2PDXA

Human aldose reductase double mutant s302r-c303d complexed with zopolrestat.
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
312
structure length
312
Chain Sequence
ASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLRDTSHKDYPFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title Merging the binding sites of aldose and aldehyde reductase for detection of inhibitor selectivity-determining features.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 103
structure length 312
sequence length 312
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2007-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2pdxA00
4JTCA 4PMJA 4ASTA 4XO6A 3CMFA 1PYFA 1YE6A 1HW6A 1YNQA 2IPWA 3BV7A 1Z89A 2NVDA 1YE4A 2PDUA 4H7CA 1Q5MA 3ERPA 2PDIA 3BCJA 2IKHA 4DBUA 4JIRA 4YS1A 1PWLA 5AZ0A 4JQ2A 3NTYA 5HNUA 4JIIX 5LIWX 3RX4A 3O0KA 3FJNA 1RY0A 1AZ2A 4JQAA 2PDBA 1X97A 3T42A 5JH2A 1AH0A 1X96A 4XK2A 4GACA 4YU1A 1IHIA 1QWKA 1PZ1A 3RX3A 1JEZA 3CV6A 3F7JA 5JH1A 2HV5A 4DZ5A 4ICCX 2R24A 3WBXA 1EF3A 5C7HA 2I17A 1SM9A 4WDWA 3S3GA 1AZ1A 2PZNA 3EB4A 4FZIA 1S1PA 4IJCA 1ZGDA 3O3RA 4QXIA 4WEVX 4QX4A 2HEJA 4GQGA 4QBXA 3LUTA 4WDTA 2PDMA 3R58A 2PEVA 1T41A 4Q7BA 3C3UA 3D3FA 1QRQA 2PD5A 3G1RA 2PDFA 3B3DA 5AZ1A 3R7MA 4PR4A 2PF8A 1M9HA 3DOPA 2PDXA 2FZBA 5HNTA 1R38A 4IGSA 3BURA 4YVVA 2PDLA 2IKJA 2PFHA 4R9OA 3CAVA 2R9RA 3G5EA 3LN3A 4YVPA 4XZLX 3R8HA 2I16A 4JQ4A 2C91A 4G5DA 4JTDA 4FAMA 2PDWA 4LBRA 2VDGA 2ACUA 4XO7A 1J96A 4XZMX 3LD5A 3EB3A 3UG8A 3GHRA 4GABA 2QXWA 3RX2A 1RALA 3DN5A 3UP8A 4JIHA 2IKIA 2ISFA 1LWIA 1AH3A 2PD9A 3V0SA 3H4GA 3LQGA 1Z3NA 2P5NA 2HVNA 2ACQA 4PRRA 3M4HA 2PDHA 4IJRA 2ALRA 1FRBA 1Z9AA 5DANA 4JQ1A 4ZFCA 4FA3A 3GHUA 1PZ0A 4FALA 2IPJA 3N2TA 4DBSA 1T40A 3CAQA 5HA7A 3UGRA 4GIEA 1YNPA 4L1XA 5KETA 3Q65A 3U2CA 1IEIA 2DUXA 2WZTA 2FZ8A 2ACSA 3MB9A 2BP1A 3V0UA 1MZRA 2IKGA 4YVXA 4LB3A 1UR3M 4LAZA 3R8GA 4QR6A 2IPFA 4WDUA 1XF0A 1EKOA 4F40A 3Q67A 4WRHA 2FGBA 2PDKA 4LAUA 4GQ0A 1RY8A 5LIYX 4EXBA 4JQ3A 2WZMA 2F38A 3CASA 2CLPA 4XZNX 3VXGA 3UZXA 3EAUA 4XAPA 4WGHA 2BGSA 1MI3A 2FVLA 1ZSXA 1EXBA 2PDNA 3V36A 2ACRA 2IQ0A 2PDJA 2FZ9A 4EXAA 3M64A 3GHSA 1GVEA 2DUZA 1S2CA 4GCAA 4LBSA 3MC5A 3KRBA 3UFYA 2HVOA 4MHBA 4HMNA 1S1RA 2A79A 3V0TA 4PUUA 4I5XA 4AUBA 1HQTA 1AH4A 3ONCA 2PDQA 1XGDA 3COTA 3LZ3A 3LEPA 5LIXX 1ZUAX 5LIKX 3CV7A 1VBJA 3FX4A 5M2FX 2INZA 3QKZA 3LENA 2PDYA 4HBKA 1LQAA 4H8NA 4WDXA 3M0IA 1XJBA 4GA8A 3GHTA 1S2AA 4Q3MA 4XVDA 3UZZA 3R6IA 2J8TA 3ONBA 1ADSA 4XZIA 2BGQA 3BUVA 3WG6A 2DV0A 4RPQA 3GUGA 3UZYA 1ZQ5A 1Q13A 4XZHA 1AFSA 3WBWA 2IS7A 1X98A 4OTKA 1PWMA 4LB4A 1EL3A 3UZWA 2F2KA 3LZ5A 4PUWA 2NVCA 2PDGA 4PRTA 4JTAA 3LNMA 1C9WA 4L1WA 3LBOA 1MRQA 3H7UA 3N6QA 2IPGA 3H7RA 3WCZA 4JTQA 1Z8AA 2HE5A 1K8CA 3R94A 4XVEA 2AGTA 2PDCA 5LIUX 1VP5A 2PDPA 4DBWA 2INEA 3UYIA 1OG6A 3LQLA 1US0A 2HE8A 3V35A 3UWEA 2IQDA 2HDJA 1A80A 3WBYA 2FZDA 3P2VA 4NKCA 4JTRA 3R43A
chains in the Genus database with same CATH superfamily
2WMJA 3R10A 2BTMA 1D9EA 2BHUA 4F2UA 5M17A 3V18A 1NP2A 1MUMA 3AMDA 1JCTA 2CLMA 3WD3A 3SCPA 2Y5EA 4KCWA 1KLYA 5XIAA 1RAKA 1FDYA 3UWUA 1XC4A 2NV2A 3D0CA 4DBUA 2WWDA 1K7EA 2GJPA 4I3GA 4QSHA 4YPJA 1ITXA 3W7NA 3UPBA 4Z1YA 3RIKA 1PDZA 4NRSA 1BVNP 4UTMA 5ABFA 4DUOA 4S3FA 4OOUA 2C3ZA 3HBLA 3MCNA 5IHRA 3CV2A 3VI2A 1WUFA 4J5NA 2A3BA 1A5SA 3POHA 1KBJA 3WMLA 4BK9A 5AC5A 1JAEA 4AIUA 1A3HA 1JQVA 1N82A 8XIAA 2CHRA 3A22A 4U5IA 2QZRA 2RDUA 1FWBC 2BOFX 3NG3A 3NQBA 1E6QM 3M0JA 3EYPA 2I17A 3E74A 2FH8A 1E6XM 3L4TA 1UH3A 1CYGA 2I5QA 4JNZA 1IR1A 3O3RA 3R0KA 1S3HA 2HEJA 2E6AA 3GNRA 4L4PA 3GX9A 1DQWA 4OBRA 4PEEA 3CMGA 5HPCA 2GYIA 1WDDA 1MDLA 4YHGA 3NZGA 1VKFA 4D6JA 3UG4A 4AH7A 2EPHA 5G4HC 2ZZ6A 4AXKA 1XYFA 3NQFA 4MSSA 1K9TA 1XLHA 2Q02A 2YB4A 1PZ3A 2YXXA 2A6LA 2DJLA 4IGSA 2Z26A 4D6DA 1LYXA 4HNUA 1P6BA 4MWAB 2QIIA 1TWSA 1EFZA 5TIMA 5LGXA 1EEPA 4IGNA 1F4HA 4J9JA 4H8VA 1VFLA 3ARXA 2OX4A 2YYTA 2PLCA 3FJLA 3WQEA 4DWSD 5CBJA 3T0BA 1HIZA 1KTCA 1E4MM 3M6YA 1NF0A 3AU6A 1ZBWA 4S3GA 4W7VA 3HPAA 1TJ2A 1CLVA 1XIHA 2ZXAA 3VGHA 4UNIA 2DIEA 4QNWA 1OFAA 3JS3A 6ALDA 1KRMA 2D20A 4YIWA 3K4WA 4HVXA 5CCZA 2NX9A 4N9CA 3CEPA 2QXWA 3ARVA 2GDQA 4GX8A 4OT7A 4GXPA 1E6RA 1Z32X 3WDHA 4JIHA 3CGTA 2X30A 4PL1A 5HINA 3RUBL 5BXPA 1K8XA 1NQ6A 3WEZA 3HGOA 1HT6A 3UY8A 5G1TA 2DIKA 1RQEA 1B3WA 3GTFA 3GC5A 1GW1A 1VRDA 1B3ZA 2EAWA 1TMQA 3G3MA 4UTWA 2W63A 1S39A 3E0LA 1OT2A 3EWBX 3MO7A 3P8IA 2J78A 3B9OA 2OLAA 2IPJA 3HU7A 1IXOA 3M46A 1W6TA 1NSJA 3AUOA 5I3GA 3UNTA 3FJ4A 2DUXA 5HJYA 2R14A 3SCOA 2BP1A 3MQTA 5EFFA 4JEQA 3I6RA 4P7NA 2VZUA 4PC8A 2Y85A 3VDGA 3GK0A 3UJSA 1QFEA 4MF4A 3VAVA 3FA3A 4BQ4A 3PNUA 1XS2A 4Y9PA 4LAUA 1RY8A 1J11A 3KOYA 3V5FA 4AC1X 4LVBA 3WK2A 3UEQA 1UR1A 3QFEA 4HOWA 4Z2IA 4HNLA 2OLSA 1IF2A 2J7CA 3WUEA 1EYEA 2GQ8A 3LNPA 1PDYA 3BQ5A 4TV5A 1MI3A 4TX9A 2UY2A 4E3TA 3RU8X 3EPNA 2FVLA 3TX9A 1ZSXA 1EXBA 4UFLA 1FWWA 3DENA 3TYEA 4JXCA 4RW3A 1RPXA 4MB1A 1XBXA 3O15A 3KRBA 3UFYA 2F8QA 3SN0A 2XIOA 3VDCA 3B4YA 4PTNA 3ITLA 4JX4A 3S6OA 4NT0A 1P0DA 4AUBA 1YHTA 4F4RA 3N1AA 3UD6A 2YCLA 1UHVA 2BASA 2GUYA 4PTMA 3FX4A 1YPFA 4DJED 2WSKA 4PMYA 2Z28A 1CZ1A 2AQWA 