2PDRA

1.7 angstrom crystal structure of the photo-excited blue-light photoreceptor vivid
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
147
structure length
147
Chain Sequence
b'TLYAPGGYDIMGYLIQIMNRPNPQVELGPVDTSCALILCDLKQKDTPIVYASEAFLYMTGYSNAEVLGRNCRFLQSPDGMVKPKSTRKYVDSNTINTMRKAIDRNAEVQVEVVNFKKNGQRFVNFLTMIPVRDETGEYRYSMGFQCE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vivid PAS protein VVD
publication title Conformational switching in the fungal light sensor Vivid
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Circadian clock protein
total genus 38
structure length 147
sequence length 147
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2pdrA00
4MN6A 1TS0A 1TS7A 4LPZA 5TBMB 2V0WA 4R3AA 2QHKA 1LSXA 1NWZA 3F1OA 3PYPA 1F98A 1MZUA 2QJ5A 3UB9A 1OTAA 3A0VA 3RTYA 4B9OA 1V9ZA 2VV6A 3SW1A 1F9IA 2HV1A 1XJ2A 3VOLA 2B02A 3H7WA 2GJ3A 4HH2A 3CAXA 3KX0X 4I3AA 3E4OA 4LRYC 5DJUA 2PD7A 3HJIA 4I5SA 5HZHA 2D01A 3H82B 1P97A 1ODVA 4BBUA 2PYPA 4L9EA 4HH3A 1EW0A 3UB6A 4HJ4A 3UB8A 2PR5A 4LLOB 1P0ZA 3MXQA 5G4YA 4WUJA 4NXGA 3LICA 1OT6A 5HD5A 5J4EA 4NXEA 2KX6A 1S67L 2PDRA 5AVEA 1DP6A 5HDCA 3K3DA 1OTIA 2VV7A 3BWLA 4BBTA 2QWSA 2YKFA 3BY9A 2V1AA 5KIZA 3E4QA 5IS1A 4KUOA 4WN5A 4EEUA 5DKKA 4HOIA 3NOTC 2JN7A 2VEAA 4L9GA 4E04A 2L1MA 3C8CA 3F1PB 1LSWA 3MFXA 3MR0A 3LI9A 2PR6A 3RH8B 5F6AA 1XJ6A 3PHYA 3MQQA 5HWVA 4F3LA 3ULFA 5HDDA 2QKPA 1DP9A 3F1OB 2A24A 1OT9A 4LRZE 3H7WB 3EWKA 4JGQA 2QJ7A 2Z6DA 2OWHA 5F68A 1N9NA 3IBRA 4GS9B 1UWPX 1WA9A 2OOLA 3LIFA 4GW9A 2WKRA 4R38A 4HP9A 2Z6CA 2OWJA 3VE3A 3LI8A 3IS2A 4HJ6A 3ICYA 2ZBBA 5DJTA 2INWA 2V1BA 5F5YA 1T18A 4I3IA 5F69A 1DP8A 4GHIA 4EQ1A 2H28A 1OTDA 2CMNA 4H6JA 3LUQA 3D72A 3UMDA 3NOUC 2P7JA 4PKYG 2VLGA 4LRXC 4EW7A 2V9AA 5AVFA 4EXOA 2PHYA 4KUKA 4R6LA 5I5LA 1T1AA 2L0WA 4WF0A 1T1CA 2YKHA 5J3WA 3CLOA 1D7EA 4I39A 1GSWA 1G28A 5G4ZA 1X0OA 4HJ3A 4F3LB 1T1BA 1UWNX 3LIEA 1OTBA 3UB7A 4HY8A 1N9OA 4JGRA 1LL8A 2A24B 5HWTA 1T19A 4JGOA 1DRMA 2I9VA 5DKLA 4EESA 3NJAA 1Y28A 2D02A 2V0UA 5HDSA 2KDKA 4DJ2A 4M4XA 2VV8A 2ZOHA 3LYXA 1JNUA 4NXBA 5HD3A 3GECA 1LSVA 3ZQ5A 3FG8A 3F1NA 5IU1A 3OLOA 3UE6A 2BASA 4WLAA 3B33A 3LIDA 3IS2B 2EA9A 1XJ4A 3G6OA 2M1CA 4GHIB 3K3CA 4K08A 1D06A 1GSVA 4KQDA 4WL9A 4H6JB 4XT2A 2PD8A 1S66L 3LIBA 3A0SA 3NHQA 1BYWA 2WKQA 4DJ3A 4HP4A 4PKYA 2R78A 3HJKA 1OJGA 3GDIA 1LT0A 5TBMA 1V9YA 4GCZA 3FC7A 4I3JA 4R70A 3LIAA 4HHDA 1S4SA 3VE4A 1XFNA 5HWWA 2WKPA 4GS9A 5J7EA 1TS8A 3P7NA 4HI4A 1VB6A 1UGUA 3UMEA 2K7SA 3H9WA 2W27A 3CWFA 3C2WA 3MJQA 4HNBA 4EETB 4NXFA 3H82A 2J80A 4HQAA 4JGPA 3E4PA 4MN5A 3MQOA 3NOPC 1XFQA 1S1ZA 1KOUA 1OJ5A 4RQ9A 1OTEA 3BY8A 2W0NA 4EERA 3F1NB 1TS6A 4EEPA 5A8BA 1S1YA 4YWZA 4HIAA 4BBVA 1N9LA 2ZOIA 4XT2B 1S4RA 1XJ3A 5HSQA 3A0RA 3T50A 2PYRA 3EEHA 4L9FA 2L4RA 4I38A 2JHEA 3F1PA 5EFWA 1GSXA
chains in the Genus database with same CATH superfamily
1TS0A 1IYPA 1TS7A 1HTZA 5TFQA 2MJ6A 3IHAA 5L10A 4R3AA 3NI9A 2BLSA 2PRFA 1FQGA 2V20A 1BT5A 3NCKA 4NEED 4B9OA 5FQ9A 1FOFA 2AVXA 1K38A 4U0XA 3VOLA 2B02A 3H7WA 3VFHA 4IEDA 4DMZA 3DTKA 5A92A 3IWQA 5EM1A 3KX0X 4I3AA 3E4OA 2PD7A 4HEFA 1YPRA 5TJJA 1TD5A 3Q81A 1PIOA 5EVIA 4DDSA 4HH3A 4HJ4A 4LLOB 3MXQA 5HL6A 1KGGA 2HDRA 1K0KA 2GNXA 1PI5A 4Y0OA 3C4PA 3CUEC 4PM7A 3UE3A 5J4EA 1N4OA 3CHWP 4IVKA 4NXEA 4X53A 4JF4A 1PFLA 1H8MA 2FFYA 5AVEA 4KZ9A 2VV7A 4FH4A 5F82A 1J3WA 4NKPA 4KQRA 4BJPA 3G30A 4BENA 2XROA 1NRJA 2JN7A 4CLCC 5FQKA 4BL3A 5DTKA 3VOZA 1WE4A 3F1PB 1KVMA 3MR0A 5CTMA 1CI9A 4E3NA 5F6AA 4OP8A 4EU0A 2VGJA 3T12B 1QMEA 3HREA 3KSFA 3PHYA 1RP5A 4F3LA 4P6BA 3QHYA 5HDDA 3LR4A 4QD4A 1XPBA 2VX8A 2EFUA 3H7WB 4Y5FA 3DTMA 4JF5A 2ZC4B 2OWHA 3IT9A 4DE0A 5GL9A 2V1ZA 3IBRA 2O9BA 4GDNA 5E2FA 4GD6A 5FL3A 2OOLA 3O5YA 3LIFA 4R0QA 3LO7A 5D3OA 3R4KA 1K4EA 1KDSA 1E3UD 4OP5A 3D3OA 4HBUA 3IS2A 4HJ6A 1CK3A 1P9WA 1XP4A 1BLSA 2ZBBA 4HBTA 5DJTA 1CF0A 2QZ6A 1BSGA 2HP5A 4GKUA 2KOIA 1TDGA 2E8IA 3WRTA 1LLBA 3LUQA 3BQ8A 1L0DA 3C30A 5M1AA 3ZHHA 4U0TA 3HCYA 1PZOA 4S2PA 4N9LA 1S0WA 2WAFA 3OCLA 3OPLA 1RGZA 2DMWA 4R6LA 3EOIA 3SH8A 3SS5A 2ACGA 2L0WA 1K57A 2YKHA 2EWVA 1ERQA 1XX2A 5J3WA 3CLOA 4DDYA 4DXBA 4G3KA 4I39A 4YNRA 4ESPA 1F2KA 5GLCA 1YLWA 2WK0A 1L2SA 4WMCA 4F3LB 3LIEA 4HY8A 3NDGA 1H8ZA 3S22A 4L0LA 5AQAA 2ZC6B 3BEBA 4N9KA 1LL8A 4LV2A 4JGOA 3IF6C 4NK3A 3NY4A 1DY6A 1PW1A 4QB8A 4JKTA 2I9VA 4S2IA 5U47A 4BMWA 1KVLA 4GN2A 3NJAA 1Y28A 3CJMA 2Q0OA 2XD5A 5FDHA 1FSYA 5DFXA 1CI8A 3V67A 3HLBA 1JNUA 5KZHA 5JYOA 3T4QA 1D1JA 4BQMA 3PTEA 5AJGA 2VGKA 3OLOA 3UE6A 3B33A 1STZA 1W7FA 3ITAA 3IS2B 4KZ6A 3BW6A 3KSIA 4OPZA 3G6OA 3T1XA 3CZDA 4C3QA 2HZ5A 4K08A 3DBAA 4WL9A 1LL9A 2Y2QA 4G3WA 3QP4A 4R3BA 4QY6A 1SKOA 5G18A 3UO9A 4YINA 3A0SA 1BYWA 2WKQA 1L0EA 2JKFA 4S2NC 1ZG6A 2V8CA 2J8YA 3IH9A 1MWUA 2JBFA 2R78A 1OJGA 2BG1A 2EXAA 3V5MA 1G6OA 5L2FA 4ZJ1A 4R3JA 1LT0A 4JXSA 4S2KA 5HAIA 3W4QA 5J8XA 1NYYA 5L09A 4BLMA 4PAUA 4GCZA 4OPRA 3HLFA 1K56D 1S6RA 2BTFP 3P98A 1S4SA 3ZG5A 1XFNA 1LHYA 3HBRA 3V50A 4GS9A 3MBZA 1Z09A 3G31A 4HI4A 3T1RA 4OOMA 4U3TA 3D4FA 2OAP1 2ZD8A 3H9WA 3VP2A 3EQVA 4NG2A 4NXFA 5FEFA 3H82A 2JKRM 2W3GA 4IUKA 4CLCD 3ZCZA 4MN5A 3VP4A 1CQAA 4WEKA 