GG0A 1K8CA 1P1XA 1XW8A 1DWGM 4DUXA 1V3LA 3JZUA 3G77A 2ISVA 5EMLA 4HTBA 5CXPA 3O0FA 3Q2DA 1DWIM 4HU0A 1WA3A 2YXOA 3H2FA 1H7NA 1MSSA 4JQ1A 2VOTA 4PFHA 2ZE3A 4B2DA 3C2EA 2P0OA 1B2YA 3O2LA 1XBYA 3UERA 3THQA 2F8QA 4KCUA 2FFIA 2Q8LA 2ZZ2A 5FF4A 8XIMA 2Q3RA 3F4DA 1XYLA 5GNXA 4Z1YA 4CGTA 2WJDA 1QASA 3A24A 1WKYA 4EWJA 5I06A 4GI8A 4JDYA 4K3ZA 2VELA 2YBVA 5HWNA 4NAEB 1B1YA 4GI6A 1E4MM 2XN1A 2PLJA 4QDWA 4A3RA 4R27A 4LV4A 3DI0A 1XH0A 1N8IA 1EGVA 1TRIA 4I6VA 1Y7VA 3ZR5A 1JUEA 2BVYA 3BQ5A 3RCYA 3GZ3A 1IIHA 4JQ3A 1B9ZA 4C60A 3WY1A 2EG8A 3PZUA 4INFA 4J2MA 5F2GA 5HMSA 1EF2A 7CGTA 3H53A 4J3UA 5AB3A 3CHDA 1LM1A 3A9IA 2GJPA 2XTKA 1J6PA 1SZRA 5E6YA 1W9BM 4UFJA 1OB0A 4NF7A 3F2BA 1ZP4A 4GA8A 2RDTA 2OEJA 1BF6A 1UKTA 4IGHA 4DJEC 5CEWA 3AIWA 3H7UA 1R30A 3B8DA 1Q45A 2JKEA 3M46A 3T2PA 4URIA 2D69A 4GNJA 3W7OA 3KL5A 2AQOA 4W7UA 3ABRA 1WBHA 3QMRA 4BK9A 3PAJA 1E6PA 1R5YA 4B91A 3BUVA 3UWZA 4PZVA 3H2EA 2X1RA 1EC7A 3ARPA 3UEQA 1BKHA 2DZXA 3ATYA 1J2BA 2DY3A 4GFSA 3TJIA 4Q7BA 1XBXA 2V5CA 1SUXA 2VGFA 1US2A 4XZIA 3EX3A 1U5VA 2B31A 5DMYA 2E28A 3IGHX 3PJXA 2Y24A 4Y2WA 1OG6A 1EC8A 4LFYA 1ZALA 5FAJA 4GH3A 2NT0A 2CBUA 1QW9A 1EH9A 3QGVA 4RDVA 1TVLA 1DORA 1THFD 4RCXA 3OGVA 2PU0A 4EKJA 3NQDA 4NYUA 5D05A 1CGTA 2PURA 4FOUA 3BLFA 1QCWA 3WD1A 1AQMA 3WF4A 4YXGA 2VEIA 3SQSA 1RCQA 3SN4A 3TKFA 1M9HA 2GSJA 4DJFC 5HDRA 2CZVA 4L1XA 3AJ7A 4IUOA 4YCOA 5LIUX 2VR4A 3TSBA 3CAWA 4EXBA 5CG0A 4FX8A 4TV5A 3W1QA 4QNEA 3STGA 1SJAA 6XIAA 2PLMA 5D9MA 1EEXA 4AZCA 3H2OA 3BG3A 3KDNA 4G56A 3P14A 1RBLA 4HNLA 3G1AA 2VFDA 1X1NA 4QSFA 3QM3A 1AL7A 2GVJA 3CLMA 4WJ8A 4C6DA 4ACYA 2OFJA 3UWYA 4LPCA 1D3HA 3QY7A 5D38A 3OIHA 4QCFA 5GPRA 3OG3A 2CLHA 3VIHA 2PDYA 2Q71A 4MZYA 3N9KA 1E0XA 3N29A 3WJSA 1EFZA 4QBXA 1EQPA 4J27A 2E1WA 1W91A 5I3DA 4LTSA 2X42A 1E0VA 2ZRZA 4D6EA 2ZWZA 4PL1A 1JL8A 5L6UA 1UR3M 3GR8A 5F2MA 4N9CA 3P60A 1R6WA 3DHFA 1R9XA 5HQEA 1Q6FA 2W79A 4L6OA 2J78A 3GHTA 4IM4A 4LWWA 2XIBA 1FDJA 5HA7A 4JL2A 4U3CA 4UTMA 3NURA 1QHOA 3ONBA 1DTUA 3BICA 5K7JA 1XHGA 3BSHA 1W9DM 4KFOA 5DFAA 2H9AA 3S6TA 1JZ4A 5T91A 3WQCA 3AS2A 2D73A 3L5AA 4TXEA 3MP3A 1GW1A 4O8AA 3I3DA 3RRAA 5DCDA 4M6UA 3DN5A 4EF8A 1RXOB 5I24A 4AZ7A 3GVRA 2X16A 5D37A 2QJGA 3N9RA 3EEZA 2Z28A 4XBKA 3M1ZA 3PFRA 4HA1A 3S2LA 4HNNA 1G4SA 2ATSA 1UHVA 3PK7A 1DQXA 2OYMA 1TPC1 5CPQA 4ZOCA 2NXHA 3N9SA 7PTDA 3ZVHB 3AQUA 4L1GA 4K6AA 3S47A 2X8RA 3DDMA 2KAUC 1K03A 1TPVA 5T26A 2VDIA 1QNRA 1XDMA 1JI1A 2R6OA 5AC8A 2YA2A 4TIMA 3PB0A 1PTGA 4O11A 1I1WA 4GD0A 3WQ4A 2XVGA 3OIXA 2WQPA 2WJFA 3W3OA 1H61A 1M65A 3BAKA 4IOTA 5HJYA 1OINA 1Q13A 2Y7GA 4GJ1A 2VKZG 4NXKA 1Z6KA 2I9UA 4BQ2A 3NVTA 3F5JA 3B0XA 4XZWA 5E9AA 2ZQ0A 2PTWA 3PWGA 3EDJA 5A6TC 5DANA 3TSDA 1AJ0A 4YHGA 3V5CA 5IHRA 2CERA 1VLIA 1R9ZA 2ZRXA 4DAIA 2ACRA 4C6CA 1PS9A 2QS8A 5PTDA 1ZCOA 3EXSA 5D2YA 1K7XA 4US6A 2GOKA 2QPSA 3WBEA 2OXNA 4AZBA 3F4CA 1SO6A 2AGTA 4LBUA 4W8LA 4P2VA 4L1WA 4IG2A 1O4UA 3MQTA 3U48A 1BVWA 1XD1A 3AMKA 4IGMA 2WWCA 3EPOA 4EPKA 4GPNA 4GI4A 3CEPA 5D32A 4V28A 3PAOA 3KTCA 4G2DA 1XGEA 1ZCCA 4H9MA 2WVSA 1W8SA 2QAPA 3L9CA 4JCMA 1R47A 4U2YA 3E5BA 3HGSA 3WG6A 4MHBA 3R1ZA 2QCMA 2CETA 3F4VA 4XBSA 5JUVA 4F0HA 1WBJA 1TWIA 1XRSA 4GY7A 1Q63A 1VFTA 2VXNA 5FF3A 1T6MA 1W5MA 5FSEC 1JIBA 3TXZA 2ANUA 3NZQA 4MJMA 2UWFA 3ITCA 4UTFA 4PA8A 4ATLA 3NEVA 3NXLA 4UQEA 3GO2A 2J27A 2DJXA 2EF9A 3EB4A 2ICSA 3CJPA 4O1BA 1MXDA 4XV0A 3TTEA 3R12A 4J3SA 2AKZA 1Z44A 3DX5A 5E5CA 2GFTA 3TMLA 2GSEA 1WQ5A 2YB1A 2CLMA 1LUCA 1L2UA 4I5UA 4KRTA 3HF3A 3WH8A 1I4NA 3ZMRA 4O14A 5DCEA 3ZT6A 3IIXA 3E5PA 2OGYA 1O5KA 1NDVA 3CQKA 1RCOB 3DCPA 1FCUA 3VCNA 4JTFA 4LX4A 1JZ2A 1L6YA 5C9XA 1TWWA 3TN3A 1SW3A 3DFNA 1O6IA 3EXTA 2ZDSA 3T08A 1PE1A 5LGZA 2GVYA 2DIKA 1VBRA 2OJPA 4H7ZA 1JPIA 1H5YA 2RDWA 5G4EA 3GVVA 2JIWA 4GGBA 4YTUA 3TN6A 2YCJA 3PUDA 2QJJA 3RAOA 4MDPA 2CEQA 1BVNP 4HA4A 2EPLX 2QDHA 3B0YA 5I7GA 