2PDRA

1.7 angstrom crystal structure of the photo-excited blue-light photoreceptor vivid
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
147
structure length
147
Chain Sequence
TLYAPGGYDIMGYLIQIMNRPNPQVELGPVDTSCALILCDLKQKDTPIVYASEAFLYMTGYSNAEVLGRNCRFLQSPDGMVKPKSTRKYVDSNTINTMRKAIDRNAEVQVEVVNFKKNGQRFVNFLTMIPVRDETGEYRYSMGFQCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vivid PAS protein VVD
publication title Conformational switching in the fungal light sensor Vivid
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Circadian clock protein
total genus 38
structure length 147
sequence length 147
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2pdrA00
4HJ3A 1LSXA 2JHEA 4JGPA 2PD8A 4GHIA 3K3DA 4HH3A 2D02A 4YWZA 4HI4A 2YKFA 5TBMA 1N9OA 4L9GA 1OT6A 4LPZA 2QHKA 1XJ6A 3PYPA 4R6LA 3F1OB 3UB9A 2KDKA 4NXBA 3UMEA 5DJTA 3FC7A 3UB6A 1TS8A 1D06A 4HP4A 5IU1A 5DJUA 4I3IA 4WUJA 1DP9A 3F1PB 1TS6A 3IS2B 2I9VA 2V0UA 4MN5A 3BY8A 4GHIB 1V9YA 4EEUA 1G28A 2YKHA 4EQ1A 2L1MA 2CMNA 3GDIA 5HZHA 1MZUA 4EXOA 1S4RA 2A24A 1OTIA 4F3LB 2VV8A 4L9EA 4B9OA 1TS0A 3NJAA 5KIZA 4H6JB 4DJ2A 2JN7A 3C2WA 4BBVA 2V1BA 1XJ4A 2WKQA 5AVFA 1T19A 3GECA 5HWWA 3RTYA 3H82B 3LIDA 4GS9B 1UWPX 1TS7A 3NHQA 5HSQA 1S67L 4PKYA 1LT0A 2H28A 5HD5A 3FG8A 4HP9A 3VOLA 2ZOIA 2W0NA 1XJ2A 3LIAA 2KX6A 3B33A 1N9LA 2QJ7A 4KUOA 4R38A 1VB6A 2A24B 2GJ3A 2EA9A 4R3AA 2PHYA 4BBUA 3E4OA 1OJ5A 1UGUA 2WKRA 5IS1A 3F1PA 3IS2A 3VE4A 3MXQA 4NXEA 1S1YA 5HDDA 3MR0A 4JGRA 5F6AA 4K08A 3LIFA 4LRYC 1GSVA 1P97A 4F3LA 1OJGA 3BWLA 3F1NA 1OTAA 3G6OA 2V9AA 3RH8B 4H6JA 4EW7A 5HWVA 4HY8A 2J80A 3VE3A 3LIBA 2ZOHA 3HJIA 3UE6A 2P7JA 3LYXA 3H82A 3CLOA 4GS9A 3LIEA 2VEAA 4DJ3A 2HV1A 2R78A 3E4PA 4EERA 5HDSA 4KUKA 2PD7A 1DP6A 1DRMA 3EWKA 2VV7A 3KX0X 5J3WA 3F1NB 3P7NA 4I39A 4WL9A 2BASA 3NOUC 1OTEA 3A0SA 3C8CA 4BBTA 4EESA 5A8BA 5HD3A 3PHYA 1Y28A 1N9NA 2PR5A 3UB8A 1D7EA 2Z6DA 5G4ZA 4MN6A 5HDCA 1T18A 1S4SA 2V1AA 5HWTA 4KQDA 1KOUA 2QJ5A 2V0WA 3ZQ5A 3A0VA 4HQAA 4HJ6A 1F9IA 2QKPA 1WA9A 4R70A 3ICYA 3MJQA 2Z6CA 3NOPC 5DKLA 2INWA 2OWJA 4EEPA 3OLOA 5J7EA 1S66L 1DP8A 1T1BA 4M4XA 4JGQA 3LICA 5DKKA 3H7WB 1OTBA 4HHDA 2PR6A 4HH2A 1ODVA 4LLOB 3UMDA 3D72A 3ULFA 4PKYG 3IBRA 2B02A 1OT9A 2PDRA 3CWFA 3CAXA 5I5LA 1XJ3A 2QWSA 1UWNX 1LSVA 4LRXC 3NOTC 3BY9A 1T1AA 4I38A 3UB7A 4XT2A 3E4QA 2OOLA 1GSXA 1P0ZA 3MQQA 1T1CA 4JGOA 4LRZE 3MQOA 4WF0A 4NXFA 2K7SA 2L0WA 2WKPA 3LI9A 1V9ZA 4GW9A 5TBMB 2PYRA 2L4RA 3LUQA 1LSWA 1XFQA 5G4YA 4I3AA 2M1CA 4RQ9A 3MFXA 1EW0A 4NXGA 4E04A 5EFWA 4WLAA 1X0OA 2VLGA 4HOIA 3A0RA 5AVEA 2ZBBA 3SW1A 4L9FA 1JNUA 4HIAA 4XT2B 3H7WA 4I3JA 4HNBA 4GCZA 4HJ4A 5F5YA 1GSWA 1NWZA 3T50A 3HJKA 2W27A 2D01A 4EETB 3F1OA 1S1ZA 1LL8A 5F69A 3K3CA 4WN5A 1F98A 5J4EA 2PYPA 3LI8A 3H9WA 2OWHA 1XFNA 2VV6A 5F68A 1BYWA 3EEHA 1OTDA 4I5SA
chains in the Genus database with same CATH superfamily
4HJ3A 5DF9A 1JWVA 1OMEA 1CK3A 1YPRA 3LFVA 4GHIA 3KSGA 3K3DA 4HH3A 3OPPA 4S2OA 4WEKA 4YWZA 4IEDA 1N9OA 3WWXA 3LEZA 5DVAA 3R7WA 2Y8HA 1FIKA 4B88A 4PPRA 4P0MA 3TW8A 1M40A 3E98A 3AGFA 2IWBA 1KVMA 5E2HA 2Y4AA 3UO9A 3IHBA 3NDEA 3ITAA 3IXDA 1TS8A 2XD5A 4LV1A 5IU1A 1NYMA 2ZC7A 3UE0A 4IBXA 1FSWA 3B3XA 2GDNA 3TRCA 4KZ9A 4F94A 3KYEA 4O8GA 4GDNA 3MKEA 2CMNA 3HLGA 5GHZA 3G31A 5HZHA 2GX5A 3T1RA 4PM8A 3P98A 4U0XA 1EI5A 4JXGA 5JYPA 1G6AA 2XDMA 1TS0A 4JF4A 4DJ2A 2JC7A 1VEUB 2V1BA 2ZM0A 4DKIA 3MFDA 5AVFA 3HUNA 1L0EA 1HD8A 4KZ3A 5HWWA 2W3DA 4OOYA 3H82B 3E2KA 3IF6C 2IWCA 4IHQA 4X53A 4PKYA 5FSRA 2WUQA 2X01A 1LT0A 3D4FA 3CHWP 5HD5A 2HP6A 2W0NA 4KUOA 4UHUA 4Q8IA 4Y13A 4BBUA 3E4OA 2VA0A 3S7PA 5A92A 1LLBA 2HGVA 3AGDA 2W3EA 5EVEA 1DY6A 4OOMA 4OONA 3VE4A 3UY6A 1S0WA 1DJBA 1K55C 4NXEA 5EM1A 3C7VA 3MR0A 3SH8A 4E6XA 5GLAA 4K08A 3LIFA 3HUMA 1RGYA 4PMAA 3L9KA 3ZG7B 2OLVA 2WK0A 1P97A 1KE3A 3DW0A 2X71A 4QPRA 1JWPA 3F1NA 1OTAA 4JLFA 4ARZA 3G6OA 2V9AA 5HL6A 3TJZC 3NBLA 2J80A 4QD4A 1FSYA 3UE6A 3M6BA 1FILA 3CLOA 3HBRA 2JE5A 4KZ6A 3V39A 5MC7A 2VEAA 4KG5A 4N1HA 3HLWA 5HDSA 1YQSA 4KUKA 3T4KA 3RJUA 2ZQ8A 5L10A 2EFXA 2VV7A 2ZL1B 5AQBA 1GA9A 5EE8A 4WL9A 5FAOA 3O3VA 3C8CA 2EX2A 1N4OA 4EESA 3PBRA 5CRFA 5A8BA 4CQHA 1Y28A 4NK3A 1D7EA 4LV0A 4Z1WA 1K4EA 1NJ4A 3IF6A 1K57C 1BLPA 4MN6A 4GD6A 5HDCA 4GDBA 1G68A 4X6TA 4M3KA 1GA0A 4KQDA 5GHXA 1KOUA 5M19A 5F1GA 5EPHA 2OAQ1 2ACGA 1K4FA 4D60A 4P6ZM 2QKPA 1WA9A 2E8JA 1CJFA 4R70A 3ICYA 1FCMA 3SS4A 2FH5A 3V5MA 1SKOB 2INWA 4KZBA 2J9PA 1DP8A 1K55A 5EV0A 2WGWA 4JGQA 1K38A 4X55A 5DKKA 4LGWA 4GZBA 3VFFA 2V1ZA 2HP9A 2PR6A 1ES3A 3M2JA 3G32A 2VJWA 3LCEA 4KZ5A 4FTXA 4FSFA 3ITBA 2K31A 1XGJA 1H8YA 1OT9A 2DMWA 4E6WA 1K54C 2PDRA 3ZCZA 3CAXA 2DCFA 1YAXA 1JTGA 3SH9A 3PBQA 1UWNX 4YOFA 3S7QA 5EVID 5DFYA 4LRXC 3DTKA 1GHPA 3UB7A 1BSGA 4E3IA 1Y54A 4LCLA 2J9OA 2P04A 2E8IA 5FAPA 3BECA 3HUOA 4JGOA 2H5SA 2EWVA 2M7UA 4PM6A 3ZHHA 3PBTA 1E4DA 3N8SA 2Y2LA 3LI9A 3ZVTA 4PM7A 1MXOA 2L4RA 4Y17A 1YSQA 4BL2A 1LSWA 1XFQA 2P08A 4I3AA 2M1CA 3WS1A 4OPQA 2B95A 3MXSA 3ZG8B 2J3TD 4WLAA 2EX9A 2K2NA 2VKSA 4S2LA 5HL1A 4L9FA 4HIAA 3UNWA 4XT2B 2O99A 2ZMAA 3H7WA 4OKPA 3QNCA 1K57A 3IQAA 3T12B 3U4LP 3T1QB 3CI6A 2Q9MA 5F5YA 1ESUA 2XRNA 