2PE3A

Crystal structure of frv operon protein frvx (ph1821)from pyrococcus horikoshii ot3
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
344
structure length
330
Chain Sequence
DWKLMQEIIEAPGVSGYEHLGIRDIVVDVLKEVADEVKVDKLGNVIAHFKGSSPRIMVAAHMDKIGVMVNHIDKDGYLHIVPIGGVLPETLVAQRIRFFTEKGERYGVVGVLPDWDQIVVDVGASSKEEAEEMGFRVGTVGEFAPNFTRLNEHRFATPYLDDRICLYAMIEAARQLGDHEADIYIVGSVQEEVGLRGARVASYAINPEVGIAMDVTFAKQPHDKGKIVPELGKGPVMDVGPNINPKLRAFADEVAKKYEIPLQVEPSPRPTGTDANVMQINREGVATAVLSIPIRYMHSQVELADARDVDNTIKLAKALLEELKPMDFTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 354aa long hypothetical operon protein Frv
publication title Crystal structure of frv operon protein frvx (ph1821)from pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
total genus 97
structure length 330
sequence length 344
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05343 Peptidase_M42 M42 glutamyl aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.40 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Peptidase M42, domain 2 2pe3A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2pe3A01
1BPMA 2PJAA 4NGSA 2PJ1A 2RFHA 2XEJA 2IMOA 2BOAA 3B3VA 2AFXA 4P45A 4JZ0A 4MHPA 2BCOA 3JRUA 4MHZA 4NGMA 3KGQA 3SJXA 2AFMA 1Y7EA 2C6PA 4P4EA 5LYLA 3HUVA 2ZEGA 1YW6A 2BO9A 3FX6A 4FWUA 4ZY1A 2PJ6A 4PPZA 3VATA 2GREA 2RB7A 3IO1A 1ZLHA 4PXCA 2VL1A 4UEFA 2V8GA 4OC5A 2ABZA 2CTCA 3KHXA 2OR4A 3KQXA 3B3SA 4P6YA 3K9TA 3FF3A 3HLPA 5K8NA 3ISZA 4MXUA 4MCSA 3D7DA 1TKFA 4PXEA 3NH5A 4X8IA 2F7VA 1PCAA 1ARLA 4NJQA 4EMEA 1VHEA 3BXMA 3FH4A 5ELYA 3D7HA 1Q7LA 3D67A 5CPAA 2C6GA 3PEIA 1GYTA 1AYEA 2PJ7A 3FVLA 2ZEFA 1YW4A 3PB4X 4W9YA 2NYQA 1AMPA 4F9UA 2IJZA 1YMEA 1LAPA 2XEIA 1LAMA 4OC1A 1HDQA 2CIJA 4P4IA 3MN8A 1XJOA 1H8LA 4A38A 4UIAA 5LRKA 4A94A 4ZI6A 3DLJA 4PXDA 4IAVA 1JQGA 3BHXA 5JH9A 3PB9X 3NA6A 1LANA 2V8DA 1IY7A 2HC9A 2ZOFA 1TKJA 4OIWA 1Z5RA 3KHZA 2GLFA 2PJ3A 1FNOA 3SJEA 2JEWA 2FVGA 2ZELA 3T8WA 5D8NA 1ARMA 2C1CA 2ZEEA 5LRGA 4DJLA 5LYFA 3H8EA 3LWUA 3V38A 4NGRA 2Q51A 2ZEMA 3PRTA 5LYIA 1ZLIA 2C6CA 3S9NA 4MCPA 2AFWA 4ZX9A 3NFZA 3D7GA 4NGPA 3RBUA 1CPXA 2G9DA 