3MFDA 4JXWA 3OPPA 4OONA 3UPNA 2J7VA 1NXYA 2QYBA 5DVAA 3HUOA 4RQ9A 3BY8A 4X69A 4WM9A 3IXHA 2JCHA 2G2WA 4EEPA 5A8BA 2WGIA 1TDLA 1N9BA 1KE4A 4FH2A 4UA7A 2OAQ1 3GRJA 2LB9A 3E2LA 4YWZA 4HIAA 1XA1A 1G6AA 1NZUA 5L8MA 4O01A 3VOYA 1S4RA 4EV4A 1KGFA 3DTIA 3Q1FA 4X55A 2PYRA 3EEHA 4L9FA 2Q9NA 1SKOB 2JHEA 1G5UA 4LFUA 3OZHA 3WS4A 5FAPA 3EGXC 4AFIA 3MF0A 5EFWA 3P01A 3MXSA 4CQHA 3A3DA 4EBPA 4MN6A 1ONHA 4OH0A 2WUQA 4GD8A 3NBLA 4MCWA 4UHUA 4MBFA 4R23A 4X68A 2QHKA 1LSXA 1XXMA 3F1OA 2W3DA 3BQAA 1GHIA 2ZL1A 1VHMA 3FYZA 1YM1A 1V9ZA 3C38A 3IF6B 1OMEA 4EBNA 1F9IA 4P6ZM 4WELA 3BJNA 5FAQA 3TSGA 1JWVA 3ZVTA 3WS1A 4OQHA 4FTXA 4RX2A 5M19A 1PNEA 1WYCA 4LRYC 4I5SA 5HZHA 3H82B 3A3IA 1GHPA 3V3SA 3FKWA 4EUVA 3OPRA 4JLFA 2ZQ7A 4DXCA 4WUJA 1OT6A 1DJCA 5HD5A 3E2KA 4LGWA 3CITA 2JE5A 3R7WA 3K3DA 1NRFA 2EWWA 3VP1A 4MBKA 3UNWA 3JVUA 5EVIC 1H5XA 4P87A 2J3TC 5KIZA 1SKFA 3O3VA 4K0XA 4X56A 4NETA 5IS1A 5DKKA 3TJZC 3NOTC 4E04A 1PYYA 2L1MA 3BYDA 1LSWA 2VZWA 3MFXA 2VKSA 1XJ6A 4B4ZA 1L3LA 3HLDA 2FZ0A 1TF1A 2QKPA 1DP9A 3F1OB 2G7UA 3KO6A 1C3BA 4Y15A 3BRMA 4GB7A 3N8LA 2WZZA 5FQIA 3EEAA 3ZG8B 4LRZE 5GHYA 4KG2A 1SDEA 5HL1A 4Z9QA 3EWKA 4JGQA 1FR6A 2Z6DA 4GDBA 3ZDJA 3C5AA 5F68A 1UWPX 2Y2LA 1WA9A 2Y91A 3RFBA 4GW9A 4KZBA 3HVFA 4JF6A 2WKRA 3QP6A 3C4OA 2OWJA 3VE3A 1W63M 1ONGA 2Y2MA 3LI8A 4DF6A 3UDXA 3QP8A 2XF3A 3ICYA 2CC1A 3JYIA 4LCLA 2RL3A 2INWA 2V1BA 3NIAA 3M2JA 4X25A 3M6HA 4DKIA 2O0YA 3C7UA 3O88A 4GNUA 3OBFA 4MBHA 3NOUC 4LCMA 4PM9A 3KYZA 4A5RA 2B18A 3VP0A 1VQQA 3V3RA 4LV1A 4N1XA 4KUKA 2VGLM 4P0MA 1T1AA 4EBLA 3S1YA 3N8SA 1T1CA 3IWIA 2HP9A 3Q07A 3ZNTA 2HGVA 4ZJ3A 1G28A 3MS6A 3I7JA 3L7HA 4K91A 1ZHHB 2GZAA 4WYYA 3IXDA 3UB7A 4QPRA 1N9OA 2ZC3B 3EGDC 1KGEA 5HWTA 1NYMA 2ZM0A 3UE0A 1K57C 3Q7VA 1LI0A 5HAQA 4KZ5A 2Y2KA 2D02A 2V0UA 4OOYA 4OPQA 3TG9A 4B4XA 3HUMA 2ZM2A 4NXBA 3DTEA 4B88A 5E2HA 4OQ0A 4RX3A 1LSVA 4XUZA 5DF9A 5CRFA 4ID4A 5IU1A 2Y2PA 3QNBA 2BASA 2Y2NA 2OV5A 2R9WA 3IBJA 4Y2FA 3SS4A 3IQAA 3MXRA 3PXPA 3G2YA 5EVIB 2EFXA 1Y54A 4KQDA 1YSQA 3T1SA 1MKMA 3GR2A 5KMWA 3LY3A 5DF7A 3T4OA 3PBNA 4H8RA 5GLBA 2R9XA 3LIBA 1VM1A 3JVVA 4MEZA 2XLNA 4DJ3A 5E43A 2X71A 1A0KA 3MZFA 2XFSA 3JPUA 3T4KA 1Q2QA 3GDIA 1K6SA 4CJNA 4QWOA 1IKGA 2C6WB 4JPMA 3SZTA 3W4OA 2H10A 1Y4OA 5FEGA 2ZLYA 5J7EA 1CEGA 1J9MA 2IWDA 1VB6A 4ZAMA 5EVID 3IHBA 4D2OA 1MBLA 2B95A 3UN7A 2J3TD 1YLYA 2P04A 4EQIA 3Q7VB 1GCEA 5CGWA 4JGPA 3A3JA 3BFDA 4MN7A 2A49A 1JWZA 2ZQ9A 1EROA 1K55C 4Z1WA 3E98A 4EERA 1FR1A 1TS6A 4YFMA 3FV7A 2J9OA 4ZDXA 5FATA 5EPHA 4R4SA 4N1HA 3BFGA 4BBVA 1GA9A 3PBQA 1ES4A 3A0RA 1XKZA 4IBXA 1NLYA 5CGXA 5HW3A 1JTDA 1EI5A 3VFFA 1HZOA 5KSCA 2J9PA 1MXOA 1NY0A 4LPZA 5JYPA 2V0WA 1E25A 1ESIA 3CPTA 3T1QB 2QMIA 3SH7A 3LEZA 4FCFA 5FQQA 3MZEA 1MZUA 2QJ5A 3AGDA 1NLZA 3UB9A 3KYQA 1OTAA 5EM0A 1EWZA 5A93A 3RTYA 1H3QA 3SW1A 4ARZA 2O9AA 2JKTM 1ALQA 4LENA 1Q2PA 4JBFA 2XA7S 1YLZA 4OQIA 1FCOA 3CAXA 1YLJA 4X1LA 1NJ4A 3G35A 5DJUA 2D01A 4XUXA 1P97A 4RYEA 5EOEA 4O7DA 3UB6A 5DTTA 1K55A 3UB8A 3P09A 2WADA 3ZG0A 1VEUA 3PBRA 2EX2A 5G4YA 5HX9A 5MC7A 4ETZA 4KZ3A 2WKHA 4IJGA 2P9VA 4ZJ2A 2KX6A 1S67L 2PDRA 2A2LA 1JVJA 1L0GA 5FAOA 1OTIA 3A3EA 3HLWA 1GA0A 5CGSA 2EX6A 1IELA 1ES3A 2QWSA 2YKFA 3BY9A 2V1AA 4BWIA 3E4QA 3M2KA 1TEMA 1IOUA 4KUOA 4EEUA 3MZDA 5BOHA 4WMCD 2VEAA 4L9GA 3Q7ZA 1ERMA 1E4DA 3C8CA 3D9YA 1FILA 4DE1A 2PR6A 4EUZA 4GOGA 2GDNA 4OPYA 1ES2A 5HPFA 5HWVA 3MQQA 3CPTB 4PM6A 4JXGA 3QNCA 4S2LA 5EECA 3RXXA 1HD8A 1VETA 3LCEA 5F1FA 3ZG7B 2Y8HA 3OOVA 1TVFA 1OT9A 2XSSA 2IWBA 5F1GA 3N7WA 1AXBA 2QJ7A 3LR3A 2J3WA 1PW8A 5IHVA 4GS9B 2IA2A 4RVAA 2ZMAA 5AQ7A 2WYXA 3VP3A 3GVBA 1YT4A 4R38A 1CJFA 4HP9A 4MLLA 4Q0HA 4Y0UA 4UQIS 2XRNA 3L9KA 3HLGA 1VEUB 1HLUP 1GHMA 3G4PA 3GQZA 4EQ1A 2P9VB 3ITBA 2H28A 2ZQAA 1ZC2A 1YAXA 3LR5A 3BECA 4D60A 3D72A 3UMDA 4KENB 3CI6A 4Q0JA 3O86A 4UAAA 4IBRA 4EW7A 4Y13A 5AVFA 4EXOA 1W5DA 3RJUA 1K4FA 2PHYA 2OLUA 4FUWA 5KSHA 5EUAA 1SHVA 3WWXA 4GZBA 2GX5A 3C7VA 3UY6A 2JKRI 3V39A 5E2GA 3T4JA 2HPBA 4ETXA 3QP5A 1D7EA 3VV4A 1GSWA 3G34A 2PBDP 4WBGA 5G4ZA 1X0OA 3BLSA 3PBSA 3PR6A 1UWNX 1ACFA 3T4LA 1W8YA 4N92A 5E2EA 4JGRA 1FCNA 1W8QA 1K54A 4BD1A 4FD8A 4Y3IA 4II7A 4UA6A 4WEJA 4Y17A 3VSKA 1BZAA 3BLMA 1BLCA 2K2NA 2W3FA 3AGEA 5HDSA 5DF8A 4HESA 2ZL1B 4GLQA 3WS5A 2WKIA 4M4XA 3U2AA 2HP6A 3GECA 3ZNYA 1YSPA 3FG8A 4O0PA 3F1NA 4PHTA 4OLDA 2RCXA 5FSRA 3GMWA 3LIDA 5DTSA 1LL5A 4KG5A 4QY5A 2EA9A 1XJ4A 5FA7A 5CHUA 2Z2LB 2HJEA 4YOFA 3K3CA 4R1GA 3U4LP 2WGWA 3N6IA 4O8GA 1E3UA 2Q9MA 4E3OA 1M40A 2PD8A 3O87A 4ZRRA 3BFFA 4E6XA 4RA7A 5HFOA 4HP4A 2HJ9C 4WZ5A 5I94A 4E3MA 3R7WB 5HPIA 5TBMA 3T4SA 2NUPC 4R70A 3LIAA 3ZYTA 2W3EA 2DCFA 4IVIA 4HHDA 2LB5A 2PU2A 1DJBA 3VE4A 1XGIA 2WKPA 3GTCA 1TS8A 4QJGA 3P7NA 2XA7M 3G32A 2XFTA 3UMEA 1YMSA 2K7SA 2ZQDA 4CLCE 2W27A 3C2WA 3WRZA 4QU3A 3OCNA 4R4RA 2QPNA 1WYBA 5L07A 2J80A 5AQ9A 2EX8A 3TW8A 2K31A 2ZQCA 1ZKJA 4UA9A 3E4PA 3MQOA 3AGFA 3DW0A 1LI9A 3NOPC 4B93A 1S1ZA 2X02A 5C5KA 3UB5P 1OJ5A 3GV9A 4E6WA 1XA7A 3IX8A 3F1NB 1I2WA 2C5WB 2WAEA 1IEMA 2IWCA 2Y2GA 5EVLA 5CXWA 2WKEA 3UE1A 5FQMA 1IFQA 1O07A 3LR0A 4S2OA 5FI2A 1N9LA 3CG5A 2WGWB 2H0YA 4F94A 4ME4A 3G2ZA 3T50A 2L4RA 2HDUA 