3W29A 4S39A 5BWAA 1Q7QA 4QM1A 1A0CA 1W6TA 4GGHA 3FGCB 4K2SA 2EJ1A 3OLDA 3HJEA 4HGXA 2HNHA 3I7QA 1DP0A 5CH9A 1V93A 4Q7NA 4G7EA 4BI6A 3HG3A 4PGLA 3LERA 2BY0A 4TR9A 2HPMA 2QCHA 4JEQA 2ZZ3A 4S3AA 3QY8A 3TWAA 1E6XM 3VI2A 2VZVA 4GABA 4DXKA 4DUVA 4DPQA 3W1PA 2P8CA 1TJRA 2W0UA 3MSRA 3TQ0A 3RHGA 3DFOA 3GK0A 2QJHA 5I23A 3CUFA 3TLQA 1LT8A 3A64A 3W6MA 3WNNA 3PN8A 4Z42C 1BQCA 1ZL1A 3RX4A 3GDMA 5HUOA 2Y5SA 3QF0A 1EBGA 3GC4A 4PUJA 1G4TA 5AECA 3D3AA 3EX1A 2UY4A 1XH2A 3W70A 2JALA 4B16A 2WM0A 3RX2A 1W1VA 2QJIA 3T4WA 5AHFA 1TCMA 4C1NB 3L4UA 4K7VA 4NUWA 2V2CA 4NX0A 1GVRA 3I4EA 5HJXA 5CZ0A 5CJ5A 2E9LA 4H00A 3GTFA 4L80A 1ZAIA 3L5LA 4MKSA 4GVFA 4AZCB 2HDJA 4KRZA 2CIPA 3UESA 2W91A 3GXTA 3QYSA 1NDWA 2OELA 3KZSA 3OBKA 4E8CA 4B5VA 2V68A 3B8WA 2RUSA 4UFIA 2Z1BA 1XISA 5AYIA 3M0LA 3SADA 3HQNA 4NZCA 2WSYA 3DH7A 4ZQPA 2WZEA 3RIKA 1H11A 4QLJA 4H7CA 2NV1A 3CWNA 4NL1A 1WOBA 4M81A 1DJNA 1QO5A 3PZTA 3P3BA 2GL5A 4DWSC 4UFLA 4Q8TA 3UWUA 4JTQA 4AWUA 2I14A 4LAKA 3GC2A 2GQ9A 3RITA 1VFOA 3C4UA 1ZY9A 2FPVA 5BMWA 2YB4A 2QIIA 2YW3A 4ILSA 5BZAA 3M0IA 4A2RA 3H2NA 3N18A 2FHFA 1HTIA 1UR0A 3FYYA 1TPH1 4PN2A 4QJ5B 5C7VA 3PANA 1U5HA 3M6YA 4GCAA 3LRKA 3AMDA 1JI2A 4J1OA 1XL9A 5E09A 3QHOA 4M82A 4ZBCA 3T09A 3GXIA 1NOWA 4NJGA 3C3UA 2WSKA 4S2CA 3VE9A 2OYLA 2PWHA 2D22A 4HMCA 1SFJA 1KM6A 4H83A 7A3HA 1HQTA 1HP4A 2DUXA 1OYBA 1F5ZA 4Y90A 5E9XA 3F4WA 5HATA 3ME3A 1SSGA 3WELA 1GJUA 1CCWB 1REQB 4HHLA 2XH0A 3W1TA 4AZIA 4K8EA 2XZ7A 4LB3A 2HJPA 4JTKA 1AH3A 1JCTA 2ZTJA 3H26A 4W8BA 5DT5A 3TTQA 2NLIA 4WDWA 2ZVRA 2NV9A 4PTWA 2FZ9A 2EPOA 2W63A 4RNHA 1YBQA 1TVNA 3M0VA 3MWCA 3WEMA 1JPKA 1RR2A 3DFYA 3W1XA 3GVGA 4LAMA 4H04A 1QVBA 3W25A 4B5WA 5A8PA 2HVNA 4MWAE 4W89A 4RE4A 4G5DA 1MDRA 1GYNA 4ACZA 3L0NA 4GH1A 4LVFA 3AZRA 4ZQRA 1CGWA 3W27A 3CV6A 4KGJA 3GSMA 4MG4A 3B0VC 3CV2A 3CB8A 4PEEA 2C15A 4NRSA 4AIEA 1DJIA 3IIZA 2NUXA 4ZE4A 4NXSA 3UR2A 3B0UX 4O53A 2H3BA 3IWPA 1JCXA 1XC4A 1AMKA 1P4CA 4RDWA 1XXXA 3WLOA 3TN4A 4QTGA 3BCDA 4XZMX 7REQA 1XS2A 1BYDA 2IQDA 4MAZA 2QDEA 1PZ0A 2W27A 4LS0A 3ARTA 2ZCGA 1NQKA 1FP8A 3BJTA 2A7RA 5U7SA 3GWQA 5M5DA 1FWNA 2VGBA 2YXGA 2QYGA 1K6AA 3D46A 3MSGA 3MYPA 3GKAA 3OOQA 4B3KA 1GJPA 1P6CA 4QG6A 7REQB 4CQDA 1J18A 3VZYA 4R34A 2ZUTA 2PP1A 4FXRA 4AHPA 2R94A 3HPXA 3UY8A 4DWSD 4X0VA 1V79A 2O56A 1VZWA 3PZ9A 3TV8A 1KM0A 1RV8A 3NVDA 2BHYA 3LOTA 4ZEPA 5D09A 1KB3A 1YDNA 3DFSA 2PDCA 3NAVA 4MJ4A 4F3HA 2H6RA 4XZLX 3F2DA 4ROPA 4W4QA 2OTDA 4DLMA 2ZWYA 2OO6A 3EKLA 4I6KA 5ABFB 1RP9A 3LA4A 3ITOA 1JDEA 2WMHA 4IMCA 1WZAA 3B04A 5AHLA 1L6GA 1FWAC 3GW0A 3IJ8A 2O9OA 3SY8A 4UTJA 1RPKA 1TRDA 1VFLA 1JPHA 4F0KA 2J6XA 2ODOA 4MKNA 1ZBVA 2CESA 1RH9A 1ADOA 3WFZA 2Y88A 1HJQA 3JU2A 4PL2A 3SFWA 2G95A 4ZENA 2G3IA 1LQ2A 4WQ6A 2A6NA 2RKXA 1CXHA 3ZIZA 3ONCA 1XX1A 4W85A 3AIUA 3IJ7A 1VEOA 1TQJA 2EG7A 4DXVA 5CZKA 2QVHA 4F8XA 3DEQA 4E2BA 1PUDA 1GEHA 4I7UA 4Q8NA 3F4NA 3UJEA 1C29A 4GACA 3V16A 4B92A 1I2OA 1R46A 1JQVA 2XSBA 4GZJA 5LZLA 2TYSA 3SY5A 3VVGA 1MYRA 1PDZA 4DXXA 4ERGA 3ZJ8A 1KKRA 1P7TA 4H6KA 5I0DA 4JL1A 1QAPA 4LS1A 3KOWA 4L64A 3WMCA 3G24A 1YEYA 1FDZA 3MHFA 3QH2A 1V3KA 4DJFA 3NYZA 2QUUA 1W0MA 3MV11 1TZ7A 3I6TA 2E6AA 2XSXA 2QGHA 1W3JA 1LCOA 2J62A 2WVVB 3WQ6A 1EWDA 4E3VA 1JF5A 2YX0A 5REQA 3H12A 2QCCA 3REQB 2NZLA 4CNTA 4JTDA 1ZJHA 1HUVA 3OLEA 1GORA 1ML1A 3WMBA 2CKSA 3LXCA 3SCRA 4X0NA 4DHGA 2Z25A 3PUEA 4G6CA 1J9YA 3WQPA 3N6JA 2XU2A 3RGTA 2W9MA 3HBLA 1DWHM 1EJWC 4N02A 2CCRA 3H4GA 1POKA 1QNPA 2WMIB 2E6YA 4LAOA 4NHVA 3IANA 3CU2A 4MAVA 1SR9A 2XIMA 4AUBA 4PB3A 3T1GA 4UTKA 2CZ5A 1B3ZA 3VFCA 1LL4A 3BANA 4ZGYA 3ITGA 5DBUA 4OUEA 4UWMA 5XINA 2CXEA 4ZODA 5EFDA 1OG0A 1TTQA 4LEFA 4D8LA 3LK6A 4DO7A 3BJFA 3TH6A 2FTPA 4RLIA 2ZX8A 4P7QA 2WVTA 4V2XA 2VFGA 1LROA 4N6FA 4WK9A 3RK8A 3TOPA 3EX6A 5G2WA 1FHDA 2B4GA 4Z2HA 4PRWA 4HYRA 3VOHA 2NLYA 1XKYA 4U5KA 1SO4A 1GOWA 4Z1DA 4QEHA 