2PDRA

1.7 angstrom crystal structure of the photo-excited blue-light photoreceptor vivid
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
147
structure length
147
Chain Sequence
TLYAPGGYDIMGYLIQIMNRPNPQVELGPVDTSCALILCDLKQKDTPIVYASEAFLYMTGYSNAEVLGRNCRFLQSPDGMVKPKSTRKYVDSNTINTMRKAIDRNAEVQVEVVNFKKNGQRFVNFLTMIPVRDETGEYRYSMGFQCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational switching in the fungal light sensor Vivid
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Circadian clock protein
molecule keywords Vivid PAS protein VVD
total genus 38
structure length 147
sequence length 147
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2pdrA00
2QJ7A 5HDCA 1XFNA 2VV7A 5AVFA 3IS2A 5TBMB 3HJIA 3UB6A 1D06A 5HZHA 2V0WA 3NJAA 5DJTA 5J7EA 2PD7A 3A0VA 2PDRA 2B02A 3SW1A 4MN6A 1TS7A 3E4OA 2HV1A 2PR6A 5DKLA 3GDIA 4HI4A 4HP4A 4R70A 3IS2B 4LRXC 1S66L 1P97A 2OWHA 3NOPC 4I3JA 4XT2B 5HDDA 3VE3A 2V9AA 1ODVA 1S1ZA 1TS6A 1XJ3A 2PD8A 3LYXA 3E4PA 3NOTC 2D01A 4GCZA 4HQAA 2P7JA 4GHIB 4EERA 5F6AA 2QJ5A 2QHKA 1OTBA 1N9OA 5J4EA 2V0UA 1LT0A 2Z6DA 2OWJA 4WUJA 4R3AA 5G4YA 4B9OA 3F1OA 3HJKA 2K7SA 1LSVA 1S4RA 1GSXA 1OTAA 2KDKA 3CWFA 1S67L 2JN7A 4GS9B 3VOLA 4EQ1A 4F3LB 5HWTA 1UGUA 3UB8A 2H28A 3OLOA 4HH3A 2VLGA 3F1NA 4GS9A 4HY8A 5HD3A 3UE6A 4F3LA 3A0RA 1N9LA 1V9YA 2L1MA 3KX0X 4DJ2A 1F98A 1UWNX 5TBMA 1JNUA 4HIAA 4NXBA 1OT9A 1F9IA 1T1BA 2VV6A 1XJ4A 2QKPA 2OOLA 3MJQA 3UB7A 1N9NA 2JHEA 4WF0A 1Y28A 5HWWA 1BYWA 2ZOIA 1V9ZA 3LICA 4HHDA 4M4XA 3F1OB 1P0ZA 1S4SA 3CAXA 5EFWA 5HD5A 4EESA 1KOUA 1NWZA 2KX6A 3NOUC 1D7EA 4EEUA 1T18A 3LIAA 3FC7A 3BWLA 2W0NA 3D72A 4HOIA 1T1AA 2VEAA 3LIBA 4GHIA 1MZUA 4HP9A 2PHYA 5J3WA 3UMEA 5DJUA 2D02A 2WKQA 2ZBBA 4L9EA 4MN5A 2L0WA 3BY8A 4WN5A 1LSXA 3RTYA 2QWSA 5G4ZA 1LSWA 3IBRA 2YKFA 2I9VA 3F1PA 5IU1A 5F69A 4L9FA 1DP6A 3ZQ5A 3MXQA 4I39A 4XT2A 1OTIA 3K3DA 5DKKA 3PYPA 1X0OA 2L4RA 4YWZA 3NHQA 3ULFA 4NXEA 3MQOA 4GW9A 2VV8A 3BY9A 1OJGA 3F1NB 4H6JA 5KIZA 3C2WA 3MFXA 1OTDA 3UB9A 4PKYG 4DJ3A 4E04A 4LPZA 5AVEA 2M1CA 3MQQA 4KUKA 4BBUA 2A24A 5I5LA 2YKHA 4BBVA 4KQDA 2WKPA 4WLAA 1TS0A 4WL9A 3H82A 5A8BA 3GECA 1LL8A 2PYPA 2V1BA 2WKRA 1T1CA 1T19A 2A24B 3LI8A 3MR0A 1G28A 4LRZE 4HJ3A 3EWKA 1XJ6A 3LIDA 4I3AA 1XFQA 3LUQA 3CLOA 5HDSA 1DP9A 3UMDA 1DRMA 4JGOA 2PR5A 2EA9A 4LRYC 4I3IA 3H7WA 4EEPA 1UWPX 3G6OA 3ICYA 4EXOA 2GJ3A 3FG8A 1GSVA 2R78A 3T50A 2CMNA 4PKYA 3K3CA 5F5YA 1XJ2A 4H6JB 2Z6CA 2PYRA 1WA9A 3F1PB 5HSQA 4BBTA 2W27A 3EEHA 3A0SA 4EW7A 3LIEA 4K08A 3E4QA 3H82B 3PHYA 4HJ4A 4JGRA 5IS1A 4HNBA 3RH8B 3VE4A 4JGPA 4L9GA 4HJ6A 4I5SA 4NXFA 4R38A 4HH2A 2J80A 4I38A 4JGQA 5HWVA 3C8CA 4R6LA 1TS8A 2INWA 5F68A 1DP8A 4LLOB 1OJ5A 4KUOA 3LI9A 2BASA 1VB6A 1GSWA 1OT6A 2ZOHA 3H7WB 4EETB 4NXGA 3LIFA 4RQ9A 3H9WA 3P7NA 3B33A 2V1AA 1OTEA 1EW0A 1S1YA
chains in the Genus database with same CATH superfamily
1XFNA 3IQAA 4DE3A 3LCEA 4WZ5C 5KZHA 3V39A 5HAPA 4S2IA 1GHMA 1YM1A 2EX2A 1H8MA 2QJ5A 1P9WA 4MN7A 3UY6A 3N4IA 4JF6A 4OPRA 2PRFA 4CJNA 3EOIA 1U60A 1S67L 1KE3A 2ZC6B 3KSGA 4Q0JA 1K57C 1AXBA 4GS9A 4EBNA 1Q2PA 1H0MA 1N9LA 4WMCD 3BLMA 3T1XA 2HJ9C 1N9NA 1XA1A 2H0TA 4WELA 1NWZA 2XLNA 3D72A 2LB5A 3LR4A 5DF9A 3GMWA 3T1RA 5F69A 2J8YA 5EPHA 1CQAA 2DNSA 3NHQA 5IHVA 3G32A 3JPUA 3VFHA 4ZBEA 4DMZA 5AVEA 1LI9A 2M1CA 1ZHHB 4Q0HA 1TS0A 4CPKA 2WKRA 2WKEA 3LIDA 4I3AA 3DTMA 3LY3A 4FSFA 3PAEA 3FPVA 2Z2MB 1YQSA 3W2ZA 3IT9A 3CJMA 5GLCA 4WEKA 3EEHA 4JKTA 3BM6A 1CJFA 4BJPA 3HREA 4LCLA 5U47A 2X01A 1K0KA 4S2NA 4EETB 3FKWA 5HZHA 3KSIA 1FCMA 4OOMA 2V0WA 2ZMAA 3A0VA 2PR6A 3T1QB 3NDEA 1K54A 1J9MA 4X69A 5EVIB 4C3QA 2DCFA 4P6BA 4JXWA 3BQAA 3ZG8B 4X53A 1CF0A 2ZQ9A 2P9VB 4ZDXA 5L09A 4GB7A 2QYBA 4BQMA 5CEBA 5HARA 1I2SA 4QPRA 2Y2PA 4P87A 1ESIA 3KYEA 5E2EA 4F94A 3HLBA 4KZ6A 4B4ZA 1F98A 1A0KA 3T4LA 2ZOIA 5C5KA 2DRWA 3OBFA 3LIAA 3UMEA 3FWLA 4MN5A 2YKFA 1MPLA 1MWSA 4L9FA 2KLIA 3AGDA 5DKKA 1OJGA 3NDGA 1KGGA 3C2WA 3P09A 1YMXA 2O0YA 2YKHA 1S6RA 2PYPA 5F83A 1MC0A 4EU0A 1BLCA 2PR5A 4JF4A 3G6OA 1RP5A 4FCFA 5F5YA 4UHUA 5HSQA 5FL3A 5CGSA 1W79A 3KYZA 3CHWP 4KZ8A 1YLYA 4IHQA 3H7WB 3LR5A 5MC7A 1NYMA 3B33A 2WKHA 4OQIA 4RX2A 1RCJA 4XUZA 1K6RA 3MZFA 3SW1A 4QB8A 4MEZA 3IF5A 3HLFA 1ZG6A 1JWZA 1S1ZA 3LYXA 4K91A 3QNCA 2PU4A 2ZM8A 2BG1A 1Y4OA 2Z6DA 5EOOA 4UQIS 1CEFA 2RL3A 2QMIA 2EFXA 1YAXA 5HWTA 4C6YA 3R7WA 2XF3A 1BULA 3DTEA 3BRMA 3LY4A 3OPHA 4D2OA 3SH7A 2OOLA 3SS5A 4MBKA 3CMZA 1QMFA 1KDWA 3BWLA 3C38A 5J3WA 3UPNA 2A2LA 3RTYA 4LENA 3IBRA 4IBXA 5M19A 2G7UA 1BLHA 4E3MA 1OTDA 2JKRM 1L0GA 3T4KA 2GX5A 3VFFA 1BTLA 3UPOA 5EUAA 5FI7A 2G2WA 3HLGA 2PBDP 2ZQDA 4BD1A 2R9WA 3T50A 3DTIA 4PKYA 3CZDA 4EBLA 4OLDA 1HTZA 4BBTA 3IXDA 2JKTI 5AQBA 2V8FA 5EE8A 3ZNYA 4JGPA 4HJ6A 1ALQA 3DWZA 3MZEA 3SH9A 2Y59A 4HEFA 4KZ4A 3MSHA 3Q1FA 5TBMB 4NG2A 1VQQA 3GRJA 3OOVA 4MDZA 2VGJA 3M6HA 1S66L 3NOPC 2Y2KA 3IX8A 3UB5P 4G3KA 4FUWA 1N9OA 3SS4A 3T4SA 4R3AA 4B9OA 2XD5A 2ZM2A 1MWRA 2PT7A 2XDMA 1HLUP 4HY8A 3A3IA 4F3LA 3O86A 3ZGAB 2BTFP 3MKFA 4QY6A 1H8ZA 4QJGA 5TBMA 1UWNX 3B47A 4NXBA 3HL9A 2JHEA 3JVVA 1YLTA 5EFWA 5HPFA 1OMEA 4HOIA 4DN0A 2HZ5A 2PHYA 2WKQA 3MQ0A 2FFYA 3IWQA 3JYIA 4WN5A 