2XEPA 3BRMA 2VGJA 1K6SA 4ID4A 3OOVA 3ISGA 2Y59A 4S2JA 1S1ZA 5F69A 3FWLA 4WN5A 1F98A 1DJCA 3H9WA 5HW3A 4OLGA 4ZDXA 2XROA 4D2OA 1PWDA 1HTZA 1XKZA 3HLFA 5GLDA 4C6YA 1VQQA 3BFEA 4QY6A 3IX4A 2FFFB 5CHMA 3S4XA 4HESA 3A3EA 4UQIM 3NIAA 1YKDA 1LHYA 4KZ4A 2PD8A 4GJ4A 3L7HA 4UAAA 5TBMA 1L0FA 1PWCA 2QHKA 4R6LA 3A3FA 4Y0OA 1K54A 2DRWA 3BJNA 4DRTA 1YMSA 1WYCA 3S1YA 2W3GA 4R23A 1W79A 1HVBA 3OCNA 5IT5A 5DJUA 1PI5A 3UDIA 2HDSA 5CGWA 3SS5A 4C75A 3IS2B 2VZWA 2XA7S 2I9VA 1MKIA 3BY8A 1MPLA 1V9YA 4JXWA 1BLCA 1G28A 2L1MA 1O07A 5L09A 4S2PA 2ZC5B 1MZUA 4LENA 2EFUA 3ZG5A 2W3HA 4MN7A 4N1XA 4JXSA 5L8MA 4FUWA 4H6JB 2XFTA 3W2ZA 1VHMA 1XJ4A 4BMWA 2KLIA 1RCJA 3LIDA 4GS9B 4S2KA 1UWPX 1FCNA 1TS7A 2B18A 3NHQA 2VGKA 1FQGA 4MBHA 3S7NA 4N9KA 5FI7A 3Q7VB 3VP4A 1XA7A 5A91A 2H28A 4HP9A 4OP5A 5CX7A 3VOLA 3FKWA 4FCFA 1XJ2A 3UPNA 3LIAA 2KX6A 3P09A 1N9LA 4R38A 1L0GA 4GOGA 3TE8A 1OJ5A 4WYYA 1UGUA 3CJMA 4PAUA 3JPUA 3GTCA 5F82A 4BJPA 1LL5A 3WS0A 2HZ5A 2W3FA 3F1PA 3CZDA 4XUXA 1VETA 3OCLA 3JYIA 5I94A 3MXQA 2W1TA 3EGDC 5F6AA 3HLCA 4ZJ3A 3CUEA 4NKPA 2XK1A 2ZM8A 4LRYC 1GSVA 4F3LA 3T1XA 5FDSA 3QP5A 5EVLA 4CPKA 3W4PA 4EW7A 2A2LA 4R3JA 4AFIA 5HWVA 4X69A 1ALQA 4MNRA 4MBKA 2H0YA 3LY3A 1TVFA 3Q07A 4N9LA 4B4ZA 2XA7M 3MS6A 2FZ0A 4EERA 4Y5FA 4FH4A 5FEFA 3PBSA 2PD7A 4KG6A 3G2ZA 1PRQA 5L07A 1CF0A 4XUZA 3IX3A 5DTKA 2XH9A 2VK3A 4I39A 4CLCC 1RGZA 2OAP1 3DAVA 2BASA 3NOUC 4DDYA 4BBTA 4WBGA 4HBTA 2HF6A 3NDGA 3S22A 3NC8A 4E3OA 3BQAA 4EBPA 4HEFA 5GLCA 5G4ZA 5LBRA 1D1JA 2EX8A 5EOEA 1W63Q 4JF5A 2BLSA 1EWZA 1YLTA 4HJ6A 3IXBA 4Q0HA 1CEGA 4UEYA 3G2YA 2H0TA 1E3UA 1E3UD 5AJGA 5F83A 4E3LA 2P9VA 4GNUA 5F1FA 5J7EA 1QMFA 1TD5A 4MEZA 1NYYA 1YSPA 1T1BA 4EBLA 4A5RA 4YINA 4HH2A 3IWOA 4LLOB 2JKTI 5EM0A 5HAQA 5FQ9A 4GN2A 3A3IA 4IUHA 3ULFA 1TDGA 4PKYG 5DFXA 3QP1A 2XQZA 3BFDA 3IBRA 4OQHA 3T1SA 5I5LA 2JKRM 1XJ3A 3IBJA 5U47A 4ZRRA 1LSVA 1IKIA 3BLMA 1ES4A 3OPRA 2HDUA 3OZHA 4I38A 2EWWA 1FOFA 4R4RA 4XT2A 3VP2A 2OOLA 2QZ6A 4JBFA 3KSFA 3PBNA 4FOFA 1NLZA 4LRZE 5HPFA 3WS2A 5KMWA 4MBFA 4WF0A 2K7SA 4KZ8A 2G7UA 1L2SA 3WRTA 3RXXA 3SH7A 5DF7A 2PYRA 1PZOA 5EOOA 5FQIA 4CLCA 4P87A 5G4YA 2Z2MB 3HREA 4DE0A 3R7WB 5G18A 1WE4A 1X0OA 2VLGA 3DWZA 2RL3A 3RFBA 2C5WB 1HZOA 1I2SA 5K5BA 4KQRA 4O7DA 3ZVWA 4UA6A 4FH2A 2Y55A 2Y2QA 2PBYA 1NWZA 4H8RA 4KENB 3PAEA 1KVLA 5TJJA 2W1RA 2Y91A 4EETB 5CECA 5J4EA 4BL3A 4E3JA 1SDNA 2IA2A 3PTEA 2LB5A 4U3TA 3T4OA 2OWHA 3BFGA 1IOUA 2Y2JA 4O01A 3ZNTA 2O0YA 2VV6A 3LEQA 5F68A 1ONGA 2LB9A 2ZC6B 2DNSA 2PBDP 4PM5A 4JKTA 4I5SA 5GL9A 3UPPA 5CXWA 2HP5A 4WM9A 4E3MA 3W4OA 4OQGA 1FCOA 1GCEA 1OT6A 1XJ6A 1STZA 2X02A 3F1OB 4JF6A 3UB9A 4DXBA 5FI2A 2KDKA 1P9WA 5E43A 1VM1A 1ZKJA 2O9AA 3C4OA 3UMEA 3MZFA 1CEFA 2HJ9C 2FFYA 1NRFA 2WAEA 3FC7A 1CI9A 5BOHA 3UB6A 4DDSA 1SDEA 3N8LA 1D06A 4HP4A 5FL3A 2ZMFA 5L2FA 5FAQA 4WUJA 3IT9A 5CEDA 3FZCA 1ESIA 1PZPA 2WGVA 3UB5P 2V0UA 3MMHA 4MN5A 4EEUA 2JKGA 3KYZA 2ZMVA 5DTTA 2YKHA 3EGXC 1U60A 4EWFA 3IXGA 4OOLA 1MWRA 2EX6A 5FA7A 3VSLA 3TOIA 4EXOA 4X25A 2NUPC 5HAIA 2VV8A 4L9EA 1RP5A 2JKFA 3ZG9B 3V3SA 1LL9A 4ARZB 3NJAA 1XXMA 3C2WA 3CPTA 3PAGA 4U0TA 3O87A 3T4SA 1BLSA 1J9MA 1IYSA 3ZG0A 2WKQA 3FPVA 2WKEA 3GECA 1I5QA 3HLBA 4OVDA 1M6KA 1S67L 2H10A 2PRFA 5EECA 3O5YA 3Q82A 3MQ0A 3UDXA 5CGSA 2HPBA 4K0WA 2HDQA 4X1MA 1GHMA 3FG8A 3IHAA 2J7VA 2ZOIA 3K2NA 2WKIA 3DWKA 3M2KA 3B33A 2QJ7A 4EUZA 1VB6A 2A24B 2GJ3A 2EA9A 4R3AA 4RX3A 3GVBA 5CHUA 2PHYA 5TR7A 3IF5A 2Y2PA 1YLWA 1IELA 2ZQ9A 3VP3A 3NI9A 1ES2A 2ZC4B 2HDRA 5IS1A 1TDLA 3S7OA 2C6WB 3QP8A 3C4PA 3IF6B 2ZQ7A 3WRZA 3FPWA 1H0MA 4ETXA 1OJGA 2EXBA 3V50A 3RH8B 1MWTA 1YLPA 2UWXA 3HCYA 1VEUA 5CHJA 3QP4A 3NCKA 3LIBA 2ZOHA 3I7JA 3HJIA 1Z09A 2Z2LB 3D9YA 3LYXA 1CI8A 3ZDJA 3H82A 3MBZA 3G34A 3FV7A 4YNRA 2XGNA 4DJ3A 2HV1A 2R78A 5CERA 4MLLA 3M6HA 2V8FA 1MC0A 1DP6A 4WEJA 1BTLA 3VP1A 3LR3A 4EU0A 2WZZA 2WGWB 3EWKA 3IWIA 3KX0X 4S2NC 4G3WA 2A49A 3P7NA 1LI0A 4WELA 4ZJ2A 4RA7A 1EROA 3W4QA 4K91A 1G5UA 4K0XA 2EXAA 3VMAA 1Y4OA 3G30A 1OTEA 3A0SA 4BQMA 1PI4A 5FQKA 5HFOA 1MWUA 3OPLA 5FQJA 5EVIB 3PHYA 3OC2A 2GZAA 3E2LA 1XX2A 3VOYA 1N9NA 5FDHA 3UB8A 2JKRI 4R4SA 2Y2MA 2Z6DA 1K6RA 1K56A 1KGFA 1ZC2A 4Z9QA 1T18A 1NRJA 3IX8A 4E3KA 5CTNA 2IWDA 4PHTA 5AQ7A 2QJ5A 2V0WA 4G3VA 3ZQ5A 1BT5A 3A0VA 5DF8A 3SOIA 1ERMA 4IJGA 5A90A 3IXHA 3QNBA 4UA9A 1A0KA 1PYYA 3MZDA 2Y2HA 3W8KA 3RXWA 2Z6CA 2O9CA 3NOPC 5DKLA 3MSHA 4X1LA 2Q9NA 3DTIA 4IBRA 4EEPA 5GHYA 1G6OA 2J3WA 5J8XA 4MDZA 1MWSA 3EEAA 1BULA 4LFUA 1Q2PA 4DE1A 4DE2A 1SHVA 4OPRA 3LICA 3H7WB 1OTBA 2PAVP 2ZL1A 4HHDA 4L0LA 1ODVA 3UMDA 3TSGA 3ZFZA 1K0KA 3D72A 1H8ZA 5FASA 1W8QA 3LR0A 3IH8A 1IKGA 3LO7A 1AWIA 3QP6A 4Y0UA 3A3DA 1XGIA 3DBAA 2PU2A 4OP8A 3BY9A 1T1AA 2UV0E 3GV9A 4BWIA 3ZGAB 1W5DA 3E4QA 4GLQA 1GSXA 5FI6A 1T1CA 2WADA 3DTMA 3MQOA 5GLBA 3VSKA 2R9XA 4NXFA 4KQQA 5DTSA 2WKPA 2ZC3B 4DMZA 4B4XA 3KYQA 4GW9A 4S2NA 5TBMB 4IUKA 2ZQDA 3LUQA 1L3LA 1TF1A 3NECA 4E3NA 4QWOA 1SKOA 3OBFA 4RQ9A 1TEMA 4OQ0A 4XXRA 4NXGA 4E04A 5EFWA 1F2KA 3LR5A 1HLUP 3A0RA 2Y79A 5AVEA 4Y7PA 2ZBBA 4QB8A 1JNUA 2WYXA 4KQOA 5TGFA 3JVUA 4CJNA 1ZHHB 5KSHA 4HNBA 2ZLYA 4HJ4A 1DJAA 1MKMA 3CITA 4EQIA 1H8MA 3F1OA 4GKUA 1LL8A 3K3CA 