1OCBA 4FHAA 5IFTA 2ON3A 1QOQA 3ZYZA 1XRFA 1GK8A 4OWGA 3LU2A 4WY0F 5A2AA 3QV8A 1JCMP 4IGSA 1BSIA 2EO7A 1S1RA 2DZPA 3K8KA 5D30A 2XGIA 2DFAA 4I9JA 2FZDA 2RGLA 3TU9A 4WDTA 3GR4A 3XISA 2A4AA 4AWSA 2D3LA 3BV7A 3IV3A 4Z08A 3ALGA 2OEKA 2ZIDA 3WJYA 5FCZA 3BMWA 4DO5A 1EDTA 4HBKA 3SCWA 1EQCA 3R79A 3TAKA 4M29A 4BEUA 4C6BA 2B7PA 2PC8A 4AFYA 3W1MA 1I0DA 2ZC8A 4C7GA 3TFCA 4RV8A 4Q4KA 3RCNA 4AIUA 1FCBA 1QOPA 1YKWA 1OBAA 4EAMA 2J66A 2NX9A 1VBJA 4TVDA 2G37A 4EAYA 1CLKA 3NZ1A 1OX5A 1XV8A 3A4WA 3THDA 4O19A 1QPRA 1DWFM 4WX2A 5ABEA 4QJ3B 4A3UA 1SJBA 2P50A 1R3TA 4QG8A 3VD4A 4S3JA 3MHUA 2PODA 3S5YA 3KOZA 3PNZA 3VNLA 2CLLA 2WV8A 2WC3A 3ABZA 4PTXA 5DX7A 2PDXA 4LOCA 5CPLA 1E4NA 1SU5A 1XGDA 1V02A 3DI1A 3U6WA 4IPLA 1OFBA 3WLHA 4IG2B 3GW3A 1DQWA 3N2OA 3WK2A 4MDOA 3UXIA 3EOSA 3B06A 2A1YA 3MP5A 1ZFJA 4FF7A 4JICA 3PTQA 3ARRA 4W8AA 3VOFA 3H8AA 4MZ1A 4RR4A 6A3HA 5IOBA 4AEEA 3RO8A 3A22A 4QQ3A 3NOEA 4LRSA 3CHCA 4H8HA 4GZIA 1CBGA 3ZOAA 3KS5A 1CYGA 3V0UA 3E96A 4RUBA 3U5UA 4BFAA 3TP4A 1MZRA 2ZRUA 4KWSA 4LCSA 2OLSA 1XGZA 1L6SA 2AOSA 3W1RA 1BVZA 1UP0A 4Z1AA 1ZP3A 3XIMA 2L5HA 1ZSXA 2OPJA 1OGBA 2FPTA 5KEZA 4JY8A 4HMDA 3BMXA 5KETA 4LAUA 2QF7A 3L2LA 3P80A 1HVQA 3URNA 1HKJA 1HKMA 2OX1A 2FDSA 4P8WA 1P6BA 4GJIA 4B90A 3CIVA 2HSAA 3HG5A 5DXXA 2YKKA 3AHTA 3MUAA 4JHZA 1RA5A 3TW6A 1FY6A 1FH9A 1UD6A 3SB0A 3FS2A 4P7OA 3U2CA 5IBXC 3KCJA 4Q8WA 1HIZA 1R2RA 4JKMA 4DRSA 2GWGA 3E9AA 2NWSA 2OYKA 3KHDA 2Y5JA 1FUYA 3M16A 4LBSA 4LUTB 4Q8UA 4LY8A 1DIEA 1UMYA 1MUWA 2FLIA 1KLZA 1W5NA 4UZUA 5K2ZA 5AHNA 3S6OA 2WLYA 6PTDA 1X8CA 3BAXA 3M0YA 3W02A 1OWQA 4TX8A 1RVKA 1E0WA 1WXYA 3WLRA 2ABAA 1GHSA 5A8OA 1YPFA 3NQEA 1ECQA 2CHOA 3ZLFA 1KR1A 4J9JA 4QCEA 1OD8A 3D6NA 1CZ1A 3O15A 2QUVA 3HB9A 4DWDA 3T81A 4M6VA 5K4XA 5FJOA 2Q09A 7TAAA 3U7VA 4H2HA 3TW7A 2VRJA 1UQYA 3HV9A 3W01A 3UR7A 3QLLA 1R3SA 3LCLA 3W2KA 2Z2UA 1I45A 8TIMA 5CLTA 4AX7A 3TSMA 1FH8A 4CQAA 2IPWA 4ZO7A 8RUCA 1FWWA 1EZWA 3HPZA 4AHOA 3W23A 4YJ5A 1GQLA 3DZ1A 4OUIA 3SBFA 4MGGA 1CW2A 4QR6A 1U30A 3BLKA 5A94A 4RZ6A 5FL0A 3ZSSA 1V3JA 3WFLA 4XD6A 4WOQA 2PDFA 4Q8PA 1NM9A 3QSRA 1VR6A 5A69A 3RXZA 3R0UA 3M4HA 3SN0A 3ITXA 1A5SA 2NX3A 4QSHA 2ZX6A 3NO3A 3WLKX 2QDGA 5T9CE 3LHYA 2GGGA 4HHPA 2VNCA 4LW7A 1BAGA 1H3GA 4H8VA 4JIIX 3GH5A 4KEMA 5I3KA 1F3TA 5C55A 3W84A 5HMEA 1LJYA 1A80A 5DMNA 4WCJA 1YYAA 1GONA 4Q22A 4R53A 3W53A 3Q4DA 3WH5A 4QEEA 1GQJA 1SJCA 4LV9A 1VS1A 1DJZA 3PULA 4IX2A 5IDZA 4ES4A 3RMJA 5I78A 3OLGA 1WO2A 1TVPA 3EWXA 4MJZA 1JAEA 3VD3A 3HO8A 1RALA 3LZ3A 3JS3A 1VPXA 4PMZA 3UF9A 1L8NA 5XIAA 3LXAA 5CLWA 3LZ5A 4K37A 1RHCA 1W5QA 3H6OA 4AZ5A 3PPCA 2FYMA 1W5PA 2PCEA 3AWOA 3U7BA 2BVTA 2FGZA 3WBWA 3ORWA 4ZE5A 1MUCA 2WQDA 4OV9A 4ROQA 1RK6A 4X2PA 4YWIA 2Q01A 5HQMA 4TVCA 4GBDA 3HGOA 1ZLPA 1T96A 4LQ1A 4JY9A 5A6MA 1NH6A 1H51A 3DFTA 3T7VA 1KM2A 4LYQA 5F4XA 1GG1A 2F7FA 4CD8A 2W3ZA 2QCEA 1Q5MA 4UNLA 4ZQOA 1L6WA 4F0SA 2FKPA 1E0UA 5HNRA 2E9BA 3R10A 1SJDA 4EK7A 4MY1A 5HMDA 2IKGA 1MUMA 2VZTA 9XIAA 3NZPA 1R86A 5E93A 4IMFA 1P5BA 3KRZA 4M56A 1KBLA 4N4QA 4AD1A 8A3HA 3GFYA 3CO4A 4AYSA 4PCTA 1TMLA 1O94A 1KO0A 3H55A 4UMBA 3CBWA 3UNDA 4ZL1A 5D8WA 1GUVA 5G2HA 1E73M 1H63A 3NDYA 4O54A 3TC7A 5CGQA 2QQ6A 3L21A 1QNSA 2PI6A 1M7XA 3NIYA 1LG2A 2V5BA 3AJXA 5DF0A 2ZDRA 2EBNA 3DYMA 3SM0A 1A0EA 1LYXA 4FLOA 2EPKX 2V5KA 2FHBA 3CQJA 4AD2A 1J0YA 3WLLA 1POJA 5EMYA 3KVMA 4C6OA 4MSSA 2Q8XA 5HPOA 1KBKA 4UQDA 3G0SA 2J47A 4KF1A 4O1FA 4NNBA 1XQKA 4PE8A 5MHBA 5IXEA 1LOSA 2YBUA 2B7OA 1P0NA 4ZXLA 3U9IA 2WOQA 1US0A 1H49A 3QOMA 1TUXA 4H3DA 1X7IA 1GQKA 4NZ3A 4JTCA 3SUVA 3S42A 3G1HA 5AY7A 3ARVA 1F61A 1J8VA 4U28A 1FHUA 4CD7A 3QBUA 4EP8C 1PZ1A 3BL3A 1Q8AA 3VOIA 2EHHA 4HSOA 2WM1A 5H1WA 2V2DA 1TV8A 1OD0A 1QWKA 3BZGA 3N2TA 3CIWA 3T55A 2ZRVA 4R85A 3WK3A 2A3BA 2BVWA 1W9PA 3LI0A 5H8PA 1OC6A 1JAKA 2PRHA 3QPZA 1V0KA 1HKVA 1GTHA 3FDKA 1JRCA 3BAJA 3TQKA 3O0KA 