1LL9A 2DMWA 1XKZA 1SDNA 3IXBA 4MMNA 4Q0IA 4DJ3A 4ETZA 2PBYA 5CXWA 2CC1A 3OPRA 3QP4A 3V67A 4KENB 4H8RA 1GA9A 1W63M 4OPYA 4KQOA 3O88A 3HVFA 2EA9A 4OQ0A 2J9PA 4X1LA 1LL5A 4LV0A 3SH8A 4P6ZS 5FI6A 3K3CA 4EWFA 3PR6A 1XJ2A 4H6JB 2Z6CA 1Q2QA 4QY5A 3ITAA 3T12B 4EW7A 1MWTA 3GR2A 3RH8B 2Y79A 4NXFA 1PI4A 1TVFA 3SS3A 4EUZA 3C8CA 5F82A 1DP8A 1GCEA 4QU3A 1PZOA 3H9WA 2V1AA 4GW9A 1W8YA 3TJZC 4N92A 1N4OA 1H5XA 3G35A 1EWZA 2B02A 4IBRA 3GDIA 5FA7A 4FH4A 3T1SA 4XT2B 1SCWA 3AGEA 5J8XA 2WKIA 1PYYA 3NCKA 2Q9NA 4N1HA 2Y2HA 1VETA 4GS9B 4NKPA 2A49A 3HLDA 3SOIA 3UE6A 5G18A 3VP0A 1KE0A 1K54C 1SZVA 2L1MA 3HUNA 4ZRRA 2J9OA 1K6SA 1V9ZA 4ZJ3A 3IWIA 5BOHA 4PM8A 5FQIA 4E3JA 2AVXA 1YPRA 2D02A 3VP4A 2EX8A 3CPTB 3PBOA 3VSKA 3QP2A 1LSWA 4X68A 2W3DA 4KQRA 2VGLS 4EUVA 3MXSA 4YWZA 4NXEA 3MQOA 1YT4A 3IXGA 5TR7A 4YFMA 1IOUA 2OAP1 3LO7A 1LL8A 2ZQ8A 1SKFA 1D1JA 2VK3A 4E3NA 3TRCA 3LEQA 3NBLA 1H8YA 3A3DA 2Y8HA 5FATA 4DRTA 1IYQA 4QWOA 2QPNA 3WWXA 4JLFA 4JBFA 5CRFA 4R38A 2J3TD 2W1RA 4GOGA 1AWIA 5E2FA 5JYOA 1OTEA 4H6JA 1EW0A 3RFBA 2O9CA 1FCNA 1L0FA 5DJTA 2X02A 4MN6A 1SDEA 3GV9A 3IS2B 1P97A 3PBQA 2VJWA 2PD8A 2A3UA 4GJ4A 1G6OA 5AQAA 3E2KA 3LEZA 1XGJA 3VP2A 3UE3A 2K7SA 2KDKA 5DTTA 1KGFA 5HD3A 4BWIA 4GD6A 1OT9A 2H10A 3IX4A 4KZAA 5FAOA 5GL9A 1PWCA 3F1OB 2B95A 2VEAA 1XPBA 4GHIA 4LFUA 4Q8IA 4L9EA 4M3KA 5G4ZA 3MXQA 4Y0UA 2WUQA 3BY9A 1E25A 4OP5A 3HBRA 3MQQA 3A3EA 2EXAA 4BBVA 3M6BA 2J7VA 3GECA 3ZG7B 4LRZE 2ZQAA 2Y2JA 2OSUA 1MBLA 1UWPX 1PWGA 3FG8A 2W1TB 3BFFA 4S2JA 2O9AA 4MLLA 3F1PB 2V8CA 1HVBA 5CX7A 5GLBA 4HH2A 2J80A 4I38A 3ZVWA 5FQQA 5FAPA 4Y17A 1LLBA 4RQ9A 2QJ7A 5AVFA 2XSSA 4ZJ2A 1M6KA 1RGYA 4Y2FA 2HV1A 5HDDA 1CK3A 3ITBA 3CG5A 3WS0A 2JKFA 3E4PA 3NOTC 1PW1A 3S7OA 4GHIB 4EERA 1IELA 5HAIA 4ARZB 3F1OA 1F2KA 1XXMA 1BSGA 2HF6A 2VA0A 3G2YA 3BLSA 4O7DA 3A0RA 4KZ5A 5FEFA 4AFIA 1G6AA 3HLWA 2EFUA 3KYQA 3UE0A 2G2UA 1TF1A 5HD5A 1S4SA 4R0QA 4WZ5A 1D7EA 1EROA 1BUEA 2JC7A 2ZMFA 2W3GA 2W0NA 2C6WB 1T1AA 3LIBA 4U0XA 1MZUA 1ESUA 5KMWA 2JCHA 3F1PA 2Y55A 1DP6A 3ZQ5A 4I39A 3O3VA 3Q7ZA 4HBTA 3ZDJA 4CLCE 1X0OA 3BFCA 3EEAA 1ES5A 4BD0A 2NUPC 4KG2A 4CLCB 2B5RA 2EX6A 3DWKA 4LPZA 4X56A 3LR0A 5I5LA 3N6IA 4WLAA 4ME4A 1T19A 5K5BA 3LUQA 3N8RA 2ZMVA 3H7WA 2H5SA 4EEPA 5KSHA 1FILA 2XR0A 4OPQA 4OOYA 3V5MA 1Z09A 4XUXA 3EQUA 3NULA 5CHMA 3G30A 1PWDA 3AGFA 2WADA 3VOYA 2XK1A 1IYOA 3LIFA 3P01A 2ZM0A 4OH0A 2Y2OA 2X71A 4JXSA 1YKDA 1STZA 4FOFA 1JTGA 1TS7A 3E4OA 4N1XA 4JPMA 3B42A 4EBPA 3S7QA 3PBTA 5EM1A 4YNRA 3NECA 1NZUA 1GSXA 3VOLA 1GHIA 4MBFA 2WAFA 3TE8A 4IEDA 1KGEA 3CPTA 4DXCA 3KX0X 3UE1A 2ZL1B 3W8KA 3FV7A 2WGVA 1IYPA 4EESA 4EEUA 3G31A 1PZPA 3MS6A 4R3JA 1W63Q 2ZBBA 3ZHHA 4O0PA 5EVIC 5L10A 2J3TC 2JKRI 3K3DA 4E3LA 5DTSA 4LV1A 1EI5A 2ZQCA 5CERA 1CI9A 2HDSA 3HUOA 4Y0OA 4IUKA 4N9KA 3LI8A 2A24B 1N9BA 4HJ3A 5HDSA 4I3IA 5DVAA 5GHYA 4ZTKA 1F5MA 3RXWA 4DE1A 4OOLA 4GDBA 4BL2A 5M18A 3PBNA 3N8LA 4HNBA 4DF6A 5DF7A 2Q0OA 4R6LA 3BQ8A 4NXGA 3VOZA 1G5UA 5F1FA 1E3UA 4RYEA 1P9RA 3NJAA 3MF0A 1IYSA 4PPRA 4G3WA 4HI4A 5TGFA 4X55A 2ZLYA 4BL3A 2FH5A 2IA2A 4X1MA 5CGXA 1ZKJA 1JTDA 1FCOA 3FKVA 1K4EA 4GZBA 5HX9A 2JKGA 1ZG4A 3IF6B 4E3KA 2HP6A 2JN7A 4U0TA 1NLZA 3NY4A 2QKPA 3UB7A 2O99A 4OONA 5EOEA 2V1ZA 3MMHA 1DJBA 3QNBA 3G2ZA 3WS5A 1SKOA 3U4LP 5CHUA 4LGWA 4GD8A 2XRNA 1RGZA 1PRQA 5IT5A 3UB9A 3ZG5A 5DFYA 5DF8A 4ESPA 4MCWA 2V1BA 3IH9A 4KQQA 1XJ6A 4JGOA 3MXRA 2KOIA 3VMAA 4K0XA 2CMNA 2WGWA 3E0YA 2Y2QA 1ES4A 4PM6A 4L0LA 3E4QA 2XA7S 4RVAA 2WYXA 4I5SA 1LI0A 2VGKA 3UPPA 2ZC7A 3KSFA 3LI9A 2ZOHA 4PHTA 5EVEA 3UB6A 4DE0A 2PD7A 1PFLA 1K38A 2HGVA 2OWHA 5CECA 3C4OA 3BEBA 3C7VA 1WYCA 2D01A 4OKPA 2V20A 5L07A 2PU2A 2OWJA 3Q07A 3QP6A 5FQKA 3GQZA 3ZYTA 4UA9A 2ACGA 3HLCA 1LHYA 2B18A 4P85A 4KZ7A 3ZG9B 3PAGA 3LGOA 1Y28A 1PW8A 4M4XA 5A92A 3O5YA 2Y2NA 4Y3IA 2WZZA 4HP9A 3C30A 1XGIA 2JE5A 3ZVTA 3TG9A 1IFQA 3C7UA 1NYYA 4ZJ1A 4WL9A 3Q82A 3UNWA 3UO9A 4YINA 1G28A 5EM0A 1XFQA 1BT5A 1C3BA 3UMDA 4IJGA 3RJUA 1ACFA 2WK0A 3ISGA 3CUEA 1ONHA 1FSWA 3S7PA 2ZJ9A 1W8QA 1WA9A 3EGXC 1GA0A 1NZOA 3BYDA 3H82B 3U2AA 1DY6A 2Y2IA 1YSQA 1BLPA 3HCYA 5DFXA 1TS8A 4LLOB 4KUOA 5HAQA 1Z6FA 5TJJA 5GLAA 1BLSA 2XD1A 4B4XA 5AJGA 4ZAMA 3BJNA 2W3EA 4GCZA 3CUEC 2XEPA 5F6AA 3Q7VA 5J4EA 2BLSA 1HZOA 1OTAA 1NRJA 2C5WB 3OLOA 2HPBA 2P08A 1YLWA 3EQVA 2ZD8A 4HIAA 4S2NC 2XFSA 1I2WA 1NRFA 4C75A 4HHDA 4E3IA 1G68A 4O8GA 1FIKA 2Y91A 1HD8A 5DJUA 4S2OA 4ARZA 1MKMA 1Y54A 4XT2A 2M7UA 4WM9A 1WE4A 2OLVA 4JXGA 1OPXA 3H82A 1WYBA 1MY8A 1PNEA 5A93A 5HFOA 4Y7PA 2GJ3A 1GSVA 2OV5A 4X25A 3WS2A 2QZ6A 2WGIA 3D9YA 2IWBA 5A91A 3A0SA 3E98A 5FQMA 1IKIA 5IS1A 3VE4A 5I94A 1BZAA 3GVBA 2ZC3B 3KSHA 3ZCZA 1SKOB 5AQ7A 5HDCA 3W4OA 3LFVA 4PM9A 4UA7A 2W3FA 4GKUA 4LRXC 1KVLA 2P9VA 3VV4A 1TS6A 4BMWA 3K2NA 1L0EA 5E2GA 1OTBA 3E2LA 3D4FA 4S2KA 1VEUA 3DTKA 3G34A 3IHAA 4F3LB 5E43A 2EWWA 2VLGA 3FZCA 3IXHA 2VKSA 3L7HA 2NUTC 1PI5A 1T1BA 3CI6A 3MJQA 1BYWA 5CHJA 3MFDA 1KOUA 2XGNA 5L8MA 3N8SA 4A5RA 4IVIA 5IU1A 3DBAA 2PAVP 3P98A 1IKGA 5KIZA 3T4QA 3IBJA 4BBUA 2P74A 2K2NA 5TFQA 4ETXA 2UWXA 2ZL1A 2HDRA 1GHPA 4EXOA 1YLJA 1ZC2A 3HUMA 1I5QA 3R4KA 5LBRA 5GLDA 1VETB 1CI8A 2EXBA 2W27A 3MZDA 2W1TA 4K0WA 