1TV8A 3LENA 7ODCA 3TR2A 4K38A 2WPGA 1W9PA 3BV4A 1HKIA 1EX1A 1HNYA 3VC5A 2ATSA 3CMJA 3G24A 5A6BD 3W83A 4NJKA 4LOCA 4OKDA 2GJXB 4JL2A 5AYBA 5I3DA 1JCXA 3ONBA 2WKLA 1KR1A 3DFTA 4C6BA 2NSOA 4UTHA 1SQ7A 1E70M 4N4QA 1OK4A 1WDQA 4MMWA 1AFSA 2V30A 1ML1A 2R1MA 1JI2A 4FX6M 1B0IA 3EWWA 2GJRA 2QUNA 1EL3A 4Y90A 1EQCA 3OOQA 3L5AA 4HNCA 2R82A 4RUBA 5HULA 3L2IA 1MRQA 2ZBTA 4DYJA 3LI0A 2IPGA 3GG7A 1W5QA 3LM3A 4HU8A 3DHUA 4O52A 1K8CA 3W76A 3MDUA 1UMYA 1OGSA 4HMEA 4MKSA 4I9MA 4UTIA 3CZJA 2INEA 3KL5A 2J7FA 4WLCA 2Z25A 3V35A 2Q01A 2XVPA 2QDDA 4Q32A 1XHGA 3G1FA 2CKRA 1GZJA 2C71A 1VGAA 2WVVB 2X05A 2BNJA 2WHMA 4RR4A 2VX4A 3ZLHA 3GH4A 2YCEA 1TPWA 3A3HA 1DWGM 4Z0JA 3T55A 3DKLA 3QC0A 3G1AA 1L2QA 2EKCA 1NIUA 2NVDA 1NAL1 3EOEA 4BEQA 3AROA 3HV9A 1QCWA 1E4IA 3TYDA 3IK4A 1B1YA 3I4KA 1VPYA 4JQ2A 3WBEA 3VILA 1IE7C 3G1VA 1CTNA 1GVSA 3BOXA 3Q4DA 1KRBC 4KGJA 4CQCA 4HT3A 2EPMX 1FWFC 3W82A 1KCZA 2ZXQA 5MKGA 1R46A 1K9EA 4PB4A 1YDYA 4A29A 2RKXA 5FJUA 3JRKA 2QEZA 4DO6A 2XH4A 3ALFA 3E0WA 3QMTA 1TUXA 3K1GA 1OCBA 1UR2A 4DXVA 2H9AB 1SM9A 3LPFA 2E8YA 2VL4A 3FHQA 4FZIA 3P5ZA 2J24A 4CD6A 4H4IA 1V5XA 1VIWA 3NOYA 2VR2A 3CZLA 3SGGA 3UZ5A 3VINA 3UERA 4AEEA 3PNZA 2FMNA 2OVLA 3C3UA 1EDTA 3DFYA 5REQB 1FFQA 1GVQA 1QXLA 2BODX 3SIMA 1TIMA 3WF2A 3BAJA 1YEYA 3WKZA 1E0XA 3CPRA 3GXPA 3OZMA 3ZS4A 2WO5A 2R8WA 4AXNA 1T8XA 1MUWA 4I5UA 4GQQA 4WKAA 2PE4A 1UKQA 4CD7A 5H1WA 4RZBA 2PURA 3M0HA 4J2PA 3PTKA 2IKJA 2DZSA 3GTIA 3BPWA 1JFHA 3AHXA 4ZQNA 2EG8A 2PLKA 2ZDRA 2G0WA 3SECA 3TLQA 3L67A 3MP5A 1R3QA 3CH0A 4AD4A 5I09A 3M7WA 2J27A 1BKHA 3FSUA 4RJEA 5JBFA 1DQXA 4RNHA 3R8HA 4O50A 3GBEA 3ABQA 3BLEA 2DW7A 5IBXA 4AYSA 1TRIA 4GWEA 4IUOA 3ZT6A 2ZE3A 4YYCA 1Y5XA 1W8GA 1BFNA 1YIXA 2PTXA 2QLYA 5FJJA 1D8CA 3G8RA 4OIFA 2PWUA 4B3LA 2FB2A 4M56A 8TIMA 3GY1A 2WC3A 2OR2A 1AH3A 4H9XA 2QV4A 4GBDA 4B2DA 2ZFAA 1YBQB 3MI3A 2YDRA 3DAQA 2A7NA 4S39A 4QS6A 2VCAA 3WLHA 1IV8A 1XDMA 3IIXA 3ZJ7A 1MW1A 4ZSTA 2ZXDA 3E3HA 2H3DA 1W91A 2BDQA 2WK2A 2X8RA 3L7RA 1J5TA 1BRLA 4ICNA 3W1XA 3KP0A 2ABBA 2OELA 1A5AA 3O6AA 3M47A 3KOXA 4MNJA 1WDPA 3PPCA 4CQBA 1GVIA 4H6RA 1XLCA 2W6RA 1QNRA 5IBXC 4NZ5A 1GYNA 3VE9A 1TE6A 5CH9A 4ZB0A 5CEWA 2AL2B 3AJXA 3BLDA 4C91A 4HJWA 3MA8A 2XIIA 1NH6A 3FW6A 3U8GA 4IPJA 3LXBA 4PMZA 2IQTA 1RJPA 5EYWA 4KIEA 1FWTA 1ZBKA 1F5ZA 3HOJA 3W23A 3PZ9A 1A5UA 4DN1A 3N14A 2QCLA 4AHPA 2X09A 2XYLA 1RXOB 4UFJA 4ZR8A 3W2KA 4JIPA 1UP0A 4DXKA 1B3YA 1CGVA 1XIIA 3ALGA 1MVYA 1NOUA 3M64A 3L4XA 1H7OA 1OC6A 3T08A 3P0WA 3MC5A 3V4BA 2BY0A 1IZKA 4HMNA 5A2AA 3PZMA 2V63A 2ZKMX 4GK8A 3B9DA 1ESWA 5LHEA 1Z44A 3PBUA 4WD0A 4Y9MA 5ECVA 4GY7A 4WXYA 5AC6A 4NHVA 1Q45A 1PE1A 1XXXA 3QLLA 4WY0F 2W5FA 2ZVIA 2FVMA 1CGWA 3E2QA 3WLLA 4RNJA 2WJEA 4ZVJA 4LVGA 1XC6A 3FS2A 3A64A 3QV7A 3L4WA 1IEXA 1V6WA 3OTRA 1BKSA 3OJGA 4MWAE 4XZIA 1QPRA 1MW2A 3T40A 4ZSUA 3TXZA 1Q6FA 1KM3A 4BWLA 1QNSA 3KL0A 2C15A 5LGZA 1VCVA 1XD1A 5AFDA 4NJIA 3WELA 2WNWA 1WDSA 5FF0A 4DF0A 1M7XA 3H2NA 4HHPA 2DT2A 4EKJA 1OX5A 1ZFJA 2VD9A 6REQB 3BGGA 1EP2A 1W3KA 4RV8A 3QFWA 3VNYA 1EOKA 3GKAA 1SW7A 3M0YA 3IEBA 5DFAA 1J6PA 3S1WA 1R30A 2V67A 1YXYA 1XH2A 3WDRA 3O2LA 3H6OA 3RMJA 5D9MA 1NELA 4KWSA 1QNPA 2VDHA 3TONA 4O8RA 1XG4A 4DHGA 3T4CA 3G1XA 1E1EA 3WF3A 1A80A 1DOSA 4MGGA 2W79A 3S2MA 4D72A 3E2SA 2WMIA 2IMRA 2YBVA 4JTCA 2Y8VA 2D69A 5L6UA 1YNYA 2FMOA 5TQLA 4M3PA 2EO7A 3THCA 4NJHA 4GYJA 2VGIA 2VI0A 4AWSA 1TMHA 1YE4A 2OZ8A 1V3MA 1FP8A 1FH8A 4PBEA 5I3JA 2QVNA 2YZRA 1XYCA 4UB9A 2NUXA 4ZFMA 4XD5A 1P6WA 2B4GA 1N8FA 4KCUA 5T91A 1CBGA 4FOUA 3PAJA 1R3WA 4JCMA 5CPNA 4FPSA 3DG7A 3H70A 3SR7A 3STGA 5C7VA 1TKKA 2XISA 3CWOX 4IT1A 3ANUA 5CSUA 1ZP3A 2TODA 2ZUTA 2DGAA 5DT5A 3IVTA 4W93A 5LHFA 3DC0A 4JZ5A 3CV6A 3N73A 5TBOA 5F1UA 3DIPA 4D8AA 5E0CA 1V0LA 2ISDA 1R87A 5FEZA 1RHCA 3KDOA 4XAYA 3S6DA 4I7UA 3HJEA 2PCQA 4XX6A 4N2YA 3AI0A 1X1NA 3KDNA 3PWGA 1ZGDA 3MU7A 1EYWA 3IV3A 2VEGA 3CUJA 2H3BA 4WDTA 4YL2A 2OQHA 1V4YA 5HDRA 1XDLA 3L9CA 1PVNA 4PTWA 5KZEA 7TAAA 4DJDA 5IXEA 3OZYA 3NQ2A 3WJZA 4JBRA 4J2MA 1CXEA 4UTJA 2QCEA 3WIJA 4A3YA 1VBGA 4YCOA 4YHEA 1UD8A 4S23A 4IL2A 1AODA 1OBAA 4GVIA 3OGRA 4I7VA 3G8EA 1O5QA 1UZHA 3MHUA 4M51A 2E4TA 5A1AA 3MCMA 3EB2A 4LNYA 4JNMA 4O14A 2QJNA 4OOZA 2FFCA 1E6SM 2XU2A 1RR2A 3MSGA 4GGHA 1PBGA 2OJPA 3QQWA 1XI3A 5BU9A 4DI9A 2V8ZA 2POZA 3NUKA 3LD5A 3DECA 3VDAA 3HURA 4AEFA 3ITYA 3RILA 3QV8A 1IZCA 3GHRA 4KS0A 1JDEA 3NQAA 1XUZA 4HPJA 2GGIA 4PMRA 1VH7A 1YX1A 1Q4WA 3CC1A 3W7DA 2ANUA 3PUOA 3AMKA 1EP3A 4PTXA 1WV2A 4Q6JA 5DRIA 4F2BA 2XIMA 5F4XA 1ZTVA 4JFTA 4LX4A 4LVFA 4IJRA 4AIEA 4LCSA 1KW1A 3W7LA 1NFBA 4RPPA 5A95A 2Z1VA 3SAZA 1JYXA 1A0DA 3MUXA 4TUFA 2P8BA 1W32A 4N9DA 2ALDA 3WD0A 1E40A 5HA7A 2X0SA 3K8KA 5CZ0A 4MJZA 3HFTA 1PUDA 1XRFA 5PTDA 3SCTA 2TMDA 3WNLA 1J4EA 4C6KA 1UWSA 2D23A 1BYAA 1GVYA 2V6AA 3LB0A 3HN3A 1KBBA 5A6LA 3DCPA 4H2HA 1E0TA 1VPQA 1H5YA 1UR9A 3OGVA 1WKEA 5BMWA 2BGNE 4IMDA 2FVKA 3F1QA 1OD8A 3T8LA 3KCOA 4R5EA 4WGXA 1AD4A 1QHOA 1HP5A 4L4MA 1DPMA 6ENLA 1A3XA 3W38A 1FOBA 4JTKA 4EPKA 3GH5A 4XAPA 4QLLA 3HO8A 1E55A 2QMJA 3W86A 2CZFA 5GNZA 4O1EA 3U7VA 5D2VA 1ZCCA 4FOJA 2Z1KA 2XG9A 2F84A 3RR1A 3AALA 2HQAA 1C7TA 3V1HA 2OOGA 1WP6A 