4PCNA 4BQ5A 3OVRA 3AHVA 2GK1A 3FOKA 3VU2A 5LGXA 3HM7A 2Z2BA 3B9AA 3HN3A 4JTEA 2OX4A 1TTIA 2F9RA 4WDXA 1T7LA 3EWUA 3NQFA 4QDPA 1NDZA 3CUZA 4NJKA 3A5VA 3EMQA 3FIGA 1KGXA 3S8HA 3BGAA 5LXXA 4D6FA 5D04C 1QNQA 4OHQA 4ECLA 3C2YA 2FVLA 1XPGA 2WNWA 3H70A 3NPWA 4W93A 3CZLA 4UTUA 2YDRA 3T6CA 5JIWA 1PO9A 3QEZA 5LYRA 1UBSA 3AZTA 4J35A 3R7MA 4Q4QA 2QF8A 4IPNB 1MFUA 3W2NA 2QZRA 4ZTXA 2WSQA 4J7RA 3W7MA 1A5LC 3OVPA 2DZSA 1UA7A 1OFOA 2PBGA 1HF6A 1FFRA 2VQTA 5EPDA 4I7VA 1RK5A 4JS3A 4HU8A 1MQPA 1UYQA 1NELA 2OG9A 1UIPA 1E6NA 4C6JA 3AMGA 3VD9A 2GJNA 5I3FA 1OFRA 4V1XA 4ERAA 1NDYA 3G1FA 4C91A 1ZS2A 3RG6A 3EMZA 4O57A 3QKZA 4UTIA 4PUNA 4HD5A 3W83A 5EU9A 2Z7KA 3FHAA 4AAJA 3AAMA 4EVZA 3M0JA 3VM7A 5CCZA 2R1MA 3UT0A 1MXGA 5DLCA 4GUJA 1CXEA 2G4JA 4S3GA 2X30A 1FDYA 3FLUA 5DEZA 1UJQA 2Z1WA 4RXFA 2GSHA 1ME8A 3GKFA 5A6SA 1OVDA 4JIEA 1S3HA 1TKKA 4RW3A 2HISA 2YYTA 2J77A 5DCBA 3LCFA 1HW6A 1BXCA 4IQJA 4UXDA 4ML4A 2X7WA 3BSGA 1J0ZA 2X0YA 1ITXA 4GIYA 1PKMA 1K7EA 1UKPA 4BY3A 1AG1O 2PC4A 3GYEA 4RX0A 3LBMA 4M19A 4FNPA 3AALA 4C6PA 3B8VA 1J4EA 4J3VA 4Q7IA 1LWIA 4JOMA 3K4WA 3BURA 1GVYA 4MNLA 2PDJA 1FX6A 2WMFA 2V8ZA 2Y1HA 3USZA 4MVAA 4BA0A 2EEXA 3MP4A 2Z26A 3M5ZA 2UZ9A 3R94A 2VO5A 3GFZA 3CAQA 3L4VA 3LTYA 4Y8FA 3E38A 1B3VA 1RCXB 4LXFA 5MF5A 1R3QA 1LRTA 1E43A 3IIVA 4I8YA 3H7RA 4RZ4A 3EAUA 4UTLA 2WYSA 1T5AA 2RJHA 2C14A 1PZ3A 1IV8A 1TCDA 5FF0A 3MVIA 4K39A 3S0CA 4NY2A 1OSEA 4GNVA 4JIRA 1S3TC 1ZPTA 4PMYA 4MM1A 4WKHA 4XKMA 3EB2A 3FA4A 3BOFA 2UY3A 7ODCA 2PDKA 3WUGA 4EPBC 2GVLA 5M03A 2GWNA 3WLJA 4DUWA 5G4WA 4BHYA 1VIZA 4DO4A 3TJ4A 3L12A 5TBOA 1SYTA 3NQCA 1ISVA 2ZUVA 1IR1A 3ES7A 3SCOA 4H6RA 4GJJA 4JD4A 4YTQA 3C5QA 2YL5A 1XP3A 2OT1A 1QK0A 3A4XA 1GKRA 4KESA 1EIXA 1P0EA 4L5ZA 3S9ZA 4LF1A 1CB7B 2BTMA 4UB9A 1QNVA 1XKJA 1H1NA 1OT1A 3UXKA 1K8ZA 1JCYA 5LNWA 3I3EA 3W71A 4NASA 2VWTA 4LNYA 3EOEA 3O9NA 5L9FA 2BB0A 1Z41A 2Q6ZA 2W5FA 1XFCA 1GOOA 4RDZA 4CQBA 1DJYA 2POZA 4IH3A 1MZHA 1DXIA 4MKVA 3R58A 1W3IA 3W07A 3QSTA 3G0XA 4D8AA 4GQGA 3HA1A 5GJNA 3C0SA 2E5CA 1OX6A 4XWUA 4F9DA 5KZEA 4XIMA 3VD7A 1GYMA 5JBFA 1EXBA 4ZO8A 1D3CA 3KUMA 2E4TA 4AY8A 3EWZA 4UFHA 1Z9AA 2FQIA 3KVKA 4EANA 1IT7A 1GVIA 4OBSA 3EDDA 3INPA 1FWFC 1AW2A 4DYJA 4W86A 3TQPA 1NAL1 1CX9A 4E8DA 1EP3A 3EPMA 3MS8A 3G3DA 4HK6A 2E8ZA 1HO1A 4HNVA 4BJHA 3WQOA 1UUMA 3V7PA 3FKKA 3W1AA 3UBPC 4PTNA 1PJ9A 3UWVA 2G4FA 3H23A 1CIUA 1O7AA 3EX2A 4C5ZA 4FNQA 3TTOA 4J3XA 3T78A 1P1MA 1BGGA 2DW6A 1BFNA 3UNTA 3VGDA 1WZKA 4FOJA 4RZ5A 2Y7DA 4KS0A 1OCNA 3MA8A 5KZDA 4HNOA 1CGUA 2W62A 4GY0A 3BW2A 1PTAA 3KRBA 3UYCA 4HCDA 4NAEA 3MMDA 5CPMA 4HJFA 4HZMA 1WDRA 1WKFA 1FP9A 1DXEA 4QP0A 2YOCA 2GJXB 1EO7A 4JIHA 1R3RA 3E0LA 2CLPA 2QULA 5BXSA 3AYRA 3QFEA 4M7TA 4DBSA 4C90A 2G5WA 1E15A 2P3ZA 2BLEA 4W7WA 4MFEA 3I7RA 4AISA 1QRQA 1S2CA 3SUWA 1YE6A 1TJPA 1A5KC 4WZHA 4ZQMA 2F2KA 4F0MA 1T40A 3XINA 1ISWA 2OQHA 4XAZA 2ESCA 3UZZA 3PZMA 4AW7A 1B4KA 1W1B1 1UROA 3PB2A 2CNCA 4FS9A 5TF0A 2EJAA 5IHSA 4DBUA 2A2IA 1PHQA 2NQHA 2C19A 1Q65A 4NJIA 4AZGA 4Z1BA 4Q4RA 4FK9A 3D3FA 1S5VA 1HX0A 3TYBA 3NPXA 3LX9A 4L6HA 2O9PA 2UY2A 5HJLA 1KXVA 1V51A 1K9FA 2ZA3A 4TUFA 2XGZA 3SCSA 2FIQA 4KEZA 2PTDA 3WQ8A 1DHPA 2QIWA 2NUWA 3G0UA 1ENUA 2XPKA 4JQ4A 1UUQA 1V02E 2G3JA 4ADTA 3BLPX 4UTWC 2RJGA 1VHCA 2R1KA 1EHNA 2HBVA 2VL4A 4O16A 1TZ9A 3ZLGA 3LQLA 4Q3MA 4PMJA 3ZQ9A 3QKEA 4A05A 2WJZA 2QCFA 4E2DA 1UPMB 3AYSA 3SW6A 3TCSA 5HNNA 8XIAA 1KCZA 4N9EA 3VC5A 2I17A 3PZQA 4N2YA 1AMYA 1PX8A 1W31A 4W7VA 4UTHA 4W5UA 2AL2A 1BLIA 3WUEA 4GVGA 3GDRA 3GR7A 4EXAA 1WXJA 1QPKA 1SO3A 5KZ6A 3PTDA 1I0BA 3Q58A 1EPVA 1C91A 4D8ZA 4AD4A 1Q6QA 2GGIA 3DGBA 3FVDA 3HFYA 2TRSA 1TA3B 2DIJA 1XLDA 1HL9A 4B5SA 4ML9A 3P0WA 3EXRA 4HP5A 3S5ZA 2FH8A 3BGJA 2HVOA 1CXKA 4UOQA 5DY2A 3BXWA 4S3FA 2PDHA 1HG3A 3VOCA 3ZFHA 1ZGDA 2PDQA 4OBRA 1EUNA 2NT1A 2JBMA 3C8NA 3B9EA 5A6JA 3HQOA 3MCMA 4JFTA 