1P9RA 2PYPA 2AVXA 3N4IA 4G3KA 1XFNA 3ZNYA 3O88A 1C3BA 4KZAA 1NZUA 4S2IA 3B47A 3C30A 4P6ZS 2QYBA 1FR6A 3EEHA 2OLUA 2JBFA 4MCWA 1OPXA 1ES5A 1S6RA 3E0YA 1ACFA 4LV3A 5E2FA 3FYZA 1LSXA 2JHEA 4JGPA 2V2FF 2D02A 4HI4A 1LI9A 2YKFA 1N9BA 1FR1A 4LV2A 4L9GA 4LPZA 4BENA 3PYPA 3LGOA 2Y2NA 1QMEA 4NXBA 1KDWA 4EBNA 5FEGA 1NZOA 2WGIA 2QMIA 5DJTA 5HX9A 5CGXA 4B93A 3QP2A 3KO6A 1YMXA 2VX8A 3U2AA 4ZAMA 2GNXA 5EVIC 5A93A 4I3IA 3KSHA 2JCHA 1SZVA 1DP9A 3F1PB 5AQ9A 1TS6A 3KSIA 4OH0A 1VETB 1JVJA 4GHIB 2W1TB 4BLMA 3WS5A 2PT7A 4EQ1A 4CLCD 3GDIA 2XR0A 3VV4A 1YLZA 1SKFA 5FATA 2WAFA 5M18A 3V3RA 1S4RA 3ZYTA 2A24A 3BLSA 3N8RA 1OTIA 5HAPA 5KZHA 4F3LB 4KZ7A 4B9OA 3BYDA 5KIZA 1I2WA 4RX2A 3T4LA 4S2MA 2JN7A 4BBVA 1WYBA 3D3OA 2J3TC 1T19A 4ETZA 3RTYA 4ESPA 2B5RA 5HSQA 4HBUA 4Y2FA 2Q0OA 1JTDA 4FD8A 4R0QA 4P85A 4UA7A 1CQAA 1PIOA 3UPOA 3PR6A 1KDSA 1IYQA 2M7VA 1W63M 4O0PA 4GB7A 2ZM2A 3GR2A 1PNEA 1IFQA 3UN7A 2WKRA 2PU4A 4Y3IA 3IH9A 3BQ8A 3C38A 3IS2A 4IVKA 3MZEA 1KGGA 1K25A 2Y2IA 1S1YA 1PW1A 3QHYA 5IHVA 5HDDA 2Y2KA 4MMNA 3LR4A 2MJ6A 4JGRA 1IYOA 3BW6A 3GQZA 3G4PA 4OQIA 3OPHA 4IVIA 4UQIS 3UE3A 3BWLA 4ZJ1A 5FQQA 4H6JA 2BG1A 2A3UA 4DXCA 3VP0A 4KG2A 1XPBA 4HY8A 3VE3A 3BFFA 2G2UA 2XD1A 1KE0A 3IWQA 4Y15A 2P7JA 5EVIA 4JPMA 2Y2OA 3EOIA 4GS9A 3UE1A 3T4JA 2P9VB 4N92A 3LIEA 3T4QA 4II7A 4P6BA 2VGLS 3Q7VA 2NUTC 2O9BA 3HVFA 3E4PA 2CC1A 3EQVA 2RCXA 2V8CA 1DRMA 1ONHA 1NY0A 3AGEA 1XP4A 2XFSA 2WKHA 3Q1FA 3F1NB 5J3WA 4ME4A 5D3OA 3WS4A 1ZG4A 1ZG6A 3HL9A 1F5MA 2OV5A 1SCWA 4OPZA 3VFHA 1J3WA 1YM1A 5JYOA 3HLDA 5HD3A 1Z6FA 2PR5A 3VOZA 2Y2GA 1NXYA 1YLYA 3FKVA 4QHCA 2R9WA 1O7EA 2JKTM 3DTEA 4R1GA 3BEBA 1ZTUA 1S4SA 2V1AA 5HWTA 2HJEA 2WZXA 3Q81A 4R3BA 4DN0A 4QJGA 3CMZA 1W7FA 3B42A 4ZTKA 4HQAA 3BFCA 1F9IA 2BTFP 4Q0JA 4YFMA 2XF3A 1E25A 2I72A 3MJQA 1MBLA 1IYPA 4CLCB 4BD0A 3P01A 2OWJA 3OLOA 3MF0A 1S66L 4PM9A 4WZ5C 4BD1A 1W8YA 4QY5A 3SZTA 4M4XA 2OSUA 4JXVA 5HARA 4RVAA 4EUVA 5CEBA 4DE3A 3PXPA 3JVVA 1Q2QA 3Q7ZA 5M1AA 4X68A 1PW8A 3EQUA 3LY4A 3CUEC 1MY8A 3A3JA 2B02A 3CWFA 2QWSA 5CTMA 3NOTC 2XSSA 1PFLA 3UDFA 5KSCA 1KE4A 3G35A 3GMWA 2VGLM 3N7WA 3V67A 1YLJA 4DF6A 4CLCE 1P0ZA 3MQQA 3CG5A 3N6IA 2P74A 1H3QA 4WMCA 4WMCD 1YT4A 4NEED 2ZD8A 2L0WA 1ERQA 1V9ZA 1IEMA 3O86A 4QU3A 1KGEA 3C7UA 4OLDA 2KOIA 2QPNA 3MFXA 3MKFA 5TFQA 3TG9A 1AXBA 1GHIA 1EW0A 2ZJ9A 1L0DA 5E2EA 1H5XA 4HOIA 4X56A 4EV4A 4RYEA 4WZ4A 2V20A 5C5KA 5HPIA 3C5AA 1BUEA 4ZBEA 3SW1A 1K56D 2G2WA 1BZAA 4I3JA 3GSGA 4GCZA 2J8YA 1GSWA 3GRJA 3T50A 3HJKA 2W27A 2D01A 2ZQCA 5FQMA 4OPYA 1JWZA 2XLNA 3LI8A 3R4KA 3MXRA 3NY4A 3T4TA 1PWGA 3BM6A 2ZQAA 4NG2A 4GD8A 3SS3A 4C3QA 4Y0TA 1XA1A 4LCMA 1BYWA 3PBOA 1NLYA 3HLEA 5E2GA 5EUAA 5AQAA 1OTDA 3NULA 4WZ5A 1BLHA 4Q0IA 3CPTB 4NETA
chains in the Genus database with same CATH topology
4HJ3A 3E0YA 5DF9A 1LSXA 2JHEA 4UQIM 1YKDA 4JGPA 2PD8A 4GJ4A 3LFVA 4GHIA 3KSGA 3K3DA 4HH3A 2D02A 4WEKA 4YWZA 4HI4A 2YKFA 5TBMA 1N9OA 4L9GA 1OT6A 4LPZA 2QHKA 1XJ6A 1STZA 3PYPA 4R6LA 3F1OB 3UB9A 3R7WA 2KDKA 2Y8HA 4NXBA 3BJNA 1P9WA 3TW8A 3E98A 2O9AA 3UMEA 2W3GA 5DJTA 2HJ9C 4B93A 3FC7A 3KO6A 2VX8A 3UB6A 3OCNA 1TS8A 3U2AA 1D06A 2GNXA 4HP4A 5IU1A 5IT5A 5FL3A 5DJUA 2ZMFA 4I3IA 3KSHA 4WUJA 1DP9A 3F1PB 1TS6A 3TRCA 3KSIA 3IS2B 2VZWA 2XA7S 2I9VA 2V0UA 3MMHA 4MN5A 3BY8A 4O8GA 4GHIB 1V9YA 2W1TB 4EEUA 3KYZA 2ZMVA 1G28A 2PT7A 2YKHA 4EQ1A 3EGXC 2L1MA 2CMNA 4CLCD 3GDIA 3VV4A 5HZHA 4OOLA 2GX5A 1MZUA 4EXOA 1S4RA 3ZYTA 2A24A 1OTIA 2NUPC 4F3LB 2VV8A 4L9EA 2W3HA 4B9OA 4MN7A 1TS0A 4ARZB 5L8MA 3NJAA 5KIZA 4H6JB 3T4LA 4DJ2A 2JN7A 3C2WA 3W2ZA 4BBVA 2V1BA 3T4SA 3D3OA 1VHMA 1XJ4A 4BMWA 2J3TC 2WKQA 3FPVA 5AVFA 1T19A 3GECA 2KLIA 4ETZA 5HWWA 3RTYA 2W3DA 3H82B 3LIDA 4GS9B 1UWPX 1TS7A 3NHQA 2B18A 4IHQA 5HSQA 1S67L 3S7NA 3O5YA 4Y2FA 4PKYA 3MQ0A 1LT0A 2H28A 5HD5A 3FG8A 4HP9A 3VOLA 5CX7A 2ZOIA 2W0NA 3K2NA 1XJ2A 3LIAA 2KX6A 3B33A 1N9LA 2QJ7A 4KUOA 4R38A 1VB6A 2A24B 2GJ3A 2EA9A 3PR6A 4R3AA 2PHYA 3TE8A 4BBUA 3E4OA 2M7VA 1W63M 4O0PA 1OJ5A 2VA0A 1UGUA 4PAUA 3S7PA 4BJPA 2HGVA 2W3EA 1IFQA 2W3FA 2WKRA 5IS1A 4OOMA 3F1PA 4Y3IA 3BQ8A 3C38A 3IS2A 3VE4A 3OCLA 3S7OA 3MXQA 2W1TA 4NXEA 1S1YA 5HDDA 4MMNA 3EGDC 3MR0A 3LR4A 2MJ6A 4JGRA 5F6AA 3BW6A 3CUEA 4NKPA 4K08A 3LIFA 4LRYC 1GSVA 3FPWA 1P97A 4UQIS 4QPRA 4ETXA 4F3LA 3UE3A 1OJGA 3BWLA 3F1NA 1OTAA 4ARZA 3G6OA 2V9AA 5HL6A 3RH8B 4H6JA 4EW7A 3TJZC 3HCYA 2A2LA 4AFIA 5HWVA 4HY8A 2J80A 3VE3A 3LIBA 2ZOHA 3HJIA 3UE6A 2P7JA 3LYXA 3H82A 3CLOA 3EOIA 4GS9A 3T4JA 5MC7A 4YNRA 2XA7M 3LIEA 3T4QA 4II7A 2VEAA 4DJ3A 2HV1A 2VGLS 2FZ0A 2NUTC 2R78A 2O9BA 3E4PA 4Y5FA 4EERA 3EQVA 5HDSA 3PBSA 4KUKA 3T4KA 1MC0A 2PD7A 1DP6A 4WEJA 1DRMA 3LR3A 4EU0A 3EWKA 2VV7A 3KX0X 4G3WA 3F1NB 3P7NA 4ME4A 4WELA 5J3WA 4I39A 4CLCC 4WL9A 2OAP1 1F5MA 2BASA 3NOUC 1OTEA 3A0SA 3C8CA 4BBTA 4EESA 3PBRA 2HF6A 5A8BA 5HD3A 4CQHA 3PHYA 1Y28A 3OC2A 2GZAA 3BQAA 1N9NA 2PR5A 3UB8A 2JKRI 1D7EA 4Z1WA 2Z6DA 5G4ZA 2JKTM 5LBRA 4MN6A 5HDCA 1ZTUA 1T18A 1S4SA 2V1AA 1W63Q 1NRJA 5HWTA 4KQDA 2HJEA 4DN0A 1KOUA 4PHTA 2QJ5A 2V0WA 4G3VA 3ZQ5A 3A0VA 3B42A 2OAQ1 4IJGA 4HQAA 4HJ6A 1F9IA 4Q0JA 4P6ZM 2QKPA 1WA9A 4Q0HA 4R70A 4UEYA 3ICYA 3MJQA 2Z6CA 5AJGA 