3L68A 4EXAA 3QMRA 2VC7A 4Z1DA 3BAWA 4MHBA 3G0XA 1JZ2A 3CT7A 3BVJA 3HQ1A 1PSCA 1K6WA 1F8IA 1FXQA 3UCDA 2QAFA 3LEPA 5C8BB 1QT1A 2I1OA 3GG1A 5LIKX 3CV7A 3WO8A 1AQMA 3K1DA 2DZTA 1K8ZA 4ADUA 3BE7A 5JXQA 2WKGA 1J0KA 1UJPA 3R0DA 1A5OC 3WMBA 3HV8A 3RJXA 4IHCA 1IXNA 1YYAA 4UIOA 3W7PA 2X2YA 1EJRC 2C0AA 1XFCA 1EWDA 1W1YA 2ZRXA 4X3ZA 2XM2A 2NT0A 3ES8A 3C52A 5F4WA 3WG6A 3PUEA 4RZ5A 2QJGA 3ARQA 7PTDA 4IH3A 4KCVA 1OIFA 5K9DA 1BPLB 1DXEA 1JYWA 1OFEA 1XIGA 3AWOA 1PWMA 2NQZA 1PKYA 2IUZA 4J4KA 2OT1A 3LZ5A 3KM8A 3UXLA 3A4AA 4YCPA 4K36A 3CAWA 1S5WA 1JG9A 3LMZA 2GUBA 4WKHA 3U5YA 3OYXA 4Z2JA 3R94A 3L4YA 2G37A 2PDCA 4F0SA 4MFEA 4OFCA 1L6SA 4IPNB 1KFBA 1TA3A 1KV5A 3W7IA 1UWIA 3NOEA 1M7PA 1SR9A 2VZSA 3CT2A 3A13A 3K30A 2XSBA 5DN1A 3GVVA 5CJNA 1AA1B 4ZQCA 5HR7A 3H2AA 4J1OA 5I03A 1XLFA 4C6PA 3S4TA 1DJQA 3I6EA 1IZJA 3QW4B 3RCMA 1BGAA 4K3ZA 7REQB 2A3LA 2A85A 4OV4A 3TK7A 4DJFA 4C7FA 5EBUA 5A8PA 4AFYA 2R91A 2WNQA 3IJDA 2V5JA 3CUXA 1CXLA 3UJ2A 1J2WA 4LRSA 4IIHA 4JOMA 3VKBA 1G6CA 1LL6A 2Z6JA 3U9IA 3SRKA 2NQJA 1EHAA 4HK5A 5DY2A 3CTTA 3NA8A 2E3ZA 3QC3A 1H7PA 2B0MA 3L21A 3FEMA 1NWRA 3HA1A 3RPTA 3SADA 1JEZA 3GUWA 4GGBA 7ENLA 1F6PA 4Q8NA 1BTMA 4CNNA 4ICCX 4LV4A 1W3NA 4LVAA 3TN6A 2X0YA 2W3ZA 2P76A 4MUPA 2PGRA 1XPGA 3REQA 4CKQA 3UA4A 3U2ZA 4IWWA 1QI2A 1EBGA 2J9XA 4FF7A 4UQ9A 4QXIA 2J9YA 1KA9F 2W92A 4HU4A 3LRMA 2QGHA 1X6LA 3HGSA 1XQLA 2PTWA 3A4XA 3CIXA 4HOZA 3TMQA 3NQEA 2FJKA 2HPIA 3DFQA 1I1XA 4DY1A 5LA2A 5FOOA 3HB9A 3NO1A 3PFMA 1DJZA 4KWUA 3TXVA 1H1ZA 4X0VA 3H12A 1V3IA 3EOLA 4GHRA 2VFFA 1XRVA 4NI3A 4HHHA 1MXSA 3PULA 4ZB5A 3KBWA 3MI2A 5RUBA 1R2TA 2DVTA 1J0JA 1PJ9A 1SW3A 5TD4A 1DWIM 2I16A 4M81A 1EUAA 4XUGA 2O9TA 1W17A 4FB7A 5I3KA 1NWUA 2ABAA 2NXGA 2OQYA 4JTDA 1TV5A 4Q4OA 4CNSA 1H2JA 2HXTA 2G97A 3R11A 2QCCA 4HZ6A 4I9AA 2EJAA 3UG8A 4HYRA 3WJSA 5G1YA 4O4WA 2YA2A 4LXFA 3MWCA 3GXIA 4DAFA 3VO0A 3DN5A 1OGGA 4PCNA 3GVGA 3NO3A 3ANVA 2QJIA 4Z1AA 3QSRA 1M3UA 2O0TA 3S2NA 1FKXA 4ZEPA 3EX3A 1RUSA 1QK2A 5I3IA 1WO2A 4M5PA 2INFA 3K4AA 4NX5A 4Q8UA 3S1VA 1KCLA 3GIQA 1QNOA 5AVNA 3U2CA 2GVJA 2J88A 1FWJC 1SFJA 2IKGA 3KRUA 4YVXA 2VELA 1C93A 4NAEA 4C6QA 3U4AA 3R8GA 2NQ5A 1OY0A 3MWAA 4JN7A 4OQVA 4DO5A 3QY7A 2IPFA 1E5NA 3TW7A 3O6DA 1MNZA 4DPQA 3SGZA 4XD4A 3QW3A 4L9XA 1FY6A 3EMCA 4Z2KA 4X61A 1AW1A 3CASA 5ABTA 3U7BA 3OEXA 4FR6A 4A2RA 1YDOA 2WHJA 3T2PA 3LBMA 3AAMA 3ZLFA 1NOWA 1F3XA 1O1ZA 1M6JA 5FJOA 4QLKA 3AUJA 1MEWA 2FGLA 4U2ZA 1X1ZA 1H1YA 3IJ7A 1GOXA 1KRAC 2V81A 2WKJA 3EWZA 4KWOA 1QJWA 1SGJA 1MW0A 4GI4A 3G0UA 4KH2A 2J79A 2A79A 2P10A 4J3SA 4I5XA 3QY6A 3COTA 3GDRA 3Q2DA 2GSHA 3QJAA 4QISA 5D4YA 4CU8A 3EKLA 1EIBA 3AU2A 4PCFA 4B9YA 3WH9A 1R9YA 4QE5A 3PPHA 3ABSA 4IQLA 1J01A 4QIUA 4LUYA 4GYKA 2C7FA 2XM1A 3AHZA 4Z42C 1ZJHA 2WW5A 3PC0A 2G3JA 3NYZA 4LANA 4G2DA 1BYCA 4GE8A 3D46A 4XVDA 3UZZA 2GGHA 2REQB 1GYLA 1P1XA 4HA3A 3VDBA 3NSXA 4QTGA 1Q8AA 4OTKA 1REQB 4X60A 5I77A 4I8YA 4E8DA 2BY1A 3ELFA 3WL1A 1VB9A 3NZPA 4JTAA 5T8GA 1C9WA 1H7RA 3RK8A 4PSPA 1RH9A 5B7YA 2Q6ZA 4E4UA 4MWAA 7XIMA 1IYXA 3AICA 4ADSA 4XVEA 5CXPA 2J75A 5LIUX 1US2A 1SVDA 1NDVA 3RITA 3LCFA 1ICQA 1W1ZA 2NW0A 3IGXA 1ECEA 2BZNA 2QF7A 3BMXA 4HMDA 4Y2WA 3W07A 1GQKA 4W4QA 5CC7A 2RUSA 2YL8A 1VFMA 2VCCA 2DSKA 2WSRA 4YTTA 1W9DM 1ISWA 2AAAA 3TJLA 4Y9AA 5HUOA 4CNPA 2DZUA 3BLKA 2E68A 2W67A 3WK1A 4ASTA 1R85A 3CMFA 4ZCWA 1YE6A 3BW2A 1JF6A 4RX0A 2X0HA 3SFWA 3FEQA 4ILSA 9CGTA 4P8VA 1Z7AA 1D2KA 2JKAA 3ITXA 1E5JA 2WYSA 1UP2A 4HOXA 3N9RA 5CPOA 2Y5JA 4GZIA 2D24A 3EXRA 3CJPA 3VIOA 4W8LA 4NZFA 1L9WA 2TSYA 3N9KA 4MNLA 4D6IA 1RVGA 2CLLA 3VGDA 1TPC1 3G1SA 1J10A 1ZS2A 3P81A 1FHVA 3O0KA 3N17A 3W1UA 3W28A 1G0CA 3GNPA 1KD0A 1OQFA 4HA1A 5DO8A 6CGTA 4E2VA 4LYKA 3DUGA 3QYSA 3RLVA 4HZ8A 1BXBA 3PK7A 2VC6A 3TOPA 1ZP4A 1KTBA 4JTIA 3VD5A 1W0MA 3W71A 1W3JA 1GG1A 1XLJA 1XKYA 2UY5A 3WLIA 4W86A 1EF3A 1HXJA 2J7HA 3M0LA 1RCOB 2PZNA 3SSZA 3TYAA 3F4NA 3W2UA 1DL3A 1H11A 4M6QA 3VA8A 3KCLA 1ONWA 1DE6A 1QO2A 4LYQA 1XYMA 5KINA 4B16A 2PDMA 3W84A 4C7GA 3SJ3A 3GIPA 1BVWA 4AF0B 4CVUA 1WXZA 4AQLA 3IVUA 3CHEA 3HQOA 4RDZA 3OQEA 3P62A 5CQ1A 1L6WA 4IFOA 3NPWA 4A2SA 4XG1A 5FEXA 2LLEA 3RRXA 2OYMA 5DMMA 2WMGA 3L65A 2E5DA 2NWRA 4FNTA 4Q8OA 2E9BA 2F7FA 3NM1A 3TJXA 1I8JA 1TPVA 3QHMA 3CB8A 2A7RA 3V16A 4K7YA 1VQTA 2GQ9A 3A5FA 1B30A 3W2NA 2RDWA 3VC6A 2CETA 3DHDA 4RK8A 2GJXA 3QPEA 2E5CA 1ISVA 3TFXA 4FAMA 4B2DD 2WM0A 3ABXA 3WLPA 1BYBA 3FYYA 4CN4A 4WY0A 1EJUC 4M6VA 4J3TA 1E56A 5FCZA 1OX4B 2DT1A 2GJNA 1UUQA 3Q94A 3ZO9A 1SFLA 1W5PA 2WCSA 3D6NA 3VIFA 4BCEA 1Z3NA 3AIWA 3QTGA 1GVRA 1ODUA 3CZ8A 1RA5A 3SB0A 5B7ZA 3A5VA 3SCWA 5FAJA 2Y5SA 2JF6A 2C0HA 1BD0A 1CXKA 1UD5A 1V7YA 5E70A 3W0KA 3NDZA 1VFHA 2OCZA 2V69A 4O57A 1VD6A 1U5HA 2F61A 2ZA1A 5E9XA 4GMEA 4OUIA 3BDKA 3EOUA 4W7UA 1M68A 2EJ1A 4L1XA 1E4LA 1EC9A 1YXCA 4H9MA 1E9ZB 1XLAA 3RNDA 1N8WA 4KEVA 3MB9A 3DI0A 3LGEA 5A6BA 3V0UA 1LQ0A 2X1TA 1IT0A 2WVVA 3SUTA 2VWSA 3T1GA 4LB3A 5I2UA 5FACA 3PPFA 2VENA 1F73A 1Y7VA 1H7NA 3VZYA 4Z17A 1E1FA 3EA1A 1XSIA 1FHUA 2OKTA 3K4DA 4AVOA 1PKLA 4W89A 5E1QA 3WNNA 1TVLA 5A6TC 4XKMA 4MDPA 4LYRA 3WLKX 1PCWA 2J13A 4UFHA 2ZX5A 3A47A 3SDOA 4GVHA 5I24A 3IIPA 1SZEA 1NF7A 