1NXYA 2HP9A 3PXPA 5HWVA 2LB9A 5JYPA 1VHMA 1JVJA 1YMSA 3MKEA 4X6TA 3RXXA 1VB6A 3DAVA 1GSWA 2P04A 2K31A 1K56A 3A3JA 4ID4A 4FD8A 3OCNA 1TEMA 4GN2A 4HP4A 4R70A 3S7NA 3QHYA 4Y13A 3VE3A 4I3JA 3QP5A 3JVUA 3V50A 4HESA 2P7JA 3NC8A 4NK3A 4OQHA 4E6WA 3TOIA 1LT0A 4FTXA 5G4YA 1K55A 2EX9A 5FSRA 4P6ZM 3UB8A 5GHXA 4R23A 1K4FA 4HH3A 5F1GA 4WYYA 4WMCA 1K25A 1ZTUA 1TDLA 4JF5A 3UN7A 2Y2LA 4DJ2A 4UA6A 1XJ4A 3ZFZA 3C5AA 3WS4A 4CLCC 2XA7M 3TSGA 3NOUC 1XX2A 1E4DA 2L0WA 3BY8A 3DW0A 1KE4A 1LSXA 3LR3A 3OCLA 2GDNA 4OQGA 3B3XA 3UDIA 3PBSA 4HBUA 3ULFA 1SHVA 4RA7A 2O9BA 4Z9QA 1JWPA 2IWCA 4Z1WA 4OLGA 4QHCA 2WKPA 4KZBA 1S0WA 4QD4A 3EWKA 1DJAA 1NLYA 3CITA 3G4PA 4RX3A 1E3UD 3ICYA 2HJEA 4D60A 2R78A 2FZ0A 4UQIM 1QMEA 4PMAA 3VP1A 4KZ3A 3PTEA 3TW8A 2HDQA 1DJCA 1W7FA 2Y4AA 5HW3A 3NIAA 1FQGA 3LIEA 2MJ6A 2I72A 1NJ4A 1YLZA 1YSPA 1KDSA 4R4RA 3M2JA 2BASA 1ES3A 3OZHA 3Q7VB 2ZC4B 5J7EA 5DKLA 4WZ4A 4Y0TA 1ODVA 4B88A 4WBGA 5EECA 1FSYA 4DXBA 4DDYA 3EGDC 2QHKA 2GZAA 4UEYA 2RCXA 3IX3A 5FQJA 3S22A 3WRTA 2Y2MA 3OPPA 1UGUA 3WS1A 2ZC5B 2JBFA 1V9YA 2GNXA 1H3QA 5CTNA 5HL6A 4BLMA 3BFEA 5HWWA 3LICA 3FYZA 4KG5A 2KX6A 4YOFA 3VSLA 1T18A 5HPIA 3T4JA 4CLCD 1M40A 4G3VA 2V2FF 4N9LA 4U3TA 4PM7A 3IWOA 3PYPA 3QP8A 5FASA 2VV8A 4II7A 3F1NB 4Y5FA 4Y15A 4KUKA 2VGLM 4KQDA 4CQHA 5FI2A 3GTCA 3S1YA 4LRYC 2EWVA 3BFDA 4KZ9A 3M2KA 5D3OA 2PYRA 3FPWA 3R7WB 4EQIA 4S2LA 4JGRA 2XQZA 4L9GA 2JKTM 5CTMA 2WAEA 3N7WA 2XFTA 3I7JA 2HDUA 4MNRA 4XXRA 1S1YA 4S2MA 2VV7A 4WEJA 3HJIA 4O01A 2UV0E 3W4PA 2PDRA 1FR1A 2Z2LB 4PAUA 3W4QA 5FDHA 3IF6A 4HQAA 3V3RA 3NI9A 1L0DA 4IVKA 2V0UA 4OP8A 5AQ9A 4WUJA 3O87A 4NEED 1W5DA 4GDNA 3OPLA 3CWFA 3IHBA 4EQ1A 2FFFB 2R9XA 1MXOA 3F1NA 3KO6A 2ZQ7A 3D3OA 3GSGA 1JNUA 1KVMA 2VV6A 1F9IA 5EVID 3C4PA 4LV3A 2E8IA 3MBZA 1P0ZA 3CAXA 3HLEA 1FOFA 4R3BA 1L3LA 2QWSA 5KSCA 3IF6C 3SZTA 3UDXA 4LV2A 3L9KA 1FR6A 4PM5A 3MFXA 5FDSA 1J3WA 5A90A 3T4TA 2XH9A 1TD5A 1NY0A 4DE2A 5A8BA 4E6XA 4OVDA 3MR0A 1PIOA 3CLOA 1DP9A 1DRMA 4EV4A 1YLPA 2WZXA 1MWUA 3T4OA 3ZG0A 2WGWB 4K08A 2XROA 2OLUA 2HP5A 2INWA 3OC2A 1CEGA 5GHZA 1IEMA 3IS2A 1D06A 4CLCA 4DDSA 5L2FA 4KG6A 5DTKA 1XP4A 5E2HA 4GLQA 1JWVA 2V9AA 1XJ3A 2H0YA 3UDFA 2VZWA 1ONGA 4DKIA 5M1AA 4FH2A 1K55C 4JXVA 3HJKA 4UAAA 2W3HA 1LSVA 1S4RA 1MKIA 2Q9MA 1TDGA 2H28A 2J3WA 3A3FA 4NETA 5EVLA 4E3OA 4LCMA 4R1GA 4WF0A 1XA7A 5FEGA 4R4SA 3FC7A 1O7EA 2I9VA 1ERQA 1VEUB 5FQ9A 3BW6A 5EV0A 1OTIA 3PBRA 1ERMA 2L4RA 3BFGA 2M7VA 5CEDA 1VM1A 2OAQ1 4E04A 3WRZA 4PKYG 2A24A 4GNUA 4B93A 2VX8A 2Y2GA 4P0MA 1T1CA 5CGWA 4MBHA 3S4XA 4BENA 3V3SA 5FAQA 1ES2A 4S2PA 3Q81A 4IUHA 3BECA 3PHYA 4HJ4A 3ZNTA 1O07A 2E8JA 1K57A 1L2SA 3IH8A 5EVIA 2IWDA 4JGQA 5F68A 4OPZA 1OT6A 3QP1A 3VP3A 3P7NA 5HL1A 1OJ5A 1K56D
chains in the Genus database with same CATH topology
1XFNA 3TJZC 3OCNA 1P9RA 3NJAA 3MF0A 2B02A 4G3WA 3GDIA 4HI4A 4HP4A 4R70A 3S7NA 3VE3A 4I3JA 4XT2B 3JVUA 2FH5A 2IA2A 2P7JA 1H8MA 2QJ5A 1P9WA 4MN7A 1LT0A 5G4YA 3EOIA 4GS9B 1S67L 2JN7A 4NKPA 4P6ZM 1NLZA 3UB8A 3KSGA 4Q0JA 4HH3A 3UE6A 4GS9A 1ZTUA 1N9LA 2L1MA 4DJ2A 2HJ9C 1XJ4A 2QKPA 4ZRRA 3UB7A 1N9NA 2O99A 1V9ZA 3MMHA 4CLCC 2XA7M 4WELA 1NWZA 3NOUC 3D72A 2LB5A 3LR4A 5DF9A 2D02A 2L0WA 3BY8A 3PBOA 1LSXA 1LSWA 3LR3A 3OCLA 5F69A 2W3DA 2VGLS 2XRNA 3PBSA 4EUVA 4YWZA 3NHQA 3ULFA 4NXEA 3MQOA 5IT5A 2O9BA 4Z1WA 1IOUA 3UB9A 4DMZA 2OAP1 5AVEA 5DFYA 2M1CA 1ZHHB 4MCWA 2WKPA 4Q0HA 1TS0A 1LL8A 2V1BA 2WKRA 3EWKA 1XJ6A 3LIDA 4I3AA 1NLYA 3CITA 3TRCA 4FSFA 4JGOA 3ICYA 2KOIA 2HJEA 2R78A 2FZ0A 2Y8HA 2CMNA 4UQIM 3FPVA 3E0YA 3W2ZA 3TW8A 4WEKA 3EEHA 3LIEA 4L0LA 4BJPA 2MJ6A 3E4QA 1YSPA 2XA7S 4I5SA 4R38A 2J3TD 2W1RA 3KSFA 3LI9A 2BASA 2ZOHA 4PHTA 4EETB 1OTEA 4H6JA 1EW0A 3RFBA 5HZHA 3KSIA 3UB6A 2O9CA 4OOMA 2V0WA 5DJTA 5J7EA 2PD7A 3A0VA 4MN6A 2PR6A 2HGVA 5DKLA 3IS2B 2OWHA 1P97A 3PBQA 2VJWA 1ODVA 2PD8A 3BQAA 2D01A 4GJ4A 1G6OA 3EGDC 2QHKA 2GZAA 2OWJA 4UEYA 2QYBA 3UE3A 4QPRA 2K7SA 2KDKA 3ZYTA 1UGUA 2B18A 5HD3A 4BWIA 1V9YA 2GNXA 1H3QA 5HL6A 1F98A 1OT9A 3T4LA 1Y28A 5HWWA 2ZOIA 3LICA 4M4XA 3O5YA 5C5KA 3F1OB 4Y3IA 3OBFA 2KX6A 4YOFA 1T18A 3LIAA 5HPIA 2VEAA 4GHIA 3C30A 4HP9A 3T4JA 3UMEA 4CLCD 4L9EA 4MN5A 5G4ZA 2YKFA 4G3VA 4L9FA 2KLIA 3MXQA 5DKKA 3PYPA 2VV8A 3BY9A 4II7A 1OJGA 3F1NB 1IFQA 3C2WA 4Y5FA 2O0YA 3MQQA 4KUKA 2VGLM 2YKHA 4BBVA 4KQDA 4CQHA 4WL9A 3GECA 2PYPA 4LRZE 1G28A 1XFQA 1MC0A 3UMDA 4IJGA 4EU0A 2PR5A 4LRYC 2EWVA 1UWPX 3CUEA 3G6OA 3FG8A 2W1TB 3S7PA 2O9AA 5F5YA 2PYRA 1WA9A 3F1PB 3FPWA 3EGXC 5HSQA 5FL3A 3KYZA 3R7WB 3H82B 4JGRA 5CX7A 3U2AA 1YSQA 4L9GA 3HCYA 4IHQA 5DFXA 4HH2A 2J80A 4I38A 2JKTM 1TS8A 4LLOB 4KUOA 3H7WB 3LR5A 5MC7A 4RQ9A 3B33A 5TJJA 1S1YA 2QJ7A 2VV7A 5AVFA 4WEJA 2XSSA 3HJIA 4O01A 3SW1A 2PDRA 4Y2FA 5AJGA 2HV1A 4PAUA 5HDDA 3BJNA 1S1ZA 3LYXA 2W3EA 3E4PA 3NOTC 4GCZA 4HQAA 3S7OA 3CUEC 4GHIB 4EERA 5F6AA 5J4EA 2V0UA 2Z6DA 4ARZB 4UQIS 4WUJA 4NEED 3F1OA 3CWFA 1OTAA 4EQ1A 1YAXA 1NRJA 5HWTA 2HF6A 2VA0A 3OLOA 3R7WA 2P08A 3F1NA 3KO6A 3D3OA 3EQVA 3A0RA 4AFIA 1JNUA 4HIAA 2VV6A 1F9IA 2OOLA 3KYQA 1TF1A 4HHDA 1P0ZA 1S4SA 3CAXA 5HD5A 4O8GA 1D7EA 2ZMFA 2W3GA 2W0NA 3BWLA 3C38A 1T1AA 3LIBA 5J3WA 1MZUA 5DJUA 2A2LA 3RTYA 