3GUXA 3N5FA 2O4HA 3WC6A 3D68A 3PB6X 3PFOA 1LFWA 2PIZA 4ZY0A 2GLJA 3B3CA 3S9LA 5CBMA 4P4FA 3KQZA 1ZG7A 2AFZA 4P4JA 2XEGA 4ZY2A 3IEHA 3CDXA 4NFRA 1NSAA 5HVGA 2WZNA 1Y0RA 2PCUA 2ZENA 4OC3A 4NGTA 1CG2A 2IQ6A 3WC5A 4F9VA 3TX8A 1DTDA 3SI2A 3PFEA 5F09A 4P4BA 3PBEA 5K8OA 3CPXA 2HB6A 4FAIA 3LMSA 4R76A 2PJ4A 5LYDA 4OKOA 5K8MA 2ZEDA 4MHYA 2Q43A 3K2KA 1VGYA 3H8GA 1CPSA 3VARA 1EE3P 4FBEA 1HEEA 3FMCA 4LQGA 2PJ0A 4R6TA 2PRQA 2JBKA 3PB8X 4NGQA 3IWWA 1HDUA 1VIXA 4Z65A 2V8HA 4MCRA 3SJFA 1OBRA 6CPAA 1UWYA 2ZEHA 2EK9A 4PQAA 3KL9A 2PVWA 4UF4A 1LCPA 4OC2A 1XBUA 4PXBA 1ZG9A 2ZEPA 4UIBA 1BLLE 2NSMA 2CF4A 1TF9A 3B2YA 3L2NA 3CPAA 4IHMA 1PYTB 5HVHA 1CX8A 3D7FA 2PJ9A 4DYOA 5HVFA 1QQ9A 4F8ZA 3KI9A 2J9AA 5DS0A 5JGFA 3B35A 4ZYQA 3PB7X 1QMUA 3KZWA 4OC4A 8CPAA 4UEZA 2O53A 4EWTA 5I4MA 4CPAA 2QJ8A 4ONWA 3MRUA 4MRIA 2POKA 4OMEA 4TWEA 1CBXA 2XEFA 3D4UA 4YWYA 2PJ5A 2EK8A 3SJGA 2PJ2A 3NH4A 3GB0A 2PJ8A 1CP7A 3PBBA 3GLJA 3FEDA 2I3CA 2OOTA 3NH8A 1XMBA 4NGNA 5THWA 3IJ3A 4JYWA 3CT9A 3QNVA 1XRYA 1BAVA 1F57A 3I1UA 4UEEA 1CP6A 3KASA 1R43A 4A39A 3VH9A 4OP4A 1LOKA 4MMOA 3IC1A 3WABA 4TNUA 3FEEA 1M4LA 5IB9A 4O23A 4EFDA 3S9MA 2AFSA 3H8FA 2GU2A 1ELLP 3SI0A 1F2PA 3B3TA 3SI1A 1BPNA 4AXVA 3RAMA 3IIBA 2EWBA 5J1QA 2AFUA 1TXRA 1Z2LA 4MHNA 4B6ZA 1ELMP 5D29A 1XFOA 3KR5A 2PE3A 4DUKA 4BD9A 2CTBA 3FJUA 4R8FA 3IFEA 5JM6A 4WJBA 4IK2A 2ANPA 2Q4ZA 2DEAA 1YSJA 4YU9A 3WT4A 4OC0A 2PVVA 2V8VA 1Z8LA 4H2KA 1F2OA 3BI0A 4G1PA 2PJBA 1FT7A 3WC7A 2PIYA 1R3NA 4GM5A 2ZEOA 4P10A 4K3NA 5K8PA 1ZG8A 4X2TA 5LRJA 1IGBA 5HXDA 2F8HA 2ZOGA 7CPAA 3B3WA 1KWMA 4MCQA 2PJCA 4P4DA 3B7IA 3ISXA 4R7MA 1VHOA 4FUUA 4P44A 4WWVA 3V7ZA 2QYVA 4KSIA 3FECA 1Y0YA 3TC8A 4OIDA 2AFOA 2QVPA 4X3RA 1TF8A 3DGVA 1DE4C 1TKHA 3D66A 4A37A 4NJRA 4ZX8A 4RUHA 2WYRA 4Q7AA 3KR4A 2V77A 1RTQA 2JBJA 1YLOA 3RZAA 3BI1A
chains in the Genus database with same CATH superfamily