1TQJA 3FYOA 3DDMA 3TQVA 3LGGA 1F6YA 3T0AA 3THAA 3URAA 3VVGA 4C6NA 2DUZA 4H8HA 2WBGA 4UZSA 3UJFA 5GNXA 1UD3A 2QCFA 2QJJA 1LBFA 3ONCA 3N3TA 3VOIA 2W62A 3VNMA 2V5DA 3K2GA 1B57A 3BOLA 2X41A 3UA3A 4DXXA 5D02A 4DLFA 2GDVA 2H9AA 2FTYA 4FSAA 3UESA 4PA8A 3QKZA 3W7CA 1BXNA 1I45A 2H8ZA 2L5HA 4X2PA 3VCRA 4IF2A 3MTWA 1A5MC 3VOCA 1UASA 4XTDA 3SRDA 3TN4A 3C56A 2C18A 3O06A 4ZO8A 1OIMA 1S2AA 1UKOA 2BXYA 4QRNA 3VE7A 4GJIA 3KVKA 2FHBA 3S5ZA 3TU9A 4ONVA 4RPQA 3U3HA 3GUGA 5REQA 3OLDA 2F9RA 1Q13A 2VX6A 1GYMA 2ZC1A 3WBWA 1V3KA 2QCDB 3SCRA 2UY3A 3MYPA 4S2BA 1DORA 1TTIA 2Y0FA 5A6MA 4J3VA 4LB4A 1K9DA 3SW6A 4I9JA 3N11A 3AJ7A 1QATA 2NZLA 4U10A 1ZNNA 4UR7A 1OEPA 3KRZA 5CC6A 5EKYA 4JIQA 3F5KA 3MYOA 1YDVA 4ZE5A 3GNDA 3V3WA 2HE8A 4JTLA 3VU2A 1S38A 2QT3A 3GQYA 3INPA 3RAOA 2PTZA 5JBDA 5DLCA 1VFFA 1POKA 4MKNA 3G18A 1H50A 3IS4A 1QI4A 2KZHA 1SR0A 3E2VA 3GYCA 2UZ9A 4I6KA 4ACYA 5H2ZA 3PP7A 4AAJA 3QR1A 1N55A 3F4DA 1F4AA 1ZPTA 1ALDA 2VFDA 1RJRA 2J77A 4E5TA 1YBQA 3M16A 3CH9A 3NZ1A 2QAPA 2E6DA 2C1HA 1EO7A 1JD9A 5HK4A 2OSXA 4C1KA 1SZGA 3N25A 1IGWA 3A21A 5D8ZA 4BR1A 1WA3A 3LX9A 1QBAA 1BQCA 5GNYA 4JFSA 2BMBA 3S9ZA 3LXCA 1TREA 1M04A 3G77A 4XBSA 1B90A 1U1UA 1EJXC 4GUJA 2ISWA 3VD7A 4LBUA 2Y4SA 5H6HA 4J7RA 2Q8ZA 3NQ8A 4CQ8A 4WX2A 1E3ZA 5HANA 1GNXA 3O07A 4DO7A 3WBXA 1UKPA 2E28A 3WUFA 1XLGA 2Z1WA 4MNMA 4REQB 1QPOA 2DPEA 2TRSA 3PWAA 2CBVA 2Z2AA 3UETA 4QX4A 2OMAA 3CHCA 3CHFA 4HN8A 2PBOA 3A23A 1YADA 4QJ5B 4PB5A 1DBTA 3D3FA 3AS2A 1QRQA 1QR7A 4WSHA 5AC7A 4MG4A 5H8UA 4PR4A 1PKNA 2PF8A 3S5YA 2XFFA 3STFA 3PANA 4US5D 3QYQA 3M0ZA 4UBPC 3BSMA 5AVHA 2XINA 1ELSA 3IK2A 3NZRA 2ZUWA 3QN3A 3CK5A 4O15A 5AY7A 4D1JA 3LN3A 1ONEA 1DIEA 1VFOA 1KM4A 2XSAA 2FDMA 3KCJA 1C29A 3L2MA 4DRSA 4M1RA 2QR6A 4YWIA 2OLHA 2V68A 4UTTA 2VDGA 3N19B 2Z1BA 1KFJA 3VIHA 1QI5A 3EKGA 3MCOA 4J35A 3M0KA 4NXSA 4J3UA 3O8AA 3VKDA 3CU2A 4D8LA 1RALA 3HGJA 2HROA 3H2CA 2E0PA 4IXXA 1LWIA 5EU9A 1D7FA 2W9MA 3I3EA 3W3OA 1H1NA 1M5WA 2UY4A 3PTMA 4NF7A 3TFCA 1BF6A 4EX4A 2ACQA 2W91A 2RH9A 3DZ1A 4D6HA 3GTNA 6TAAA 3IJ6A 2PAJA 2QVHA 3ITGA 3TN3A 3H4WA 3KBMA 4FA3A 4JTGA 3OVGA 1XD0A 3M9YA 3R0UA 5D2YA 5C9UA 1YNPA 1ONXA 1OK6A 1B9ZA 3LCHA 4LF2A 3W00A 3AXKA 3Q65A 4C1LA 1PX8A 5LA1A 2VOMA 2ACSA 3CYJA 3WFLA 3R13A 4LAMA 1R7AA 4R85A 5MF5A 3HM7A 3CQIA 3H2OA 2QCNA 1CXHA 1XLBA 1VYSX 3KL3A 1HO4A 1TG7A 5CPTA 3CPUA 3BLFA 5EGRA 4FS9A 3IJ9A 3PJUA 4XZ9A 2UV8G 1FXPA 1NDYA 1LM1A 4JKKA 1JXKA 4F48A 1JCYA 3P61A 1F07A 1KM2A 2E6FA 1W56A 4D8ZA 3NR0A 5FJIA 1DJNA 3RM4A 4ALDA 2ZYFA 1XP3A 5EFDA 5LNRA 1IGSA 2CLPA 2HJPA 1V6VA 1W1VA 3ZT7A 3M5YA 3RLHA 1ZAHA 1T8QA 2JBMA 5DT7A 5JUVA 2C1GA 4FNUA 1OFPA 1JGMA 3WDPP 1R7OA 3URNA 3U57A 4ML9A 3WZ0E 2YLLA 5T26A 2VR4A 3NVTA 4ZENA 1H09A 3JR2A 1A3WA 1Y5WA 2DZXA 2G41A 4NAFB 1EPXA 2FPVA 1XGDA 5CJ5A 1OF8A 3UJEA 4GUHA 1W2VA 1ZENA 3HPXA 1QUMA 1UQZA 3MBFA 4JTFA 2Y62A 4X9YA 3PJTA 1PX4A 4HBKA 3UCCA 1WAWA 2OFJA 3ATZA 2OWXA 1J9YA 4EPDC 2RGLA 2ZRWA 5C2GA 1ICSA 3EEGA 4GZEA 1S2TA 1P43A 5BOOA 1XIBA 4ZE4A 4Q3MA 1FWSA 1CGTA 4LUSB 1HP4A 2QPUA 2C13A 4NJJA 3KLKA 4Y7EA 1ZQ5A 3CZGA 2YA1A 3C86A 4NUWA 1S5MA 3DG3A 4V1XA 4ZO6A 3L5MA 2IS7A 1VHNA 2HNEA 3CTLA 3VZXA 3AXMA 1LRTA 1UWTA 3G3DA 4DLMA 1LBLA 2B81A 3KTXA 3KWXA 3QH2A 3MW7A 3H7UA 5T9BG 4IQDA 2AQOA 3OA5A 4IIBA 3NXFA 4JTQA 3BCDA 3WF1A 3WLQA 1JYNA 3LHZA 4XQ6A 3LXAA 3SN4A 2E09A 4AD0A 1R47A 3DFHA 4H9ZA 3KRSA 2WZIA 5FEWA 1YPXA 3NPUA 5E93A 4Q8VA 3EA2A 2XUCA 2ZOXA 3W1AA 3NM3A 5A6SA 5I5RA 1FA2A 1GZGA 1ZALA 4DJFD 1W3LA 4WCJA 2YYUA 4YNGA 4ATWA 1VBUA 4UFKA 4F0KA 4Z2LA 4IMAA 4ZOEA 2RJGA 5CPMA 3KE0A 1Q2SA 4IP4A 4JCLA 1G7VA 1DJGA 4LEQA 4X22A 4HNOA 3M5XA 3Q45A 4AD5A 1UYQA 3NFUA 4GD0A 2J8GA 3XIMA 1GGOA 3FK4A 4B5SA 3MVIA 2J7GA 4GYFA 2GK1B 1RY0A 1CW2A 5FJPA 3I65A 1XBZA 1VJZA 3F2BA 2D2OA 4K2SA 3WQFA 4UTFA 1X97A 1TCMA 1AH0A 1X96A 4JTHA 4M0XA 2X7WA 3QQ0A 1JFXA 3OQ8A 4L1GA 1KXTA 4TVUA 4WSKA 3UWYA 3HIJA 1KBLA 1NFGA 1VF8A 4QP0A 5DXYA 4O10A 1SSGA 1NP0A 3S3GA 2F2HA 1D3GA 2A5HA 2V82A 5EB8A 3IAPA 1TTQA 3GDMA 2ZZ5A 4LS1A 4V1YA 3F4CA 4KMQA 3GNNA 1J93A 3C6CA 2YJQA 1QI3A 3AIVA 1V93A 1TO3A 4Q7BA 2DT0A 2VVNA 4B5TA 1H51A 2ZRZA 2XIBA 2ZADA 5FI8A 1JDDA 3FXGA 3IPWA 4JDYA 1X6NA 1B3XA 1XLDA 3PJXA 1UUOA 3GM8A 3TQ0A 3GR7A 1V51A 3GB6A 3KX6A 1TIWA 3WDIA 2B7OA 1SZFA 1ITCA 4XSLA 2PZ0A 5BRBA 5KZDA 4HU0A 5HJLA 5HQMA 1UPMB 4K1GA 5U4NA 3AZRA 1TWIA 3OLEA 4HCDA 2OB3A 1ONRA 4AZ6A 3GDLA 3EEZA 1KRCC 4L56A 1J96A 1XH1A 5FL1A 3DHFA 1V0MA 3E96A 4UCGA 2YSWA 2ZTJA 1VENA 1J0IA 1GQJA 2XJ7A 4W5UA 1K77A 5C54A 1IEVA 3L0KA 5BRPA 5D32A 1L2UA 1B3VA 2ISFA 4IICA 4H6QA 1J0HA 3ZOAA 5IFTA 2PTYA 1CGYA 1QK0A 3I68A 5TAOA 1WE5A 1BVZA 2HVNA 3WLMA 2XGIA 4M24A 3TCEA 2CERA 3VNLA 1VPXA 3BSHA 3CWNA 2J6VA 2VFGA 4H3DA 1XBYA 3WQPA 5KSWA 4U31A 3N2TA 4DBSA 3CAQA 4KRUA 3U48A 1KGUA 3BGAA 4XV0A 1VAHA 4HK6A 3WQ6A 2O4MA 3GXTA 2OTDA 2GOUA 1JDCA 1SPQA 7TIMA 3DFNA 1MWOA 5IDIA 3AXIA 1SMDA 3ZIZA 1CIUA 1EKOA 1NVMA 1LUCB 4B5VA 2EXOA 4F0MA 3W7RA 5I07A 5AHEA 1M03A 4URIA 5D2WA 2V0TA 7REQA 5C9WA 3MBDA 3GU9A 4NYUA 2PUZA 2R1LA 2P8CA 4JN8A 2A3CA 2RAGA 1E73M 4MAZA 3MS8A 3WL0A 2ISVA 1QW9A 3A4WA 3W22A 2ACRA 2Z2BA 1XRTA 4GZ7A 1GOQA 3P60A 