2WBGA 4HOWA 1OIFA 1J01A 4US5D 5CZTA 5F4SA 5CC7A 4BR1A 4ALDA 1IR2A 1G67A 2X1TA 2X7VA 4ZQNA 1OCJA 4O10A 5HNTA 1OGSA 4LUYA 5E0KA 3P5ZA 2ZX9A 4H9XA 4H7VA 1IZJA 2DQWA 2LLEA 4PTDA 4A35A 1MEIA 1ZRQA 2JF6A 1TMQA 3U4AA 3BLEA 4JTJA 3VDGA 1Q66A 3AHZA 3K1DA 3G2GA 2QR6A 1V0LA 4MWAC 2BY3A 1QHPA 4JAWA 4R9OA 5I3HA 2V81A 2WSRA 3GIPA 3T0AA 2DVUA 2GDQA 2CWNA 4PODA 3UJ2A 2YJQA 4IIDA 1CLXA 3TAOA 4EOUA 4A8IA 1ZBWA 2QT3A 2XFYA 4PMQA 3AXHA 2VD8A 3CL7A 2NVAA 5A8MA 1AUSL 1ZJAA 3QQ1A 1KCXA 3U8GA 2O4MA 4W88A 1JUKA 1KQYA 2MANA 1TTPA 3IGSA 2IKJA 2VMFA 3HMCA 4RPQA 4M6QA 1NFBA 1FKXA 5AZ1A 2OR2A 2O0TA 4ZB0A 1NY1A 2GQAA 3BLIA 4JIPA 3V3WA 3FSTA 1B90A 2VR2A 4PB4A 1RJPA 3N12A 3RLHA 1SW7A 3FA3A 3W7RA 3KE0A 4O12A 3FEMA 2FZ8A 1HGWA 2V82A 3EDFA 5BWFA 3VE7A 4R3UA 2O9TA 4MIMA 3RO6A 4DPPA 5LIYX 2Z4GA 5FACA 3RCMA 3C61A 4I9AA 4DNHA 5C0QA 1HZYA 4HN8A 1KA9F 3HG4A 4GYPC 4LT9A 2NUYA 4RW5A 5E6ZA 1CPUA 2PGRA 3L4WA 1DE5A 4HPNA 1VF8A 3QHNA 3DHDA 4ADUA 4OTKA 3GTHA 1UQZA 4YNGA 1C8XA 3IVUA 2A85A 3CLWA 1ADDA 3LBOA 2INZA 1IEVA 1WDQA 2WMJA 3CQHA 4DLFA 2HTMA 1TV3A 1UWIA 3LM3A 1WOAA 1HVXA 2GGJA 4WR3A 5AYBA 1QI2A 4PMDA 1WZMA 5J8LA 4M6PA 1HGYA 1H5VA 4AB4A 3MJYA 1YBQB 4F2BA 1WDPA 2BOGX 2VX6A 4M5PA 4Q32A 4NNAA 3B9NA 3MMTA 2WHLA 3MI6A 4QS6A 4V27A 4LC6A 5MKGB 1XBVA 1IQ8A 4M8UA 4XUGA 1AD1A 3GM8A 2VTFA 4X22A 3GAKA 3N34A 3CIXA 3TCEA 2DH2A 4DBDA 4F9JA 1ZTVA 3GYCA 4UZSA 3DYOA 3VDCA 2PGWA 2YXXA 3O63A 1QMLA 3PZGA 4UOJA 1E72M 2YW4A 1V7YA 3EGJA 5BNKA 3VK5A 3HMJG 1T0OA 3MMUA 3HPFA 3CHFA 1TJ1A 1TPEA 3GU1A 3E1F1 4MB3A 4HTYA 2PDMA 1OC7A 1ONRA 3VUSA 4Z2KA 4KW2A 4MOZA 1VCVA 3BAYA 1GZGA 2V38A 1ZAHA 4JTIA 1W2VA 3JRKA 1MW0A 3EWYA 1OIMA 3VUPA 2Z1SA 2HZGA 2VDHA 1K70A 3B8UA 3SSJA 1T99A 2OGJA 3TNOA 4XD3A 4CN4A 1UWRA 3SUTA 3S2JA 4PUUA 5B80A 3OU8A 3APYA 1OX4B 4PYSA 4UQCA 2VT0A 1Q2RA 3UWQA 2VDGA 3QQWA 1P0BA 4ATWA 1YPIA 1DWJM 2YFNA 3DGRA 3IJDA 1TPUA 2BGQA 4MYXA 4P5UA 2I56A 3E2RA 2NSXA 2PWUA 4CD6A 5AYZA 4PCSA 3ARQA 4US5A 3VMOA 1AH4A 2FMNA 3STEA 5DELA 2GUUA 5E1QA 1UR2A 2YA1A 1GEQA 1QI5A 3I6RA 1P7TB 2QDDA 2XISA 4I3GA 4HOXA 3W73A 1F6PA 3WQEA 4DF1A 1XINA 3L4ZA 3RRXA 4GUFA 1XLAA 2ZXBA 5KSWA 1A5NC 1IF2A 2E40A 5F2IA 4DZ5A 4UFMA 1YXDA 4IHCA 3E2QA 4IGNA 3USBA 1ALDA 2Y62A 3W7KA 3LSCA 2Y61A 1HJUA 5K3VA 3N4FA 2BY1A 3HFTA 3LLFA 4R7JA 3OA3A 1K02A 1TV7A 3KAOA 1XBZA 3H2CA 4LYKA 1OQFA 1TV2A 1O1ZA 3PJWA 1LTDA 1GZ1A 4HOZA 4OJYA 3REQA 3P62A 1SR0A 2Y7FA 4N42A 5CC3A 2AQWA 3MKCA 2VEKA 2WNNA 9CGTA 2X1SA 3PM6A 3ZWTA 3WMLA 4CN6A 1MNSA 5BXPA 3U4FA 2E0PA 2C0AA 1JNDA 1WV2A 3LHVA 2J88A 3D47A 2CPUA 3TW9A 3PUGA 2DT2A 3F1QA 1ZENA 5D8ZA 1TWZA 4REQA 3CUGA 3NL5A 3CV1A 1E55A 2POTA 4NT0A 5AZ0A 1GKPA 1DJWA 3SJ3A 4DJFD 1VBGA 3ANVA 1BTCA 5D4YA 3V5FA 1UWQA 3BLLA 2R24A 1VCFA 3V5OA 2I7GA 4P8XA 3ICJA 3GHUA 1LZOA 2VGGA 2SFPA 4MLRA 4F0RA 3V4BA 1FH7A 5D03A 1R8LA 3U5YA 2ZXDA 3FVMA 1XUZA 3VNJA 3HU7A 3LNPA 1UJPA 3ZT5A 3ARSA 4BI7A 3DBPA 2XIOA 1HFBA 4KMQA 3NFUA 4HQVA 4O1DA 3NGFA 3PVFA 1DEDA 3S5NA 1Q6DA 4BS0A 2JKPA 3N1AA 3KLLA 1H7PA 2DU2A 4XTIA 2HS6A 4OGZA 4ORIA 1GOIA 5A6BA 1IXQA 2ACSA 1U2YA 4XX6A 1NWTA 5G5IA 5H2ZA 3GX9A 3L4YA 1W9XA 1E9YB 3AIVA 3AIBA 3CUXA 5K4ZA 4WXYA 1MRQA 2XIIA 2A5HA 4PMRA 4ZVJA 3ZO9A 1FKWA 3JR2A 1XRVA 3W75A 4OFCA 4OZOA 1DOSA 3NDOA 3B4UA 3F2CA 5H6HA 1DIDA 4HHHA 3A5FA 3IARA 3VCCA 3AIEA 3GVQA 3GXPA 1B9BA 2FZMA 1XF0A 1X6NA 3QYQA 2YPIA 1XYBA 5CGMA 1C8VA 1A3WA 4G1NA 3UD6A 4XB3A 4GUIA 4BEQA 1E3XA 1E71M 3SGZA 4UC5A 4LGXA 4ZFCA 1JYNA 3GRIA 1VJSA 2JIEA 4NZ1A 2CXGA 3STCA 3THUA 1QW8A 3BTNA 3PSWA 1IXNA 1V0MA 4C1LA 2DH3A 4K8HA 2J8GA 1KXTA 3LCGA 4CD4A 1JF6A 4JR5A 2V63A 3NUKA 2PGEA 2VRKA 2AKMA 3NSMA 1CWYA 1YQ2A 3BARA 1Z7AA 1XDLA 4B9YA 5DRIA 3N73A 3WEOA 1JUBA 4TX9A 2XH4A 3MV01 1W1IE 2CZDA 2TODA 3KBNA 3PF3A 4ZB2A 2Y7EA 1JULA 3G8EA 4U31A 1G01A 3AS3A 2V5LA 4XISA 2WNZA 2QUMA 3MHGA 1CDGA 1XG4A 4WJEA 5HXMA 