1BPMA 1WU8A 3T51B 2PJ1A 3U6KA 2RFHA 2XEJA 2IMOA 2BOAA 4JXRA 3Q6RA 3JRUA 3BCDA 4II2A 5GV8A 1UMKA 3GQBA 2GIVA 1TVCA 2PR8A 3PP9A 5LYLA 1ZO0A 3HUVA 2QTZA 3FX6A 4HKFA 2VZYA 4OADA 3EC4A 4PPZA 2AE6A 4OLLA 2Z3KA 4H9GA 3ES9A 1ZLHA 3OJWA 4PXCA 5KTDA 3GKRA 2DF5A 2V8GA 4YEJA 2CTCA 2ZBVA 3AGQA 3KHXA 3KQXA 4P6YA 3LQ6A 3FF3A 3HLPA 2D3LA 3ISZA 4RI1A 3I1FA 1E3XA 2GE3A 1XE1A 1E62A 2C5BA 4MY3A 3W5HA 3D7DA 2HQYA 4R9MA 4X8IA 4CYQA 3F8KA 1T5EA 4NJQA 4EMEA 4JMQA 1VHEA 2GK7A 4B47A 1Q81D 3PVDA 1R57A 3ONUA 1JA0A 3D7HA 3Q38A 3D67A 3VO2A 3CXQA 2C6GA 3PEIA 1GYTA 3PUMA 1AYEA 5HMNA 3PB4X 2DY1A 4YELA 4W9YA 3P27A 4U9ZA 5I0CA 1YMEA 1LAPA 1LAMA 2ZITA 4B3GA 5C82A 4XD7A 2ZW4A 4UIAA 1VQ8B 3B8GA 3ZBUA 3ZUGA 3NA6A 1UD8A 1LANA 2ZZEA 5A28A 2REEA 4XOPA 1H8EA 3TOBA 2ZOFA 3QB8A 1IICA 2PJ3A 2M5SA 1XE4A 5HKKA 2B3VA 3TO9A 4MFKA 3ZZUA 3FJOA 3VNVA 1DDGA 4XPLA 4Y49B 5D8NA 3D3SA 4XKVA 1NB9A 1E1RA 5F4JA 5EMIA 5FIUA 2CNMA 1WWZA 3W6XA 5DWNA 4KOSA 3JU4A 4KKTA 3JQPA 1ZLIA 1FNBA 2AFWA 4JXQA 3Q6QA 4QHYA 4CAVA 4ZX9A 4H6ZA 2WPWA 4M2LA 2NPFA 2DYIA 4XONA 3MMPA 4KVXA 4CGMA 3A8IA 3WC6A 1P4NA 2B5GB 3ZZTA 4ZY0A 2GLJA 3B3CA 1EFUA 5CBMA 3S9LA 4XORA 1ZG7A 2AFZA 4LBWA 2BPOA 1GJRA 3IEHA 5E96A 4OP7A 1Y0RA 1QSTA 1G7TA 2FCKA 2PCUA 4OC3A 1CG2A 3U2QA 4NGTA 2IQ6A 2X6XA 2QMUA 3BY1A 2OBTA 3PFEA 3SI2A 3R9FA 4BBHA 1YI2B 2WR8A 3ZIAA 4RS2A 4C2ZA 2V7UA 1QX4A 3CPXA 4X0CA 3P2HA 5JPHA 1VQ5B 4OKOA 4MHYA 1Y9KA 3CCLB 3H8GA 1XB2A 4UCMA 1I8DA 5HZAA 4FBEA 1J9ZA 1V0CA 3H94A 4Z4RA 2H5MA 2FIWA 2FX3A 1KK2A 3PB8X 2JBKA 1HDUA 1FY7A 1EFTA 2PC1A 1W34A 1Z8XA 1OBRA 4U5YA 2R8VA 6CPAA 3G3SA 1QSOA 3SHPA 2EK9A 3KL9A 2P6EA 3FIXA 4DK1A 1XBUA 3CXPA 4PXBA 1ZG9A 3SEJA 2WPDA 4FK8A 5IK2A 1WK4A 3L2NA 3PGPA 2R9VA 4DYOA 4NF1A 2FE7A 5HVFA 2B4BA 1QVFB 2GQFA 2J9AA 2YWFA 3ZBTA 4ZYQA 1QMUA 1QFJA 1N8RD 4MHDA 5I4MA 2XZLA 2RC4A 4BPRA 4TWEA 3GIUA 1YJNB 2ZPAA 2LZJA 4UFXA 4K1XA 2ZBUA 1V0FA 2PJ8A 2VBSA 3SXOA 1Q7YD 4NGNA 3H5ZA 1PKVA 4R71A 3CT9A 4A95A 2Z6BD 2OTJB 3JUWA 4TMTA 2VNIA 4XMYA 4ZV4A 3VH9A 4ASUA 1YVKA 2OTLB 4PV6A 5KNLA 1M4LA 1RO5A 5KTAA 3F0AA 4F0XA 5IB9A 4O23A 4LBVA 2GFQA 2GU2A 4E8OA 5L46A 3SI0A 4QVTA 3RAMA 1E1QA 1XMTA 3QFCA 4C2XA 4X05A 5J35A 1ELMP 3GY9A 1N0VC 2X0KA 2PE3A 4CYNA 1EP3B 1R5BA 3DSBA 3WNDA 2CBXA 5KTCA 3NE8A 2Q4ZA 4MFQA 4A30A 1M1DA 2I1LA 3VR6A 3WT4A 4MFLA 2VNHA 2ZZGA 1I21A 4N3NA 4YALA 4C7IA 3BI0A 4B43A 1W0KA 2PQ8A 2PJBA 3S6GA 4PC1A 1R3NA 2ZEOA 5K8PA 2WSSA 1IGBA 3TTHA 2JLMA 3B3WA 5HH1A 1PU9A 1A2ZA 4WZTA 2D74A 4MCQA 4TKOB 4G7WA 2PJCA 3DDDA 3B7IA 4Y9UA 5IB0A 2B5OA 3EXNA 4R7MA 1DDIA 2BN4A 1VHOA 4FD7A 4WWVA 3SJZA 4B48A 1UFHA 4CGNA 4KSIA 3FECA 1Y0YA 3TC8A 2QVPA 3PA2A 1S7NA 1RQRA 4E0FA 4YFJA 2V7WA 3PUNA 3PA1A 3T53B 2X8KA 2Q6IA 4NNJA 4UZEA 4II9A 1RTQA 4CGPA 1YLOA 4B4DA 4KOYA 3H9NA 2B7CA 2ZW7A 5FL7A 4R3KA 1I12A 3W2HA 3B3VA 2AFXA 4P45A 1NBMA 1S5KA 2VQYA 4WZLA 3SJXA 1Y7EA 4P4EA 3MCAA 4P12A 1YW6A 5J8CA 4XLAA 4FWUA 2ZL5A 2PJ6A 3VATA 2GJRA 1M44A 2FL4A 1M4DA 3CCEB 5LMZA 5FO1A 4NSQA 4YAOA 4G6IA 3G71B 1ZM3A 4JWPA 4GS4A 4AG7A 2JIZA 4C43A 1TKFA 3J81k 5J8FA 1L0CA 4TSFA 3RYOA 1D8TA 2W6IA 1ZM9A 3EO4A 1PCAA 5A8AA 3BXMA 4U9YA 4N3GA 2REFA 3TOAA 1GAWA 3U6BA 2CC2A 3OZUA 1W87A 2CNDA 2ZEFA 3OE7A 1YW4A 2F1MA 1AMPA 3CW2A 3R9GA 4B14A 3GVJA 2YNEA 4P4IA 4XQFA 5A88A 4ZCMA 3R95A 3OPOA 3A3GA 1H8LA 1XJOA 4LUAA 4CYOA 5H59A 2O28A 5LRKA 1M1KD 4PXDA 3B82A 4UZUA 3LQEA 5AG7A 4AF6A 4G7XA 3G05A 3BHXA 1N07A 1BOBA 2VEZA 1IYKA 1M4GA 1XF8A 3GIRA 1EFRA 3TFYA 2R98A 1M4IA 2GLFA 2I79A 3SJEA 3CP8A 2Q7SA 2JEWA 4MFZA 4RD6A 3CD6B 3T8WA 4KKSA 2VNKA 1D1NA 1EXMA 1ARMA 1Z8WA 2C1CA 5LRGA 4AVBA 2YWEA 3AVUA 1B87A 3V38A 3T56B 4NGRA 3CC2B 4KOUA 2Q51A 5F46A 2QIRA 3OOCA 3S9NA 4WZEA 3I9SA 2BF4A 2J8MA 2PDOA 1YJWB 1W0JA 1X12A 3G4SB 3D7GA 3GYAA 2Q6LA 4B10A 4NGPA 2ZL6A 3OAAA 1F60A 5F49A 5TY0A 5IYNA 2G9DA 2OK8A 4PC2A 4HNYB 3P26A 1Y7RA 2FS5A 2B5GA 1N08A 4TMWA 5GV7A 3VWDA 4P4JA 5FVJA 2HMAA 2XEGA 3FNCA 2B58A 1UD5A 5F4OA 1NSAA 1JB9A 2WZNA 4AB7A 2B7BA 1KK0A 2ZENA 4L8AA 4FD5A 5EC4A 1EP2B 3I56B 4KOTA 4KORA 3WC5A 3TX8A 1DTDA 4YGOA 5F09A 2VXKA 3CXCB 3PBEA 2HB6A 4B11A 3LMSA 4CGLA 1S7LA 1QG0A 3NE5B 4X5KA 2C77A 1NMTA 4UWIA 4MBUA 2Q43A 3JTKA 2P3MA 3OFNA 4PAAA 1HEEA 4Z4UA 2PJ0A 2Z0ZA 4M4SA 2OB0A 2ZW6A 2PRQA 2DCUA 4IF5A 3IWWA 5H86A 4RDKA 3A35A 1VIXA 4M3SA 3OKXA 4P22A 4MCRA 3R9EA 2J8RA 4Z4TA 2V4DA 1CNEA 1OB2A 1IYLA 2ZEHA 4F0YA 5IYQA 4P1VA 4UWJA 2XEXA 2BEIA 1D2EA 1S4MA 3R1KA 3NE7A 1LCPA 1Z8TA 2D4OA 5FO0A 4TT3A 2V7VA 1GO2A 3V7AA 4UIBA 2ZTGA 2BM0A 4X7DA 4IHMA 4KOXA 3VNUA 3LO8A 4OOSA 4AC9A 1SKYB 3OP1A 4XLHA 1XOVA 3VWEA 