2QWSA 3IBRA 4ARZA 1MKMA 3F1PA 1DP6A 3ZQ5A 4I39A 4XT2A 4CLCE 1X0OA 3EEAA 2M7UA 2NUPC 4CLCB 2G7UA 3MFXA 1OTDA 2JKRM 4LPZA 3T4TA 3LR0A 3T4KA 5I5LA 2GX5A 1OPXA 1TD5A 4WLAA 5A8BA 3H82A 4ME4A 1T19A 3MR0A 5K5BA 3LUQA 3CLOA 1DP9A 1DRMA 2ZMVA 3H7WA 4EEPA 5KSHA 2GJ3A 3T50A 1GSVA 4PKYA 3T4OA 4BBTA 2JKTI 3A0SA 3E98A 4K08A 2XROA 3EQUA 5IS1A 3VE4A 4JGPA 4HJ6A 2INWA 3KSHA 3OC2A 3LIFA 3P01A 5HDCA 3IS2A 5TBMB 1D06A 4CLCA 3LFVA 1YKDA 1STZA 4FOFA 1TS7A 3E4OA 3OOVA 4MDZA 2W3FA 4LRXC 1S66L 3NOPC 3VV4A 3B42A 4GLQA 2V9AA 1TS6A 1XJ3A 4BMWA 3K2NA 2VZWA 4G3KA 3S7QA 1OTBA 1N9OA 3PBTA 3T4SA 4R3AA 4YNRA 4B9OA 3HJKA 2W3HA 1LSVA 1S4RA 1GSXA 4F3LB 2PT7A 3VOLA 2EWWA 2H28A 2J3WA 2VLGA 4HY8A 3TE8A 4F3LA 2VKSA 2NUTC 3KX0X 5TBMA 1UWNX 3B47A 4NXBA 1T1BA 3CI6A 3MJQA 2JHEA 4WF0A 1BYWA 3JVVA 5EFWA 4EESA 1KOUA 5L8MA 5HPFA 4EEUA 3FC7A 4HOIA 4DN0A 2PHYA 2WKQA 3MQ0A 1W63Q 2ZBBA 4WN5A 2DMWA 4O0PA 2I9VA 5IU1A 3DBAA 3BW6A 1OTIA 2J3TC 2JKRI 3K3DA 3PBRA 2L4RA 2M7VA 4MMNA 4Q0IA 5KIZA 2OAQ1 3T4QA 4DJ3A 4E04A 4PKYG 4ETZA 3IBJA 4BBUA 2A24A 2K2NA 4IUKA 4ETXA 4B93A 2VX8A 1T1CA 3LI8A 2A24B 3V67A 4HJ3A 1W63M 5HDSA 4KQOA 2EA9A 4I3IA 4EXOA 4P6ZS 3R4KA 1F5MA 3K3CA 3PR6A 5LBRA 1XJ2A 4H6JB 4OOLA 2Z6CA 2W27A 4IUHA 2W1TA 4EW7A 3PBNA 3PHYA 4HJ4A 3PXPA 4HNBA 3RH8B 2Y79A 4NXFA 5HWVA 2LB9A 4JGQA 1VHMA 3C8CA 4R6LA 3BQ8A 5F68A 1DP8A 1VB6A 1GSWA 1OT6A 2P04A 4NXGA 3H9WA 3P7NA 2K31A 2V1AA 1OJ5A 4GW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QJ7 A;  5HDC A;  1XFN A;  2VV7 A;  5AVF A;  3IS2 A;  5TBM B;  3HJI A;  3UB6 A;  1D06 A;  5HZH A;  2V0W A;  3NJA A;  5DJT A;  5J7E A;  2PD7 A;  3A0V A;  2PDR A;  2B02 A;  3SW1 A;  4MN6 A;  1TS7 A;  3E4O A;  2HV1 A;  2PR6 A;  5DKL A;  3GDI A;  4HI4 A;  4HP4 A;  4R70 A;  3IS2 B;  4LRX C;  1S66 L;  1P97 A;  2OWH A;  3NOP C;  4I3J A;  4XT2 B;  5HDD A;  3VE3 A;  2V9A A;  1ODV A;  1S1Z A;  1TS6 A;  1XJ3 A;  2PD8 A;  3LYX A;  3E4P A;  3NOT C;  2D01 A;  4GCZ A;  4HQA A;  2P7J A;  4GHI B;  4EER A;  5F6A A;  2QJ5 A;  2QHK A;  1OTB A;  1N9O A;  5J4E A;  2V0U A;  1LT0 A;  2Z6D A;  2OWJ A;  4WUJ A;  4R3A A;  5G4Y A;  4B9O A;  3F1O A;  3HJK A;  2K7S A;  1LSV A;  1S4R A;  1GSX A;  1OTA A;  2KDK A;  3CWF A;  1S67 L;  2JN7 A;  4GS9 B;  3VOL A;  4EQ1 A;  4F3L B;  5HWT A;  1UGU A;  3UB8 A;  2H28 A;  3OLO A;  4HH3 A;  2VLG A;  3F1N A;  4GS9 A;  4HY8 A;  5HD3 A;  3UE6 A;  4F3L A;  3A0R A;  1N9L A;  1V9Y A;  2L1M A;  3KX0 X;  4DJ2 A;  1F98 A;  1UWN X;  5TBM A;  1JNU A;  4HIA A;  4NXB A;  1OT9 A;  1F9I A;  1T1B A;  2VV6 A;  1XJ4 A;  2QKP A;  2OOL A;  3MJQ A;  3UB7 A;  1N9N A;  2JHE A;  4WF0 A;  1Y28 A;  5HWW A;  1BYW A;  2ZOI A;  1V9Z A;  3LIC A;  4HHD A;  4M4X A;  3F1O B;  1P0Z A;  1S4S A;  3CAX A;  5EFW A;  5HD5 A;  4EES A;  1KOU A;  1NWZ A;  2KX6 A;  3NOU C;  1D7E A;  4EEU A;  1T18 A;  3LIA A;  3FC7 A;  3BWL A;  2W0N A;  3D72 A;  4HOI A;  1T1A A;  2VEA A;  3LIB A;  4GHI A;  1MZU A;  4HP9 A;  2PHY A;  5J3W A;  3UME A;  5DJU A;  2D02 A;  2WKQ A;  2ZBB A;  4L9E A;  4MN5 A;  2L0W A;  3BY8 A;  4WN5 A;  1LSX A;  3RTY A;  2QWS A;  5G4Z A;  1LSW A;  3IBR A;  2YKF A;  2I9V A;  3F1P A;  5IU1 A;  5F69 A;  4L9F A;  1DP6 A;  3ZQ5 A;  3MXQ A;  4I39 A;  4XT2 A;  1OTI A;  3K3D A;  5DKK A;  3PYP A;  1X0O A;  2L4R A;  4YWZ A;  3NHQ A;  3ULF A;  4NXE A;  3MQO A;  4GW9 A;  2VV8 A;  3BY9 A;  1OJG A;  3F1N B;  4H6J A;  5KIZ A;  3C2W A;  3MFX A;  1OTD A;  3UB9 A;  4PKY G;  4DJ3 A;  4E04 A;  4LPZ A;  5AVE A;  2M1C A;  3MQQ A;  4KUK A;  4BBU A;  2A24 A;  5I5L A;  2YKH A;  4BBV A;  4KQD A;  2WKP A;  4WLA A;  1TS0 A;  4WL9 A;  3H82 A;  5A8B A;  3GEC A;  1LL8 A;  2PYP A;  2V1B A;  2WKR A;  1T1C A;  1T19 A;  2A24 B;  3LI8 A;  3MR0 A;  1G28 A;  4LRZ E;  4HJ3 A;  3EWK A;  1XJ6 A;  3LID A;  4I3A A;  1XFQ A;  3LUQ A;  3CLO A;  5HDS A;  1DP9 A;  3UMD A;  1DRM A;  4JGO A;  2PR5 A;  2EA9 A;  4LRY C;  4I3I A;  3H7W A;  4EEP A;  1UWP X;  3G6O A;  3ICY A;  4EXO A;  2GJ3 A;  3FG8 A;  1GSV A;  2R78 A;  3T50 A;  2CMN A;  4PKY A;  3K3C A;  5F5Y A;  1XJ2 A;  4H6J B;  2Z6C A;  2PYR A;  1WA9 A;  3F1P B;  5HSQ A;  4BBT A;  2W27 A;  3EEH A;  3A0S A;  4EW7 A;  3LIE A;  4K08 A;  3E4Q A;  3H82 B;  3PHY A;  4HJ4 A;  4JGR A;  5IS1 A;  4HNB A;  3RH8 B;  3VE4 A;  4JGP A;  4L9G A;  4HJ6 A;  4I5S A;  4NXF A;  4R38 A;  4HH2 A;  2J80 A;  4I38 A;  4JGQ A;  5HWV A;  3C8C A;  4R6L A;  1TS8 A;  2INW A;  5F68 A;  1DP8 A;  4LLO B;  1OJ5 A;  4KUO A;  3LI9 A;  2BAS A;  1VB6 A;  1GSW A;  1OT6 A;  2ZOH A;  3H7W B;  4EET B;  4NXG A;  3LIF A;  4RQ9 A;  3H9W A;  3P7N A;  3B33 A;  2V1A A;  1OTE A;  1EW0 A;  1S1Y A; 
#chains in the Genus database with same CATH topology