4I38A 3DWKA 3B42A 1F5MA 3N8RA 3NECA 3LGOA 2XR0A 1GSXA 2FH5A 3M6BA 1ES5A 3UDFA 5TBMB 4PM5A 3PBOA 2UWXA 4P6ZS 3TE8A 3T4TA 1NWZA 2W1TA 3PYPA 1F98A 4G3VA 4GJ4A 4PMAA 1ZG4A 3NDEA 1MC0A 2WZXA 1H8YA 3A0VA 2VV6A 1K6RA 1K56A 5FI7A 3DAVA 3CUEA 2HV1A 1XJ2A 4OKPA 3IX3A 1KE3A 2OLVA 2M7UA 1MWSA 4Q8IA 4M3KA 3S4XA 1PRQA 2GJ3A 4HH2A 3RXWA 1BTLA 2M7VA 3IX4A 3HJIA 3FWLA 1YLPA 2H5SA 1IYSA 2OSUA 3S7NA 1ODVA 4BBUA 1SDNA 2PYPA 4L9EA 4UQIM 1EW0A 3LFVA 2PR5A 5HAPA 1P0ZA 4LV0A 3QP1A 4QHCA 5CHMA 3IH8A 3WS2A 4P85A 1CEFA 3S7PA 4CLCA 4OOLA 4OQGA 4NXGA 3LICA 5HARA 5CEDA 1U60A 4PM8A 2E8JA 1DP6A 5HDCA 5GLDA 1PWDA 3BWLA 3W2ZA 1ESUA 3KSGA 2VK3A 2G2UA 2Y2HA 4BBTA 3MSHA 3ZVWA 1KDWA 1FCMA 4WZ4A 4WN5A 1O7EA 4HOIA 4X1MA 5IT5A 2XQZA 3LI9A 4C75A 3OPHA 3LEQA 2PBYA 3RH8B 1MPLA 2EX9A 5EV0A 2PU4A 3NC8A 3HUNA 5AQBA 3ULFA 2Y55A 2W1TB 3A3FA 3W8KA 3TOIA 3WS0A 4E3IA 1IYOA 2EXBA 2A24A 3IF5A 2Y59A 2A3UA 5A91A 3VSLA 3KSHA 3MKEA 5K5BA 4DRTA 4KZ7A 3SOIA 3ZFZA 4S2MA 2DNSA 5CECA 2PAVP 1N9NA 3FPVA 4EWFA 3UPPA 5FASA 3S7OA 2XEPA 1P9RA 2Z6CA 4DE3A 1JWPA 1PWGA 3SH9A 4CLCB 3EQUA 4OVDA 2JC7A 5F5YA 1T18A 4I3IA 5F69A 1DP8A 2ZM8A 3BFEA 3DWZA 4GHIA 2HDQA 3TRCA 3SS3A 1OTDA 2CMNA 4H6JA 4C6YA 2XGNA 2VGLS 1FSWA 2ZC5B 2P7JA 2WGVA 1M6KA 3MMHA 4PKYG 2VLGA 4LRXC 4JXVA 2W1RA 1AWIA 1RCJA 2V9AA 2V2FF 3QP2A 3IF6A 5I5LA 1IKIA 4WF0A 4FSFA 2W3HA 4ZTKA 2XK1A 3VMAA 2FFFB 4XXRA 1Z6FA 5FDSA 3FZCA 4E3KA 1H0MA 1JTGA 4CPKA 1QMFA 4FOFA 4MMNA 3NULA 1L0FA 1K25A 3B47A 4HJ3A 3BM6A 1MWTA 4Y0TA 1T1BA 3ISGA 1OTBA 5F83A 5EE8A 2O99A 1OPXA 1IYQA 2UV0E 5M18A 2I72A 2A24B 2HF6A 2DRWA 2ZJ9A 1T19A 1SCWA 1DRMA 3MQ0A 5DKLA 5CHJA 1PZPA 4EESA 4KQQA 3E0YA 3GSGA 2ZMVA 5DFYA 2JKGA 4KZ4A 2KDKA 4DJ2A 1YKDA 1MWRA 1PWCA 3PAGA 4KG6A 2VV8A 2ZOHA 3FKVA 2KLIA 1KE0A 3LYXA 5LBRA 5HD3A 1YQSA 4ARZB 3ZQ5A 4S2NA 5GHZA 4KQOA 4OLGA 4WLAA 1K54C 1BULA 2Y2JA 1BUEA 2M1CA 4KZ8A 5GHXA 3S7QA 2NUTC 4GHIB 1D06A 1GSVA 1MKIA 4H6JB 4XT2A 1DJAA 3PBTA 4BL2A 1S66L 5EVEA 2Y79A 3W4PA 2O9CA 3NHQA 4ZBEA 5CTNA 4PKYA 2JKTI 4UEYA 3HJKA 3IWOA 2Y2OA 5TR7A 5CX7A 5FQJA 3HLEA 3IXGA 3HLCA 1YMXA 1FIKA 1V9YA 1W63Q 3FC7A 4I3JA 4DE2A 4E3JA 1NZOA 2VA0A 5HWWA 3IXBA 2ZC7A 2Y2IA 1RGYA 1HVBA 4K0WA 5A90A 1UGUA 4MDZA 5TGFA 4MNRA 3CWFA 3CMZA 3MJQA 4HNBA 4EETB 4WZ5C 3UDIA 3KYEA 3Q82A 1G68A 1BLPA 4LV3A 2P74A 4HQAA 2XH9A 4Y7PA 4IUHA 3B3XA 4X6TA 1YLTA 5FI6A 1XFQA 2V8FA 2XDMA 1VETB 1KOUA 1MY8A 2H0TA 5GLAA 3FPWA 3N4IA 1OTEA 2ZMFA 2W0NA 5CERA 3LY4A 3K2NA 3UPOA 4BD0A 1I5QA 4IHQA 2PT7A 2B5RA 1PI4A 3ZG9B 5EOOA 3BFCA 4E3LA 1S1YA 1ZTUA 4DN0A 1BLHA 3PAEA 2Z2MB 2X01A 2ZOIA 4XT2B 2VJWA 1XJ3A 2Y4AA 1SZVA 5HSQA 1I2SA 2HDSA 4Q0IA 4PPRA 3ZGAB 3MKFA 4S2JA 5CEBA 1XGJA 3OC2A 2XD1A 4KZAA 3HL9A 3F1PA 2ZQ8A 1W79A 2P08A
chains in the Genus database with same CATH topology
4MN6A 1TS0A 1TS7A 4LPZA 5TBMB 2V0WA 4MCWA 2MJ6A 3PBOA 4R3AA 4P6ZS 3TE8A 3T4TA 2QHKA 1LSXA 1NWZA 2W1TA 3F1OA 2W3DA 1F98A 3PYPA 3BQAA 1MZUA 2QJ5A 4G3VA 1NLZA 4GJ4A 3UB9A 1VHMA 3KYQA 1OTAA 1MC0A 3A0VA 3RTYA 1H3QA 4NEED 4B9OA 1V9ZA 2VV6A 3C38A 3SW1A 4ARZA 1F9IA 3CUEA 4P6ZM 2HV1A 1XJ2A 3VOLA 4WELA 2B02A 3BJNA 3H7WA 2O9AA 2JKTM 2M7UA 2XA7S 2GJ3A 4HH2A 4DMZA 3CAXA 3KX0X 4I3AA 2M7VA 3E4OA 4LRYC 5DJUA 2PD7A 3HJIA 4I5SA 5HZHA 2D01A 3H82B 3S7NA 5TJJA 1P97A 1TD5A 1ODVA 4BBUA 2PYPA 4L9EA 4HH3A 4UQIM 1EW0A 3UB6A 3LFVA 4HJ4A 3UB8A 2PR5A 4LLOB 4EUVA 1P0ZA 3MXQA 5HL6A 3PBRA 3S7PA 2GNXA 4CLCA 4OOLA 5G4YA 3CUEC 4WUJA 4NXGA 5MC7A 3LICA 3UE3A 1OT6A 4ETZA 5HD5A 5J4EA 4IJGA 3CITA 4NXEA 2KX6A 1S67L 1H8MA 2PDRA 3R7WA 5AVEA 2A2LA 1DP6A 5HDCA 3K3DA 1OTIA 2VV7A 3BWLA 2EWWA 3W2ZA 3JVUA 3KSGA 4NKPA 4BJPA 4BBTA 2QWSA 2YKFA 3BY9A 2J3TC 2V1AA 4BWIA 5KIZA 3E4QA 1IOUA 5IS1A 1NRJA 2XROA 4KUOA 4WN5A 4EEUA 5DKKA 4HOIA 3TJZC 5IT5A 3NOTC 2JN7A 4CLCC 2VEAA 4L9GA 4E04A 2L1MA 3C8CA 3F1PB 1LSWA 2VZWA 3MFXA 3MR0A 3LI9A 2PR6A 3RH8B 5F6AA 2VKSA 1XJ6A 4EU0A 3KSFA 5HPFA 3PHYA 3MQQA 5HWVA 4F3LA 3ULFA 2FZ0A 1TF1A 5HDDA 2QKPA 1DP9A 2W1TB 3F1OB 2G7UA 3KO6A 3LR4A 2A24A 2Y8HA 3OOVA 1OT9A 3EEAA 4LRZE 2XSSA 3KSHA 5K5BA 2VX8A 3H7WB 4Y5FA 3EWKA 4JGQA 2QJ7A 2Z6DA 3LR3A 2OWHA 2J3WA 5F68A 1N9NA 3IBRA 2O9BA 3FPVA 1UWPX 2IA2A 4GS9B 1WA9A 5FL3A 2OOLA 3O5YA 3RFBA 3LIFA 4GW9A 2WKRA 4R38A 3S7OA 4HP9A 1P9RA 2Z6CA 3R4KA 2OWJA 4Q0HA 3VE3A 1W63M 4UQIS 2XRNA 3LI8A 3D3OA 3IS2A 4HJ6A 1P9WA 4CLCB 3ICYA 3EQUA 2ZBBA 5DJTA 2INWA 2V1BA 5F5YA 1T18A 4I3IA 5F69A 1DP8A 4GHIA 4EQ1A 3TRCA 2KOIA 2O0YA 2H28A 1OTDA 2CMNA 4H6JA 1YAXA 3LR5A 2VGLS 3LUQA 3BQ8A 3D72A 3UMDA 3OBFA 3NOUC 2P7JA 3C30A 3CI6A 3KYZA 3MMHA 4PKYG 4Q0JA 2VLGA 4LRXC 3HCYA 2W1RA 2B18A 2V9AA 4EW7A 3OCLA 5AVFA 4EXOA 2PHYA 4KUKA 2VGLM 5KSHA 2DMWA 4R6LA 5I5LA 3EOIA 1T1AA 2L0WA 4WF0A 4FSFA 2GX5A 2W3HA 2YKHA 1T1CA 2EWVA 2JKRI 3T4JA 5J3WA 3CLOA 4ETXA 1D7EA 4G3KA 4I39A 4YNRA 3VV4A 1GSWA 2HGVA 4FOFA 4MMNA 1G28A 5G4ZA 1X0OA 3B47A 4HJ3A 3PBSA 4F3LB 3PR6A 1T1BA 1UWNX 1ZHHB 2GZAA 3LIEA 1OTBA 3UB7A 3T4LA 2O99A 4HY8A 1OPXA 4QPRA 1N9OA 4L0LA 3EGDC 4JGRA 1LL8A 2A24B 2HF6A 5HWTA 1T19A 4JGOA 1DRMA 3MQ0A 4Y3IA 4II7A 2I9VA 4WEJA 5DKLA 4BMWA 4EESA 3E0YA 3NJAA 1Y28A 2K2NA 2ZMVA 2D02A 2V0UA 2W3FA 5DFYA 5HDSA 