3ITCA 1JF5A 5G1MA 4NJGA 2CEQA 3AIUA 1VIZA 1DIOA 1PYMA 1SJBA 3QEZA 3BJTA 4OU1A 1G4TA 2DVUA 4UWMA 2CITA 3KLLA 2OYKA 1UKTA 3LYEA 3P82A 3M0VA 2EPNA 1LWJA 2ODOA 4E0CA 3NSNA 2QQ6A 4N02A 3AYSA 5I23A 4GQRA 2R6OA 4RZ4A 2BX7A 3K46A 1EZWA 3NIYA 4RDYA 4JEJA 2C8NA 1TPB1 1Q7ZA 3M0IA 5LNVA 2QPSA 3B40A 4AW7A 1W1TA 1Q6GA 1MYRA 2QIWA 1BLIA 2ZUNA 2XGBA 1RVKA 3GHTA 1ADOA 5EY5A 3R6IA 1R0MA 1KFWA 3W2MA 2DV0A 1GPFA 1XSJA 3N13A 4B92A 3LHWA 1BSLA 4Q7NA 4MWAD 3K8MA 4R7JA 5FKYA 3EDEA 5D09A 5CG7A 2P53A 4NI8A 1GWJA 4B3ZA 1RA0A 3ZWTA 5AHMA 3FGCB 3S1XA 1JPDX 1QOXA 2PLJA 3PSWA 4DX3A 3WQCA 2X2GA 2QDHA 2VO5A 1VEMA 3CM4A 3S47A 1E4NA 3CIVA 5CAHA 3KVMA 4BQ3A 4G8TA 4PUWA 1MEHA 1HJWA 3CLWA 4IGMA 4FLOA 4OWGA 4WSJA 2VP8A 3WEMA 1QNVA 4GUGA 1LLWA 2B7PA 4CEXC 3CUZA 1MUCA 2C16A 4DWDA 3EDDA 4O17A 3VM7A 3CL8A 4JX6A 4M29A 2Z7KA 5AC8A 3UYIA 1EEXA 1ZL1A 3UBPC 1LRNA 2WCAA 3UWEA 1C8VA 2VVSA 3R8RA 1J2BA 1RJQA 5AYIA 4C6DA 4PUDA 4Q4QA 4PRWA 3KAOA 4NKCA 1FCUA 1I75A 5KEZA 5DX7A 4W8AA 1FWIC 4OE7A 4JYDA 2BWGA 4PMJA 3DESA 1XBVA 1AL7A 3FAXA 4NYYA 5DCEA 1EJTC 3S9YA 2GVEA 1HW6A 1PTAA 2DSVA 1XQKA 4LEFA 1MSSA 4UUIA 1EA0A 4C60A 3APGA 4UMCA 4E4FA 4LYPA 1R3TA 1VCFA 2D1ZA 1Z6KA 2VCBA 3QQ1A 4AMAA 1GOMA 3VCNA 2BB0A 1THFD 2QUTA 5D30A 3LTPA 3MUY1 1VLIA 3EX6A 3QGAC 3NO5A 3UR7A 4F2TA 2OODA 3EWYA 3C0SA 2G5WA 3GIYA 2DSUA 2HPMA 4XK2A 4YU1A 1P0KA 4MY1A 2JE8A 1F3WA 4US6A 3L4ZA 2XH2A 3ARRA 2O56A 3APYA 2NQHA 4ZOBA 1O95A 1V3JA 3MT1A 2FLIA 2FB3A 4ERGA 1EP1A 3W70A 4DO4A 1Q6EA 1TPEA 2VURA 2JGYA 1I2QA 1DP0A 2ZX8A 4GUFA 4NSBA 1JPMA 4V33A 4WDWA 5LKYA 2BXZA 4PCTA 2GZXA 4ZGYA 3VTRA 1SO4A 3MJMA 2DZWA 1JQXA 3ARWA 1WXYA 2O92A 4O13A 5DCBA 5ABEA 4BI7A 1K3UA 3PG9A 3RMEA 1AG1O 1Y8BA 2I56A 1G01A 2P3EA 4PMNA 4JIEA 1NU5A 1XLMA 2ZTKA 1WZKA 2OEKA 3T4WA 5IRPA 3NL3A 3W74A 2C14A 4OGZA 4GO9A 1B4KA 2GVGA 3EPOA 3SRFA 2FZBA 2O7SA 1ZBVA 1R38A 2E77A 1MMFA 4YVVA 2VEIA 3EZ4A 3H2EA 1U1JA 4HTYA 3T9PA 1OWQA 1R6WA 2R9RA 3BW4A 4V2XA 1K8YA 4B5NA 1I2PA 1V7AA 1F8MA 4MZ8A 2ZZ1A 2GL5A 4TOQA 3MJYA 2POTA 3L0GA 3TLLA 2REQA 1Q4NX 2RGMA 3QR0A 3SCQA 5FIPA 3GH7A 3G6LA 5A8QA 1REQA 4GVFA 5EL1A 4AMCA 1FUYA 5CC5A 1RV8A 4N7QA 3HG4A 5LXEA 1EDGA 1B54A 4JTTA 1NOFA 3VX0A 1BHGA 1HKMA 4FHAA 4NY2A 3RM8A 1TELA 4M6PA 1DJYA 3BZGA 4LUIA 1CLXA 3UXDA 1QU4A 3ZMRA 4JNYA 3GXNA 1W1B1 5D9NA 4MY9A 1W9VA 3GXMA 5H91A 2XWEA 5EMJA 2IXUA 1TPDA 1M7JA 4KFOA 3UXAA 4ML4A 3E6EA 1WPCA 2DUAA 5G2HA 4RV3A 3S5SA 1R86A 3HPZA 1JPIA 2AAMA 2EF9A 4QHRA 5EBAA 5I06A 1MZRA 3AHVA 1VCGA 1E9LA 1LJYA 1XIEA 4ERIA 2V9DA 5K7JA 1EJVC 4FLSA 3PZTA 4HSHA 3KTSA 3HMJG 4XD6A 1KO0A 1QW7A 3OLIA 2HVMA 2NLIA 1RBAA 5LXXA 1RBLA 1FWNA 2VGFA 2WZMA 1CB7B 3PZVA 3C2YA 2PC8A 4LU0A 3W02A 1F6KA 4H19A 2AGKA 3GDTA 4AD2A 2QPXA 2CU0A 4CD5A 4L64A 3LU2A 2EKGA 2CHOA 4O8AA 4TVDA 3RM9A 4QG6A 3V36A 2WHKA 1Q6DA 1A4MA 3LHVA 3KBNA 2VQUA 2IQ0A 2H8XA 3LCGA 5DMNA 4UQDA 1XM3A 3M44A 4GCAA 1S2CA 4RLIA 2ZRUA 3LCWA 3W6LA 1PIGA 5EMYA 2HRWA 5A6AA 2PGWA 1U83A 1W3IA 1HQTA 4CU7A 4IIDA 4GUIA 5LIXX 1AQHA 3AXHA 4ZXOA 4L6HA 5A8NA 3LDVA 2JKPA 1NDWA 3VNIA 1H3GA 2ZZ2A 4IPPA 4Q4MA 3VOGA 4Y96A 1ZB5A 1P7TB 3PUDA 4KBXA 1R9ZA 3LHYA 3TTEA 3QHNA 5GQBA 3LRKA 4A35A 1K9FA 4PUEA 1KV8A 1QW8A 1GONA 2WC7A 5D2XA 1OD0A 4RW5A 3BUVA 1PAMA 3OIHA 1W5OA 3GVQA 4CQDA 3B8SA 4AF0A 4XZHA 3SCUA 1HVQA 4JTSA 4X9SA 1YTKA 1TX2A 4IISA 3MMUA 3FSTA 5A94A 3QPZA 3QBUA 5FA5A 4LS0A 1GPWA 2YFNA 3NQDA 4C90A 4AY7A 4ZO9A 4F66A 1FP9A 4NZ4A 5F2GA 2J74A 4UNKA 1R5YA 3IACA 4OUEA 2DORA 3GDKA 4E8GA 5E6YA 2OQLA 2XPKA 2PI6A 4W5ZA 3LQLA 3WD4A 3BH4A 1US0A 2QMKA 4Q33A 4ORIA 4MZ1A 4INFA 5GJMA 4C6CA 2VZTA 3GSMA 2ZA2A 4D1IA 3NEVA 2IQDA 4J27A 1R3YA 3ZXWA 5C9ZA 3UQNA 1KFLA 3P8JA 4S3DA 2G95A 1V6XA 3F4WA 3SURA 2PWHA 4DIAA 4KWWA 5HMDA 1OX4A 4R3UA 1ZU8A 4M8UA 3PBYA 4K6AA 4A3RA 4BS0A 4MM1A 4E3VA 1YTEA 2IPWA 1PIIA 2YBTA 1HO1A 2OT0A 3MKCA 2QCGA 4EF9A 2FH6A 3UR8A 1XIDA 4Q7IA 2IKHA 1ICPA 3VMNA 3LTYA 4Z1BA 4KFPA 4JIIX 1FHLA 1Q85A 3W7KA 5LIWX 3O63A 1E1CB 1V79A 3CL7A 3B9EA 2EG7A 4ACZA 4Q8TA 1VBRA 3FY1A 1SZNA 2PS2A 2P88A 5JBEA 2P0IA 4GIRA 4KEZA 4GACA 3TYBA 1IHIA 1NARA 1QWKA 4GXWA 4ZOAA 1OX6A 4M7SA 2X40A 4J40A 3OHMB 1LZOA 1DJHA 4AY1A 1ZHAA 1HJUA 5JVLA 2VGBA 1VJSA 3E2RA 4PMUA 1X38A 3V75A 4O1CA 1KGWA 4O0ZA 2JIWA 1J18A 3WQ5A 4AZ7A 4GY1A 1EGZA 2V5KA 4HSOA 2X1UA 2J7BA 1UOZA 2XSXA 1KCKA 5CZJA 4KT2A 1XLIA 3PBVA 2CESA 3NPVA 1E9YB 1DIKA 1U5JA 5H8PA 2CBIA 3MDWA 4WEVX 1CNVA 4O12A 2OU4A 4UTLA 4QBXA 4AIBA 3VKCA 2Z1XA 4HP5A 3THQA 3IGSA 2H90A 4JS3A 1Q8JA 3LV6A 2YPIA 3NVDA 4RDWA 3LM7A 1DVJA 3AC0A 3GRIA 1G4PA 1CXFA 5AYYA 1MRAA 4IZGA 2WZHA 3S2CA 1KLZA 3RG6A 1PO9A 3GDBA 3BW3A 1HG3A 1O6IA 1L8NA 3E38A 2WPBA 1WNOA 3DOPA 3FOKA 2PDXA 3M43A 3W87A 2GSEA 3JZUA 3BURA 3R12A 1VHCA 3I7QA 3TYUA 1W1A1 1KFKA 1EX5A 3TV8A 1WDWA 3OYZA 2V5CA 3PPGA 2WLZA 1LP6A 1O1HA 4GPNA 1J0ZA 4RXGA 5CGQA 4RE4A 2C91A 4GC3A 2WCGA 3TROA 4JY9A 1KGXA 4L9YA 4R27A 2PDWA 3TN5A 1T5AA 4XO7A 5IM51 4O0KA 4S3EA 3ZVIA 5KTLA 3EB3A 3PM6A 4PE8A 3IWPA 4M19A 4YTQA 3UYCA 4C6EA 2QCDA 1KC7A 5A2CA 4JN6A 4TX6A 4ZZ9A 5A69A 5JQ9A 3BLOA 3T0CA 1M65A 4PRRA 7A3HA 3S46A 3N34A 4JICA 3KTCA 2XFRA 3QGKC 3F4VA 3AIEA 4JQ1A 2EHHA 4BEUA 