 1XFN A;  3IQA A;  4DE3 A;  3LCE A;  4WZ5 C;  5KZH A;  3V39 A;  5HAP A;  4S2I A;  1GHM A;  1YM1 A;  2EX2 A;  1H8M A;  2QJ5 A;  1P9W A;  4MN7 A;  3UY6 A;  3N4I A;  4JF6 A;  4OPR A;  2PRF A;  4CJN A;  3EOI A;  1U60 A;  1S67 L;  1KE3 A;  2ZC6 B;  3KSG A;  4Q0J A;  1K57 C;  1AXB A;  4GS9 A;  4EBN A;  1Q2P A;  1H0M A;  1N9L A;  4WMC D;  3BLM A;  3T1X A;  2HJ9 C;  1N9N A;  1XA1 A;  2H0T A;  4WEL A;  1NWZ A;  2XLN A;  3D72 A;  2LB5 A;  3LR4 A;  5DF9 A;  3GMW A;  3T1R A;  5F69 A;  2J8Y A;  5EPH A;  1CQA A;  2DNS A;  3NHQ A;  5IHV A;  3G32 A;  3JPU A;  3VFH A;  4ZBE A;  4DMZ A;  5AVE A;  1LI9 A;  2M1C A;  1ZHH B;  4Q0H A;  1TS0 A;  4CPK A;  2WKR A;  2WKE A;  3LID A;  4I3A A;  3DTM A;  3LY3 A;  4FSF A;  3PAE A;  3FPV A;  2Z2M B;  1YQS A;  3W2Z A;  3IT9 A;  3CJM A;  5GLC A;  4WEK A;  3EEH A;  4JKT A;  3BM6 A;  1CJF A;  4BJP A;  3HRE A;  4LCL A;  5U47 A;  2X01 A;  1K0K A;  4S2N A;  4EET B;  3FKW A;  5HZH A;  3KSI A;  1FCM A;  4OOM A;  2V0W A;  2ZMA A;  3A0V A;  2PR6 A;  3T1Q B;  3NDE A;  1K54 A;  1J9M A;  4X69 A;  5EVI B;  4C3Q A;  2DCF A;  4P6B A;  4JXW A;  3BQA A;  3ZG8 B;  4X53 A;  1CF0 A;  2ZQ9 A;  2P9V B;  4ZDX A;  5L09 A;  4GB7 A;  2QYB A;  4BQM A;  5CEB A;  5HAR A;  1I2S A;  4QPR A;  2Y2P A;  4P87 A;  1ESI A;  3KYE A;  5E2E A;  4F94 A;  3HLB A;  4KZ6 A;  4B4Z A;  1F98 A;  1A0K A;  3T4L A;  2ZOI A;  5C5K A;  2DRW A;  3OBF A;  3LIA A;  3UME A;  3FWL A;  4MN5 A;  2YKF A;  1MPL A;  1MWS A;  4L9F A;  2KLI A;  3AGD A;  5DKK A;  1OJG A;  3NDG A;  1KGG A;  3C2W A;  3P09 A;  1YMX A;  2O0Y A;  2YKH A;  1S6R A;  2PYP A;  5F83 A;  1MC0 A;  4EU0 A;  1BLC A;  2PR5 A;  4JF4 A;  3G6O A;  1RP5 A;  4FCF A;  5F5Y A;  4UHU A;  5HSQ A;  5FL3 A;  5CGS A;  1W79 A;  3KYZ A;  3CHW P;  4KZ8 A;  1YLY A;  4IHQ A;  3H7W B;  3LR5 A;  5MC7 A;  1NYM A;  3B33 A;  2WKH A;  4OQI A;  4RX2 A;  1RCJ A;  4XUZ A;  1K6R A;  3MZF A;  3SW1 A;  4QB8 A;  4MEZ A;  3IF5 A;  3HLF A;  1ZG6 A;  1JWZ A;  1S1Z A;  3LYX A;  4K91 A;  3QNC A;  2PU4 A;  2ZM8 A;  2BG1 A;  1Y4O A;  2Z6D A;  5EOO A;  4UQI S;  1CEF A;  2RL3 A;  2QMI A;  2EFX A;  1YAX A;  5HWT A;  4C6Y A;  3R7W A;  2XF3 A;  1BUL A;  3DTE A;  3BRM A;  3LY4 A;  3OPH A;  4D2O A;  3SH7 A;  2OOL A;  3SS5 A;  4MBK A;  3CMZ A;  1QMF A;  1KDW A;  3BWL A;  3C38 A;  5J3W A;  3UPN A;  2A2L A;  3RTY A;  4LEN A;  3IBR A;  4IBX A;  5M19 A;  2G7U A;  1BLH A;  4E3M A;  1OTD A;  2JKR M;  1L0G A;  3T4K A;  2GX5 A;  3VFF A;  1BTL A;  3UPO A;  5EUA A;  5FI7 A;  2G2W A;  3HLG A;  2PBD P;  2ZQD A;  4BD1 A;  2R9W A;  3T50 A;  3DTI A;  4PKY A;  3CZD A;  4EBL A;  4OLD A;  1HTZ A;  4BBT A;  3IXD A;  2JKT I;  5AQB A;  2V8F A;  5EE8 A;  3ZNY A;  4JGP A;  4HJ6 A;  1ALQ A;  3DWZ A;  3MZE A;  3SH9 A;  2Y59 A;  4HEF A;  4KZ4 A;  3MSH A;  3Q1F A;  5TBM B;  4NG2 A;  1VQQ A;  3GRJ A;  3OOV A;  4MDZ A;  2VGJ A;  3M6H A;  1S66 L;  3NOP C;  2Y2K A;  3IX8 A;  3UB5 P;  4G3K A;  4FUW A;  1N9O A;  3SS4 A;  3T4S A;  4R3A A;  4B9O A;  2XD5 A;  2ZM2 A;  1MWR A;  2PT7 A;  2XDM A;  1HLU P;  4HY8 A;  3A3I A;  4F3L A;  3O86 A;  3ZGA B;  2BTF P;  3MKF A;  4QY6 A;  1H8Z A;  4QJG A;  5TBM A;  1UWN X;  3B47 A;  4NXB A;  3HL9 A;  2JHE A;  3JVV A;  1YLT A;  5EFW A;  5HPF A;  1OME A;  4HOI A;  4DN0 A;  2HZ5 A;  2PHY A;  2WKQ A;  3MQ0 A;  2FFY A;  3IWQ A;  3JYI A;  4WN5 A;  1LL9 A;  2DMW A;  1XKZ A;  1SDN A;  3IXB A;  4MMN A;  4Q0I A;  4DJ3 A;  4ETZ A;  2PBY A;  5CXW A;  2CC1 A;  3OPR A;  3QP4 A;  3V67 A;  4KEN B;  4H8R A;  1GA9 A;  1W63 M;  4OPY A;  4KQO A;  3O88 A;  3HVF A;  2EA9 A;  4OQ0 A;  2J9P A;  4X1L A;  1LL5 A;  4LV0 A;  3SH8 A;  4P6Z S;  5FI6 A;  3K3C A;  4EWF A;  3PR6 A;  1XJ2 A;  4H6J B;  2Z6C A;  1Q2Q A;  4QY5 A;  3ITA A;  3T12 B;  4EW7 A;  1MWT A;  3GR2 A;  3RH8 B;  2Y79 A;  4NXF A;  1PI4 A;  1TVF A;  3SS3 A;  4EUZ A;  3C8C A;  5F82 A;  1DP8 A;  1GCE A;  4QU3 A;  1PZO A;  3H9W A;  2V1A A;  4GW9 A;  1W8Y A;  3TJZ C;  4N92 A;  1N4O A;  1H5X A;  3G35 A;  1EWZ A;  2B02 A;  4IBR A;  3GDI A;  5FA7 A;  4FH4 A;  3T1S A;  4XT2 B;  1SCW A;  3AGE A;  5J8X A;  2WKI A;  1PYY A;  3NCK A;  2Q9N A;  4N1H A;  2Y2H A;  1VET A;  4GS9 B;  4NKP A;  2A49 A;  3HLD A;  3SOI A;  3UE6 A;  5G18 A;  3VP0 A;  1KE0 A;  1K54 C;  1SZV A;  2L1M A;  3HUN A;  4ZRR A;  2J9O A;  1K6S A;  1V9Z A;  4ZJ3 A;  3IWI A;  5BOH A;  4PM8 A;  5FQI A;  4E3J A;  2AVX A;  1YPR A;  2D02 A;  3VP4 A;  2EX8 A;  3CPT B;  3PBO A;  3VSK A;  3QP2 A;  1LSW A;  4X68 A;  2W3D A;  4KQR A;  2VGL S;  4EUV A;  3MXS A;  4YWZ A;  4NXE A;  3MQO A;  1YT4 A;  3IXG A;  5TR7 A;  4YFM A;  1IOU A;  2OAP 1;  3LO7 A;  1LL8 A;  2ZQ8 A;  1SKF A;  1D1J A;  2VK3 A;  4E3N A;  3TRC A;  3LEQ A;  3NBL A;  1H8Y A;  3A3D A;  2Y8H A;  5FAT A;  4DRT A;  1IYQ A;  4QWO A;  2QPN A;  3WWX A;  4JLF A;  4JBF A;  5CRF A;  4R38 A;  2J3T D;  2W1R A;  4GOG A;  1AWI A;  5E2F A;  5JYO A;  1OTE A;  4H6J A;  1EW0 A;  3RFB A;  2O9C A;  1FCN A;  1L0F A;  5DJT A;  2X02 A;  4MN6 A;  1SDE A;  3GV9 A;  3IS2 B;  1P97 A;  3PBQ A;  2VJW A;  2PD8 A;  2A3U A;  4GJ4 A;  1G6O A;  5AQA A;  3E2K A;  3LEZ A;  1XGJ A;  3VP2 A;  3UE3 A;  2K7S A;  2KDK A;  5DTT A;  1KGF A;  5HD3 A;  4BWI A;  4GD6 A;  1OT9 A;  2H10 A;  3IX4 A;  4KZA A;  5FAO A;  5GL9 A;  1PWC A;  3F1O B;  2B95 A;  2VEA A;  1XPB A;  4GHI A;  4LFU A;  4Q8I A;  4L9E A;  4M3K A;  5G4Z A;  3MXQ A;  4Y0U A;  2WUQ A;  3BY9 A;  1E25 A;  4OP5 A;  3HBR A;  3MQQ A;  3A3E A;  2EXA A;  4BBV A;  3M6B A;  2J7V A;  3GEC A;  3ZG7 B;  4LRZ E;  2ZQA A;  2Y2J A;  2OSU A;  1MBL A;  1UWP X;  1PWG A;  3FG8 A;  2W1T B;  3BFF A;  4S2J A;  2O9A A;  4MLL A;  3F1P B;  2V8C A;  1HVB A;  5CX7 A;  5GLB A;  4HH2 A;  2J80 A;  4I38 A;  3ZVW A;  5FQQ A;  5FAP A;  4Y17 A;  1LLB A;  4RQ9 A;  2QJ7 A;  5AVF A;  2XSS A;  4ZJ2 A;  1M6K A;  1RGY A;  4Y2F A;  2HV1 A;  5HDD A;  1CK3 A;  3ITB A;  3CG5 A;  3WS0 A;  2JKF A;  3E4P A;  3NOT C;  1PW1 A;  3S7O A;  4GHI B;  4EER A;  1IEL A;  5HAI A;  4ARZ B;  3F1O A;  1F2K A;  1XXM A;  1BSG A;  2HF6 A;  2VA0 A;  3G2Y A;  3BLS A;  4O7D A;  3A0R A;  4KZ5 A;  5FEF A;  4AFI A;  1G6A A;  3HLW A;  2EFU A;  3KYQ A;  3UE0 A;  2G2U A;  1TF1 A;  5HD5 A;  1S4S A;  4R0Q A;  4WZ5 A;  1D7E A;  1ERO A;  1BUE A;  2JC7 A;  2ZMF A;  2W3G A;  2W0N A;  2C6W B;  1T1A A;  3LIB A;  4U0X A;  1MZU A;  1ESU A;  5KMW A;  2JCH A;  3F1P A;  2Y55 A;  1DP6 A;  3ZQ5 A;  4I39 A;  3O3V A;  3Q7Z A;  4HBT A;  3ZDJ A;  4CLC E;  1X0O A;  3BFC A;  3EEA A;  1ES5 A;  4BD0 A;  2NUP C;  4KG2 A;  4CLC B;  2B5R A;  2EX6 A;  3DWK A;  4LPZ A;  4X56 A;  3LR0 A;  5I5L A;  3N6I A;  4WLA A;  4ME4 A;  1T19 A;  5K5B A;  3LUQ A;  3N8R A;  2ZMV A;  3H7W A;  2H5S A;  4EEP A;  5KSH A;  1FIL A;  2XR0 A;  4OPQ A;  4OOY A;  3V5M A;  1Z09 A;  4XUX A;  3EQU A;  3NUL A;  5CHM A;  3G30 A;  1PWD A;  3AGF A;  2WAD A;  3VOY A;  2XK1 A;  1IYO A;  3LIF A;  3P01 A;  2ZM0 A;  4OH0 A;  2Y2O A;  2X71 A;  4JXS A;  1YKD A;  1STZ A;  4FOF A;  1JTG A;  1TS7 A;  3E4O A;  4N1X A;  4JPM A;  3B42 A;  4EBP A;  3S7Q A;  3PBT A;  5EM1 A;  4YNR A;  3NEC A;  1NZU A;  1GSX A;  3VOL A;  1GHI A;  4MBF A;  2WAF A;  3TE8 A;  4IED A;  1KGE A;  3CPT A;  4DXC A;  3KX0 X;  3UE1 A;  2ZL1 B;  3W8K A;  3FV7 A;  2WGV A;  1IYP A;  4EES A;  4EEU A;  3G31 A;  1PZP A;  3MS6 A;  4R3J A;  1W63 Q;  2ZBB A;  3ZHH A;  4O0P A;  5EVI C;  5L10 A;  2J3T C;  2JKR I;  3K3D A;  4E3L A;  5DTS A;  4LV1 A;  1EI5 A;  2ZQC A;  5CER A;  1CI9 A;  2HDS A;  3HUO A;  4Y0O A;  4IUK A;  4N9K A;  3LI8 A;  2A24 B;  1N9B A;  4HJ3 A;  5HDS A;  4I3I A;  5DVA A;  5GHY A;  4ZTK A;  1F5M A;  3RXW A;  4DE1 A;  4OOL A;  4GDB A;  4BL2 A;  5M18 A;  3PBN A;  3N8L A;  4HNB A;  4DF6 A;  5DF7 A;  2Q0O A;  4R6L A;  3BQ8 A;  4NXG A;  3VOZ A;  1G5U A;  5F1F A;  1E3U A;  4RYE A;  1P9R A;  3NJA A;  3MF0 A;  1IYS A;  4PPR A;  4G3W A;  4HI4 A;  5TGF A;  4X55 A;  2ZLY A;  4BL3 A;  2FH5 A;  2IA2 A;  4X1M A;  5CGX A;  1ZKJ A;  1JTD A;  1FCO A;  3FKV A;  1K4E A;  4GZB A;  5HX9 A;  2JKG A;  1ZG4 A;  3IF6 B;  4E3K A;  2HP6 A;  2JN7 A;  4U0T A;  1NLZ A;  3NY4 A;  2QKP A;  3UB7 A;  2O99 A;  4OON A;  5EOE A;  2V1Z A;  3MMH A;  1DJB A;  3QNB A;  3G2Z A;  3WS5 A;  1SKO A;  3U4L P;  5CHU A;  4LGW A;  4GD8 A;  2XRN A;  1RGZ A;  1PRQ A;  5IT5 A;  3UB9 A;  3ZG5 A;  5DFY A;  5DF8 A;  4ESP A;  4MCW A;  2V1B A;  3IH9 A;  4KQQ A;  1XJ6 A;  4JGO A;  3MXR A;  2KOI A;  3VMA A;  4K0X A;  2CMN A;  2WGW A;  3E0Y A;  2Y2Q A;  1ES4 A;  4PM6 A;  4L0L A;  3E4Q A;  2XA7 S;  4RVA A;  2WYX A;  4I5S A;  1LI0 A;  2VGK A;  3UPP A;  2ZC7 A;  3KSF A;  3LI9 A;  2ZOH A;  4PHT A;  5EVE A;  3UB6 A;  4DE0 A;  2PD7 A;  1PFL A;  1K38 A;  2HGV A;  2OWH A;  5CEC A;  3C4O A;  3BEB A;  3C7V A;  1WYC A;  2D01 A;  4OKP A;  2V20 A;  5L07 A;  2PU2 A;  2OWJ A;  3Q07 A;  3QP6 A;  5FQK A;  3GQZ A;  3ZYT A;  4UA9 A;  2ACG A;  3HLC A;  1LHY A;  2B18 A;  4P85 A;  4KZ7 A;  3ZG9 B;  3PAG A;  3LGO A;  1Y28 A;  1PW8 A;  4M4X A;  5A92 A;  3O5Y A;  2Y2N A;  4Y3I A;  2WZZ A;  4HP9 A;  3C30 A;  1XGI A;  2JE5 A;  3ZVT A;  3TG9 A;  1IFQ A;  3C7U A;  1NYY A;  4ZJ1 A;  4WL9 A;  3Q82 A;  3UNW A;  3UO9 A;  4YIN A;  1G28 A;  5EM0 A;  1XFQ A;  1BT5 A;  1C3B A;  3UMD A;  4IJG A;  3RJU A;  1ACF A;  2WK0 A;  3ISG A;  3CUE A;  1ONH A;  1FSW A;  3S7P A;  2ZJ9 A;  1W8Q A;  1WA9 A;  3EGX C;  1GA0 A;  1NZO A;  3BYD A;  3H82 B;  3U2A A;  1DY6 A;  2Y2I A;  1YSQ A;  1BLP A;  3HCY A;  5DFX A;  1TS8 A;  4LLO B;  4KUO A;  5HAQ A;  1Z6F A;  5TJJ A;  5GLA A;  1BLS A;  2XD1 A;  4B4X A;  5AJG A;  4ZAM A;  3BJN A;  2W3E A;  4GCZ A;  3CUE C;  2XEP A;  5F6A A;  3Q7V A;  5J4E A;  2BLS A;  1HZO A;  1OTA A;  1NRJ A;  2C5W B;  3OLO A;  2HPB A;  2P08 A;  1YLW A;  3EQV A;  2ZD8 A;  4HIA A;  4S2N C;  2XFS A;  1I2W A;  1NRF A;  4C75 A;  4HHD A;  4E3I A;  1G68 A;  4O8G A;  1FIK A;  2Y91 A;  1HD8 A;  5DJU A;  4S2O A;  4ARZ A;  1MKM A;  1Y54 A;  4XT2 A;  2M7U A;  4WM9 A;  1WE4 A;  2OLV A;  4JXG A;  1OPX A;  3H82 A;  1WYB A;  1MY8 A;  1PNE A;  5A93 A;  5HFO A;  4Y7P A;  2GJ3 A;  1GSV A;  2OV5 A;  4X25 A;  3WS2 A;  2QZ6 A;  2WGI A;  3D9Y A;  2IWB A;  5A91 A;  3A0S A;  3E98 A;  5FQM A;  1IKI A;  5IS1 A;  3VE4 A;  5I94 A;  1BZA A;  3GVB A;  2ZC3 B;  3KSH A;  3ZCZ A;  1SKO B;  5AQ7 A;  5HDC A;  3W4O A;  3LFV A;  4PM9 A;  4UA7 A;  2W3F A;  4GKU A;  4LRX C;  1KVL A;  2P9V A;  3VV4 A;  1TS6 A;  4BMW A;  3K2N A;  1L0E A;  5E2G A;  1OTB A;  3E2L A;  3D4F A;  4S2K A;  1VEU A;  3DTK A;  3G34 A;  3IHA A;  4F3L B;  5E43 A;  2EWW A;  2VLG A;  3FZC A;  3IXH A;  2VKS A;  3L7H A;  2NUT C;  1PI5 A;  1T1B A;  3CI6 A;  3MJQ A;  