1ESWA 3W7HA 2RHGA 3UJFA 1ISXA 3AICA 4X2RA 4NZJA 3RFAA 4ICCX 1UZ1A 3F5KA 4JQ2A 3AU6A 4DELA 1VYSX 3R0KA 1F05A 3ZM8A 3NQBA 3B97A 3UY7A 4HPHA 2XH2A 3VOGA 4ACZB 3N17A 1GVEA 2VM8A 4WOZA 3CASA 1B4EA 4AWTA 3R25A 2VZUA 2E67A 3QR1A 2V3GA 4N4PA 3OZYA 1KRCC 6ALDA 3ENLA 4Z0SA 1V5XA 3I6EA 2WZIA 4D6DA 3BLDA 1TPDA 3TWBA 2HBXA 5BRPA 1SFLA 2G50A 1AH0A 4B5TA 1UWAA 1WAUA 1XD0A 3SUSA 4IIGA 1JZ6A 2XH7A 4GC4A 1JGIA 4IT1A 5I3JA 3P8IA 2Y2WA 4BF5A 2E1DA 5ENLA 3GNXA 3VD5A 3THCA 3R4IA 1LQ0A 4KETA 2D24A 4DY1A 4PMXA 1ODZA 4IFRA 2QAFA 1MNZA 5M3WA 1XM3A 2BASA 2X2GA 4YHEA 5F2LA 1J10A 3AIRA 4LCQA 4KWVA 1UPPA 4DYKA 3M6DA 3AHYA 1Q6CA 3N2XA 3BCJA 2ZZ1A 4XQ6A 3V75A 4YMZA 1X7FA 3WK1A 3O6AA 3G6LA 4MNMA 2RAGA 3HPAA 3CAKA 2ZUWA 4H8UA 1TJ0A 2WHMA 1NF0A 2PTYA 4P7LA 1E6SM 4CEUC 3SSZA 2QW5A 4L9YA 1EJ7L 5ABFA 1WP6A 3S2MA 3W1NA 1H09A 2FFCA 1Y5VA 3I68A 3W7DA 4D6JA 2AL2B 4KEVA 1CTNA 3F5LA 5ABGA 2XG9A 1EDGA 3WLTA 4ICMA 4O4WA 2DZAA 3W38A 1XLGA 2NWRA 3IACA 3AMCA 4FNSA 1HL2A 1SFSA 2NQZA 5DBTA 4CNOA 1IEIA 1RLCL 3NO1A 5HWJA 2A3CA 3RM4A 3KOXA 5C5YA 5TQLA 2NQ5A 3UU0A 3MB9A 4IJRA 1E9ZB 3EOOA 1IEWA 3L0GA 3WDPP 3QC3A 2ACQA 5JBEA 2PFHA 3S83A 1M04A 1J0HA 4XO7A 1JNEA 3NQMA 3C8FA 3OO2A 1XIBA 3B3DA 1TZZA 2FVKA 4K7YA 2C91A 3WH7A 1ZBCA 5LSMA 1V6XA 3GLCA 4WD0A 3VIKA 5M2FX 1JEZA 4C6LA 4MFDA 2FJUB 3LHWA 1ISZA 1HO4A 1AQ0A 1OFAA 2PS2A 1KFLA 2O9RA 3WNKA 1QXLA 3LXBA 1MI3A 3MWAA 3OB8A 2TPSA 2AAMA 3W7NA 4YYCA 5JVLA 3FGCA 1UD4A 3S3GA 1KFJA 5FJIA 1OFDA 3IRDA 5C8BB 3WDHA 1B31A 4O13A 3BPWA 4E3TA 2PBOA 3PY2A 5AKQA 4HPXA 1H4PA 1GPFA 5EB8A 3CQ0A 4YS1A 3QTGA 1JYWA 3IJIA 2G3FA 2QPUA 2CLEA 2VVNA 3EWDA 3GTXA 4L56A 4HB7A 3M0XA 5C9UA 2CWXA 2WHJA 1V3HA 4FOKA 3IJQA 4EF9A 4LU0A 1U1HA 3U2EA 4NILA 1NJJA 4QHRA 1KM5A 2I16A 4BZYA 3NOYA 2GQ8A 1HJSA 3OYXA 2BDQA 3N04A 4MPQA 1UW9A 4KH2A 3BK0A 1PYFA 3IK2A 1XLCA 3KP0A 4X63A 1G7UA 5LXEA 4XUYA 1Z69A 3MANA 3T4CA 1GOMA 4JGDA 1ZB5A 3FXYA 3NM3A 5JU6A 4AX6A 3KOYA 3A23A 3DG3A 1MVYA 1EWEA 3FKRA 3L66A 5LHFA 1XIIA 5EGRA 4H1ZA 4U3AA 4CKQA 5IDIA 3IUDA 3NXFA 3TFXA 1RQBA 2J7BA 3SI9A 3A4JA 2BXVA 1EPXA 3VTRA 1QPOA 1UKQA 1KFCA 1SGJA 2YBTA 4OQVA 4HNUA 2V67A 1F6KA 1LLZA 1V6YA 2YLLA 4DWSA 3GVWA 4FR1A 3DAQA 3ERPA 1L0PA 1Z42A 1MRAA 4Y96A 1F8IA 1FA2A 3HV8A 3WQ5A 1JRBA 4GHRA 1K9DA 3WQVA 4EACA 1K7FA 4A8LA 4ATDA 4S1FA 2WW5A 1JZ8A 2J9YA 4H19A 1XI3A 1J6OA 1EA9C 4KIRA 4QE1A 1JPDX 2Q3OA 1ONWA 2Y89A 5I00A 1UH2A 1UKSA 2HCVA 1JDDA 1EJVC 3N6HA 3UWEA 2Y8KA 1GCYA 2QLYA 1JJKA 1FWEC 1U83A 1QFEA 2WO5A 5CC6A 5K9CA 3SFKA 1W1A1 1LQAA 1HJXA 1S2AA 3NZRA 1IEXA 1H50A 3UPBA 5RUBA 4JIQA 4GVIA 1YMYA 3T42A 1F2JA 5DRCA 1S2WA 4GVHA 4C65A 1E5NA 3NNTA 3B4YA 4ICNA 1EYEA 4NSBA 4M3PA 3VKBA 3PBUA 2PDBA 2C18A 1REQA 4XVEA 3KVLA 2JKAA 1JDCA 1YPXA 1VPYA 3TJXA 1J0KA 3SY1A 1KRAC 3WUBA 2GUYA 1J12A 2X1UA 3ABXA 1VH7A 4A29A 2R82A 4LUSA 1QI0A 1H0IA 2O4QA 3TUUA 4AY7A 1FVPA 2DEPA 4Y8EA 4NNCA 2IS7A 1Q85A 4FXJA 4XBJA 5BU6A 1W37A 1X38A 3TX9A 3GIQA 3BW4A 4YVPA 4CQCA 3AXMA 4U4MA 1S46A 3QY6A 1H7OA 1H41A 3EA3A 3PSVA 2A79A 1WPCA 1QDSA 3BOXA 1GOXA 2DP3A 4CNSA 4R88A 1OFPA 3NTYA 4IFKA 3OEXA 1MMFA 2XN2A 3W7GA 2R8WA 3KEHA 2QV5A 3S5OA 4HU4A 3VZZA 1L2QA 4P7NA 4V1YA 3R0DA 4XKYA 1TX0A 3M0KA 4O50A 4LUJA 4O0KA 3QHMA 2D2OA 1C8QA 3AHXA 4KIEA 2W6RA 3T07A 1FHVA 3B40A 1A0DA 1YTKA 2YA0A 2BX7A 1XLJA 3FFSA 4F66A 1H0GA 1K8XA 1KFKA 1QATA 2VEPA 4X60A 1DJHA 4B5XA 2QJMA 3ZJKA 3FYOA 2F84A 3BWWA 3WQWA 2R1NA 4MPKA 4E6MA 2VFHA 3NDZA 4CNNA 4XKYB 3TR2A 3VMNA 1OY0A 1OZMA 1LL6A 1E0TA 3C2FA 4GQ0A 4CN1A 3P5YA 5H8UA 2ISFA 4NX5A 3BGGA 2V9DA 3QZ6A 4Y6GA 1NWUA 1YXCA 3GHSA 4NVTA 4HPJA 1B30A 5C2CA 1XRTA 3LLXA 3GY1A 1OF8A 4PFMA 5FIPA 4HYWA 1NP2A 1OCQA 2PWGA 3NWRA 5CSUA 1JZ5A 2NSOA 2BWGA 3UYIA 2PF8A 3WF1A 3A12A 4IICA 3JUGA 3PPGA 2F2HA 3S1XA 4B2DD 4POCA 3DFPA 3MUIA 2EQDA 2OZ3A 4O18A 1AODA 4Z17A 4UQBA 3W7PA 3QV7A 2Z00A 4JQAA 1IT8A 