4G1VA 1YVOA 5JBQA 1OGIA 2B4DB 2C2WA 4HNXB 4EWTA 4DNRB 4Z4VA 4LQ6A 2QJ8A 4CPAA 4ONWA 1VQ7B 1E3ZA 5IYPA 4QUZA 3MRUA 4KZTA 4MRIA 2X6WA 4OMEA 2A4NA 3KEWA 4L89A 4PC6A 4AVCA 2XEFA 3D4UA 1TLLA 3NH4A 3G8WA 3W2EA 4ACBA 4H89A 2GJPA 5EBVA 2OOTA 5THWA 4M85A 3IJ3A 1W9XA 4JYWA 3DNSA 3D2MA 2Y0MA 1XRYA 1BAVA 1EFCA 4RDJA 4UEEA 4LBZA 3ASQA 3AGPA 1OZPA 4UBRA 4NXYA 5KSWB 1QVGB 4HE5A 2X7BA 1CQXA 4RN7A 4MMOA 1PUAA 4NCZA 4HPSA 3D26A 2R7HA 4PC3A 3QAYA 1KUXA 1MJ9A 2Z3LA 4EFDA 1WSRA 1N06A 2C5HA 1FX0A 2ZXVA 1ELLP 2EIXA 4L8JA 2EFGA 3JVNA 3MGDA 5J1QA 1Z4RA 1E63A 1QGYA 4TMVA 2BM1A 4G1BA 1MK4A 3LNNA 4AVAA 4DNTB 4R8FA 3IFEA 5JM6A 2JN9A 2XZPA 2ANPA 2X53S 4CRYB 4DK0A 4EVYA 1YX2A 2QGGA 3DR6A 1Z8LA 2Z3OA 4H2KA 1BQEA 1F2OA 1VQPB 5FA6A 2X6YA 2YWHA 2GJKA 3RNZA 1UD6A 3A8KA 4GM5A 3T9YA 5LRJA 1IOFA 3LD2A 4B12A 4TMXA 3OJXA 2F8HA 2BUEA 2D3NA 3CCUB 2I00A 4MYUA 1KWMA 1YLEA 4P4DA 4YAWA 1X10A 2PIAA 4P44A 3WBJA 1AUGA 2DXQA 2QYVA 2QTLA 3GSIA 2IL4A 4X3RA 3DGVA 3D66A 2OZUA 4A37A 3E20A 1VQ4B 3QFRA 4RUHA 3ASPA 4ZGYB 3ZPNA 2DEUA 2YGWA 3WR7A 1YQEA 4KOWA 1Q9SA 4HIZA 3KR4A 1E64A 4GXHA 4IUSA 3R96A 4ONUA 1QH0A 4KUBA 4MYTA 4NGSA 1AMOA 1P0HA 1GR1A 4JLYA 2PR1A 4B13A 4F7DA 4MHZA 4QBJA 2OU2A 4NGMA 1NRKA 3KGQA 2AFMA 1QSRA 3QFTA 2ZEGA 4M6HA 2BO9A 4ZY1A 2AJ6A 2GREA 2XNCA 3S6FA 4RPDA 3IO1A 4OC5A 2ABZA 4B5PB 3QE2A 1SM4A 2ZL7A 4P26A 3B3SA 2RC6A 2ATRA 5K8NA 1KK3A 4MXUA 1VQOB 1SQHA 4MY0A 4CAWA 3Q3AA 3W2FA 1W35A 4Z4YA 4MCSA 3CMMA 1EWYA 1OHHA 4PXEA 3NH5A 1AIPA 2F7VA 4UFVA 1ARLA 2NV4A 5FNZA 1MABA 2Z3NA 3FH4A 5AGEA 1I18A 4OPSA 5ELYA 4Y7CA 2Z11A 1OB5A 1IJFA 5G20A 2HDNB 4M6GA 4Z1MA 5CPAA 2JJ2A 3BJ7A 4KUAA 1E79A 1G7CA 3FVLA 2CXAA 4C2YA 4YRHA 3SXNA 2NYQA 3V8IA 3CZXA 2IJZA 2XEIA 2WZPP 2CIJA 5AG5A 1V5VA 2VZZA 2QA4B 2Z3MA 2WUUA 1KUYA 2CNSA 4QB9A 4ZI6A 2BL1A 2DPTA 4ZBGA 1WPCA 5JH9A 1RQPA 1U2RA 1WOSA 3DR8A 3PZJA 2HC9A 3W91A 4B44A 5GCNA 3S6HA 3KHZA 3LODA 5THXA 4M6IA 1XQBA 4Q36A 4QC6A 1VQ6B 3CTAA 2VI7A 4CRZB 2FVGA 2ZELA 1CJWA 3OW7A 2DETA 1S0UA 1S7KA 2EBJA 2DERA 2C4TA 3E1YE 2QMLA 4DJLA 1VF7A 5LYFA 2GK6A 4AVZA 3H8EA 1TTTA 1NJID 3LWUA 2WJYA 2Q7BA 2C6CA 4B3XA 4MCPA 1KUVA 4QVJA 2R1IA 