2O9CA 3NOPC 2FH5A 5DKLA 4CLCB 3P01A 2INWA 2OWJA 4EEPA 3OLOA 3MF0A 5J7EA 1G6OA 1S66L 2J3WA 4MDZA 1TD5A 1DP8A 3EEAA 1YSPA 1T1BA 4M4XA 4JGQA 3LICA 5DKKA 3H7WB 4EUVA 1OTBA 4HHDA 4L0LA 2PR6A 3PXPA 3JVVA 1ODVA 4HH2A 4LLOB 3EQUA 2JKTI 2VJWA 3UMDA 3D72A 4FSFA 4IUHA 3ULFA 4PKYG 3CUEC 2K31A 5DFXA 3IBRA 3LR0A 2B02A 2DMWA 1OT9A 2PDRA 3CWFA 3CAXA 5I5LA 2JKRM 1XJ3A 1YAXA 2QWSA 3IBJA 3PBQA 1UWNX 4YOFA 3S7QA 5DFYA 3DBAA 4ZRRA 1LSVA 4LRXC 3BY9A 3NOTC 2XSSA 1T1AA 4BWIA 4I38A 2EWWA 3UB7A 4XT2A 3E4QA 2VGLM 4GLQA 2OOLA 1GSXA 3V67A 3KSFA 2P04A 3PBNA 4CLCE 1P0ZA 3MQQA 4FOFA 1T1CA 1NLZA 4JGOA 4LRZE 3MQOA 5HPFA 2EWVA 1H3QA 4WF0A 4NXFA 2M7UA 2K7SA 4NEED 2G7UA 3PBTA 2L0WA 2WKPA 3LI9A 4DMZA 1V9ZA 3KYQA 4GW9A 5TBMB 4IUKA 2PYRA 2L4RA 1YSQA 3LUQA 1TF1A 4CLCA 1LSWA 1XFQA 2P08A 2KOIA 5G4YA 3OBFA 4I3AA 2M1CA 4RQ9A 3MFXA 1EW0A 4NXGA 4E04A 3R7WB 2J3TD 5EFWA 4WLAA 1X0OA 2VLGA 3LR5A 3RFBA 4HOIA 3A0RA 2Y79A 5AVEA 5HPIA 5C5KA 2K2NA 2VKSA 2ZBBA 5K5BA 3SW1A 4L9FA 1JNUA 4HIAA 4XT2B 2O99A 3H7WA 4KQOA 3JVUA 1ZHHB 5KSHA 4I3JA 4HNBA 4GCZA 3CI6A 4HJ4A 5F5YA 1GSWA 1NWZA 2XRNA 3T50A 1MKMA 3CITA 3HJKA 2W27A 3OOVA 2D01A 5TJJA 2W1RA 1H8MA 4EETB 3F1OA 1S1ZA 1LL8A 5F69A 3K3CA 4WN5A 1F98A 5J4EA 1P9RA 2IA2A 2PYPA 3LI8A 3H9WA 2LB5A 3R4KA 3T4OA 4G3KA 3T4TA 2OWHA 1XFNA 1IOUA 2XROA 4O01A 2O0YA 2VV6A 3B47A 5F68A 3C30A 1BYWA 2LB9A 2QYBA 3PBOA 4P6ZS 1NLYA 3EEHA 1OTDA 4MCWA 1OPXA 4Q0IA 4I5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HJ3 A;  1LSX A;  2JHE A;  4JGP A;  2PD8 A;  4GHI A;  3K3D A;  4HH3 A;  2D02 A;  4YWZ A;  4HI4 A;  2YKF A;  5TBM A;  1N9O A;  4L9G A;  1OT6 A;  4LPZ A;  2QHK A;  1XJ6 A;  3PYP A;  4R6L A;  3F1O B;  3UB9 A;  2KDK A;  4NXB A;  3UME A;  5DJT A;  3FC7 A;  3UB6 A;  1TS8 A;  1D06 A;  4HP4 A;  5IU1 A;  5DJU A;  4I3I A;  4WUJ A;  1DP9 A;  3F1P B;  1TS6 A;  3IS2 B;  2I9V A;  2V0U A;  4MN5 A;  3BY8 A;  4GHI B;  1V9Y A;  4EEU A;  1G28 A;  2YKH A;  4EQ1 A;  2L1M A;  2CMN A;  3GDI A;  5HZH A;  1MZU A;  4EXO A;  1S4R A;  2A24 A;  1OTI A;  4F3L B;  2VV8 A;  4L9E A;  4B9O A;  1TS0 A;  3NJA A;  5KIZ A;  4H6J B;  4DJ2 A;  2JN7 A;  3C2W A;  4BBV A;  2V1B A;  1XJ4 A;  2WKQ A;  5AVF A;  1T19 A;  3GEC A;  5HWW A;  3RTY A;  3H82 B;  3LID A;  4GS9 B;  1UWP X;  1TS7 A;  3NHQ A;  5HSQ A;  1S67 L;  4PKY A;  1LT0 A;  2H28 A;  5HD5 A;  3FG8 A;  4HP9 A;  3VOL A;  2ZOI A;  2W0N A;  1XJ2 A;  3LIA A;  2KX6 A;  3B33 A;  1N9L A;  2QJ7 A;  4KUO A;  4R38 A;  1VB6 A;  2A24 B;  2GJ3 A;  2EA9 A;  4R3A A;  2PHY A;  4BBU A;  3E4O A;  1OJ5 A;  1UGU A;  2WKR A;  5IS1 A;  3F1P A;  3IS2 A;  3VE4 A;  3MXQ A;  4NXE A;  1S1Y A;  5HDD A;  3MR0 A;  4JGR A;  5F6A A;  4K08 A;  3LIF A;  4LRY C;  1GSV A;  1P97 A;  4F3L A;  1OJG A;  3BWL A;  3F1N A;  1OTA A;  3G6O A;  2V9A A;  3RH8 B;  4H6J A;  4EW7 A;  5HWV A;  4HY8 A;  2J80 A;  3VE3 A;  3LIB A;  2ZOH A;  3HJI A;  3UE6 A;  2P7J A;  3LYX A;  3H82 A;  3CLO A;  4GS9 A;  3LIE A;  2VEA A;  4DJ3 A;  2HV1 A;  2R78 A;  3E4P A;  4EER A;  5HDS A;  4KUK A;  2PD7 A;  1DP6 A;  1DRM A;  3EWK A;  2VV7 A;  3KX0 X;  5J3W A;  3F1N B;  3P7N A;  4I39 A;  4WL9 A;  2BAS A;  3NOU C;  1OTE A;  3A0S A;  3C8C A;  4BBT A;  4EES A;  5A8B A;  5HD3 A;  3PHY A;  1Y28 A;  1N9N A;  2PR5 A;  3UB8 A;  1D7E A;  2Z6D A;  5G4Z A;  4MN6 A;  5HDC A;  1T18 A;  1S4S A;  2V1A A;  5HWT A;  4KQD A;  1KOU A;  2QJ5 A;  2V0W A;  3ZQ5 A;  3A0V A;  4HQA A;  4HJ6 A;  1F9I A;  2QKP A;  1WA9 A;  4R70 A;  3ICY A;  3MJQ A;  2Z6C A;  3NOP C;  5DKL A;  2INW A;  2OWJ A;  4EEP A;  3OLO A;  5J7E A;  1S66 L;  1DP8 A;  1T1B A;  4M4X A;  4JGQ A;  3LIC A;  5DKK A;  3H7W B;  1OTB A;  4HHD A;  2PR6 A;  4HH2 A;  1ODV A;  4LLO B;  3UMD A;  3D72 A;  3ULF A;  4PKY G;  3IBR A;  2B02 A;  1OT9 A;  2PDR A;  3CWF A;  3CAX A;  5I5L A;  1XJ3 A;  2QWS A;  1UWN X;  1LSV A;  4LRX C;  3NOT C;  3BY9 A;  1T1A A;  4I38 A;  3UB7 A;  4XT2 A;  3E4Q A;  2OOL A;  1GSX A;  1P0Z A;  3MQQ A;  1T1C A;  4JGO A;  4LRZ E;  3MQO A;  4WF0 A;  4NXF A;  2K7S A;  2L0W A;  2WKP A;  3LI9 A;  1V9Z A;  4GW9 A;  5TBM B;  2PYR A;  2L4R A;  3LUQ A;  1LSW A;  1XFQ A;  5G4Y A;  4I3A A;  2M1C A;  4RQ9 A;  3MFX A;  1EW0 A;  4NXG A;  4E04 A;  5EFW A;  4WLA A;  1X0O A;  2VLG A;  4HOI A;  3A0R A;  5AVE A;  2ZBB A;  3SW1 A;  4L9F A;  1JNU A;  4HIA A;  4XT2 B;  3H7W A;  4I3J A;  4HNB A;  4GCZ A;  4HJ4 A;  5F5Y A;  1GSW A;  1NWZ A;  3T50 A;  3HJK A;  2W27 A;  2D01 A;  4EET B;  3F1O A;  1S1Z A;  1LL8 A;  5F69 A;  3K3C A;  4WN5 A;  1F98 A;  5J4E A;  2PYP A;  3LI8 A;  3H9W A;  2OWH A;  1XFN A;  2VV6 A;  5F68 A;  1BYW A;  3EEH A;  1OTD A;  4I5S A; 
#chains in the Genus database with same CATH topology