1BYW A;  5CHJ A;  3MFD A;  1KOU A;  2XGN A;  5L8M A;  3N8S A;  4A5R A;  4IVI A;  5IU1 A;  3DBA A;  2PAV P;  3P98 A;  1IKG A;  5KIZ A;  3T4Q A;  3IBJ A;  4BBU A;  2P74 A;  2K2N A;  5TFQ A;  4ETX A;  2UWX A;  2ZL1 A;  2HDR A;  1GHP A;  4EXO A;  1YLJ A;  1ZC2 A;  3HUM A;  1I5Q A;  3R4K A;  5LBR A;  5GLD A;  1VET B;  1CI8 A;  2EXB A;  2W27 A;  3MZD A;  2W1T A;  4K0W A;  1NXY A;  2HP9 A;  3PXP A;  5HWV A;  2LB9 A;  5JYP A;  1VHM A;  1JVJ A;  1YMS A;  3MKE A;  4X6T A;  3RXX A;  1VB6 A;  3DAV A;  1GSW A;  2P04 A;  2K31 A;  1K56 A;  3A3J A;  4ID4 A;  4FD8 A;  3OCN A;  1TEM A;  4GN2 A;  4HP4 A;  4R70 A;  3S7N A;  3QHY A;  4Y13 A;  3VE3 A;  4I3J A;  3QP5 A;  3JVU A;  3V50 A;  4HES A;  2P7J A;  3NC8 A;  4NK3 A;  4OQH A;  4E6W A;  3TOI A;  1LT0 A;  4FTX A;  5G4Y A;  1K55 A;  2EX9 A;  5FSR A;  4P6Z M;  3UB8 A;  5GHX A;  4R23 A;  1K4F A;  4HH3 A;  5F1G A;  4WYY A;  4WMC A;  1K25 A;  1ZTU A;  1TDL A;  4JF5 A;  3UN7 A;  2Y2L A;  4DJ2 A;  4UA6 A;  1XJ4 A;  3ZFZ A;  3C5A A;  3WS4 A;  4CLC C;  2XA7 M;  3TSG A;  3NOU C;  1XX2 A;  1E4D A;  2L0W A;  3BY8 A;  3DW0 A;  1KE4 A;  1LSX A;  3LR3 A;  3OCL A;  2GDN A;  4OQG A;  3B3X A;  3UDI A;  3PBS A;  4HBU A;  3ULF A;  1SHV A;  4RA7 A;  2O9B A;  4Z9Q A;  1JWP A;  2IWC A;  4Z1W A;  4OLG A;  4QHC A;  2WKP A;  4KZB A;  1S0W A;  4QD4 A;  3EWK A;  1DJA A;  1NLY A;  3CIT A;  3G4P A;  4RX3 A;  1E3U D;  3ICY A;  2HJE A;  4D60 A;  2R78 A;  2FZ0 A;  4UQI M;  1QME A;  4PMA A;  3VP1 A;  4KZ3 A;  3PTE A;  3TW8 A;  2HDQ A;  1DJC A;  1W7F A;  2Y4A A;  5HW3 A;  3NIA A;  1FQG A;  3LIE A;  2MJ6 A;  2I72 A;  1NJ4 A;  1YLZ A;  1YSP A;  1KDS A;  4R4R A;  3M2J A;  2BAS A;  1ES3 A;  3OZH A;  3Q7V B;  2ZC4 B;  5J7E A;  5DKL A;  4WZ4 A;  4Y0T A;  1ODV A;  4B88 A;  4WBG A;  5EEC A;  1FSY A;  4DXB A;  4DDY A;  3EGD C;  2QHK A;  2GZA A;  4UEY A;  2RCX A;  3IX3 A;  5FQJ A;  3S22 A;  3WRT A;  2Y2M A;  3OPP A;  1UGU A;  3WS1 A;  2ZC5 B;  2JBF A;  1V9Y A;  2GNX A;  1H3Q A;  5CTN A;  5HL6 A;  4BLM A;  3BFE A;  5HWW A;  3LIC A;  3FYZ A;  4KG5 A;  2KX6 A;  4YOF A;  3VSL A;  1T18 A;  5HPI A;  3T4J A;  4CLC D;  1M40 A;  4G3V A;  2V2F F;  4N9L A;  4U3T A;  4PM7 A;  3IWO A;  3PYP A;  3QP8 A;  5FAS A;  2VV8 A;  4II7 A;  3F1N B;  4Y5F A;  4Y15 A;  4KUK A;  2VGL M;  4KQD A;  4CQH A;  5FI2 A;  3GTC A;  3S1Y A;  4LRY C;  2EWV A;  3BFD A;  4KZ9 A;  3M2K A;  5D3O A;  2PYR A;  3FPW A;  3R7W B;  4EQI A;  4S2L A;  4JGR A;  2XQZ A;  4L9G A;  2JKT M;  5CTM A;  2WAE A;  3N7W A;  2XFT A;  3I7J A;  2HDU A;  4MNR A;  4XXR A;  1S1Y A;  4S2M A;  2VV7 A;  4WEJ A;  3HJI A;  4O01 A;  2UV0 E;  3W4P A;  2PDR A;  1FR1 A;  2Z2L B;  4PAU A;  3W4Q A;  5FDH A;  3IF6 A;  4HQA A;  3V3R A;  3NI9 A;  1L0D A;  4IVK A;  2V0U A;  4OP8 A;  5AQ9 A;  4WUJ A;  3O87 A;  4NEE D;  1W5D A;  4GDN A;  3OPL A;  3CWF A;  3IHB A;  4EQ1 A;  2FFF B;  2R9X A;  1MXO A;  3F1N A;  3KO6 A;  2ZQ7 A;  3D3O A;  3GSG A;  1JNU A;  1KVM A;  2VV6 A;  1F9I A;  5EVI D;  3C4P A;  4LV3 A;  2E8I A;  3MBZ A;  1P0Z A;  3CAX A;  3HLE A;  1FOF A;  4R3B A;  1L3L A;  2QWS A;  5KSC A;  3IF6 C;  3SZT A;  3UDX A;  4LV2 A;  3L9K A;  1FR6 A;  4PM5 A;  3MFX A;  5FDS A;  1J3W A;  5A90 A;  3T4T A;  2XH9 A;  1TD5 A;  1NY0 A;  4DE2 A;  5A8B A;  4E6X A;  4OVD A;  3MR0 A;  1PIO A;  3CLO A;  1DP9 A;  1DRM A;  4EV4 A;  1YLP A;  2WZX A;  1MWU A;  3T4O A;  3ZG0 A;  2WGW B;  4K08 A;  2XRO A;  2OLU A;  2HP5 A;  2INW A;  3OC2 A;  1CEG A;  5GHZ A;  1IEM A;  3IS2 A;  1D06 A;  4CLC A;  4DDS A;  5L2F A;  4KG6 A;  5DTK A;  1XP4 A;  5E2H A;  4GLQ A;  1JWV A;  2V9A A;  1XJ3 A;  2H0Y A;  3UDF A;  2VZW A;  1ONG A;  4DKI A;  5M1A A;  4FH2 A;  1K55 C;  4JXV A;  3HJK A;  4UAA A;  2W3H A;  1LSV A;  1S4R A;  1MKI A;  2Q9M A;  1TDG A;  2H28 A;  2J3W A;  3A3F A;  4NET A;  5EVL A;  4E3O A;  4LCM A;  4R1G A;  4WF0 A;  1XA7 A;  5FEG A;  4R4S A;  3FC7 A;  1O7E A;  2I9V A;  1ERQ A;  1VEU B;  5FQ9 A;  3BW6 A;  5EV0 A;  1OTI A;  3PBR A;  1ERM A;  2L4R A;  3BFG A;  2M7V A;  5CED A;  1VM1 A;  2OAQ 1;  4E04 A;  3WRZ A;  4PKY G;  2A24 A;  4GNU A;  4B93 A;  2VX8 A;  2Y2G A;  4P0M A;  1T1C A;  5CGW A;  4MBH A;  3S4X A;  4BEN A;  3V3S A;  5FAQ A;  1ES2 A;  4S2P A;  3Q81 A;  4IUH A;  3BEC A;  3PHY A;  4HJ4 A;  3ZNT A;  1O07 A;  2E8J A;  1K57 A;  1L2S A;  3IH8 A;  5EVI A;  2IWD A;  4JGQ A;  5F68 A;  4OPZ A;  1OT6 A;  3QP1 A;  3VP3 A;  3P7N A;  5HL1 A;  1OJ5 A;  1K56 D; 
#chains in the Genus database with same CATH homology