1YJ9B 1CPXA 3GUXA 1IOIA 4ZCIA 2D9RA 3N5FA 2O4HA 5DN6A 1KK1A 2YNCA 3PB6X 3PFOA 1LFWA 1VQNB 1OB0A 3A8JA 4XNHC 4P4FA 4FN5A 2P6FA 3OEEA 4KSAA 1XIXA 4ZY2A 3CDXA 4RLZA 4NFRA 1HVXA 4KVOE 2PRBA 5C88A 1FDRA 2ZZFA 1BO4A 4P6VF 3A3BA 2HV2A 3B78A 2Q6KA 5HXBA 1U6MA 4P3IA 3CB4A 1YREA 1QUEA 4FAIA 4R76A 3N7ZA 2WSAA 3D8PA 4AG9A 3CMAB 2FSRA 3G6EB 5K8MA 3ZZ0A 1YR0A 2G0BA 3K2KA 4C68A 5TR9A 3QSYA 4E0AA 1CPSA 4XOTA 4MFJA 3VARA 4KSFA 1N0UA 3FMCA 5HZBA 1QGAA 4B5OA 1W2BB 3ZC3A 3UY5A 2OK7A 1CNFA 1JNYA 2F4NA 4R6TA 4Z65A 2B3UA 4TN1A 2QEXB 1QUFA 1CM0A 3TT2A 2QE7A 2OZHA 3CCMB 4RJLA 4II3A 4WQMA 1B6BA 1VLOA 4X07A 3W2IA 3FYNA 4PC7A 4QVAA 2ZEPA 1BLLE 1TF9A 4R57A 3B2YA 4Q7JB 4XKWA 3CPAA 5HVHA 3AVTA 4M53A 4PK2A 4RCYA 1S72B 3KI9A 2BV3A 2CRVA 3BC9A 5DS0A 5JGFA 4LC0A 4CS0B 3PB7X 3K9UA 2B4DA 4TMZA 3FKSA 4UEZA 4QV2A 1LRZA 3RO0A 3IWGA 4KVME 1M90D 1CBXA 1HA3A 4YWYA 2PJ5A 1N05A 1GAQA 3GB0A 2VBTA 4XR6A 3ASRA 1CP7A 4PK3A 2I3CA 4RD4A 3SJPA 5F4MA 3I55B 3QNVA 1PJ6A 1J4JA 2OZGA 2V7QA 5CNPA 3I1UA 1CP6A 3KASA 5KW9A 1UD4A 2V31A 4A39A 2BSAA 5A27A 1COWA 4XLCA 4OP4A 4PABA 1LOKA 1ELOA 3IC1A 2JDDA 1VLYA 3A1PA 3FEEA 4ACAA 1QFZA 3S9MA 2AFSA 3BNWA 4UZFA 1TUIA 1Z4EA 2GPJA 3SI1A 1YGHA 3IIBA 1DARA 2EWBA 4IW3B 2AFUA 2ZXHA 4B6ZA 3MHPA 1WSVA 5AG4A 3BQJA 5D29A 3ZZIA 4X7FA 3KR5A 4DUKA 3P2FA 2CTBA 3FJUA 5F48A 2BGIA 4PGOA 4WJBA 4IK2A 1YIJB 5TV2A 4YXWA 1Q82D 2DEAA 4XNHB 3F5BA 5G21A 3S6KA 3OZVA 1YSJA 4RDLA 4KLVA 4OPOA 2V8VA 3TO7A 3CC7B 1N71A 1IB0A 4OAEA 2VJJA 3HAGA 4C0SA 2CK3A 2KCWA 3BY2A 4G1PA 4Q38A 2JJ1A 1FT7A 2PIYA 1JA1A 4K3NA 4UCPA 4X2TA 3BCFA 3GVLA 1QGZA 2J7KA 4QFMA 5IX3A 1P4MA 1NE9A 2HUZA 3SKBA 2BVNA 2PSWA 2OBRA 1VQ9B 3I3GA 3T90A 1VKCA 2FXFA 4FUUA 1WTHD 4OOXA 2ZXIA 2ODFA 4F6AA 2WJVA 2GANA 4CYPA 4CAEA 3W6SA 1Q2DA 4XPDB 2XNJA 5JQ4A 4Y9RA 2V7XA 1RXTA 4NJRA 4ZX8A 3FRMA 1K9MD 4OPVA 1K4JA 1JWQA 2VNJA 2OH1A 1YHQB 4U9UA 2WYRA 1FRQA 1PJ7A 4RPBA 1KC8D 4FD4A 1XEBA 2V77A 2Q6OA 4X7EA 4Z4ZA 3AVVA 4P9SA 4CGOA 3BI1A 1T6ZA 1UD3A 2PJAA 4GQNA 3QFSA 3OW2B 3JQQA 2Q44A 4JZ0A 4MHPA 2G3AA 3OZWA 1VQLB 4R3LA 2C78A 2BCOA 3C26A 4DQKA 4UA3A 2DPSA 2C6PA 3R6JA 5AG6A 4M0LA 3VO1A 4JJXA 