4GUHA 3LPOA 1CECA 4GG9A 3T0TA 3TYZA 3VXGA 3EB3A 3QLDA 3UG3A 2IKIA 3ABSA 2HV5A 3CUIA 4H41A 3RR4A 3QOKA 3MW7A 4V33A 3DFHA 3B05A 2R1PA 3GNOA 2WAGA 3NL3A 3CL6A 4HK7A 1GVFA 3UG8A 2C1HA 1S5MA 1ADSA 3RPDA 2V30A 4EIVA 2WPBA 4OVXA 2Z7GA 3PZNA 3W74A 5K9DA 4ZR8A 2G41A 3CYJA 3PR2A 1W5OA 2DVXA 4K38A 5DQPA 4WUIA 4DBEA 3FX4A 4Y9AA 2NW0A 4J28A 2VYOA 4O52A 3NQVA 1UR9A 1EA0A 3VCRA 1CXLA 1LLOA 3O7UA 4Q8OA 4JTUA 1F8MA 2PA6A 2J7CA 1A3XA 3SCVA 5CPTA 4AZ6A 2WHKA 4PB5A 3LTPA 2QCLA 4LNCA 3GB6A 4P8VA 4UOZA 3MDUA 1CLVA 4QAWA 2Z6JA 2VUNA 4QDMA 3M0ZA 2BGNE 4B15A 3SRDA 2Q8ZA 4WY0B 3OBEA 1LL7A 4BI5A 3G1RA 1IT0A 3K5XA 4J2PA 4W5ZA 4NI3A 2JF7A 4TVUA 1TIWA 1M41A 4X3ZA 3WF3A 1BSLA 4KKXA 3RLVA 4C6IA 1A5OC 2HE8A 4LYPA 1QW7A 1XIJA 3QV6A 5GQBA 2E6DA 2A3HA 4AC7C 3ZVIA 3UWWA 4GXWA 4RKAA 3TYDA 1WAWA 1VYRA 2PDGA 2V69A 1TIMA 1XIHA 2H3DA 4MNJA 5FOOA 4CEXC 3EA1A 1TO3A 4G8TA 4UMCA 4JTAA 2JE8A 1NF7A 4AEFA 1B57A 3GXMA 5FEZA 3C2VA 4UCGA 3CUHA 2VC6A 4FSAA 3UZXA 1TV4A 1J2WA 4D1IA 1GVQA 1WDDA 3VIOA 4FP1A 3U3HA 4FF5A 1W1YA 2QUNA 3SEPA 1E4LA 1QU4A 1EC9A 1Q6EA 1PIIA 5CSYA 3UQNA 4LF2A 3LPPA 4KERA 3WL0A 3CZKA 2DZBA 2H90A 2OWCA 4JTTA 4NAFB 3BSMA 5I79A 1B3YA 1P48A 3MO4A 3UPWA 4DJDA 3S1VA 2WLZA 4Q8MA 5DMLA 2WKLA 4R7OA 4F2TA 4CCEA 1J5TA 3RU6A 4DUOA 5G2IA 4F40A 2HXTA 3VNKA 4Y9NA 5EMKA 4AVFA 5AHIA 4AD5A 3HURA 3WN6A 3VAVA 5CAKA 1B3OA 3WJZA 1IZKA 3OHMB 2C1IA 1OABA 4C5YA 5FESA 3OQ8A 3AWNA 3B8SA 3PG9A 3GIYA 3L0KA 3QGAC 6REQA 1ICPA 1FWCC 2W92A 1KWGA 2QJNA 1NOFA 2QPXA 3W2LA 4JHOA 1K4GA 1KXHA 2GVGA 2X09A 2E8YA 1VBUA 1E6QM 2OCZA 2ZYFA 1CT5A 1XLFA 3QN3A 1KFWA 3CPGA 4KBXA 1KM3A 4DJDC 4FNUA 3VIIA 2D23A 3NCOA 4HZ8A 3R43A 1ME9A 5CZJA 2DJLA 1HKWA 1RJQA 4L6DA 3M5XA 1U33A 3BO9A 1XSKA 5TD4A 1PEZA 1MFVA 2FZNA 4MMWA 1U1UA 2PUZA 1PCKA 3W7EA 1C90A 2YR1A 1JR1A 2ZUSA 2BXZA 3GDLA 3BZJA 3C52A 1U22A 6CGTA 3AU2A 2PWVA 4IPIA 4AQLA 1WYIA 2D20A 2ALRA 1G4EA 3GHRA 4C7FA 3M43A 3BDKA 1KCLA 2Z29A 4XAGA 2D0HA 3CZJA 2ISSA 4RE0A 1FWGC 5LIXX 3LUTA 1VCGA 2VC9A 3V36A 2X2YA 3NQGA 1NVMA 3HIJA 1RUSA 3KLKA 4LCRA 3UJRA 5CG7A 4B5NA 4AIBA 3OHIA 3KL0A 3K13A 4CCCA 4QFUA 1OYAA 1TX2A 1HP5A 2QNEA 4FMVA 5KMYA 1PVNA 3LSBA 4LC8A 1JGMA 3OGSA 2WCGA 3RUBL 5I2UA 4DJEA 2NVDA 1VB9A 4GYPA 3H22A 4DIAA 3VKJA 1XYFA 3SGUA 3BE7A 3E6EA 3NL6A 1EP1A 4WGHA 3GU2A 1TWDA 2OU4A 1M03A 1Q6GA 1SZEA 2CLFA 2GDVA 4F79A 4TTUA 3CZEA 1B3XA 2ZTKA 1JPMA 3OGRA 4WKFA 4DM2A 3LG3A 4S3KA 3MCOA 4C6KA 1LWJA 1I2PA 3POHA 3FW6A 2HMCA 1E6RA 3UXDA 3VDHA 3LEPA 2ZRWA 1VENA 4GKLA 5B7ZA 1LG1A 4GIAA 1DIOA 2FDMA 3W00A 1JD9A 1WCGA 4LRTA 2BODX 4A21A 1ICQA 2ACUA 3N6QA 3LS9A 1GOKA 4KCVA 3GDTA 4WXZA 2JEQA 3MCNA 4OV4A 3K4AA 2H8XA 3MPGA 4ZQCA 4Q4PA 3S9YA 3NM1A 5XIMA 3EPNA 1BQGA 5BYWA 3ECQA 2J8TA 1QBAA 1Y8BA 4JN8A 1YX1A 1EEPA 2WBKA 3POCA 3STFA 2WKJA 3QMSA 4HT3A 5HAOA 4JBRA 1IEQA 2BNJA 2WZHA 1H1ZA 1S2TA 1YRRA 1UZDA 5K9XA 2CITA 4M0XA 9RUBA 1IZCA 3PC0A 3LV5A 2IKHA 4U10A 5HUPA 2AGKA 1WB0A 5G4HC 3TLLA 1UOZA 5H8MA 3AXXA 5JH2A 1D7FA 5EKYA 5DO8A 5CZSA 3QJAA 3IGXA 2EPNA 3SGGA 3GXNA 1Z3NA 3A3HA 3VKCA 2CBVA 3TNBA 3PUOA 1G69A 2NQ9A 4FI4A 2J7FA 4JHMA 5FF2A 5JQ9A 1V6UA 3E2SA 4E8GA 5CAHA 1EJXC 1JQXA 4KFPA 3OJGA 1YNPA 4ZFMA 3O3RA 1FCVA 1GWJA 1P43A 3MBDA 1P0KA 4IP5A 1QTWA 3GNRA 3P67A 4MZ8A 3S9IA 2BHUA 4FX7A 3W1UA 1EXPA 5AYYA 1PAMA 3ATZA 1EJUC 3PZIA 1DYSA 4HCHA 2UBPC 3S2CA 1HKIA 2XM1A 4WSHA 1QOXA 1G4PA 5LKYA 1XC6A 2GDUA 3T0CA 2HPIA 4IJCA 1KTNA 1MO0A 2DSKA 4DYEA 3DUGA 3WLPA 4C1NA 3OZPA 1ITUA 2E6FA 2DT0A 1MW3A 3MC5A 4ZCWA 5EFFA 3W7QA 1JVNA 2WB5A 4QAIA 4LALA 2G3NA 3OVQA 2OMAA 3WDRA 4AY1A 1W17A 3MZNA 4E5TA 4H2CA 2DORA 2ZUMA 1YTDA 3IAPA 4L61A 3W2UA 1FQ0A 2A21A 2WKGA 2Z1KA 3LY0A 5CGTA 3Q65A 1J0JA 2PMQA 2JGYA 3CV7A 4KCWA 4KT2A 2E5DA 1GPWA 3M64A 1H62A 1Y5WA 3P81A 2WCAA 1L8PA 2A3AA 3KXQA 4D2JA 3CZ8A 4MYAA 5BXRA 2OLHA 5JMUA 1TB3A 4WIWA 1WNOA 2E25A 2MNRA 