2KDKA 4GLQA 1YKDA 4DJ2A 5DFXA 4M4XA 2VV8A 3V67A 3U2AA 2ZOHA 2KLIA 3LYXA 1JNUA 4NXBA 5LBRA 5HD3A 3GECA 1LSVA 3T4QA 4ARZB 3ZQ5A 1YSPA 5DF9A 3FG8A 4O0PA 3F1NA 4KQOA 4PHTA 5AJGA 5IU1A 3OLOA 3UE6A 4CQHA 2BASA 4WLAA 3B33A 3LIDA 1STZA 3IS2B 3BW6A 2EA9A 3IBJA 3KSIA 1XJ4A 4Y2FA 3G6OA 2M1CA 2HJEA 3S7QA 2NUTC 3PXPA 4GHIB 3K3CA 4YOFA 4K08A 1D06A 1GSVA 4KQDA 1YSQA 3DBAA 4WL9A 4H6JB 4O8GA 4XT2A 1MKMA 4G3WA 3PBTA 3T4OA 2PD8A 3PBNA 1S66L 2Y79A 3LIBA 4ZRRA 2O9CA 3JVVA 3A0SA 3NHQA 1BYWA 2WKQA 4DJ3A 4HP4A 4PKYA 2JKTI 2R78A 4UEYA 3HJKA 2HJ9C 1OJGA 1G6OA 3T4KA 3GDIA 5CX7A 3R7WB 1LT0A 5HPIA 4PAUA 5TBMA 1V9YA 3T4SA 4GCZA 1W63Q 3FC7A 4I3JA 2NUPC 4R70A 3LIAA 3ZYTA 2W3EA 4HHDA 2LB5A 1S4SA 2VA0A 1XFNA 3VE4A 5HWWA 2WKPA 4GS9A 5J7EA 1TS8A 3P7NA 2XA7M 4HI4A 1VB6A 4OOMA 1UGUA 3UMEA 4MDZA 2OAP1 2K7SA 4CLCE 3H9WA 2W27A 3CWFA 3C2WA 3EQVA 3MJQA 4HNBA 2J3TD 4EETB 2P04A 1GSXA 3OCNA 4NXFA 3H82A 2JKRM 2J80A 2W3GA 3TW8A 2K31A 4HQAA 4IUKA 4CLCD 4JGPA 3E4PA 4MN5A 4IUHA 3MQOA 4WEKA 3NOPC 1XFQA 4B93A 4MN7A 1S1ZA 2QYBA 1KOUA 5C5KA 1OJ5A 4RQ9A 3FPWA 1OTEA 2ZMFA 3BY8A 4Z1WA 2W0NA 3E98A 4EERA 3K2NA 3F1NB 1TS6A 4EEPA 5A8BA 4IHQA 2PT7A 1IFQA 2OAQ1 1S1YA 1ZTUA 2LB9A 3LR0A 4YWZA 4DN0A 4HIAA 4BBVA 1N9LA 5L8MA 2ZOIA 4O01A 4XT2B 1S4RA 2VJWA 3PBQA 1XJ3A 4ME4A 5HSQA 3A0RA 3T50A 4Q0IA 2PYRA 3EEHA 4L9FA 2L4RA 4I38A 2JHEA 1NLYA 3OC2A 3B42A 1F5MA 3EGXC 3F1PA 4AFIA 3MF0A 5EFWA 3P01A 2P08A 2FH5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MN6 A;  1TS0 A;  1TS7 A;  4LPZ A;  5TBM B;  2V0W A;  4R3A A;  2QHK A;  1LSX A;  1NWZ A;  3F1O A;  3PYP A;  1F98 A;  1MZU A;  2QJ5 A;  3UB9 A;  1OTA A;  3A0V A;  3RTY A;  4B9O A;  1V9Z A;  2VV6 A;  3SW1 A;  1F9I A;  2HV1 A;  1XJ2 A;  3VOL A;  2B02 A;  3H7W A;  2GJ3 A;  4HH2 A;  3CAX A;  3KX0 X;  4I3A A;  3E4O A;  4LRY C;  5DJU A;  2PD7 A;  3HJI A;  4I5S A;  5HZH A;  2D01 A;  3H82 B;  1P97 A;  1ODV A;  4BBU A;  2PYP A;  4L9E A;  4HH3 A;  1EW0 A;  3UB6 A;  4HJ4 A;  3UB8 A;  2PR5 A;  4LLO B;  1P0Z A;  3MXQ A;  5G4Y A;  4WUJ A;  4NXG A;  3LIC A;  1OT6 A;  5HD5 A;  5J4E A;  4NXE A;  2KX6 A;  1S67 L;  2PDR A;  5AVE A;  1DP6 A;  5HDC A;  3K3D A;  1OTI A;  2VV7 A;  3BWL A;  4BBT A;  2QWS A;  2YKF A;  3BY9 A;  2V1A A;  5KIZ A;  3E4Q A;  5IS1 A;  4KUO A;  4WN5 A;  4EEU A;  5DKK A;  4HOI A;  3NOT C;  2JN7 A;  2VEA A;  4L9G A;  4E04 A;  2L1M A;  3C8C A;  3F1P B;  1LSW A;  3MFX A;  3MR0 A;  3LI9 A;  2PR6 A;  3RH8 B;  5F6A A;  1XJ6 A;  3PHY A;  3MQQ A;  5HWV A;  4F3L A;  3ULF A;  5HDD A;  2QKP A;  1DP9 A;  3F1O B;  2A24 A;  1OT9 A;  4LRZ E;  3H7W B;  3EWK A;  4JGQ A;  2QJ7 A;  2Z6D A;  2OWH A;  5F68 A;  1N9N A;  3IBR A;  4GS9 B;  1UWP X;  1WA9 A;  2OOL A;  3LIF A;  4GW9 A;  2WKR A;  4R38 A;  4HP9 A;  2Z6C A;  2OWJ A;  3VE3 A;  3LI8 A;  3IS2 A;  4HJ6 A;  3ICY A;  2ZBB A;  5DJT A;  2INW A;  2V1B A;  5F5Y A;  1T18 A;  4I3I A;  5F69 A;  1DP8 A;  4GHI A;  4EQ1 A;  2H28 A;  1OTD A;  2CMN A;  4H6J A;  3LUQ A;  3D72 A;  3UMD A;  3NOU C;  2P7J A;  4PKY G;  2VLG A;  4LRX C;  4EW7 A;  2V9A A;  5AVF A;  4EXO A;  2PHY A;  4KUK A;  4R6L A;  5I5L A;  1T1A A;  2L0W A;  4WF0 A;  1T1C A;  2YKH A;  5J3W A;  3CLO A;  1D7E A;  4I39 A;  1GSW A;  1G28 A;  5G4Z A;  1X0O A;  4HJ3 A;  4F3L B;  1T1B A;  1UWN X;  3LIE A;  1OTB A;  3UB7 A;  4HY8 A;  1N9O A;  4JGR A;  1LL8 A;  2A24 B;  5HWT A;  1T19 A;  4JGO A;  1DRM A;  2I9V A;  5DKL A;  4EES A;  3NJA A;  1Y28 A;  2D02 A;  2V0U A;  5HDS A;  2KDK A;  4DJ2 A;  4M4X A;  2VV8 A;  2ZOH A;  3LYX A;  1JNU A;  4NXB A;  5HD3 A;  3GEC A;  1LSV A;  3ZQ5 A;  3FG8 A;  3F1N A;  5IU1 A;  3OLO A;  3UE6 A;  2BAS A;  4WLA A;  3B33 A;  3LID A;  3IS2 B;  2EA9 A;  1XJ4 A;  3G6O A;  2M1C A;  4GHI B;  3K3C A;  4K08 A;  1D06 A;  1GSV A;  4KQD A;  4WL9 A;  4H6J B;  4XT2 A;  2PD8 A;  1S66 L;  3LIB A;  3A0S A;  3NHQ A;  1BYW A;  2WKQ A;  4DJ3 A;  4HP4 A;  4PKY A;  2R78 A;  3HJK A;  1OJG A;  3GDI A;  1LT0 A;  5TBM A;  1V9Y A;  4GCZ A;  3FC7 A;  4I3J A;  4R70 A;  3LIA A;  4HHD A;  1S4S A;  3VE4 A;  1XFN A;  5HWW A;  2WKP A;  4GS9 A;  5J7E A;  1TS8 A;  3P7N A;  4HI4 A;  1VB6 A;  1UGU A;  3UME A;  2K7S A;  3H9W A;  2W27 A;  3CWF A;  3C2W A;  3MJQ A;  4HNB A;  4EET B;  4NXF A;  3H82 A;  2J80 A;  4HQA A;  4JGP A;  3E4P A;  4MN5 A;  3MQO A;  3NOP C;  1XFQ A;  1S1Z A;  1KOU A;  1OJ5 A;  4RQ9 A;  1OTE A;  3BY8 A;  2W0N A;  4EER A;  3F1N B;  1TS6 A;  4EEP A;  5A8B A;  1S1Y A;  4YWZ A;  4HIA A;  4BBV A;  1N9L A;  2ZOI A;  4XT2 B;  1S4R A;  1XJ3 A;  5HSQ A;  3A0R A;  3T50 A;  2PYR A;  3EEH A;  4L9F A;  2L4R A;  4I38 A;  2JHE A;  3F1P A;  5EFW A;  1GSX A; 
#chains in the Genus database with same CATH topology