4WR3A 2BVYA 4R7OA 4M80A 3OPSA 4MADA 1PZ0A 2HS8A 4U3AA 3FDKA 2QUVA 2CLIA 1AJ0A 4LCRA 1A5LC 1H60A 2QHAA 2VTFA 4ZA0A 3MUIA 1FDZA 1S5TA 3NL5A 1B3OA 3EKZA 2A7PA 4MB3A 2A3EA 2G8ZA 3OODA 5E6ZA 4G7FA 1AJ2A 1XKJA 4K68A 4F9JA 3FA5A 2NX3A 1HL8A 4GH3A 4Z2GA 2XFWA 1E0UA 1RZMA 1Q7MA 1MO0A 4S3JA 3TR9A 2GOKA 1I6NA 5HXMA 3DERA 3STCA 4PTDA 1N8IA 1JCNA 4IQJA 3O6YX 5E5CA 1XGEA 4LC8A 1F74A 3UPMA 4LT9A 1WDRA 4DBEA 1QASA 4FMVA 1RQHA 4F9DA 1J8VA 2DIJA 2KX9A 3W75A 1TV3A 1G1YA 1BXCA 4I6VA 4CNTA 4XD3A 3PN8A 1A0EA 4MDOA 2IXVA 4OBTA 4MJ4A 4Q8PA 3W1TA 1B9BA 2PDNA 1RD6A 2XVLA 4C6JA 3P0XA 3PTQA 2O9RA 1CGXA 5BU6A 3W2JA 3ZR4A 2NXIA 3BO9A 3QSTA 4LY8A 3C2EA 4NZ3A 1NQKA 1QPNA 3WFAA 4KRTA 2AQVA 4NU7A 1PTDA 4ATLA 1MEIA 3T2OA 5D38A 1FHDA 3PBWA 2ZE0A 3TIMA 1JXJA 3RDKA 4FR1A 2Y24A 3EOOA 2V3EA 1H49A 4JHOA 3S83A 3N29A 5GVJA 5A6KA 4REQA 1I0DA 4EAYA 1LTDA 1LQAA 3NNTA 4GNKB 1XLLA 2WJZA 4NL1A 3MUAA 1LLOA 4NRRA 4FNRA 2DFAA 2CW6A 3RLUA 2G4JA 1ME7A 3M7SA 4BFAA 1LG1A 2QNEA 2FZMA 4HPNA 3GW3A 1H4PA 2DZBA 4Y9NA 1ME8A 5LYRA 4UMBA 8A3HA 4C7DA 1DTNA 2FTWA 4FIRA 1U30A 1UC5A 2CYGA 1G69A 2YIHA 3IIZA 1SO3A 1K4GA 3AYVA 1TR1A 2F2KA 2PRHA 1I2NA 1Q3NA 5F4SA 3C8FA 3KBJA 3K8LA 3OP2A 1KM6A 4U33A 2CXGA 2ZCGA 3H4XA 2YW3A 5CSSA 3GAKA 4D6GA 2HISA 1BWKA 2GPTA 1AMYA 4R53A 1PXGA 2CLEA 1ZBCA 4GXMA 2GVLA 1GKQA 4KERA 3RN6A 4DEFA 1HN1A 2WVTA 1DQUA 1JZ8A 4XKYB 4E6MA 3CQKA 3KVJA 2BVWA 4MPQA 5D9OA 1CCWB 3JZEA 5HBFA 4AU0A 2WSYA 2O55A 3UPWA 3TDFA 5G5IA 1S2UA 3EWUA 1ODZA 4H7CA 4KWVA 4H1ZA 3H2MA 3GYEA 3T7VA 4US5A 3C5QA 1FWGC 3PS7A 3VNKA 3SUSA 4A6GA 4YS1A 1WB0A 4JX5A 3EMQA 4PEKA 2VWTA 1AK5A 3FJNA 1VC4A 4CN1A 4GNVA 2J47A 2PMQA 4EANA 3ARUA 3UWQA 4P8UA 2PDBA 1VLWA 2FPTA 4MJMA 4UQCA 2HSAA 4N0RA 1WAUA 1UJQA 3LPPA 3IJ8A 4AX7A 2BXVA 1UW9A 3RX3A 4FXRA 3ITOA 1F9CA 2OKOA 4PUMA 3ARYA 5F2MA 3SY8A 5LNUA 1J12A 4DI8A 1DE5A 3W6YA 3IRSA 1JVNA 2VR5A 1GEHA 2YL5A 4CVWA 4RKAA 1R2RA 1KBIA 4HK7A 1DWHM 3TJIA 1A49A 2XHYA 1WQ5A 3UCQA 4F3HA 5SWUA 2Q3RA 6A3HA 1FTXA 6XIMA 1WZAA 1EUNA 3TWBA 1F3EA 1U2YA 4Y8FA 4D6CA 3F2CA 1Z48A 1TPFA 2WJDA 4HYVA 4WOZA 1I2RA 1V6TA 4U5KA 4P61A 5A8MA 4BQ5A 4EIVA 1H62A 4ROQA 2WXDM 3B3DA 2OSWA 1OYBA 3CS2A 1O68A 1M9HA 1WCGA 3C2RA 3UG5A 1TQXA 3TWAA 4CQ9A 3A3XA 2VEKA 2WQDA 4P7QA 3VMOA 4NNCA 3LSCA 1YLVA 3ZSSA 2O9PA 5CKSA 3G0SA 3SZ8A 4A05A 2YDAA 2QDEA 1GOOA 3QRHA 3TOYA 2OOFA 3SJNA 4ZODA 4N9EA 4C1NB 4KKXA 5A2BA 4LUSA 2WC4A 4PFHA 2MANA 3E5BA 1UG6A 2C1IA 5I3HA 3RR4A 1GG0A 3W88A 4MPKA 1L0PA 1UMLA 2W27A 3TCSA 1JI1A 4EAMA 4U4MA 3VD3A 3OVQA 3GC4A 1F3TA 3FIGA 3BANA 1UR4A 2BOGX 1A53A 8RUCA 5FF4A 1XDJA 1U33A 3SM0A 2QV5A 1O60A 4K8EA 2G50A 4HN4A 1GVFA 1OCQA 1I1WA 4AZGA 3LQGA 3XINA 5C9XA 2P5NA 4DZIA 2DZPA 2VX7A 1XYZA 4NVTA 3VM5A 1X6UA 4OV9A 1S3TC 1ENUA 1GQLA 3AFBA 2QDGA 3GG0A 4CNUA 3PBGA 2NV1A 2IW0A 1W5MA 4JFUA 4F79A 1T7LA 4WJEA 3BL3A 1BEUA 3AS3A 5EPDA 4GIEA 5KETA 2OGYA 3BJSA 3VMPA 1ISZA 2FZ8A 3GO2A 1RCXB 4QROA 3T6CA 3QOKA 4Q22A 3B8UA 4PGLA 4RNIA 3UXKA 1UD2A 2VZVA 4KETA 3BOFA 3BXWA 2WSQA 1KTNA 1A50A 3DFSA 3NDYA 2WOQA 4M1BA 1W5NA 3RHGA 3IV8A 1O12A 1O94A 4N4PA 1VFTA 3ZSTA 4ERAA 1UPPA 5LNWA 1O7AA 1HJQA 4JQ3A 5LSMA 5AYZA 2VX5A 1ITQA 5MHBA 1PS9A 3LPGA 3QV6A 2ZDSA 4XZNX 4KW2A 2BG5A 5BMXA 5L9FA 3VABA 1CECA 4JKMA 1US3A 3BAIA 3W1NA 1JIBA 3VXGA 3UZXA 4J28A 3TJ4A 3CPGA 2X1SA 2BGSA 2CLKA 4NASA 3DGRA 4Q4RA 5T9CE 4XSMA 1XYAA 4IFKB 1JZ4A 2Z24A 1KKOA 3UJRA 2GK1A 1HL9A 1QHPA 1RBOB 3SI9A 2PDJA 2ESCA 4EP8C 4UXDA 4QGCA 1FBAA 1J5SA 1GVEA 3QLDA 3QZEA 3S5NA 3WSUA 3KOFA 3TAKA 2ZWYA 3PFRA 3BLLA 1QI0A 3VX1A 3O05A 1K6AA 1SUXA 3SY5A 3PZQA 3CWHA 5AECA 1ZUAX 3P6LA 2YLAA 2GJLA 4UC5A 2Y7FA 1CB2A 2PWGA 4WXZA 1XX1A 4PB3A 1HVXA 1ZZMA 3NJ3A 4LW7A 3R89A 4WDXA 2CCRA 2AKZA 1XJBA 5HMEA 2Y61A 5AHFA 4LC6A 4Y9OA 1OGBA 1FCQA 3BLPX 4W8BA 4A3UA 3LSBA 3VKJA 1OINA 1SZRA 4IX0A 2RFGA 2Z6IA 2DEPA 2EPOA 4AISA 4KEUA 4QAIA 2YXOA 3WH7A 4S1FA 2BVTA 4N42A 3GBDA 1A5KC 2D3NA 5GJPA 2DSZA 1F61A 4FOKA 3A9IA 3MKVA 4DWSB 1IQ8A 2VFIA 4DUVA 2CBUA 5EMKA 1JL8A 2YL9A 1CWYA 1L6GA 1OC7A 1K1DA 1H63A 3MP3A 3G6MA 4GI6A 1C8QA 2P0OA 1XIJA 3SUUA 1XCXA 5G4EA 4EXQA 5CZTA 5BXSA 1MQPA 5CZSA 4Q8MA 3EX4A 1FWAC 1RLDA 2NVAA 2VKZG 2PDPA 1AW5A 2Y7GA 3UVAA 3BGJA 3DFPA 4L65A 1OG6A 2NLYA 4QE4A 1L8PA 2PWFA 4CU6A 1F05A 4PUJA 3NPXA 1TPUA 1LCOA 4GFIA 4P7OA 4AVFA 1YPIA 2TPSA 4NZ1A 2YKKA 3PUGA 4UTWC 5FEPA 4O54A 1W31A 3B8IA 4ZOCA 3IUHA 1JR1A 2Z1SA 3JUGA 5JIWA 1EH9A 3B8WA 2HBVA 4XO6A 3CUIA 5KZ6A 1XFBA 2BFGA 5HWMA 4L6DA 3W85A 2BLEA 4Z1CA 4R33A 1YNQA 2Z27A 1Z89A 1BTCA 1JZ6A 4IOTA 2PF0A 2ZZ7A 1AMKA 4MAVA 3S2LA 2C19A 3W7EA 5A6JA 2PDIA 1G4EA 1DWJM 3L0NA 3CQ0A 3WLRA 1TWZA 3RU6A 4MNKA 1JAKA 3RRAA 4QQ3A 3HFYA 4I5RA 1UH4A 4FNSA 5I6SA 4BF7A 3ITVA 1AZ2A 4AC7C 4JQAA 3T8QA 2I14A 4LAKA 2EPKX 2XGZA 3P67A 3S5OA 3BAKA 1PPIA 3C61A 2ZICA 5D33A 3VD9A 3O6CA 3TNBA 5C70A 5JH1A 4IXHA 4WY0B 1P6CA 1LUCA 1NY1A 1FWCC 1OJXA 1C91A 4LQ1A 2HV5A 4DZ5A 2R24A 2Q8XA 4HKPA 2OYLA 4FX8A 5CSYA 1L6FA 1RCQA 3QOMA 3E49A 4NG3A 3WQ8A 1JDFA 1HGWA 1S1PA 3TYCA 5E0KA 2QCMA 2A4AA 2EGZA 2FYMA 5BRQA 3VIJA 1AVAA 1LRQA 5AHIA 2F6XA 1GJWA 4GYPA 1KFCA 2ZA3A 1OFDA 4ROPA 1IWPA 3S8HA 5FD0A 3BG5A 4NIRA 