 4HJ3 A;  5DF9 A;  1JWV A;  1OME A;  1CK3 A;  1YPR A;  3LFV A;  4GHI A;  3KSG A;  3K3D A;  4HH3 A;  3OPP A;  4S2O A;  4WEK A;  4YWZ A;  4IED A;  1N9O A;  3WWX A;  3LEZ A;  5DVA A;  3R7W A;  2Y8H A;  1FIK A;  4B88 A;  4PPR A;  4P0M A;  3TW8 A;  1M40 A;  3E98 A;  3AGF A;  2IWB A;  1KVM A;  5E2H A;  2Y4A A;  3UO9 A;  3IHB A;  3NDE A;  3ITA A;  3IXD A;  1TS8 A;  2XD5 A;  4LV1 A;  5IU1 A;  1NYM A;  2ZC7 A;  3UE0 A;  4IBX A;  1FSW A;  3B3X A;  2GDN A;  3TRC A;  4KZ9 A;  4F94 A;  3KYE A;  4O8G A;  4GDN A;  3MKE A;  2CMN A;  3HLG A;  5GHZ A;  3G31 A;  5HZH A;  2GX5 A;  3T1R A;  4PM8 A;  3P98 A;  4U0X A;  1EI5 A;  4JXG A;  5JYP A;  1G6A A;  2XDM A;  1TS0 A;  4JF4 A;  4DJ2 A;  2JC7 A;  1VEU B;  2V1B A;  2ZM0 A;  4DKI A;  3MFD A;  5AVF A;  3HUN A;  1L0E A;  1HD8 A;  4KZ3 A;  5HWW A;  2W3D A;  4OOY A;  3H82 B;  3E2K A;  3IF6 C;  2IWC A;  4IHQ A;  4X53 A;  4PKY A;  5FSR A;  2WUQ A;  2X01 A;  1LT0 A;  3D4F A;  3CHW P;  5HD5 A;  2HP6 A;  2W0N A;  4KUO A;  4UHU A;  4Q8I A;  4Y13 A;  4BBU A;  3E4O A;  2VA0 A;  3S7P A;  5A92 A;  1LLB A;  2HGV A;  3AGD A;  2W3E A;  5EVE A;  1DY6 A;  4OOM A;  4OON A;  3VE4 A;  3UY6 A;  1S0W A;  1DJB A;  1K55 C;  4NXE A;  5EM1 A;  3C7V A;  3MR0 A;  3SH8 A;  4E6X A;  5GLA A;  4K08 A;  3LIF A;  3HUM A;  1RGY A;  4PMA A;  3L9K A;  3ZG7 B;  2OLV A;  2WK0 A;  1P97 A;  1KE3 A;  3DW0 A;  2X71 A;  4QPR A;  1JWP A;  3F1N A;  1OTA A;  4JLF A;  4ARZ A;  3G6O A;  2V9A A;  5HL6 A;  3TJZ C;  3NBL A;  2J80 A;  4QD4 A;  1FSY A;  3UE6 A;  3M6B A;  1FIL A;  3CLO A;  3HBR A;  2JE5 A;  4KZ6 A;  3V39 A;  5MC7 A;  2VEA A;  4KG5 A;  4N1H A;  3HLW A;  5HDS A;  1YQS A;  4KUK A;  3T4K A;  3RJU A;  2ZQ8 A;  5L10 A;  2EFX A;  2VV7 A;  2ZL1 B;  5AQB A;  1GA9 A;  5EE8 A;  4WL9 A;  5FAO A;  3O3V A;  3C8C A;  2EX2 A;  1N4O A;  4EES A;  3PBR A;  5CRF A;  5A8B A;  4CQH A;  1Y28 A;  4NK3 A;  1D7E A;  4LV0 A;  4Z1W A;  1K4E A;  1NJ4 A;  3IF6 A;  1K57 C;  1BLP A;  4MN6 A;  4GD6 A;  5HDC A;  4GDB A;  1G68 A;  4X6T A;  4M3K A;  1GA0 A;  4KQD A;  5GHX A;  1KOU A;  5M19 A;  5F1G A;  5EPH A;  2OAQ 1;  2ACG A;  1K4F A;  4D60 A;  4P6Z M;  2QKP A;  1WA9 A;  2E8J A;  1CJF A;  4R70 A;  3ICY A;  1FCM A;  3SS4 A;  2FH5 A;  3V5M A;  1SKO B;  2INW A;  4KZB A;  2J9P A;  1DP8 A;  1K55 A;  5EV0 A;  2WGW A;  4JGQ A;  1K38 A;  4X55 A;  5DKK A;  4LGW A;  4GZB A;  3VFF A;  2V1Z A;  2HP9 A;  2PR6 A;  1ES3 A;  3M2J A;  3G32 A;  2VJW A;  3LCE A;  4KZ5 A;  4FTX A;  4FSF A;  3ITB A;  2K31 A;  1XGJ A;  1H8Y A;  1OT9 A;  2DMW A;  4E6W A;  1K54 C;  2PDR A;  3ZCZ A;  3CAX A;  2DCF A;  1YAX A;  1JTG A;  3SH9 A;  3PBQ A;  1UWN X;  4YOF A;  3S7Q A;  5EVI D;  5DFY A;  4LRX C;  3DTK A;  1GHP A;  3UB7 A;  1BSG A;  4E3I A;  1Y54 A;  4LCL A;  2J9O A;  2P04 A;  2E8I A;  5FAP A;  3BEC A;  3HUO A;  4JGO A;  2H5S A;  2EWV A;  2M7U A;  4PM6 A;  3ZHH A;  3PBT A;  1E4D A;  3N8S A;  2Y2L A;  3LI9 A;  3ZVT A;  4PM7 A;  1MXO A;  2L4R A;  4Y17 A;  1YSQ A;  4BL2 A;  1LSW A;  1XFQ A;  2P08 A;  4I3A A;  2M1C A;  3WS1 A;  4OPQ A;  2B95 A;  3MXS A;  3ZG8 B;  2J3T D;  4WLA A;  2EX9 A;  2K2N A;  2VKS A;  4S2L A;  5HL1 A;  4L9F A;  4HIA A;  3UNW A;  4XT2 B;  2O99 A;  2ZMA A;  3H7W A;  4OKP A;  3QNC A;  1K57 A;  3IQA A;  3T12 B;  3U4L P;  3T1Q B;  3CI6 A;  2Q9M A;  5F5Y A;  1ESU A;  2XRN A;  2XEP A;  3BRM A;  2VGJ A;  1K6S A;  4ID4 A;  3OOV A;  3ISG A;  2Y59 A;  4S2J A;  1S1Z A;  5F69 A;  3FWL A;  4WN5 A;  1F98 A;  1DJC A;  3H9W A;  5HW3 A;  4OLG A;  4ZDX A;  2XRO A;  4D2O A;  1PWD A;  1HTZ A;  1XKZ A;  3HLF A;  5GLD A;  4C6Y A;  1VQQ A;  3BFE A;  4QY6 A;  3IX4 A;  2FFF B;  5CHM A;  3S4X A;  4HES A;  3A3E A;  4UQI M;  3NIA A;  1YKD A;  1LHY A;  4KZ4 A;  2PD8 A;  4GJ4 A;  3L7H A;  4UAA A;  5TBM A;  1L0F A;  1PWC A;  2QHK A;  4R6L A;  3A3F A;  4Y0O A;  1K54 A;  2DRW A;  3BJN A;  4DRT A;  1YMS A;  1WYC A;  3S1Y A;  2W3G A;  4R23 A;  1W79 A;  1HVB A;  3OCN A;  5IT5 A;  5DJU A;  1PI5 A;  3UDI A;  2HDS A;  5CGW A;  3SS5 A;  4C75 A;  3IS2 B;  2VZW A;  2XA7 S;  2I9V A;  1MKI A;  3BY8 A;  1MPL A;  1V9Y A;  4JXW A;  1BLC A;  1G28 A;  2L1M A;  1O07 A;  5L09 A;  4S2P A;  2ZC5 B;  1MZU A;  4LEN A;  2EFU A;  3ZG5 A;  2W3H A;  4MN7 A;  4N1X A;  4JXS A;  5L8M A;  4FUW A;  4H6J B;  2XFT A;  3W2Z A;  1VHM A;  1XJ4 A;  4BMW A;  2KLI A;  1RCJ A;  3LID A;  4GS9 B;  4S2K A;  1UWP X;  1FCN A;  1TS7 A;  2B18 A;  3NHQ A;  2VGK A;  1FQG A;  4MBH A;  3S7N A;  4N9K A;  5FI7 A;  3Q7V B;  3VP4 A;  1XA7 A;  5A91 A;  2H28 A;  4HP9 A;  4OP5 A;  5CX7 A;  3VOL A;  3FKW A;  4FCF A;  1XJ2 A;  3UPN A;  3LIA A;  2KX6 A;  3P09 A;  1N9L A;  4R38 A;  1L0G A;  4GOG A;  3TE8 A;  1OJ5 A;  4WYY A;  1UGU A;  3CJM A;  4PAU A;  3JPU A;  3GTC A;  5F82 A;  4BJP A;  1LL5 A;  3WS0 A;  2HZ5 A;  2W3F A;  3F1P A;  3CZD A;  4XUX A;  1VET A;  3OCL A;  3JYI A;  5I94 A;  3MXQ A;  2W1T A;  3EGD C;  5F6A A;  3HLC A;  4ZJ3 A;  3CUE A;  4NKP A;  2XK1 A;  2ZM8 A;  4LRY C;  1GSV A;  4F3L A;  3T1X A;  5FDS A;  3QP5 A;  5EVL A;  4CPK A;  3W4P A;  4EW7 A;  2A2L A;  4R3J A;  4AFI A;  5HWV A;  4X69 A;  1ALQ A;  4MNR A;  4MBK A;  2H0Y A;  3LY3 A;  1TVF A;  3Q07 A;  4N9L A;  4B4Z A;  2XA7 M;  3MS6 A;  2FZ0 A;  4EER A;  4Y5F A;  4FH4 A;  5FEF A;  3PBS A;  2PD7 A;  4KG6 A;  3G2Z A;  1PRQ A;  5L07 A;  1CF0 A;  4XUZ A;  3IX3 A;  5DTK A;  2XH9 A;  2VK3 A;  4I39 A;  4CLC C;  1RGZ A;  2OAP 1;  3DAV A;  2BAS A;  3NOU C;  4DDY A;  4BBT A;  4WBG A;  4HBT A;  2HF6 A;  3NDG A;  3S22 A;  