2C4UA 4ZGQB 2RC5A 4PSXA 4XM3A 2RB7A 1K73D 1A8PA 2VL1A 2BGJA 4UEFA 1GHEA 1T6XA 4B5PA 2X3UA 4A33A 1G7SA 1FNCA 2ZW5A 2OR4A 3CCSB 4P3YA 1WOPA 1H8HA 3K9TA 1BX1A 3WYAA 2CY2A 4UFWA 3V76A 2Q0YA 3WNBA 1BPLA 5E6TA 5BWAB 5CDFA 4RD3A 2XZOA 2DIEA 1I1DA 1EP1B 4I49A 5DWMA 3IU2A 2V7TA 5BSYA 3CXSA 1Q7LA 2Q04A 2PJ7A 3WQZA 1ZM2A 1UD2A 1KQSB 4RM0A 4F9UA 4J3GA 2K5TA 1HZEA 2QECA 1WOOA 4OC1A 1HDQA 2OYNA 1ZUNB 3OEHA 2E1RA 2XGJA 1H42A 3MN8A 2F1LA 3FPPA 1VQMB 1ON0A 4A38A 4A94A 3CCVB 3DLJA 1FNDA 4IAVA 1JQGA 3GVKA 1MRZA 1MJAA 2G3TA 2HCJB 4BINA 3PB9X 5B6IA 3ASTA 4DNCA 1IHMA 2EO8A 2V8DA 5H5JA 1IY7A 1KZLA 1Z9UA 4HE6A 1TKJA 3WXMA 3WY9A 4OIWA 1Z5RA 2AHOA 1FNOA 2CW5A 1OGJA 1I7PA 4RD1A 1GVHA 1VJSA 3AVXA 5G1ZA 1H85A 5AN9A 2ZEEA 3RY8A 1QSNA 2VBQA 3IU1A 4KS9A 5G22A 4M1KA 3B8HA 4C7HA 2ZEMA 2XOKA 4ZGNB 1IIDA 2X85A 3A9LA 3PRTA 5LYIA 2PMDA 5ISVA 1S60A 1MJBA 3KKWA 3NFZA 2Z10A 1ZM4A 5J3OA 4JD6A 2PLFA 4KLWA 2J8NA 3RBUA 2BMWA 3Q39A 3D68A 2PIZA 3JQRA 3CMEB 1KTVA 1FNMA 3KQZA 1YITB 1K28D 2QDXA 1KRHA 2KVOA 3AVYA 3CCRB 2C27A 5HVGA 4CQJA 2JDIA 4NEXA 4UAJA 1FRNA 4NBSA 2VYQA 1BJKA 3BJ8A 4XN0A 1KMHA 1NSLA 4F9VA 4A32A 4Z4WA 2D4PA 4P4BA 5K8OA 1BMFA 3LACA 1R5OA 1WDTA 4HNWB 4ROXA 2PJ4A 3H4QA 3DDYA 5LYDA 3CPWB 3ASSA 3W5UA 1F20A 2ZEDA 3EFAA 3TE4A 4RCZA 1VGYA 2YNDA 4E2AA 1EE3P 3CESA 4Z4SA 4LQGA 3VMFA 4WZKA 3QAHA 3W5VA 4NGQA 3EY5A 1B2RA 2V8HA 3D2PA 1Q86D 3SJFA 1T6YA 1UWYA 4X7CA 4BMHA 2Z3PA 3FBUA 4B3FX 4P25A 4PQAA 2P6GA 5IV0A 3OWCA 3BLNA 2PVWA 1IJEA 3BH4A 4UF4A 3CP2A 4CAXA 4KOVA 4OC2A 3W2GA 2NSMA 2CF4A 1IB1E 3CCQB 4KKUA 5EMNA 4XNFA 4ZCLA 1PYTB 2YNCC 1CX8A 1IU8A 3D7FA 2PJ9A 4P2NA 4XLFA 3IGRA 2NMTA 1QQ9A 4F8ZA 3B35A 3SLNA 1E43A 5IYRA 4MI4A 3KZWA 4OC4A 8CPAA 2O53A 1Q2YA 1YK3A 4RD0A 1V0EA 4G5GA 3WNCA 2F5IA 4XL9A 2POKA 4K30A 1B23P 2VJIA 4NCNA 1G7RA 2EK8A 3SJGA 2PJ2A 3PBBA 3GLJA 3FEDA 4H6UA 1WORA 3NH8A 4DQLA 1XMBA 2E1BA 1K8AD 4J0QA 1F57A 2FIAA 1R43A 5IYWA 2ARHA 2FT0A 3ONYA 2YWGA 2OBSA 1TIQA 1Q2CA 3WABA 3FPKA 4TNUA 2W6JA 4LX9A 4FD6A 3E0KA 5A89A 5TRDA 2CNTA 1BLIA 3H8FA 4AF7A 2QN6A 1F2PA 4MFPA 3B3TA 1BPNA 4AXVA 4ORFA 1S3ZA 4X06A 1TXRA 1Z2LA 3TCVA 4MHNA 4YAFA 5H84A 