3I3DA 1TJPA 5G2IA 4GVGA 3UXIA 5FESA 1NTHA 3R7MA 3T09A 3ZR6A 3VFCA 3MI6A 3P3BA 2QF8A 5HNNA 1TB3A 2Y7EA 1Q6QA 1QNQA 3BICA 2PPGA 1C92A 3OU8A 3B06A 5XIMA 3GFYA 4DZAA 3FVDA 1K7FA 3BLIA 3W9ZA 1TWDA 3W81A 1JRCA 4GQBA 1TYGA 3N2OA 2A1YA 1SSDA 3UG3A 4GIAA 4KESA 3CV1A 4XZLX 2FGZA 3BSGA 5CLTA 4CEUC 4MIMA 4QG9A 5I7GA 4JAWA 4JQ4A 4DNHA 4H6EA 4E2BA 4LPCA 3AXXA 4G7EB 2QS8A 3W7JA 1GORA 3PB0A 4S3BA 2ZX6A 3IJLA 1EF2A 5G2WA 4FXFA 3FGCA 4PTVA 4L80A 4GYPC 4JDBA 4HTBA 1Q6RA 1X1OA 3GG8A 1QAPA 3V7PA 2WQPA 3B8VA 1PEZA 5HWJA 2GGJA 3CZKA 1JNEA 3SUWA 1TTPA 1AL8A 3QKEA 5EA9A 5CPSA 1FWRA 2PGFA 4N6EA 2Y8UA 1ADDA 2A21A 3C2FA 4QITA 1CEOA 2Q71A 1GVOA 1OFBA 3GHUA 1FH7A 4QJ1A 4D9PA 3FCPA 3KUMA 1SW0A 3EA3A 1U22A 4IPIA 1GKPA 4MLJA 3GU1A 3EGJA 3OB8A 3GKFA 5A5WA 2HZGA 2Y8KA 3DKJA 1E6PA 1HGYA 2XVNA 3GVRA 3IVSA 4YXGA 1E43A 1MQRA 4GI9A 4DYEA 2FHFA 4CCDA 3F5LA 4G6CA 3TNOA 4JHZA 3CQHA 4C6FA 1WUEA 3EXSA 4F40A 3Q67A 2A6NA 3N18A 4A8IA 3L2LA 1LF1A 3AHTA 1MFVA 4JTUA 4HPGA 1RK6A 3BMVA 3W7HA 5M3WA 2E6YA 3PY2A 1W3HA 3T0TA 3CL6A 3AMCA 3CQJA 2X1IA 3PBMA 3SCSA 2WSPA 4FNPA 1C9DA 5HR6A 4O1AA 2R94A 4OZOA 2PU1A 3N15A 3U4FA 1EA9C 1Q6CA 4XIMA 1XSKA 4GC4A 3CUFA 1LROA 1UD4A 3UGVA 2JF7A 3D47A 4HQVA 2XZ7A 3CIWA 3R25A 4M7TA 3WH5A 3R2GA 3WNKA 1D8WA 3JU2A 3ZM8A 2EBNA 1AH4A 6XIAA 5BOFA 2OZ3A 4IIFA 1SO6A 2G3MA 1CXIA 2PBGA 2WNZA 2B31A 3FYPA 5CGMA 3W27A 3MV11 4GG9A 1KXHA 4Y8EA 4RE0A 3UZJA 2GLKA 4FNQA 1JULA 3EXTA 3HGRA 3LBCA 2A2IA 2VUNA 3SBFA 2BVDA 4O0QA 3P84A 3A24A 3HPSA 1ADSA 3GFZA 3NQGA 3TC6A 3HQNA 4AWEA 4H01A 1OCJA 4AD3A 3V1PA 3TTYA 1SJDA 4LH8A 4MYAA 4JKLA 3C3NA 4PMOA 2X42A 3TAOA 3VIKA 3LY0A 1TE1A 2ZRVA 2PP1A 1W9XA 1NFPA 3QY8A 5DBUA 1XLEA 2XWDA 3VIGA 1TSIA 4I90A 3UU0A 1PB0A 3TSMA 5HJXA 2BBFA 2NVCA 2A3HA 3LBOA 2V2HA 2QCHA 2QJHA 3QXBA 4MZYA 4P7RA 1LLZA 3H7RA 3LLFA 4QEEA 3KZSA 1PHWA 3B4UA 3VPLA 4GFSA 5I78A 3S1UA 2V2CA 1EJWC 4P8XA 4BHYA 3G1DA 4ZQRA 2D2JA 4C5YA 1TV4A 3I7RA 5J5DA 2WLYA 4H41A 1UWRA 1ME9A 3VUPA 1AQ0A 5C55A 3UR5A 1S46A 1EWEA 2HS6A 3FNDA 4AYGA 1VFUA 2J62A 1TX0A 4I9TA 2OWWA 1MXDA 2W66A 3HJZA 3BV7A 1Q6OA 3RPDA 3W24A 2WWCA 1T0OA 3WQDA 1GHSA 3OO2A 1QMLA 3RJYA 9XIMA 4MKVA 3AISA 1D7KA 1VEOA 2KAUC 4C6IA 4TQTA 4UMAA 2E8ZA 2PA6A 3TUUA 3SCNA 2GQAA 1V02E 1OYCA 1J79A 2ZXBA 3CB3A 1VRXA 4WJ8A 5M5DA 4NZCA 5D04C 5CLWA 3NZQA 2Q09A 3VCCA 4R7WA 3WFZA 3E12A 3C0LA 4R9XA 5HQLA 1KKRA 4JGDA 1TCDA 3ABZA 3KHDA 1EIXA 2YL6A 3NL6A 1E15A 1XINA 4A21A 3GC2A 3L4VA 2XVKA 2E67A 4ICMA 1D3CA 2EPLX 1ISYA 3ZVHB 3NQCA 1EXPA 2AKMA 1YQ2A 3FKKA 2XN1A 1IT7A 2Q3OA 1VBHA 2PRMA 3PHAA 3WDQA 4OJYA 3WF4A 3AQUA 3TA9A 4HSNA 3HG3A 2VFEA 2ZUSA 3P5YA 3WQVA 3VUSA 4FIQA 3WBAA 5K4ZA 4NNAA 4X2RA 4OHQA 9RUBA 1P0BA 2P3ZA 3MVTA 3NDOA 5EMLA 5M03A 1NWSA 4IPLA 4RL3A 4X0NA 2PDFA 2V3GA 2Y1HA 2ZQ0A 3BQ6A 4O1DA 3KP1A 3TYZA 3ZYZA 2HBXA 4QCEA 1V08A 2WJFA 4H6KA 4PH6A 5ABHA 4BWLC 2YGYA 1XWYA 2PFHA 3NWRA 1P7TA 4D6FA 1GCYA 1K7XA 3OG2A 1IR2A 5F7UA 2CWXA 3SY1A 3WENA 2BY2A 4NXKA 5HNRA 1OZQA 1DKWA 5ABGA 4G5DA 1W1IE 2DVXA 5LA0A 3GZAA 1E6ZA 3H8AA 3K5XA 4DZHA 3JVAA 1JGIA 3TTOA 4WOQA 3S2JA 1I60A 4EF8A 5C2XA 2Y6ZA 1CGUA 2JEPA 1H5VA 4GJ1A 5IHSA 2GSJA 4ZMGA 4EPEC 3CHVA 2XFYA 4W85A 1JJKA 4MYXA 4AB4A 2TYSA 3I7SA 3B0XA 1IXPA 5A8OA 1A4LA 1JPKA 1XL9A 5CBBA 1DHKA 4TR9A 5CSRA 5IDZA 1XH0A 4QJ4B 3FVMA 2E5BA 1DHPA 4KRZA 2OO6A 3M4HA 1LBMA 3KS6A 5DF0A 4UNLA 5HMSA 1Z9AA 3UWWA 2J4GA 3N2CA 1V03A 4Q4SA 1R3RA 3DYOA 3U2EA 3LA4A 4PL2A 4FALA 4HPXA 1T40A 3FA4A 4HMCA 4L9ZA 4HU3A 3WLJA 5H8MA 3ZLGA 3NSMA 2Y63A 3RYSA 2WZTA 4IQEA 1OSEA 1YTDA 2ZZ4A 3QGVA 4GI8A 3NAVA 3KFTA 4GNJA 1RK5A 3VGFA 2D0HA 4EACA 4O18A 5K4XA 4RZ6A 1IIGA 3WH8A 4WKFA 1HJSA 1VYRA 3T81A 4XTIA 4GQ0A 1UQYA 3N3MA 4FK9A 3PZGA 4IMFA 1H7WA 3PWIA 4WGHA 3BWWA 4QFUA 3OLGA 1GTHA 1KWGA 3M0MA 4NZJA 1PL9A 2H6RA 1SU5A 3B97A 1E1CA 2PP3A 4V15A 4AX6A 4L61A 4DBDA 5FSEC 1QVBA 1HUVA 3WDJA 1EC7A 2FZ9A 3A9BA 4LV9A 4H2CA 3W1LA 1CT5A 3B9NA 2G3IA 3LOTA 3WUBA 4LBSA 2XZ9A 2PU0A 3TA6A 3B03A 4HIBA 1WKYA 5K9XA 3IUDA 1UB3A 2PDQA 4G1NA 1OFRA 2VT0A 2F6UA 1E0WA 1JUEA 3VYLA 3UY7A 1Z42A 1XR2A 1VBJA 1BWVA 1FDJA 3IIVA 4DJDC 2V5LA 5M2FX 4D71A 3OBKA 2WAGA 3PG8A 2VOTA 3U0HA 2XN2A 2FHCA 3AMGA 4DQWA 4CCCA 3GTHA 3VNDA 3MHFA 2ON3A 2CFFA 4K39A 2ZRYA 4GA8A 1TVPA 4P7LA 2GWGA 1WZMA 3IIOA 3DC8A 2JEQA 2AL2A 2OWCA 3EX2A 3TZNA 4Q8QA 3H54A 4S3AA 4FXJA 4LNCA 1JD7A 1XV8A 1FWHC 5FL0A 4EK7A 4RDVA 1YXDA 1ZAIA 2BHZA 3C2OA 3TMLA 5CPLA 3I10A 4FX7A 4N9BA 3URQA 3WLNA 4DELA 1H61A 2RDXA 3WCZA 5LZLA 2R1KA 3J7HA 2ADAA 3EDJA 5D2TA 1KR0A 4Z2HA 3QPYA 1HJXA 4DBWA 4UZUA 4U2YA 1B5TA 4JY8A 1VS1A 1DIDA 2XH0A 2ZZ3A 4PCPA 1QBBA 3KVLA 4C65A 3WK3A 3GAYA 1YMYA 2FFIA 3GTXA 1GJUA 1E51A 2J7EA 4LUJA 1H0GA 1KB3A 1X7IA 3LERA 2HDJA 4JFWA 2Z2UA 1G94A 4FF5A 3U5UA 3WN6A 3EWCA 3B8DA 5J8LA 5DBTA 4UQBA 3MZNA 4HJFA 1JPHA 3VNZA 3O9NA 2JGQA 2VNCA 4GINA 3GFXA 3TH6A 3QV9A 5D37A 4YN5A 3IJIA 4ZQPA 3HG5A 1BG4A 2GFTA 4W87A 4C6LA 3NURA 3W1PA 3WY1A 1YDNA 2PTDA 5AZ0A 2ATMA 5HNUA 4O4VA 3B04A 5FF7A 5J04A 1LORA 2SFPA 4TU1A 5C6MA 2GGEA 3MANA 3R5EA 2JFEX 4MLRA 3TVAA 1OG0A 4ZQOA 2PC4A 1Q6LA 4G9PA 1VFSA 3WNMA 4DPPA 3MSRA 4HCHA 6REQA 3VDHA 2HCVA 2Z29A 4LUTB 