 1TS0 A;  1IYP A;  1TS7 A;  1HTZ A;  5TFQ A;  2MJ6 A;  3IHA A;  5L10 A;  4R3A A;  3NI9 A;  2BLS A;  2PRF A;  1FQG A;  2V20 A;  1BT5 A;  3NCK A;  4NEE D;  4B9O A;  5FQ9 A;  1FOF A;  2AVX A;  1K38 A;  4U0X A;  3VOL A;  2B02 A;  3H7W A;  3VFH A;  4IED A;  4DMZ A;  3DTK A;  5A92 A;  3IWQ A;  5EM1 A;  3KX0 X;  4I3A A;  3E4O A;  2PD7 A;  4HEF A;  1YPR A;  5TJJ A;  1TD5 A;  3Q81 A;  1PIO A;  5EVI A;  4DDS A;  4HH3 A;  4HJ4 A;  4LLO B;  3MXQ A;  5HL6 A;  1KGG A;  2HDR A;  1K0K A;  2GNX A;  1PI5 A;  4Y0O A;  3C4P A;  3CUE C;  4PM7 A;  3UE3 A;  5J4E A;  1N4O A;  3CHW P;  4IVK A;  4NXE A;  4X53 A;  4JF4 A;  1PFL A;  1H8M A;  2FFY A;  5AVE A;  4KZ9 A;  2VV7 A;  4FH4 A;  5F82 A;  1J3W A;  4NKP A;  4KQR A;  4BJP A;  3G30 A;  4BEN A;  2XRO A;  1NRJ A;  2JN7 A;  4CLC C;  5FQK A;  4BL3 A;  5DTK A;  3VOZ A;  1WE4 A;  3F1P B;  1KVM A;  3MR0 A;  5CTM A;  1CI9 A;  4E3N A;  5F6A A;  4OP8 A;  4EU0 A;  2VGJ A;  3T12 B;  1QME A;  3HRE A;  3KSF A;  3PHY A;  1RP5 A;  4F3L A;  4P6B A;  3QHY A;  5HDD A;  3LR4 A;  4QD4 A;  1XPB A;  2VX8 A;  2EFU A;  3H7W B;  4Y5F A;  3DTM A;  4JF5 A;  2ZC4 B;  2OWH A;  3IT9 A;  4DE0 A;  5GL9 A;  2V1Z A;  3IBR A;  2O9B A;  4GDN A;  5E2F A;  4GD6 A;  5FL3 A;  2OOL A;  3O5Y A;  3LIF A;  4R0Q A;  3LO7 A;  5D3O A;  3R4K A;  1K4E A;  1KDS A;  1E3U D;  4OP5 A;  3D3O A;  4HBU A;  3IS2 A;  4HJ6 A;  1CK3 A;  1P9W A;  1XP4 A;  1BLS A;  2ZBB A;  4HBT A;  5DJT A;  1CF0 A;  2QZ6 A;  1BSG A;  2HP5 A;  4GKU A;  2KOI A;  1TDG A;  2E8I A;  3WRT A;  1LLB A;  3LUQ A;  3BQ8 A;  1L0D A;  3C30 A;  5M1A A;  3ZHH A;  4U0T A;  3HCY A;  1PZO A;  4S2P A;  4N9L A;  1S0W A;  2WAF A;  3OCL A;  3OPL A;  1RGZ A;  2DMW A;  4R6L A;  3EOI A;  3SH8 A;  3SS5 A;  2ACG A;  2L0W A;  1K57 A;  2YKH A;  2EWV A;  1ERQ A;  1XX2 A;  5J3W A;  3CLO A;  4DDY A;  4DXB A;  4G3K A;  4I39 A;  4YNR A;  4ESP A;  1F2K A;  5GLC A;  1YLW A;  2WK0 A;  1L2S A;  4WMC A;  4F3L B;  3LIE A;  4HY8 A;  3NDG A;  1H8Z A;  3S22 A;  4L0L A;  5AQA A;  2ZC6 B;  3BEB A;  4N9K A;  1LL8 A;  4LV2 A;  4JGO A;  3IF6 C;  4NK3 A;  3NY4 A;  1DY6 A;  1PW1 A;  4QB8 A;  4JKT A;  2I9V A;  4S2I A;  5U47 A;  4BMW A;  1KVL A;  4GN2 A;  3NJA A;  1Y28 A;  3CJM A;  2Q0O A;  2XD5 A;  5FDH A;  1FSY A;  5DFX A;  1CI8 A;  3V67 A;  3HLB A;  1JNU A;  5KZH A;  5JYO A;  3T4Q A;  1D1J A;  4BQM A;  3PTE A;  5AJG A;  2VGK A;  3OLO A;  3UE6 A;  3B33 A;  1STZ A;  1W7F A;  3ITA A;  3IS2 B;  4KZ6 A;  3BW6 A;  3KSI A;  4OPZ A;  3G6O A;  3T1X A;  3CZD A;  4C3Q A;  2HZ5 A;  4K08 A;  3DBA A;  4WL9 A;  1LL9 A;  2Y2Q A;  4G3W A;  3QP4 A;  4R3B A;  4QY6 A;  1SKO A;  5G18 A;  3UO9 A;  4YIN A;  3A0S A;  1BYW A;  2WKQ A;  1L0E A;  2JKF A;  4S2N C;  1ZG6 A;  2V8C A;  2J8Y A;  3IH9 A;  1MWU A;  2JBF A;  2R78 A;  1OJG A;  2BG1 A;  2EXA A;  3V5M A;  1G6O A;  5L2F A;  4ZJ1 A;  4R3J A;  1LT0 A;  4JXS A;  4S2K A;  5HAI A;  3W4Q A;  5J8X A;  1NYY A;  5L09 A;  4BLM A;  4PAU A;  4GCZ A;  4OPR A;  3HLF A;  1K56 D;  1S6R A;  2BTF P;  3P98 A;  1S4S A;  3ZG5 A;  1XFN A;  1LHY A;  3HBR A;  3V50 A;  4GS9 A;  3MBZ A;  1Z09 A;  3G31 A;  4HI4 A;  3T1R A;  4OOM A;  4U3T A;  3D4F A;  2OAP 1;  2ZD8 A;  3H9W A;  3VP2 A;  3EQV A;  4NG2 A;  4NXF A;  5FEF A;  3H82 A;  2JKR M;  2W3G A;  4IUK A;  4CLC D;  3ZCZ A;  4MN5 A;  3VP4 A;  1CQA A;  4WEK A;  3MFD A;  4JXW A;  3OPP A;  4OON A;  3UPN A;  2J7V A;  1NXY A;  2QYB A;  5DVA A;  3HUO A;  4RQ9 A;  3BY8 A;  4X69 A;  4WM9 A;  3IXH A;  2JCH A;  2G2W A;  4EEP A;  5A8B A;  2WGI A;  1TDL A;  1N9B A;  1KE4 A;  4FH2 A;  4UA7 A;  2OAQ 1;  3GRJ A;  2LB9 A;  3E2L A;  4YWZ A;  4HIA A;  1XA1 A;  1G6A A;  1NZU A;  5L8M A;  4O01 A;  3VOY A;  1S4R A;  4EV4 A;  1KGF A;  3DTI A;  3Q1F A;  4X55 A;  2PYR A;  3EEH A;  4L9F A;  2Q9N A;  1SKO B;  2JHE A;  1G5U A;  4LFU A;  3OZH A;  3WS4 A;  5FAP A;  3EGX C;  4AFI A;  3MF0 A;  5EFW A;  3P01 A;  3MXS A;  4CQH A;  3A3D A;  4EBP A;  4MN6 A;  1ONH A;  4OH0 A;  2WUQ A;  4GD8 A;  3NBL A;  4MCW A;  4UHU A;  4MBF A;  4R23 A;  4X68 A;  2QHK A;  1LSX A;  1XXM A;  3F1O A;  2W3D A;  3BQA A;  1GHI A;  2ZL1 A;  1VHM A;  3FYZ A;  1YM1 A;  1V9Z A;  3C38 A;  3IF6 B;  1OME A;  4EBN A;  1F9I A;  4P6Z M;  4WEL A;  3BJN A;  5FAQ A;  3TSG A;  1JWV A;  3ZVT A;  3WS1 A;  4OQH A;  4FTX A;  4RX2 A;  5M19 A;  1PNE A;  1WYC A;  4LRY C;  4I5S A;  5HZH A;  3H82 B;  3A3I A;  1GHP A;  3V3S A;  3FKW A;  4EUV A;  3OPR A;  4JLF A;  2ZQ7 A;  4DXC A;  4WUJ A;  1OT6 A;  1DJC A;  5HD5 A;  3E2K A;  4LGW A;  3CIT A;  2JE5 A;  3R7W A;  3K3D A;  1NRF A;  2EWW A;  3VP1 A;  4MBK A;  3UNW A;  3JVU A;  5EVI C;  1H5X A;  4P87 A;  2J3T C;  5KIZ A;  1SKF A;  3O3V A;  4K0X A;  4X56 A;  4NET A;  5IS1 A;  5DKK A;  3TJZ C;  3NOT C;  4E04 A;  1PYY A;  2L1M A;  3BYD A;  1LSW A;  2VZW A;  3MFX A;  2VKS A;  1XJ6 A;  4B4Z A;  1L3L A;  3HLD A;  2FZ0 A;  1TF1 A;  2QKP A;  1DP9 A;  3F1O B;  2G7U A;  3KO6 A;  1C3B A;  4Y15 A;  3BRM A;  4GB7 A;  3N8L A;  2WZZ A;  5FQI A;  3EEA A;  3ZG8 B;  4LRZ E;  5GHY A;  4KG2 A;  1SDE A;  5HL1 A;  4Z9Q A;  3EWK A;  4JGQ A;  1FR6 A;  2Z6D A;  4GDB A;  3ZDJ A;  3C5A A;  5F68 A;  1UWP X;  2Y2L A;  1WA9 A;  2Y91 A;  3RFB A;  4GW9 A;  4KZB A;  3HVF A;  4JF6 A;  2WKR A;  3QP6 A;  3C4O A;  2OWJ A;  3VE3 A;  1W63 M;  1ONG A;  2Y2M A;  3LI8 A;  4DF6 A;  3UDX A;  3QP8 A;  2XF3 A;  3ICY A;  2CC1 A;  3JYI A;  4LCL A;  2RL3 A;  2INW A;  2V1B A;  3NIA A;  3M2J A;  4X25 A;  3M6H A;  4DKI A;  2O0Y A;  3C7U A;  3O88 A;  4GNU A;  