3OPSA 3LI1A 1E51A 3VGHA 5KITA 1Q6RA 1DV7A 3KWSA 4DQWA 1KNWA 3WNOA 2ZXQA 4S2BA 4QISA 1HKKA 1S2UA 2CLIA 4PRRA 3SIZA 4PULA 4AVNA 1LOQA 3U0HA 2OO0A 4MTVA 1N8FA 2PCQA 3GNPA 5KZMA 1DVJA 1O1HA 2VURA 1IXPA 2JEPA 3CNYA 4ZSTA 4Q4OA 3FHQA 3NJ3A 3M47A 4QE4A 3OG2A 3AISA 3M44A 4AYGA 2VR5A 1XLMA 1ZUAX 2F6KA 2WWDA 3BJSA 5ABHA 3T0BA 3DU0A 4GZ7A 4W9TA 1YE4A 3R8HA 2E7FA 3CWHA 5EA9A 3AC0A 3IUIA 1SFTA 3CC1A 1OHLA 3MJMA 1TYGA 4LVDA 4DNMA 1NIUA 3VGEA 1F07A 2NQLA 4F0LA 5CPNA 1DJXA 4PTVA 5HPCA 1UWSA 4MY8A 1GGOA 1ZU8A 3R13A 2WSPA 1QO2A 2CC0A 3QR3A 1X1ZA 3C6CA 2A6LA 1PIGA 1K8YA 3QZEA 4UQ9A 3SN1A 4WLCA 4AU0A 5FJPA 3WMSA 4NP7A 3ARYA 2ISDA 1CB2A 4E2OA 3OBAA 4IFKB 1OFEA 1N2VA 4JTRA 4MADA 1M1BA 2YZ5A 3UZYA 1KBIA 3R6IA 4OIFA 3ES8A 2DIEA 2MUCA 3UXLA 1NU5A 3QRHA 4FX6M 5AC6A 2GK1B 6TAAA 3VNIA 3ANYA 4X61A 4PUWA 3GXDA 4KWWA 2E3ZA 1F4HA 3W24A 3QV9A 1CXFA 4KCTA 4PSPA 4CLMA 5HANA 4FR6A 1FWSA 4FXSA 5MKGA 4WKAA 1XDJA 4QITA 4C6FA 3RJXA 2PWFA 1HJWA 3H2MA 5HWMA 3TZFA 1EO5A 1ITQA 1DBTA 2PDNA 1G94A 3SCQA 5HQLA 3WDQA 3G1VA 2A3EA 4GISA 6XIMA 4PH6A 3A4AA 2WZTA 4IP4A 5DY3A 1F7BA 5A6AA 1ECEA 2CBJA 3ELFA 3U2ZA 2BBFA 1JCLA 3V18A 4IISA 4O0ZA 3VGBA 3D5HA 4V15A 1FFQA 4JXCA 2J4GA 3HOJA 4H9VA 4GE8A 1HT6A 1WKDA 1XIFA 3IIPA 3LGGA 3AOFA 3N2CA 2XYLA 5BRQA 2FZBA 1KC7A 1X97A 2YYUA 4AHQA 3EEGA 1CI1A 4CQ8A 1JZ7A 1D9EA 4IIFA 3CZGA 1GZJA 1PZ2A 2ABBA 3O6YX 1RZMA 1L6FA 4S3CA 1VC4A 3FJ4A 2WC7A 1XLKA 2HK1A 3UJSA 1C92A 3LCXA 3WSUA 3DBNA 1A47A 2OOFA 3MUCA 3WX7A 3KWXA 1XYCA 3HZ3A 1UC4A 3TROA 1UWTA 1T8XA 3LM7A 4JEJA 3EA2A 5GNYA 1BG9A 4DM1A 4PMUA 1I2QA 1PWMA 4XZHA 4C1KA 4QJ1A 3MI2A 1G6CA 3LDVA 4LSBA 3APGA 3P8JA 3HGJA 5GNZA 1Q8JA 3EMCA 3N2MA 2G3MA 3COTA 1LWHA 2OZ8A 3FJNA 1QWGA 3L4XA 1C7SA 5J5DA 2O7SA 5C6MA 3GNDA 1M5WA 3DG6A 2VCAA 2P53A 3ARZA 4YVXA 3RR1A 2I5QA 1UBPC 2VCCA 3IVSA 1OZQA 1EL3A 1RAKA 3M0HA 4S3DA 4D1JA 5I77A 4PMNA 3THAA 4WRHA 1V03A 3L67A 5H91A 3NQ6A 5D2XA 3TXVA 5C2XA 2PEVA 2W67A 4UNIA 4BQ3A 1TTJA 1DQUA 5A8GA 3W4RA 1EHAA 1XR2A 3CB3A 1V77A 1BRLA 1ZNNA 1DIKA 3RDKA 1QPNA 1XWYA 4CUCA 1K9EA 4PTMA 2QMKA 1ZJBA 1F76A 2Z0IA 4IQLA 1UD2A 2QCNA 4GK8A 4GI9A 3GBEA 3AIQA 3QFWA 3CEUA 4PC8A 4Z2IA 2FH6A 1NSJA 3NZGA 1R3VA 4HCLA 2PAJA 2HWGA 3LQGA 3CL8A 5G1YA 1R7AA 2ZVIA 1KLYA 3TONA 1G7VA 3WL1A 1EX1A 1AJZA 4YVVA 4E38A 4MUZA 3DOPA 2D2JA 2OQLA 3KS6A 3UW6A 2FGBA 3LYEA 5F1UA 1BEUA 3STPA 1TSIA 3EWBX 4TQTA 5CC5A 3Q67A 3OODA 1W54A 3WYZA 4FB7A 2V3EA 3VABA 5ABTA 3SDOA 5LIWX 2XFFA 5J04A 4PCFA 2PE4A 3VM5A 2BVDA 3T2QA 2XWEA 3AROA 3FDGA 4KEUA 4I8DA 2YZRA 4TOQA 4HZ7A 4BWLC 1KKOA 1AZ1A 1S5WA 3GTNA 3PS7A 1FHLA 3MI3A 1J0IA 2WZMA 1JXKA 2XM2A 1SZGA 1R3WA 1C3FA 2BP1A 4Z2JA 4DJED 5CBBA 1WKEA 2PSNA 3WBXA 3T0DA 1CGYA 1R2TA 2HNEA 4GKTA 2QCDA 1A5CA 3W7IA 2F6UA 4HA0A 3CH0A 1ME7A 5BOEA 2ZXAA 3LNMA 3VO0A 4R33A 3A9BA 3YPIA 1FWIC 4QGCA 4D6HA 3R5EA 2C8NA 4XO6A 3GXFA 2B7QA 2ZZ4A 4D9PA 3O1NA 1C8YA 5FA5A 4IIBA 3CQIA 1B5TA 5EBUA 3P93A 1LBFA 3WLNA 3ISIX 1R38A 4J3TA 3UP8A 1R2SA 3KDOA 3LMZA 5FEWA 1W1TA 2J6VA 5T8GA 3P0XA 1ONXA 2ISWA 1J96A 2QMJA 3FAWA 1WXZA 1G1YA 2VFFA 1YDVA 3SECA 1BF2A 1VP5A 1A3HA 2Y0FA 3UGRA 5G1TA 3TTYA 3ZS4A 3GDBA 4EX4A 1V6VA 1YNQA 1Q4NX 3W37A 2ZA1A 3RMEA 3BG5A 1PIFA 1GVSA 1Z32X 3AS0A 4UTTC 3GG1A 2VGIA 4K1WA 2E77A 4K68A 3QPEA 4GXMA 1IIGA 2ALDA 1OEPA 1PBGA 1VBHA 3W88A 3MY9A 1HL8A 2CZEA 2YL9A 3WQGA 1V0NA 5I02A 3LGEA 4GLEA 1I9CB 1BG4A 2GGHA 4GOAA 2Y4SA 3P2VA 1TG7A 4AXKA 1LP6A 4JFUA 1U5JA 2XUCA 4E4FA 4X9YA 1XLIA 4I5RA 4RDYA 5C9WA 2VC7A 3VKAA 3NO5A 4H9ZA 3EDKA 1S1PA 3EDEA 4YWSA 2VHLA 5LNUA 3UR5A 1VHNA 2GJXA 3CO8A 1WE5A 5E0FA 3RLUA 5FEXA 5DMMA 1YHTA 5FD0A 1G5AA 3LCHA 5AVNA 3V35A 3GBDA 3SUUA 1MEHA 3VX0A 1XCXA 5JIPA 3ZLHA 5EL1A 1HXJA 1V6TA 2V3DA 4AMAA 2B0MA 1OFQA 3DECA 5JXQA 4KGLA 3ITTA 3VC6A 2VENA 2IPFA 4I9TA 3FCPA 4MNKA 4LUIA 3QVQA 5C71A 3C2OA 4D72A 4CVUA 5E0CA 2UV8G 4N9DA