3NC8 A;  4E3O A;  3BQA A;  4EBP A;  4HEF A;  5GLC A;  5G4Z A;  5LBR A;  1D1J A;  2EX8 A;  5EOE A;  1W63 Q;  4JF5 A;  2BLS A;  1EWZ A;  1YLT A;  4HJ6 A;  3IXB A;  4Q0H A;  1CEG A;  4UEY A;  3G2Y A;  2H0T A;  1E3U A;  1E3U D;  5AJG A;  5F83 A;  4E3L A;  2P9V A;  4GNU A;  5F1F A;  5J7E A;  1QMF A;  1TD5 A;  4MEZ A;  1NYY A;  1YSP A;  1T1B A;  4EBL A;  4A5R A;  4YIN A;  4HH2 A;  3IWO A;  4LLO B;  2JKT I;  5EM0 A;  5HAQ A;  5FQ9 A;  4GN2 A;  3A3I A;  4IUH A;  3ULF A;  1TDG A;  4PKY G;  5DFX A;  3QP1 A;  2XQZ A;  3BFD A;  3IBR A;  4OQH A;  3T1S A;  5I5L A;  2JKR M;  1XJ3 A;  3IBJ A;  5U47 A;  4ZRR A;  1LSV A;  1IKI A;  3BLM A;  1ES4 A;  3OPR A;  2HDU A;  3OZH A;  4I38 A;  2EWW A;  1FOF A;  4R4R A;  4XT2 A;  3VP2 A;  2OOL A;  2QZ6 A;  4JBF A;  3KSF A;  3PBN A;  4FOF A;  1NLZ A;  4LRZ E;  5HPF A;  3WS2 A;  5KMW A;  4MBF A;  4WF0 A;  2K7S A;  4KZ8 A;  2G7U A;  1L2S A;  3WRT A;  3RXX A;  3SH7 A;  5DF7 A;  2PYR A;  1PZO A;  5EOO A;  5FQI A;  4CLC A;  4P87 A;  5G4Y A;  2Z2M B;  3HRE A;  4DE0 A;  3R7W B;  5G18 A;  1WE4 A;  1X0O A;  2VLG A;  3DWZ A;  2RL3 A;  3RFB A;  2C5W B;  1HZO A;  1I2S A;  5K5B A;  4KQR A;  4O7D A;  3ZVW A;  4UA6 A;  4FH2 A;  2Y55 A;  2Y2Q A;  2PBY A;  1NWZ A;  4H8R A;  4KEN B;  3PAE A;  1KVL A;  5TJJ A;  2W1R A;  2Y91 A;  4EET B;  5CEC A;  5J4E A;  4BL3 A;  4E3J A;  1SDN A;  2IA2 A;  3PTE A;  2LB5 A;  4U3T A;  3T4O A;  2OWH A;  3BFG A;  1IOU A;  2Y2J A;  4O01 A;  3ZNT A;  2O0Y A;  2VV6 A;  3LEQ A;  5F68 A;  1ONG A;  2LB9 A;  2ZC6 B;  2DNS A;  2PBD P;  4PM5 A;  4JKT A;  4I5S A;  5GL9 A;  3UPP A;  5CXW A;  2HP5 A;  4WM9 A;  4E3M A;  3W4O A;  4OQG A;  1FCO A;  1GCE A;  1OT6 A;  1XJ6 A;  1STZ A;  2X02 A;  3F1O B;  4JF6 A;  3UB9 A;  4DXB A;  5FI2 A;  2KDK A;  1P9W A;  5E43 A;  1VM1 A;  1ZKJ A;  2O9A A;  3C4O A;  3UME A;  3MZF A;  1CEF A;  2HJ9 C;  2FFY A;  1NRF A;  2WAE A;  3FC7 A;  1CI9 A;  5BOH A;  3UB6 A;  4DDS A;  1SDE A;  3N8L A;  1D06 A;  4HP4 A;  5FL3 A;  2ZMF A;  5L2F A;  5FAQ A;  4WUJ A;  3IT9 A;  5CED A;  3FZC A;  1ESI A;  1PZP A;  2WGV A;  3UB5 P;  2V0U A;  3MMH A;  4MN5 A;  4EEU A;  2JKG A;  3KYZ A;  2ZMV A;  5DTT A;  2YKH A;  3EGX C;  1U60 A;  4EWF A;  3IXG A;  4OOL A;  1MWR A;  2EX6 A;  5FA7 A;  3VSL A;  3TOI A;  4EXO A;  4X25 A;  2NUP C;  5HAI A;  2VV8 A;  4L9E A;  1RP5 A;  2JKF A;  3ZG9 B;  3V3S A;  1LL9 A;  4ARZ B;  3NJA A;  1XXM A;  3C2W A;  3CPT A;  3PAG A;  4U0T A;  3O87 A;  3T4S A;  1BLS A;  1J9M A;  1IYS A;  3ZG0 A;  2WKQ A;  3FPV A;  2WKE A;  3GEC A;  1I5Q A;  3HLB A;  4OVD A;  1M6K A;  1S67 L;  2H10 A;  2PRF A;  5EEC A;  3O5Y A;  3Q82 A;  3MQ0 A;  3UDX A;  5CGS A;  2HPB A;  4K0W A;  2HDQ A;  4X1M A;  1GHM A;  3FG8 A;  3IHA A;  2J7V A;  2ZOI A;  3K2N A;  2WKI A;  3DWK A;  3M2K A;  3B33 A;  2QJ7 A;  4EUZ A;  1VB6 A;  2A24 B;  2GJ3 A;  2EA9 A;  4R3A A;  4RX3 A;  3GVB A;  5CHU A;  2PHY A;  5TR7 A;  3IF5 A;  2Y2P A;  1YLW A;  1IEL A;  2ZQ9 A;  3VP3 A;  3NI9 A;  1ES2 A;  2ZC4 B;  2HDR A;  5IS1 A;  1TDL A;  3S7O A;  2C6W B;  3QP8 A;  3C4P A;  3IF6 B;  2ZQ7 A;  3WRZ A;  3FPW A;  1H0M A;  4ETX A;  1OJG A;  2EXB A;  3V50 A;  3RH8 B;  1MWT A;  1YLP A;  2UWX A;  3HCY A;  1VEU A;  5CHJ A;  3QP4 A;  3NCK A;  3LIB A;  2ZOH A;  3I7J A;  3HJI A;  1Z09 A;  2Z2L B;  3D9Y A;  3LYX A;  1CI8 A;  3ZDJ A;  3H82 A;  3MBZ A;  3G34 A;  3FV7 A;  4YNR A;  2XGN A;  4DJ3 A;  2HV1 A;  2R78 A;  5CER A;  4MLL A;  3M6H A;  2V8F A;  1MC0 A;  1DP6 A;  4WEJ A;  1BTL A;  3VP1 A;  3LR3 A;  4EU0 A;  2WZZ A;  2WGW B;  3EWK A;  3IWI A;  3KX0 X;  4S2N C;  4G3W A;  2A49 A;  3P7N A;  1LI0 A;  4WEL A;  4ZJ2 A;  4RA7 A;  1ERO A;  3W4Q A;  4K91 A;  1G5U A;  4K0X A;  2EXA A;  3VMA A;  1Y4O A;  3G30 A;  1OTE A;  3A0S A;  4BQM A;  1PI4 A;  5FQK A;  5HFO A;  1MWU A;  3OPL A;  5FQJ A;  5EVI B;  3PHY A;  3OC2 A;  2GZA A;  3E2L A;  1XX2 A;  3VOY A;  1N9N A;  5FDH A;  3UB8 A;  2JKR I;  4R4S A;  2Y2M A;  2Z6D A;  1K6R A;  1K56 A;  1KGF A;  1ZC2 A;  4Z9Q A;  1T18 A;  1NRJ A;  3IX8 A;  4E3K A;  5CTN A;  2IWD A;  4PHT A;  5AQ7 A;  2QJ5 A;  2V0W A;  4G3V A;  3ZQ5 A;  1BT5 A;  3A0V A;  5DF8 A;  3SOI A;  1ERM A;  4IJG A;  5A90 A;  3IXH A;  3QNB A;  4UA9 A;  1A0K A;  1PYY A;  3MZD A;  2Y2H A;  3W8K A;  3RXW A;  2Z6C A;  2O9C A;  3NOP C;  5DKL A;  3MSH A;  4X1L A;  2Q9N A;  3DTI A;  4IBR A;  4EEP A;  5GHY A;  1G6O A;  2J3W A;  5J8X A;  4MDZ A;  1MWS A;  3EEA A;  1BUL A;  4LFU A;  1Q2P A;  4DE1 A;  4DE2 A;  1SHV A;  4OPR A;  3LIC A;  3H7W B;  1OTB A;  2PAV P;  2ZL1 A;  4HHD A;  4L0L A;  1ODV A;  3UMD A;  3TSG A;  3ZFZ A;  1K0K A;  3D72 A;  1H8Z A;  5FAS A;  1W8Q A;  3LR0 A;  3IH8 A;  1IKG A;  3LO7 A;  1AWI A;  3QP6 A;  4Y0U A;  3A3D A;  1XGI A;  3DBA A;  2PU2 A;  4OP8 A;  3BY9 A;  1T1A A;  2UV0 E;  3GV9 A;  4BWI A;  3ZGA B;  1W5D A;  3E4Q A;  4GLQ A;  1GSX A;  5FI6 A;  1T1C A;  2WAD A;  3DTM A;  3MQO A;  5GLB A;  3VSK A;  2R9X A;  4NXF A;  4KQQ A;  5DTS A;  2WKP A;  2ZC3 B;  4DMZ A;  4B4X A;  3KYQ A;  4GW9 A;  4S2N A;  5TBM B;  4IUK A;  2ZQD A;  3LUQ A;  1L3L A;  1TF1 A;  3NEC