3OBF A;  4MBH A;  3NOU C;  4LCM A;  4PM9 A;  3KYZ A;  4A5R A;  2B18 A;  3VP0 A;  1VQQ A;  3V3R A;  4LV1 A;  4N1X A;  4KUK A;  2VGL M;  4P0M A;  1T1A A;  4EBL A;  3S1Y A;  3N8S A;  1T1C A;  3IWI A;  2HP9 A;  3Q07 A;  3ZNT A;  2HGV A;  4ZJ3 A;  1G28 A;  3MS6 A;  3I7J A;  3L7H A;  4K91 A;  1ZHH B;  2GZA A;  4WYY A;  3IXD A;  3UB7 A;  4QPR A;  1N9O A;  2ZC3 B;  3EGD C;  1KGE A;  5HWT A;  1NYM A;  2ZM0 A;  3UE0 A;  1K57 C;  3Q7V A;  1LI0 A;  5HAQ A;  4KZ5 A;  2Y2K A;  2D02 A;  2V0U A;  4OOY A;  4OPQ A;  3TG9 A;  4B4X A;  3HUM A;  2ZM2 A;  4NXB A;  3DTE A;  4B88 A;  5E2H A;  4OQ0 A;  4RX3 A;  1LSV A;  4XUZ A;  5DF9 A;  5CRF A;  4ID4 A;  5IU1 A;  2Y2P A;  3QNB A;  2BAS A;  2Y2N A;  2OV5 A;  2R9W A;  3IBJ A;  4Y2F A;  3SS4 A;  3IQA A;  3MXR A;  3PXP A;  3G2Y A;  5EVI B;  2EFX A;  1Y54 A;  4KQD A;  1YSQ A;  3T1S A;  1MKM A;  3GR2 A;  5KMW A;  3LY3 A;  5DF7 A;  3T4O A;  3PBN A;  4H8R A;  5GLB A;  2R9X A;  3LIB A;  1VM1 A;  3JVV A;  4MEZ A;  2XLN A;  4DJ3 A;  5E43 A;  2X71 A;  1A0K A;  3MZF A;  2XFS A;  3JPU A;  3T4K A;  1Q2Q A;  3GDI A;  1K6S A;  4CJN A;  4QWO A;  1IKG A;  2C6W B;  4JPM A;  3SZT A;  3W4O A;  2H10 A;  1Y4O A;  5FEG A;  2ZLY A;  5J7E A;  1CEG A;  1J9M A;  2IWD A;  1VB6 A;  4ZAM A;  5EVI D;  3IHB A;  4D2O A;  1MBL A;  2B95 A;  3UN7 A;  2J3T D;  1YLY A;  2P04 A;  4EQI A;  3Q7V B;  1GCE A;  5CGW A;  4JGP A;  3A3J A;  3BFD A;  4MN7 A;  2A49 A;  1JWZ A;  2ZQ9 A;  1ERO A;  1K55 C;  4Z1W A;  3E98 A;  4EER A;  1FR1 A;  1TS6 A;  4YFM A;  3FV7 A;  2J9O A;  4ZDX A;  5FAT A;  5EPH A;  4R4S A;  4N1H A;  3BFG A;  4BBV A;  1GA9 A;  3PBQ A;  1ES4 A;  3A0R A;  1XKZ A;  4IBX A;  1NLY A;  5CGX A;  5HW3 A;  1JTD A;  1EI5 A;  3VFF A;  1HZO A;  5KSC A;  2J9P A;  1MXO A;  1NY0 A;  4LPZ A;  5JYP A;  2V0W A;  1E25 A;  1ESI A;  3CPT A;  3T1Q B;  2QMI A;  3SH7 A;  3LEZ A;  4FCF A;  5FQQ A;  3MZE A;  1MZU A;  2QJ5 A;  3AGD A;  1NLZ A;  3UB9 A;  3KYQ A;  1OTA A;  5EM0 A;  1EWZ A;  5A93 A;  3RTY A;  1H3Q A;  3SW1 A;  4ARZ A;  2O9A A;  2JKT M;  1ALQ A;  4LEN A;  1Q2P A;  4JBF A;  2XA7 S;  1YLZ A;  4OQI A;  1FCO A;  3CAX A;  1YLJ A;  4X1L A;  1NJ4 A;  3G35 A;  5DJU A;  2D01 A;  4XUX A;  1P97 A;  4RYE A;  5EOE A;  4O7D A;  3UB6 A;  5DTT A;  1K55 A;  3UB8 A;  3P09 A;  2WAD A;  3ZG0 A;  1VEU A;  3PBR A;  2EX2 A;  5G4Y A;  5HX9 A;  5MC7 A;  4ETZ A;  4KZ3 A;  2WKH A;  4IJG A;  2P9V A;  4ZJ2 A;  2KX6 A;  1S67 L;  2PDR A;  2A2L A;  1JVJ A;  1L0G A;  5FAO A;  1OTI A;  3A3E A;  3HLW A;  1GA0 A;  5CGS A;  2EX6 A;  1IEL A;  1ES3 A;  2QWS A;  2YKF A;  3BY9 A;  2V1A A;  4BWI A;  3E4Q A;  3M2K A;  1TEM A;  1IOU A;  4KUO A;  4EEU A;  3MZD A;  5BOH A;  4WMC D;  2VEA A;  4L9G A;  3Q7Z A;  1ERM A;  1E4D A;  3C8C A;  3D9Y A;  1FIL A;  4DE1 A;  2PR6 A;  4EUZ A;  4GOG A;  2GDN A;  4OPY A;  1ES2 A;  5HPF A;  5HWV A;  3MQQ A;  3CPT B;  4PM6 A;  4JXG A;  3QNC A;  4S2L A;  5EEC A;  3RXX A;  1HD8 A;  1VET A;  3LCE A;  5F1F A;  3ZG7 B;  2Y8H A;  3OOV A;  1TVF A;  1OT9 A;  2XSS A;  2IWB A;  5F1G A;  3N7W A;  1AXB A;  2QJ7 A;  3LR3 A;  2J3W A;  1PW8 A;  5IHV A;  4GS9 B;  2IA2 A;  4RVA A;  2ZMA A;  5AQ7 A;  2WYX A;  3VP3 A;  3GVB A;  1YT4 A;  4R38 A;  1CJF A;  4HP9 A;  4MLL A;  4Q0H A;  4Y0U A;  4UQI S;  2XRN A;  3L9K A;  3HLG A;  1VEU B;  1HLU P;  1GHM A;  3G4P A;  3GQZ A;  4EQ1 A;  2P9V B;  3ITB A;  2H28 A;  2ZQA A;  1ZC2 A;  1YAX A;  3LR5 A;  3BEC A;  4D60 A;  3D72 A;  3UMD A;  4KEN B;  3CI6 A;  4Q0J A;  3O86 A;  4UAA A;  4IBR A;  4EW7 A;  4Y13 A;  5AVF A;  4EXO A;  1W5D A;  3RJU A;  1K4F A;  2PHY A;  2OLU A;  4FUW A;  5KSH A;  5EUA A;  1SHV A;  3WWX A;  4GZB A;  2GX5 A;  3C7V A;  3UY6 A;  2JKR I;  3V39 A;  5E2G A;  3T4J A;  2HPB A;  4ETX A;  3QP5 A;  1D7E A;  3VV4 A;  1GSW A;  3G34 A;  2PBD P;  4WBG A;  5G4Z A;  1X0O A;  3BLS A;  3PBS A;  3PR6 A;  1UWN X;  1ACF A;  3T4L A;  1W8Y A;  4N92 A;  5E2E A;  4JGR A;  1FCN A;  1W8Q A;  1K54 A;  4BD1 A;  4FD8 A;  4Y3I A;  4II7 A;  4UA6 A;  4WEJ A;  4Y17 A;  3VSK A;  1BZA A;  3BLM A;  1BLC A;  2K2N A;  2W3F A;  3AGE A;  5HDS A;  5DF8 A;  4HES A;  2ZL1 B;  4GLQ A;  3WS5 A;  2WKI A;  4M4X A;  3U2A A;  2HP6 A;  3GEC A;  3ZNY A;  1YSP A;  3FG8 A;  4O0P A;  3F1N A;  4PHT A;  4OLD A;  2RCX A;  5FSR A;  3GMW A;  3LID A;  5DTS A;  1LL5 A;  4KG5 A;  4QY5 A;  2EA9 A;  1XJ4 A;  5FA7 A;  5CHU A;  2Z2L B;  2HJE A;  4YOF A;  3K3C A;  4R1G A;  3U4L P;  2WGW A;  3N6I A;  4O8G A;  1E3U A;  2Q9M A;  4E3O A;  1M40 A;  2PD8 A;  3O87 A;  4ZRR A;  3BFF A;  4E6X A;  4RA7 A;  5HFO A;  4HP4 A;  2HJ9 C;  4WZ5 A;  5I94 A;  4E3M A;  3R7W B;  5HPI A;  5TBM A;  3T4S A;  2NUP C;  4R70 A;  3LIA A;  3ZYT A;  2W3E A;  2DCF A;  4IVI A;  4HHD A;  2LB5 A;  2PU2 A;  1DJB A;  3VE4 A;  1XGI A;  2WKP A;  3GTC A;  1TS8 A;  4QJG A;  3P7N A;  2XA7 M;  3G32 A;  2XFT A;  3UME A;  1YMS A;  2K7S A;  2ZQD A;  4CLC E;  2W27 A;  3C2W A;  3WRZ A;  4QU3 A;  3OCN A;  4R4R A;  2QPN A;  1WYB A;  5L07 A;  2J80 A;  5AQ9 A;  2EX8 A;  3TW8 A;  2K31 A;  2ZQC A;  1ZKJ A;  4UA9 A;  3E4P A;  3MQO A;  3AGF A;  3DW0 