5J5RA 3N2BA 2O4QA 4IMGA 1UUMA 3PZIA 4IG2B 4BJHA 3M0XA 1T6MA 3FAWA 3T07A 4AWUA 4E2DA 3A12A 1HKJA 3PF3A 2VHLA 1JCJA 3LTSA 3O16A 3ZR5A 3DU0A 3ARPA 2C79A 4LJ3A 3KWSA 4LS2A 3LUTA 3NGFA 1QPQA 2GUUA 1RP8A 1LOSA 2FTPA 4DB7A 3FKRA 2VC9A 3KBVA 3STEA 1KXQA 4EOUA 3GR8A 2PD5A 3G1RA 2R1NA 2PWVA 1DXIA 3LRLA 2XIQA 4BY3A 1GK8A 1A5NC 2OX1A 1A0CA 1OABA 4A4AA 4V28A 4MOZA 2WHLA 1WX0A 5AHLA 1O5XA 2CZEA 3V5OA 1Y5VA 2CHNA 3W7GA 5HNTA 4E4PA 3BC9A 1UA7A 4GKLA 4AZHA 4QSFA 2VD8A 4B15A 2AMXA 4U3CA 1JZ3A 2WANA 3ICJA 3R1ZA 4R9OA 2PGEA 2G3NA 5AYXA 3G1HA 3G5EA 5JU6A 3HPFA 1O5RA 2A0NA 3S1GA 1F2JA 3EBVA 5HAOA 4AEOA 1WYIA 4TXEA 1GQIA 1E9IA 2I9UA 1S2WA 2E1DA 4YYFA 5CPQA 1H7XA 3VKKA 1EJSC 2J8FA 3W2LA 3AYRA 3H23A 1QWGA 4ZB2A 2VDIA 4GY0A 5ECUA 2D73A 2WMFA 4AZCB 4NNBA 3CUHA 4GABA 1P48A 3ECQA 4TVCA 1UA3A 3N6HA 3RPMA 3PZOA 5HQEA 2ZWZA 4H7VA 3CO8A 3T0DA 4LRTA 3WLSA 1ISXA 1UZ1A 1F76A 5DANA 3HG2A 3H21A 3OGSA 4CNOA 3UR2A 1JCMP 3WLTA 1LL7A 2VXNA 2Y89A 3QR3A 3BMWA 3IARA 3TW9A 5FF3A 3MMDA 1TZ9A 5ABFB 3CUGA 3B8TA 1XW8A 2D3LA 3R79A 1X39A 3DGBA 4DJFC 4XKYA 3M5ZA 3P74A 1BSIA 1A47A 2CPUA 4QEHA 1TV7A 4AY8A 4WZHA 3GNOA 4NQ1A 4QE1A 3WEOA 2J7DA 1I4NA 4P2VA 3TKFA 1RQBA 1C7SA 1UWUA 3VK5A 3ISIX 5LIYX 4ORMA 3NEHA 2OEMA 4JFVA 3VZZA 3VOFA 2F38A 3W7OA 3BAYA 4F0LA 2P1FA 1GJPA 5I3FA 2MUCA 4W9TA 1TJ0A 1FFRA 3EAUA 2RDTA 3RCNA 4QNEA 3DFOA 2WVSA 4Z0SA 4GZJA 1U1HA 1CX9A 4LWWA 1M53A 5F2IA 1XCFA 2WMHA 3AHYA 5EMMA 1UBPC 4H9UA 5U7SA 4A8LA 2I9EA 3RGTA 2G4FA 2G3FA 1B31A 2HVOA 2FPYA 2E9LA 1S1RA 5CC3A 3KEHA 3A6OA 1M1BA 3APTA 3KW3A 4GCXA 4ZBCA 3LZ3A 3SGUA 2JK2A 3CLMA 3MUZ1 3O1NA 3M41A 1E0VA 2D2HA 6PTDA 2Z0IA 1UIOA 3LG3A 1D3HA 3L66A 4HA0A 4PMVA 4HYWA 1SJAA 3FXYA 3M07A 4H7ZA 3OVRA 3LHUA 9XIAA 4W7WA 3CBWA 1IIHA 4KGLA 1HKWA 2BGQA 2YR1A 1ZJBA 4ZTXA 1W2PA 3W1MA 3N04A 4B91A 1C8XA 4CN6A 1TPH1 5CGTA 3ZJ6A 3SCVA 4DYKA 3MV01 3EX1A 1UWAA 3AWNA 4NX0A 1CI1A 1GTEA 1FVPA 3H7VA 2Z00A 4XBJA 1EDQA 4LTSA 4TV6A 1R8LA 1OFQA 4L1WA 2DQWA 4L4LA 2B7NA 2NXHA 4S2CA 4KIRA 3KXQA 1NDZA 3W26A 1JZ7A 5KMYA 1Z8AA 5TF0A 4ATDA 3SO7A 4C6OA 3G1YA 4C1NA 5BWAA 4H9YA 3FFSA 3WUGA 3LI1A 5FJRA 3ZT5A 3HQPA 5LNSA 1L6YA 4HPHA 4BZYA 3LK6A 5C71A 1K03A 4DVOA 3P2VA 2Z7GA 3MSYA 1R9XA 3R43A 3NYDA 3EPMA 1KCXA 1N7KA 1PYFA 4MJ2A 1ITUA 3IANA 4IIEA 3Q37A 2OO0A 1KFEA 2NUWA 3H24A 4MUZA 4GKTA 3ENLA 1ZCOA 3BCFA 3QZ6A 2PDUA 4R34A 1DEDA 4RCXA 3VGEA 1Q5MA 3ERPA 3FJ6A 3OZOA 2TAAA 2DQXA 1DTUA 1HKVA 3MPGA 1X7FA 1XYBA 1P1MA 2HMCA 5BWFA 1MFUA 4DM1A 4PMQA 2UBPC 2AL1A 1POJA 5JH2A 3TQKA 4WHBA 5HMFA 1PTGA 2CWNA 1B2YA 3VFLA 1PZ1A 3AIRA 3B9AA 3GXFA 4HD5A 3OA3A 4ADTA 4PBGA 2OZ0A 3B0YA 2CBJA 1XG3A 4KEMA 3PJWA 4HZMA 3QHOA 2YCLB 3DBNA 4CCEA 2VFHA 2EQDA 4WVXA 1S5VA 3KBSA 2PCEA 1V02A 2NUYA 1O4UA 5AHNA 3RLGA 4J3ZA 2Z4GA 1QHZA 3P7YA 3EB4A 2NT1A 3OBAA 2ISSA 4LFYA 2Y70A 1ZLPA 4IJCA 1FKWA 2CC0A 1G5AA 3WF0A 5IFPA 4AWTA 4QDPA 4IFKA 1LQ2A 3WJYA 3C0QA 1A5CA 3R58A 4FEZA 3KHJA 2EEXA 3VNJA 1H0IA 3CNYA 1EC8A 4TX8A 2DH3A 2E7FA 4L4OA 2D2GA 1RSCA 3BG9A 1UP3A 4GH1A 2ZX9A 4FI4A 1YRRA 4RE2A 3W7MA 3OVPA 1AD1A 2OG9A 1LOLA 2G96A 4Z08A 4H9VA 1BF2A 1FWEC 4G1KA 3VIMA 1R3SA 3VOJA 1HF6A 4GX9A 8CGTA 1O66A 1I2OA 3WH6A 1JRBA 4YVPA 1IXQA 7CGTA 1MXGA 1OVDA 1HX0A 4EPBC 1OZMA 4IFRA 2VQTA 2Y88A 3ME3A 2VEPA 4MWAC 2ACUA 3OHIA 5D9PA 1GQNA 3L5LA 4P8WA 1F7BA 4KCTA 3RO6A 1RPKA 4LAOA 5DCDA 1WKFA 2J9ZA 5DELA 2HTMA 4DNMA 2CZ5A 3GE7A 4YMZA 2CNCA 2CZDA 4IIGA 5BZAA 2VEFA 4DWSA 1PX3A 4K7VA 1IEWA 4AIOA 4AD1A 3KS5A 3H4GA 1NEYA 5I02A 4ZXLA 3A3WA 2PDHA 4PUKA 3USZA 4DUXA 4D2JA 1V77A 5I79A 4P5UA 4ZFCA 3HTWA 2CLOA 3VIPA 1BGGA 5DMLA 3TSBA 1KQZA 3JW7A 2GQ3A 4B3KA 3R4IA 5FSDC 2YW4A 4YWSA 4JTJA 1Q7QA 3IUIA 5MKGB 3T2QA 4JYEA 4HA4A 4HCLA 3EWDA 1PHQA 4LAZA 4A8RA 2VMFA 4AZIA 2QULA 3CEUA 1OB0A 3P93A 4FLQA 3F03K 3GU2A 4F0RA 1PV8A 5BCAA 4BI5A 4DWSC 4JR5A 3AMLA 3GS6A 2DZAA 4O53A 3WJXA 3H26A 1N2VA 2DY3A 4LSBA 3OW1A 3UWZA 4A8NA 5CZKA 5AB3A 1M7OA 5D03A 2QKFA 1J6OA 1BQGA 3KOZA 1UD6A 2I5IA 4GLEA 2BOEX 1QOQA 5G4WA 1W3TA 3WQ4A 1QPKA 4U28A 3EDKA 4ES4A 5HATA 5XINA 3N12A 1Z41A 3CO4A 1EQPA 4XB3A 4TIMA 3V0TA 4UR8A 1TFVA 4DUWA 1SJCA 3PZUA 3F2DA 1E71M 3G22A 1W54A 1RLCL 1KWKA 1GOIA 3DHPA 4IJBA 2ZC8A 2DZVA 4CCZA 1TJ1A 2FDSA 4CQAA 2W0UA 3DX5A 3GD6A 3WK0A 1S2VA 4F8XA 4G56A 1VR6A 4IUGA 3A4JA 3P80A 4K37A 3HMCA 4I7WA 4UOQA 1XISA 3W73A 1HFBA 2QUMA 3M1ZA 3UVIA 3DEQA 2YXGA 4DJEA 3E1F1 1WBJA 1UIPA 1NM9A 1CLKA 1DWFM 1TJRA 3TP4A 4B5UA 4A22A 3AO0A 3POCA 4ACZB 1ZAJA 5AN7A 2V2DA 3TEVA 3GNXA 3GWQA 1S5NA 4XZBA 4AVNA 2DW6A 2HXUA 1IWBA 3FN9A 3F5JA 2PDGA 5D05A 3THUA 2ZX7A 5HOSA 2HK0A 1DWAM 4R88A 2JKEA 2XVGA 1MNSA 3WQOA 1MQQA 2YZ5A 3I6TA 3LCIA 5C9RA 5BROA 1LG2A 4KPLA 2F6KA 1BRLB 4J3XA 3W29A 3SUVA 4UOJA 5HUPA 1LOQA 3TW6A 1W9BM 3W72A 4G7EA 2BS9A 1Q66A 5DXXA 1EGMA 4UTUA 2D0GA 1OADA 1E72M 2OXNA 5FJTA 4UOZA 4DF2A 3IRDA 3UF9A 4OECA 4JTRA 4YLWA 3DXIA 3SQLA 3ARSA 5A8GA 4XAFA 4DJEC 1SYTA 1PIFA 1HL2A 4MB4A 4IP7A 3D5HA 2PWEA 2J66A 2PB1A 4IP5A 3SN1A 5CAKA 5HWNA 1TTJA 4JTEA 3I3BA 5AKQA 4H83A 3ATYA 2HK1A 2YFOA 1V6YA 2NWSA 4FP1A 4XBKA 3BCJA 2DP3A 2D0FA 4MTVA 1KM5A 1X8FA 4WF7A 3W37A 1PWLA 1QDSA 4ZL1A 1Q2RA 2ASHA 4W84A