A;  4E3N A;  4QWO A;  1SKO A;  3OBF A;  4RQ9 A;  1TEM A;  4OQ0 A;  4XXR A;  4NXG A;  4E04 A;  5EFW A;  1F2K A;  3LR5 A;  1HLU P;  3A0R A;  2Y79 A;  5AVE A;  4Y7P A;  2ZBB A;  4QB8 A;  1JNU A;  2WYX A;  4KQO A;  5TGF A;  3JVU A;  4CJN A;  1ZHH B;  5KSH A;  4HNB A;  2ZLY A;  4HJ4 A;  1DJA A;  1MKM A;  3CIT A;  4EQI A;  1H8M A;  3F1O A;  4GKU A;  1LL8 A;  3K3C A;  1P9R A;  2PYP A;  2AVX A;  3N4I A;  4G3K A;  1XFN A;  3ZNY A;  3O88 A;  1C3B A;  4KZA A;  1NZU A;  4S2I A;  3B47 A;  3C30 A;  4P6Z S;  2QYB A;  1FR6 A;  3EEH A;  2OLU A;  2JBF A;  4MCW A;  1OPX A;  1ES5 A;  1S6R A;  3E0Y A;  1ACF A;  4LV3 A;  5E2F A;  3FYZ A;  1LSX A;  2JHE A;  4JGP A;  2V2F F;  2D02 A;  4HI4 A;  1LI9 A;  2YKF A;  1N9B A;  1FR1 A;  4LV2 A;  4L9G A;  4LPZ A;  4BEN A;  3PYP A;  3LGO A;  2Y2N A;  1QME A;  4NXB A;  1KDW A;  4EBN A;  5FEG A;  1NZO A;  2WGI A;  2QMI A;  5DJT A;  5HX9 A;  5CGX A;  4B93 A;  3QP2 A;  3KO6 A;  1YMX A;  2VX8 A;  3U2A A;  4ZAM A;  2GNX A;  5EVI C;  5A93 A;  4I3I A;  3KSH A;  2JCH A;  1SZV A;  1DP9 A;  3F1P B;  5AQ9 A;  1TS6 A;  3KSI A;  4OH0 A;  1VET B;  1JVJ A;  4GHI B;  2W1T B;  4BLM A;  3WS5 A;  2PT7 A;  4EQ1 A;  4CLC D;  3GDI A;  2XR0 A;  3VV4 A;  1YLZ A;  1SKF A;  5FAT A;  2WAF A;  5M18 A;  3V3R A;  1S4R A;  3ZYT A;  2A24 A;  3BLS A;  3N8R A;  1OTI A;  5HAP A;  5KZH A;  4F3L B;  4KZ7 A;  4B9O A;  3BYD A;  5KIZ A;  1I2W A;  4RX2 A;  3T4L A;  4S2M A;  2JN7 A;  4BBV A;  1WYB A;  3D3O A;  2J3T C;  1T19 A;  4ETZ A;  3RTY A;  4ESP A;  2B5R A;  5HSQ A;  4HBU A;  4Y2F A;  2Q0O A;  1JTD A;  4FD8 A;  4R0Q A;  4P85 A;  4UA7 A;  1CQA A;  1PIO A;  3UPO A;  3PR6 A;  1KDS A;  1IYQ A;  2M7V A;  1W63 M;  4O0P A;  4GB7 A;  2ZM2 A;  3GR2 A;  1PNE A;  1IFQ A;  3UN7 A;  2WKR A;  2PU4 A;  4Y3I A;  3IH9 A;  3BQ8 A;  3C38 A;  3IS2 A;  4IVK A;  3MZE A;  1KGG A;  1K25 A;  2Y2I A;  1S1Y A;  1PW1 A;  3QHY A;  5IHV A;  5HDD A;  2Y2K A;  4MMN A;  3LR4 A;  2MJ6 A;  4JGR A;  1IYO A;  3BW6 A;  3GQZ A;  3G4P A;  4OQI A;  3OPH A;  4IVI A;  4UQI S;  3UE3 A;  3BWL A;  4ZJ1 A;  5FQQ A;  4H6J A;  2BG1 A;  2A3U A;  4DXC A;  3VP0 A;  4KG2 A;  1XPB A;  4HY8 A;  3VE3 A;  3BFF A;  2G2U A;  2XD1 A;  1KE0 A;  3IWQ A;  4Y15 A;  2P7J A;  5EVI A;  4JPM A;  2Y2O A;  3EOI A;  4GS9 A;  3UE1 A;  3T4J A;  2P9V B;  4N92 A;  3LIE A;  3T4Q A;  4II7 A;  4P6B A;  2VGL S;  3Q7V A;  2NUT C;  2O9B A;  3HVF A;  3E4P A;  2CC1 A;  3EQV A;  2RCX A;  2V8C A;  1DRM A;  1ONH A;  1NY0 A;  3AGE A;  1XP4 A;  2XFS A;  2WKH A;  3Q1F A;  3F1N B;  5J3W A;  4ME4 A;  5D3O A;  3WS4 A;  1ZG4 A;  1ZG6 A;  3HL9 A;  1F5M A;  2OV5 A;  1SCW A;  4OPZ A;  3VFH A;  1J3W A;  1YM1 A;  5JYO A;  3HLD A;  5HD3 A;  1Z6F A;  2PR5 A;  3VOZ A;  2Y2G A;  1NXY A;  1YLY A;  3FKV A;  4QHC A;  2R9W A;  1O7E A;  2JKT M;  3DTE A;  4R1G A;  3BEB A;  1ZTU A;  1S4S A;  2V1A A;  5HWT A;  2HJE A;  2WZX A;  3Q81 A;  4R3B A;  4DN0 A;  4QJG A;  3CMZ A;  1W7F A;  3B42 A;  4ZTK A;  4HQA A;  3BFC A;  1F9I A;  2BTF P;  4Q0J A;  4YFM A;  2XF3 A;  1E25 A;  2I72 A;  3MJQ A;  1MBL A;  1IYP A;  4CLC B;  4BD0 A;  3P01 A;  2OWJ A;  3OLO A;  3MF0 A;  1S66 L;  4PM9 A;  4WZ5 C;  4BD1 A;  1W8Y A;  4QY5 A;  3SZT A;  4M4X A;  2OSU A;  4JXV A;  5HAR A;  4RVA A;  4EUV A;  5CEB A;  4DE3 A;  3PXP A;  3JVV A;  1Q2Q A;  3Q7Z A;  5M1A A;  4X68 A;  1PW8 A;  3EQU A;  3LY4 A;  3CUE C;  1MY8 A;  3A3J A;  2B02 A;  3CWF A;  2QWS A;  5CTM A;  3NOT C;  2XSS A;  1PFL A;  3UDF A;  5KSC A;  1KE4 A;  3G35 A;  3GMW A;  2VGL M;  3N7W A;  3V67 A;  1YLJ A;  4DF6 A;  4CLC E;  1P0Z A;  3MQQ A;  3CG5 A;  3N6I A;  2P74 A;  1H3Q A;  4WMC A;  4WMC D;  1YT4 A;  4NEE D;  2ZD8 A;  2L0W A;  1ERQ A;  1V9Z A;  1IEM A;  3O86 A;  4QU3 A;  1KGE A;  3C7U A;  4OLD A;  2KOI A;  2QPN A;  3MFX A;  3MKF A;  5TFQ A;  3TG9 A;  1AXB A;  1GHI A;  1EW0 A;  2ZJ9 A;  1L0D A;  5E2E A;  1H5X A;  4HOI A;  4X56 A;  4EV4 A;  4RYE A;  4WZ4 A;  2V20 A;  5C5K A;  5HPI A;  3C5A A;  1BUE A;  4ZBE A;  3SW1 A;  1K56 D;  2G2W A;  1BZA A;  4I3J A;  3GSG A;  4GCZ A;  2J8Y A;  1GSW A;  3GRJ A;  3T50 A;  3HJK A;  2W27 A;  2D01 A;  2ZQC A;  5FQM A;  4OPY A;  1JWZ A;  2XLN A;  3LI8 A;  3R4K A;  3MXR A;  3NY4 A;  3T4T A;  1PWG A;  3BM6 A;  2ZQA A;  4NG2 A;  4GD8 A;  3SS3 A;  4C3Q A;  4Y0T A;  1XA1 A;  4LCM A;  1BYW A;  3PBO A;  1NLY A;  3HLE A;  5E2G A;  5EUA A;  5AQA A;  1OTD A;  3NUL A;  4WZ5 A;  1BLH A;  4Q0I A;  3CPT B;  4NET A; 
#chains in the Genus database with same CATH homology