A;  1LI9 A;  3NOP C;  4B93 A;  1S1Z A;  2X02 A;  5C5K A;  3UB5 P;  1OJ5 A;  3GV9 A;  4E6W A;  1XA7 A;  3IX8 A;  3F1N B;  1I2W A;  2C5W B;  2WAE A;  1IEM A;  2IWC A;  2Y2G A;  5EVL A;  5CXW A;  2WKE A;  3UE1 A;  5FQM A;  1IFQ A;  1O07 A;  3LR0 A;  4S2O A;  5FI2 A;  1N9L A;  3CG5 A;  2WGW B;  2H0Y A;  4F94 A;  4ME4 A;  3G2Z A;  3T50 A;  2L4R A;  2HDU A;  4I38 A;  3DWK A;  3B42 A;  1F5M A;  3N8R A;  3NEC A;  3LGO A;  2XR0 A;  1GSX A;  2FH5 A;  3M6B A;  1ES5 A;  3UDF A;  5TBM B;  4PM5 A;  3PBO A;  2UWX A;  4P6Z S;  3TE8 A;  3T4T A;  1NWZ A;  2W1T A;  3PYP A;  1F98 A;  4G3V A;  4GJ4 A;  4PMA A;  1ZG4 A;  3NDE A;  1MC0 A;  2WZX A;  1H8Y A;  3A0V A;  2VV6 A;  1K6R A;  1K56 A;  5FI7 A;  3DAV A;  3CUE A;  2HV1 A;  1XJ2 A;  4OKP A;  3IX3 A;  1KE3 A;  2OLV A;  2M7U A;  1MWS A;  4Q8I A;  4M3K A;  3S4X A;  1PRQ A;  2GJ3 A;  4HH2 A;  3RXW A;  1BTL A;  2M7V A;  3IX4 A;  3HJI A;  3FWL A;  1YLP A;  2H5S A;  1IYS A;  2OSU A;  3S7N A;  1ODV A;  4BBU A;  1SDN A;  2PYP A;  4L9E A;  4UQI M;  1EW0 A;  3LFV A;  2PR5 A;  5HAP A;  1P0Z A;  4LV0 A;  3QP1 A;  4QHC A;  5CHM A;  3IH8 A;  3WS2 A;  4P85 A;  1CEF A;  3S7P A;  4CLC A;  4OOL A;  4OQG A;  4NXG A;  3LIC A;  5HAR A;  5CED A;  1U60 A;  4PM8 A;  2E8J A;  1DP6 A;  5HDC A;  5GLD A;  1PWD A;  3BWL A;  3W2Z A;  1ESU A;  3KSG A;  2VK3 A;  2G2U A;  2Y2H A;  4BBT A;  3MSH A;  3ZVW A;  1KDW A;  1FCM A;  4WZ4 A;  4WN5 A;  1O7E A;  4HOI A;  4X1M A;  5IT5 A;  2XQZ A;  3LI9 A;  4C75 A;  3OPH A;  3LEQ A;  2PBY A;  3RH8 B;  1MPL A;  2EX9 A;  5EV0 A;  2PU4 A;  3NC8 A;  3HUN A;  5AQB A;  3ULF A;  2Y55 A;  2W1T B;  3A3F A;  3W8K A;  3TOI A;  3WS0 A;  4E3I A;  1IYO A;  2EXB A;  2A24 A;  3IF5 A;  2Y59 A;  2A3U A;  5A91 A;  3VSL A;  3KSH A;  3MKE A;  5K5B A;  4DRT A;  4KZ7 A;  3SOI A;  3ZFZ A;  4S2M A;  2DNS A;  5CEC A;  2PAV P;  1N9N A;  3FPV A;  4EWF A;  3UPP A;  5FAS A;  3S7O A;  2XEP A;  1P9R A;  2Z6C A;  4DE3 A;  1JWP A;  1PWG A;  3SH9 A;  4CLC B;  3EQU A;  4OVD A;  2JC7 A;  5F5Y A;  1T18 A;  4I3I A;  5F69 A;  1DP8 A;  2ZM8 A;  3BFE A;  3DWZ A;  4GHI A;  2HDQ A;  3TRC A;  3SS3 A;  1OTD A;  2CMN A;  4H6J A;  4C6Y A;  2XGN A;  2VGL S;  1FSW A;  2ZC5 B;  2P7J A;  2WGV A;  1M6K A;  3MMH A;  4PKY G;  2VLG A;  4LRX C;  4JXV A;  2W1R A;  1AWI A;  1RCJ A;  2V9A A;  2V2F F;  3QP2 A;  3IF6 A;  5I5L A;  1IKI A;  4WF0 A;  4FSF A;  2W3H A;  4ZTK A;  2XK1 A;  3VMA A;  2FFF B;  4XXR A;  1Z6F A;  5FDS A;  3FZC A;  4E3K A;  1H0M A;  1JTG A;  4CPK A;  1QMF A;  4FOF A;  4MMN A;  3NUL A;  1L0F A;  1K25 A;  3B47 A;  4HJ3 A;  3BM6 A;  1MWT A;  4Y0T A;  1T1B A;  3ISG A;  1OTB A;  5F83 A;  5EE8 A;  2O99 A;  1OPX A;  1IYQ A;  2UV0 E;  5M18 A;  2I72 A;  2A24 B;  2HF6 A;  2DRW A;  2ZJ9 A;  1T19 A;  1SCW A;  1DRM A;  3MQ0 A;  5DKL A;  5CHJ A;  1PZP A;  4EES A;  4KQQ A;  3E0Y A;  3GSG A;  2ZMV A;  5DFY A;  2JKG A;  4KZ4 A;  2KDK A;  4DJ2 A;  1YKD A;  1MWR A;  1PWC A;  3PAG A;  4KG6 A;  2VV8 A;  2ZOH A;  3FKV A;  2KLI A;  1KE0 A;  3LYX A;  5LBR A;  5HD3 A;  1YQS A;  4ARZ B;  3ZQ5 A;  4S2N A;  5GHZ A;  4KQO A;  4OLG A;  4WLA A;  1K54 C;  1BUL A;  2Y2J A;  1BUE A;  2M1C A;  4KZ8 A;  5GHX A;  3S7Q A;  2NUT C;  4GHI B;  1D06 A;  1GSV A;  1MKI A;  4H6J B;  4XT2 A;  1DJA A;  3PBT A;  4BL2 A;  1S66 L;  5EVE A;  2Y79 A;  3W4P A;  2O9C A;  3NHQ A;  4ZBE A;  5CTN A;  4PKY A;  2JKT I;  4UEY A;  3HJK A;  3IWO A;  2Y2O A;  5TR7 A;  5CX7 A;  5FQJ A;  3HLE A;  3IXG A;  3HLC A;  1YMX A;  1FIK A;  1V9Y A;  1W63 Q;  3FC7 A;  4I3J A;  4DE2 A;  4E3J A;  1NZO A;  2VA0 A;  5HWW A;  3IXB A;  2ZC7 A;  2Y2I A;  1RGY A;  1HVB A;  4K0W A;  5A90 A;  1UGU A;  4MDZ A;  5TGF A;  4MNR A;  3CWF A;  3CMZ A;  3MJQ A;  4HNB A;  4EET B;  4WZ5 C;  3UDI A;  3KYE A;  3Q82 A;  1G68 A;  1BLP A;  4LV3 A;  2P74 A;  4HQA A;  2XH9 A;  4Y7P A;  4IUH A;  3B3X A;  4X6T A;  1YLT A;  5FI6 A;  1XFQ A;  2V8F A;  2XDM A;  1VET B;  1KOU A;  1MY8 A;  2H0T A;  5GLA A;  3FPW A;  3N4I A;  1OTE A;  2ZMF A;  2W0N A;  5CER A;  3LY4 A;  3K2N A;  3UPO A;  4BD0 A;  1I5Q A;  4IHQ A;  2PT7 A;  2B5R A;  1PI4 A;  3ZG9 B;  5EOO A;  3BFC A;  4E3L A;  1S1Y A;  1ZTU A;  4DN0 A;  1BLH A;  3PAE A;  2Z2M B;  2X01 A;  2ZOI A;  4XT2 B;  2VJW A;  1XJ3 A;  2Y4A A;  1SZV A;  5HSQ A;  1I2S A;  2HDS A;  4Q0I A;  4PPR A;  3ZGA B;  3MKF A;  4S2J A;  5CEB A;  1XGJ A;  3OC2 A;  2XD1 A;  4KZA A;  3HL9 A;  3F1P A;  2ZQ8 A;  1W79 A;  2P08 A; 
#chains in the Genus database with same CATH homology