 1XFN A;  3TJZ C;  3OCN A;  1P9R A;  3NJA A;  3MF0 A;  2B02 A;  4G3W A;  3GDI A;  4HI4 A;  4HP4 A;  4R70 A;  3S7N A;  3VE3 A;  4I3J A;  4XT2 B;  3JVU A;  2FH5 A;  2IA2 A;  2P7J A;  1H8M A;  2QJ5 A;  1P9W A;  4MN7 A;  1LT0 A;  5G4Y A;  3EOI A;  4GS9 B;  1S67 L;  2JN7 A;  4NKP A;  4P6Z M;  1NLZ A;  3UB8 A;  3KSG A;  4Q0J A;  4HH3 A;  3UE6 A;  4GS9 A;  1ZTU A;  1N9L A;  2L1M A;  4DJ2 A;  2HJ9 C;  1XJ4 A;  2QKP A;  4ZRR A;  3UB7 A;  1N9N A;  2O99 A;  1V9Z A;  3MMH A;  4CLC C;  2XA7 M;  4WEL A;  1NWZ A;  3NOU C;  3D72 A;  2LB5 A;  3LR4 A;  5DF9 A;  2D02 A;  2L0W A;  3BY8 A;  3PBO A;  1LSX A;  1LSW A;  3LR3 A;  3OCL A;  5F69 A;  2W3D A;  2VGL S;  2XRN A;  3PBS A;  4EUV A;  4YWZ A;  3NHQ A;  3ULF A;  4NXE A;  3MQO A;  5IT5 A;  2O9B A;  4Z1W A;  1IOU A;  3UB9 A;  4DMZ A;  2OAP 1;  5AVE A;  5DFY A;  2M1C A;  1ZHH B;  4MCW A;  2WKP A;  4Q0H A;  1TS0 A;  1LL8 A;  2V1B A;  2WKR A;  3EWK A;  1XJ6 A;  3LID A;  4I3A A;  1NLY A;  3CIT A;  3TRC A;  4FSF A;  4JGO A;  3ICY A;  2KOI A;  2HJE A;  2R78 A;  2FZ0 A;  2Y8H A;  2CMN A;  4UQI M;  3FPV A;  3E0Y A;  3W2Z A;  3TW8 A;  4WEK A;  3EEH A;  3LIE A;  4L0L A;  4BJP A;  2MJ6 A;  3E4Q A;  1YSP A;  2XA7 S;  4I5S A;  4R38 A;  2J3T D;  2W1R A;  3KSF A;  3LI9 A;  2BAS A;  2ZOH A;  4PHT A;  4EET B;  1OTE A;  4H6J A;  1EW0 A;  3RFB A;  5HZH A;  3KSI A;  3UB6 A;  2O9C A;  4OOM A;  2V0W A;  5DJT A;  5J7E A;  2PD7 A;  3A0V A;  4MN6 A;  2PR6 A;  2HGV A;  5DKL A;  3IS2 B;  2OWH A;  1P97 A;  3PBQ A;  2VJW A;  1ODV A;  2PD8 A;  3BQA A;  2D01 A;  4GJ4 A;  1G6O A;  3EGD C;  2QHK A;  2GZA A;  2OWJ A;  4UEY A;  2QYB A;  3UE3 A;  4QPR A;  2K7S A;  2KDK A;  3ZYT A;  1UGU A;  2B18 A;  5HD3 A;  4BWI A;  1V9Y A;  2GNX A;  1H3Q A;  5HL6 A;  1F98 A;  1OT9 A;  3T4L A;  1Y28 A;  5HWW A;  2ZOI A;  3LIC A;  4M4X A;  3O5Y A;  5C5K A;  3F1O B;  4Y3I A;  3OBF A;  2KX6 A;  4YOF A;  1T18 A;  3LIA A;  5HPI A;  2VEA A;  4GHI A;  3C30 A;  4HP9 A;  3T4J A;  3UME A;  4CLC D;  4L9E A;  4MN5 A;  5G4Z A;  2YKF A;  4G3V A;  4L9F A;  2KLI A;  3MXQ A;  5DKK A;  3PYP A;  2VV8 A;  3BY9 A;  4II7 A;  1OJG A;  3F1N B;  1IFQ A;  3C2W A;  4Y5F A;  2O0Y A;  3MQQ A;  4KUK A;  2VGL M;  2YKH A;  4BBV A;  4KQD A;  4CQH A;  4WL9 A;  3GEC A;  2PYP A;  4LRZ E;  1G28 A;  1XFQ A;  1MC0 A;  3UMD A;  4IJG A;  4EU0 A;  2PR5 A;  4LRY C;  2EWV A;  1UWP X;  3CUE A;  3G6O A;  3FG8 A;  2W1T B;  3S7P A;  2O9A A;  5F5Y A;  2PYR A;  1WA9 A;  3F1P B;  3FPW A;  3EGX C;  5HSQ A;  5FL3 A;  3KYZ A;  3R7W B;  3H82 B;  4JGR A;  5CX7 A;  3U2A A;  1YSQ A;  4L9G A;  3HCY A;  4IHQ A;  5DFX A;  4HH2 A;  2J80 A;  4I38 A;  2JKT M;  1TS8 A;  4LLO B;  4KUO A;  3H7W B;  3LR5 A;  5MC7 A;  4RQ9 A;  3B33 A;  5TJJ A;  1S1Y A;  2QJ7 A;  2VV7 A;  5AVF A;  4WEJ A;  2XSS A;  3HJI A;  4O01 A;  3SW1 A;  2PDR A;  4Y2F A;  5AJG A;  2HV1 A;  4PAU A;  5HDD A;  3BJN A;  1S1Z A;  3LYX A;  2W3E A;  3E4P A;  3NOT C;  4GCZ A;  4HQA A;  3S7O A;  3CUE C;  4GHI B;  4EER A;  5F6A A;  5J4E A;  2V0U A;  2Z6D A;  4ARZ B;  4UQI S;  4WUJ A;  4NEE D;  3F1O A;  3CWF A;  1OTA A;  4EQ1 A;  1YAX A;  1NRJ A;  5HWT A;  2HF6 A;  2VA0 A;  3OLO A;  3R7W A;  2P08 A;  3F1N A;  3KO6 A;  3D3O A;  3EQV A;  3A0R A;  4AFI A;  1JNU A;  4HIA A;  2VV6 A;  1F9I A;  2OOL A;  3KYQ A;  1TF1 A;  4HHD A;  1P0Z A;  1S4S A;  3CAX A;  5HD5 A;  4O8G A;  1D7E A;  2ZMF A;  2W3G A;  2W0N A;  3BWL A;  3C38 A;  1T1A A;  3LIB A;  5J3W A;  1MZU A;  5DJU A;  2A2L A;  3RTY A;  2QWS A;  3IBR A;  4ARZ A;  1MKM A;  3F1P A;  1DP6 A;  3ZQ5 A;  4I39 A;  4XT2 A;  4CLC E;  1X0O A;  3EEA A;  2M7U A;  2NUP C;  4CLC B;  2G7U A;  3MFX A;  1OTD A;  2JKR M;  4LPZ A;  3T4T A;  3LR0 A;  3T4K A;  5I5L A;  2GX5 A;  1OPX A;  1TD5 A;  4WLA A;  5A8B A;  3H82 A;  4ME4 A;  1T19 A;  3MR0 A;  5K5B A;  3LUQ A;  3CLO A;  1DP9 A;  1DRM A;  2ZMV A;  3H7W A;  4EEP A;  5KSH A;  2GJ3 A;  3T50 A;  1GSV A;  4PKY A;  3T4O A;  4BBT A;  2JKT I;  3A0S A;  3E98 A;  4K08 A;  2XRO A;  3EQU A;  5IS1 A;  3VE4 A;  4JGP A;  4HJ6 A;  2INW A;  3KSH A;  3OC2 A;  3LIF A;  3P01 A;  5HDC A;  3IS2 A;  5TBM B;  1D06 A;  4CLC A;  3LFV A;  1YKD A;  1STZ A;  4FOF A;  1TS7 A;  3E4O A;  3OOV A;  4MDZ A;  2W3F A;  4LRX C;  1S66 L;  3NOP C;  3VV4 A;  3B42 A;  4GLQ A;  2V9A A;  1TS6 A;  1XJ3 A;  4BMW A;  3K2N A;  2VZW A;  4G3K A;  3S7Q A;  1OTB A;  1N9O A;  3PBT A;  3T4S A;  4R3A A;  4YNR A;  4B9O A;  3HJK A;  2W3H A;  1LSV A;  1S4R A;  1GSX A;  4F3L B;  2PT7 A;  3VOL A;  2EWW A;  2H28 A;  2J3W A;  2VLG A;  4HY8 A;  3TE8 A;  4F3L A;  2VKS A;  2NUT C;  3KX0 X;  5TBM A;  1UWN X;  3B47 A;  4NXB A;  1T1B A;  3CI6 A;  3MJQ A;  2JHE A;  4WF0 A;  1BYW A;  3JVV A;  5EFW A;  4EES A;  1KOU A;  5L8M A;  5HPF A;  4EEU A;  3FC7 A;  4HOI A;  4DN0 A;  2PHY A;  2WKQ A;  3MQ0 A;  1W63 Q;  2ZBB A;  4WN5 A;  2DMW A;  4O0P A;  2I9V A;  5IU1 A;  3DBA A;  3BW6 A;  1OTI A;  2J3T C;  2JKR I;  3K3D A;  3PBR A;  2L4R A;  2M7V A;  4MMN A;  4Q0I A;  5KIZ A;  2OAQ 1;  3T4Q A;  4DJ3 A;  4E04 A;  4PKY G;  4ETZ A;  3IBJ A;  4BBU A;  2A24 A;  2K2N A;  4IUK A;  4ETX A;  4B93 A;  2VX8 A;  1T1C A;  3LI8 A;  2A24 B;  3V67 A;  4HJ3 A;  1W63 M;  5HDS A;  4KQO A;  2EA9 A;  4I3I A;  4EXO A;  4P6Z S;  3R4K A;  1F5M A;  3K3C A;  3PR6 A;  5LBR A;  1XJ2 A;  4H6J B;  4OOL A;  2Z6C A;  2W27 A;  4IUH A;  2W1T A;  4EW7 A;  3PBN A;  3PHY A;  4HJ4 A;  3PXP A;  4HNB A;  3RH8 B;  2Y79 A;  4NXF A;  5HWV A;  2LB9 A;  4JGQ A;  1VHM A;  3C8C A;  4R6L A;  3BQ8 A;  5F68 A;  1DP8 A;  1VB6 A;  1GSW A;  1OT6 A;  2P04 A;  4NXG A;  3H9W A;  3P7N A;  2K31 A;  2V1A A;  1OJ5 A;  4GW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...