 4HJ3 A;  3E0Y A;  5DF9 A;  1LSX A;  2JHE A;  4UQI M;  1YKD A;  4JGP A;  2PD8 A;  4GJ4 A;  3LFV A;  4GHI A;  3KSG A;  3K3D A;  4HH3 A;  2D02 A;  4WEK A;  4YWZ A;  4HI4 A;  2YKF A;  5TBM A;  1N9O A;  4L9G A;  1OT6 A;  4LPZ A;  2QHK A;  1XJ6 A;  1STZ A;  3PYP A;  4R6L A;  3F1O B;  3UB9 A;  3R7W A;  2KDK A;  2Y8H A;  4NXB A;  3BJN A;  1P9W A;  3TW8 A;  3E98 A;  2O9A A;  3UME A;  2W3G A;  5DJT A;  2HJ9 C;  4B93 A;  3FC7 A;  3KO6 A;  2VX8 A;  3UB6 A;  3OCN A;  1TS8 A;  3U2A A;  1D06 A;  2GNX A;  4HP4 A;  5IU1 A;  5IT5 A;  5FL3 A;  5DJU A;  2ZMF A;  4I3I A;  3KSH A;  4WUJ A;  1DP9 A;  3F1P B;  1TS6 A;  3TRC A;  3KSI A;  3IS2 B;  2VZW A;  2XA7 S;  2I9V A;  2V0U A;  3MMH A;  4MN5 A;  3BY8 A;  4O8G A;  4GHI B;  1V9Y A;  2W1T B;  4EEU A;  3KYZ A;  2ZMV A;  1G28 A;  2PT7 A;  2YKH A;  4EQ1 A;  3EGX C;  2L1M A;  2CMN A;  4CLC D;  3GDI A;  3VV4 A;  5HZH A;  4OOL A;  2GX5 A;  1MZU A;  4EXO A;  1S4R A;  3ZYT A;  2A24 A;  1OTI A;  2NUP C;  4F3L B;  2VV8 A;  4L9E A;  2W3H A;  4B9O A;  4MN7 A;  1TS0 A;  4ARZ B;  5L8M A;  3NJA A;  5KIZ A;  4H6J B;  3T4L A;  4DJ2 A;  2JN7 A;  3C2W A;  3W2Z A;  4BBV A;  2V1B A;  3T4S A;  3D3O A;  1VHM A;  1XJ4 A;  4BMW A;  2J3T C;  2WKQ A;  3FPV A;  5AVF A;  1T19 A;  3GEC A;  2KLI A;  4ETZ A;  5HWW A;  3RTY A;  2W3D A;  3H82 B;  3LID A;  4GS9 B;  1UWP X;  1TS7 A;  3NHQ A;  2B18 A;  4IHQ A;  5HSQ A;  1S67 L;  3S7N A;  3O5Y A;  4Y2F A;  4PKY A;  3MQ0 A;  1LT0 A;  2H28 A;  5HD5 A;  3FG8 A;  4HP9 A;  3VOL A;  5CX7 A;  2ZOI A;  2W0N A;  3K2N A;  1XJ2 A;  3LIA A;  2KX6 A;  3B33 A;  1N9L A;  2QJ7 A;  4KUO A;  4R38 A;  1VB6 A;  2A24 B;  2GJ3 A;  2EA9 A;  3PR6 A;  4R3A A;  2PHY A;  3TE8 A;  4BBU A;  3E4O A;  2M7V A;  1W63 M;  4O0P A;  1OJ5 A;  2VA0 A;  1UGU A;  4PAU A;  3S7P A;  4BJP A;  2HGV A;  2W3E A;  1IFQ A;  2W3F A;  2WKR A;  5IS1 A;  4OOM A;  3F1P A;  4Y3I A;  3BQ8 A;  3C38 A;  3IS2 A;  3VE4 A;  3OCL A;  3S7O A;  3MXQ A;  2W1T A;  4NXE A;  1S1Y A;  5HDD A;  4MMN A;  3EGD C;  3MR0 A;  3LR4 A;  2MJ6 A;  4JGR A;  5F6A A;  3BW6 A;  3CUE A;  4NKP A;  4K08 A;  3LIF A;  4LRY C;  1GSV A;  3FPW A;  1P97 A;  4UQI S;  4QPR A;  4ETX A;  4F3L A;  3UE3 A;  1OJG A;  3BWL A;  3F1N A;  1OTA A;  4ARZ A;  3G6O A;  2V9A A;  5HL6 A;  3RH8 B;  4H6J A;  4EW7 A;  3TJZ C;  3HCY A;  2A2L A;  4AFI A;  5HWV A;  4HY8 A;  2J80 A;  3VE3 A;  3LIB A;  2ZOH A;  3HJI A;  3UE6 A;  2P7J A;  3LYX A;  3H82 A;  3CLO A;  3EOI A;  4GS9 A;  3T4J A;  5MC7 A;  4YNR A;  2XA7 M;  3LIE A;  3T4Q A;  4II7 A;  2VEA A;  4DJ3 A;  2HV1 A;  2VGL S;  2FZ0 A;  2NUT C;  2R78 A;  2O9B A;  3E4P A;  4Y5F A;  4EER A;  3EQV A;  5HDS A;  3PBS A;  4KUK A;  3T4K A;  1MC0 A;  2PD7 A;  1DP6 A;  4WEJ A;  1DRM A;  3LR3 A;  4EU0 A;  3EWK A;  2VV7 A;  3KX0 X;  4G3W A;  3F1N B;  3P7N A;  4ME4 A;  4WEL A;  5J3W A;  4I39 A;  4CLC C;  4WL9 A;  2OAP 1;  1F5M A;  2BAS A;  3NOU C;  1OTE A;  3A0S A;  3C8C A;  4BBT A;  4EES A;  3PBR A;  2HF6 A;  5A8B A;  5HD3 A;  4CQH A;  3PHY A;  1Y28 A;  3OC2 A;  2GZA A;  3BQA A;  1N9N A;  2PR5 A;  3UB8 A;  2JKR I;  1D7E A;  4Z1W A;  2Z6D A;  5G4Z A;  2JKT M;  5LBR A;  4MN6 A;  5HDC A;  1ZTU A;  1T18 A;  1S4S A;  2V1A A;  1W63 Q;  1NRJ A;  5HWT A;  4KQD A;  2HJE A;  4DN0 A;  1KOU A;  4PHT A;  2QJ5 A;  2V0W A;  4G3V A;  3ZQ5 A;  3A0V A;  3B42 A;  2OAQ 1;  4IJG A;  4HQA A;  4HJ6 A;  1F9I A;  4Q0J A;  4P6Z M;  2QKP A;  1WA9 A;  4Q0H A;  4R70 A;  4UEY A;  3ICY A;  3MJQ A;  2Z6C A;  5AJG A;  2O9C A;  3NOP C;  2FH5 A;  5DKL A;  4CLC B;  3P01 A;  2INW A;  2OWJ A;  4EEP A;  3OLO A;  3MF0 A;  5J7E A;  1G6O A;  1S66 L;  2J3W A;  4MDZ A;  1TD5 A;  1DP8 A;  3EEA A;  1YSP A;  1T1B A;  4M4X A;  4JGQ A;  3LIC A;  5DKK A;  3H7W B;  4EUV A;  1OTB A;  4HHD A;  4L0L A;  2PR6 A;  3PXP A;  3JVV A;  1ODV A;  4HH2 A;  4LLO B;  3EQU A;  2JKT I;  2VJW A;  3UMD A;  3D72 A;  4FSF A;  4IUH A;  3ULF A;  4PKY G;  3CUE C;  2K31 A;  5DFX A;  3IBR A;  3LR0 A;  2B02 A;  2DMW A;  1OT9 A;  2PDR A;  3CWF A;  3CAX A;  5I5L A;  2JKR M;  1XJ3 A;  1YAX A;  2QWS A;  3IBJ A;  3PBQ A;  1UWN X;  4YOF A;  3S7Q A;  5DFY A;  3DBA A;  4ZRR A;  1LSV A;  4LRX C;  3BY9 A;  3NOT C;  2XSS A;  1T1A A;  4BWI A;  4I38 A;  2EWW A;  3UB7 A;  4XT2 A;  3E4Q A;  2VGL M;  4GLQ A;  2OOL A;  1GSX A;  3V67 A;  3KSF A;  2P04 A;  3PBN A;  4CLC E;  1P0Z A;  3MQQ A;  4FOF A;  1T1C A;  1NLZ A;  4JGO A;  4LRZ E;  3MQO A;  5HPF A;  2EWV A;  1H3Q A;  4WF0 A;  4NXF A;  2M7U A;  2K7S A;  4NEE D;  2G7U A;  3PBT A;  2L0W A;  2WKP A;  3LI9 A;  4DMZ A;  1V9Z A;  3KYQ A;  4GW9 A;  5TBM B;  4IUK A;  2PYR A;  2L4R A;  1YSQ A;  3LUQ A;  1TF1 A;  4CLC A;  1LSW A;  1XFQ A;  2P08 A;  2KOI A;  5G4Y A;  3OBF A;  4I3A A;  2M1C A;  4RQ9 A;  3MFX A;  1EW0 A;  4NXG A;  4E04 A;  3R7W B;  2J3T D;  5EFW A;  4WLA A;  1X0O A;  2VLG A;  3LR5 A;  3RFB A;  4HOI A;  3A0R A;  2Y79 A;  5AVE A;  5HPI A;  5C5K A;  2K2N A;  2VKS A;  2ZBB A;  5K5B A;  3SW1 A;  4L9F A;  1JNU A;  4HIA A;  4XT2 B;  2O99 A;  3H7W A;  4KQO A;  3JVU A;  1ZHH B;  5KSH A;  4I3J A;  4HNB A;  4GCZ A;  3CI6 A;  4HJ4 A;  5F5Y A;  1GSW A;  1NWZ A;  2XRN A;  3T50 A;  1MKM A;  3CIT A;  3HJK A;  2W27 A;  3OOV A;  2D01 A;  5TJJ A;  2W1R A;  1H8M A;  4EET B;  3F1O A;  1S1Z A;  1LL8 A;  5F69 A;  3K3C A;  4WN5 A;  1F98 A;  5J4E A;  1P9R A;  2IA2 A;  2PYP A;  3LI8 A;  3H9W A;  2LB5 A;  3R4K A;  3T4O A;  4G3K A;  3T4T A;  2OWH A;  1XFN A;  1IOU A;  2XRO A;  4O01 A;  2O0Y A;  2VV6 A;  3B47 A;  5F68 A;  3C30 A;  1BYW A;  2LB9 A;  2QYB A;  3PBO A;  4P6Z S;  1NLY A;  3EEH A;  1OTD A;  4MCW A;  1OPX A;  4Q0I A;  4I5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...