 4MN6 A;  1TS0 A;  1TS7 A;  4LPZ A;  5TBM B;  2V0W A;  4MCW A;  2MJ6 A;  3PBO A;  4R3A A;  4P6Z S;  3TE8 A;  3T4T A;  2QHK A;  1LSX A;  1NWZ A;  2W1T A;  3F1O A;  2W3D A;  1F98 A;  3PYP A;  3BQA A;  1MZU A;  2QJ5 A;  4G3V A;  1NLZ A;  4GJ4 A;  3UB9 A;  1VHM A;  3KYQ A;  1OTA A;  1MC0 A;  3A0V A;  3RTY A;  1H3Q A;  4NEE D;  4B9O A;  1V9Z A;  2VV6 A;  3C38 A;  3SW1 A;  4ARZ A;  1F9I A;  3CUE A;  4P6Z M;  2HV1 A;  1XJ2 A;  3VOL A;  4WEL A;  2B02 A;  3BJN A;  3H7W A;  2O9A A;  2JKT M;  2M7U A;  2XA7 S;  2GJ3 A;  4HH2 A;  4DMZ A;  3CAX A;  3KX0 X;  4I3A A;  2M7V A;  3E4O A;  4LRY C;  5DJU A;  2PD7 A;  3HJI A;  4I5S A;  5HZH A;  2D01 A;  3H82 B;  3S7N A;  5TJJ A;  1P97 A;  1TD5 A;  1ODV A;  4BBU A;  2PYP A;  4L9E A;  4HH3 A;  4UQI M;  1EW0 A;  3UB6 A;  3LFV A;  4HJ4 A;  3UB8 A;  2PR5 A;  4LLO B;  4EUV A;  1P0Z A;  3MXQ A;  5HL6 A;  3PBR A;  3S7P A;  2GNX A;  4CLC A;  4OOL A;  5G4Y A;  3CUE C;  4WUJ A;  4NXG A;  5MC7 A;  3LIC A;  3UE3 A;  1OT6 A;  4ETZ A;  5HD5 A;  5J4E A;  4IJG A;  3CIT A;  4NXE A;  2KX6 A;  1S67 L;  1H8M A;  2PDR A;  3R7W A;  5AVE A;  2A2L A;  1DP6 A;  5HDC A;  3K3D A;  1OTI A;  2VV7 A;  3BWL A;  2EWW A;  3W2Z A;  3JVU A;  3KSG A;  4NKP A;  4BJP A;  4BBT A;  2QWS A;  2YKF A;  3BY9 A;  2J3T C;  2V1A A;  4BWI A;  5KIZ A;  3E4Q A;  1IOU A;  5IS1 A;  1NRJ A;  2XRO A;  4KUO A;  4WN5 A;  4EEU A;  5DKK A;  4HOI A;  3TJZ C;  5IT5 A;  3NOT C;  2JN7 A;  4CLC C;  2VEA A;  4L9G A;  4E04 A;  2L1M A;  3C8C A;  3F1P B;  1LSW A;  2VZW A;  3MFX A;  3MR0 A;  3LI9 A;  2PR6 A;  3RH8 B;  5F6A A;  2VKS A;  1XJ6 A;  4EU0 A;  3KSF A;  5HPF A;  3PHY A;  3MQQ A;  5HWV A;  4F3L A;  3ULF A;  2FZ0 A;  1TF1 A;  5HDD A;  2QKP A;  1DP9 A;  2W1T B;  3F1O B;  2G7U A;  3KO6 A;  3LR4 A;  2A24 A;  2Y8H A;  3OOV A;  1OT9 A;  3EEA A;  4LRZ E;  2XSS A;  3KSH A;  5K5B A;  2VX8 A;  3H7W B;  4Y5F A;  3EWK A;  4JGQ A;  2QJ7 A;  2Z6D A;  3LR3 A;  2OWH A;  2J3W A;  5F68 A;  1N9N A;  3IBR A;  2O9B A;  3FPV A;  1UWP X;  2IA2 A;  4GS9 B;  1WA9 A;  5FL3 A;  2OOL A;  3O5Y A;  3RFB A;  3LIF A;  4GW9 A;  2WKR A;  4R38 A;  3S7O A;  4HP9 A;  1P9R A;  2Z6C A;  3R4K A;  2OWJ A;  4Q0H A;  3VE3 A;  1W63 M;  4UQI S;  2XRN A;  3LI8 A;  3D3O A;  3IS2 A;  4HJ6 A;  1P9W A;  4CLC B;  3ICY A;  3EQU A;  2ZBB A;  5DJT A;  2INW A;  2V1B A;  5F5Y A;  1T18 A;  4I3I A;  5F69 A;  1DP8 A;  4GHI A;  4EQ1 A;  3TRC A;  2KOI A;  2O0Y A;  2H28 A;  1OTD A;  2CMN A;  4H6J A;  1YAX A;  3LR5 A;  2VGL S;  3LUQ A;  3BQ8 A;  3D72 A;  3UMD A;  3OBF A;  3NOU C;  2P7J A;  3C30 A;  3CI6 A;  3KYZ A;  3MMH A;  4PKY G;  4Q0J A;  2VLG A;  4LRX C;  3HCY A;  2W1R A;  2B18 A;  2V9A A;  4EW7 A;  3OCL A;  5AVF A;  4EXO A;  2PHY A;  4KUK A;  2VGL M;  5KSH A;  2DMW A;  4R6L A;  5I5L A;  3EOI A;  1T1A A;  2L0W A;  4WF0 A;  4FSF A;  2GX5 A;  2W3H A;  2YKH A;  1T1C A;  2EWV A;  2JKR I;  3T4J A;  5J3W A;  3CLO A;  4ETX A;  1D7E A;  4G3K A;  4I39 A;  4YNR A;  3VV4 A;  1GSW A;  2HGV A;  4FOF A;  4MMN A;  1G28 A;  5G4Z A;  1X0O A;  3B47 A;  4HJ3 A;  3PBS A;  4F3L B;  3PR6 A;  1T1B A;  1UWN X;  1ZHH B;  2GZA A;  3LIE A;  1OTB A;  3UB7 A;  3T4L A;  2O99 A;  4HY8 A;  1OPX A;  4QPR A;  1N9O A;  4L0L A;  3EGD C;  4JGR A;  1LL8 A;  2A24 B;  2HF6 A;  5HWT A;  1T19 A;  4JGO A;  1DRM A;  3MQ0 A;  4Y3I A;  4II7 A;  2I9V A;  4WEJ A;  5DKL A;  4BMW A;  4EES A;  3E0Y A;  3NJA A;  1Y28 A;  2K2N A;  2ZMV A;  2D02 A;  2V0U A;  2W3F A;  5DFY A;  5HDS A;  2KDK A;  4GLQ A;  1YKD A;  4DJ2 A;  5DFX A;  4M4X A;  2VV8 A;  3V67 A;  3U2A A;  2ZOH A;  2KLI A;  3LYX A;  1JNU A;  4NXB A;  5LBR A;  5HD3 A;  3GEC A;  1LSV A;  3T4Q A;  4ARZ B;  3ZQ5 A;  1YSP A;  5DF9 A;  3FG8 A;  4O0P A;  3F1N A;  4KQO A;  4PHT A;  5AJG A;  5IU1 A;  3OLO A;  3UE6 A;  4CQH A;  2BAS A;  4WLA A;  3B33 A;  3LID A;  1STZ A;  3IS2 B;  3BW6 A;  2EA9 A;  3IBJ A;  3KSI A;  1XJ4 A;  4Y2F A;  3G6O A;  2M1C A;  2HJE A;  3S7Q A;  2NUT C;  3PXP A;  4GHI B;  3K3C A;  4YOF A;  4K08 A;  1D06 A;  1GSV A;  4KQD A;  1YSQ A;  3DBA A;  4WL9 A;  4H6J B;  4O8G A;  4XT2 A;  1MKM A;  4G3W A;  3PBT A;  3T4O A;  2PD8 A;  3PBN A;  1S66 L;  2Y79 A;  3LIB A;  4ZRR A;  2O9C A;  3JVV A;  3A0S A;  3NHQ A;  1BYW A;  2WKQ A;  4DJ3 A;  4HP4 A;  4PKY A;  2JKT I;  2R78 A;  4UEY A;  3HJK A;  2HJ9 C;  1OJG A;  1G6O A;  3T4K A;  3GDI A;  5CX7 A;  3R7W B;  1LT0 A;  5HPI A;  4PAU A;  5TBM A;  1V9Y A;  3T4S A;  4GCZ A;  1W63 Q;  3FC7 A;  4I3J A;  2NUP C;  4R70 A;  3LIA A;  3ZYT A;  2W3E A;  4HHD A;  2LB5 A;  1S4S A;  2VA0 A;  1XFN A;  3VE4 A;  5HWW A;  2WKP A;  4GS9 A;  5J7E A;  1TS8 A;  3P7N A;  2XA7 M;  4HI4 A;  1VB6 A;  4OOM A;  1UGU A;  3UME A;  4MDZ A;  2OAP 1;  2K7S A;  4CLC E;  3H9W A;  2W27 A;  3CWF A;  3C2W A;  3EQV A;  3MJQ A;  4HNB A;  2J3T D;  4EET B;  2P04 A;  1GSX A;  3OCN A;  4NXF A;  3H82 A;  2JKR M;  2J80 A;  2W3G A;  3TW8 A;  2K31 A;  4HQA A;  4IUK A;  4CLC D;  4JGP A;  3E4P A;  4MN5 A;  4IUH A;  3MQO A;  4WEK A;  3NOP C;  1XFQ A;  4B93 A;  4MN7 A;  1S1Z A;  2QYB A;  1KOU A;  5C5K A;  1OJ5 A;  4RQ9 A;  3FPW A;  1OTE A;  2ZMF A;  3BY8 A;  4Z1W A;  2W0N A;  3E98 A;  4EER A;  3K2N A;  3F1N B;  1TS6 A;  4EEP A;  5A8B A;  4IHQ A;  2PT7 A;  1IFQ A;  2OAQ 1;  1S1Y A;  1ZTU A;  2LB9 A;  3LR0 A;  4YWZ A;  4DN0 A;  4HIA A;  4BBV A;  1N9L A;  5L8M A;  2ZOI A;  4O01 A;  4XT2 B;  1S4R A;  2VJW A;  3PBQ A;  1XJ3 A;  4ME4 A;  5HSQ A;  3A0R A;  3T50 A;  4Q0I A;  2PYR A;  3EEH A;  4L9F A;  2L4R A;  4I38 A;  2JHE A;  1NLY A;  3OC2 A;  3B42 A;  1F5M A;  3EGX C;  3F1P A;  4AFI A;  3MF0 A;  5EFW A;  3P01 A;  2P08 A;  2FH5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...