1XFOA 4YHBA 4BD9A 3ZJ0A 1SKQA 5DSZA 2P0WA 4PSWA 4RD2A 4YU9A 4FWTA 3CCJB 3LVBA 5BSXA 3PENA 4YAUA 3AVWA 4OC0A 2PVVA 4XPDC 4EH1A 1QSMA 1VHSA 4MJ8A 2R6HA 4CAFA 3SLDA 1NB0A 3FXTA 3IWEA 4R87A 1PJ5A 3WC7A 4XN3A 2VBVA 1VQKB 4P10A 1R5NA 1ZG8A 4OOVA 4Y49C 2VZLA 5HXDA 2ZOGA 7CPAA 2JEVA 4A31A 1WP6A 2Q4VA 3TO6A 3ISXA 1KZFA 4XPKA 1QFYA 2HLDA 2F43A 3V7ZA 1Y9WA 1BX0A 2Q4YA 3FB3A 4OIDA 4A2ZA 2JDCA 2AFOA 3WBKA 2WPXA 2ZZQA 1JJ2B 1DG1G 1TF8A 3CRZA 4UCNA 1DE4C 1TKHA 1NDHA 2DOGA 2BSWA 4LBYA 3CC4B 1YX0A 2ZTNA 2XNDA 4QUSA 2EVNA 4FXUA 1KD1D 2VBUA 1KJZA 4Q7AA 3R6KA 5F47A 1S7FA 2EUIA 2JBJA 3RZAA 4XLEA
chains in the Genus database with same CATH topology
1BPMA 2PJAA 4NGSA 2PJ1A 2RFHA 2XEJA 2IMOA 2BOAA 3B3VA 2AFXA 4P45A 4JZ0A 4MHPA 2BCOA 3JRUA 4MHZA 4NGMA 3KGQA 3SJXA 2AFMA 1Y7EA 2C6PA 4P4EA 5LYLA 3HUVA 2ZEGA 1YW6A 2BO9A 3FX6A 4FWUA 4ZY1A 2PJ6A 4PPZA 3VATA 2GREA 2RB7A 3IO1A 1ZLHA 4PXCA 2VL1A 4UEFA 2V8GA 4OC5A 2ABZA 2CTCA 3KHXA 2OR4A 3KQXA 3B3SA 4P6YA 3K9TA 3FF3A 3HLPA 5K8NA 3ISZA 4MXUA 4MCSA 3D7DA 1TKFA 4PXEA 3NH5A 4X8IA 2F7VA 1PCAA 1ARLA 4NJQA 4EMEA 1VHEA 3BXMA 3FH4A 5ELYA 3D7HA 1Q7LA 3D67A 5CPAA 2C6GA 3PEIA 1GYTA 1AYEA 2PJ7A 3FVLA 2ZEFA 1YW4A 3PB4X 4W9YA 2NYQA 1AMPA 4F9UA 2IJZA 1YMEA 1LAPA 2XEIA 1LAMA 4OC1A 1HDQA 2CIJA 4P4IA 3MN8A 1XJOA 1H8LA 4A38A 4UIAA 5LRKA 4A94A 4ZI6A 3DLJA 4PXDA 4IAVA 1JQGA 3BHXA 5JH9A 3PB9X 3NA6A 1LANA 2V8DA 1IY7A 2HC9A 2ZOFA 1TKJA 4OIWA 1Z5RA 3KHZA 2GLFA 2PJ3A 1FNOA 3SJEA 2JEWA 2FVGA 2ZELA 3T8WA 5D8NA 1ARMA 2C1CA 2ZEEA 5LRGA 4DJLA 5LYFA 3H8EA 3LWUA 3V38A 4NGRA 2Q51A 2ZEMA 3PRTA 5LYIA 1ZLIA 2C6CA 3S9NA 4MCPA 2AFWA 4ZX9A 3NFZA 3D7GA 4NGPA 3RBUA 1CPXA 2G9DA 3GUXA 3N5FA 2O4HA 3WC6A 3D68A 3PB6X 3PFOA 1LFWA 2PIZA 4ZY0A 2GLJA 3B3CA 3S9LA 5CBMA 4P4FA 3KQZA 1ZG7A 2AFZA 4P4JA 2XEGA 4ZY2A 3IEHA 3CDXA 4NFRA 1NSAA 5HVGA 2WZNA 1Y0RA 2PCUA 2ZENA 4OC3A 4NGTA 1CG2A 2IQ6A 3WC5A 4F9VA 3TX8A 1DTDA 3SI2A 3PFEA 5F09A 4P4BA 3PBEA 5K8OA 3CPXA 2HB6A 4FAIA 3LMSA 4R76A 2PJ4A 5LYDA 4OKOA 5K8MA 2ZEDA 4MHYA 2Q43A 3K2KA 1VGYA 3H8GA 1CPSA 3VARA 1EE3P 4FBEA 1HEEA 3FMCA 4LQGA 2PJ0A 4R6TA 2PRQA 2JBKA 3PB8X 4NGQA 3IWWA 1HDUA 1VIXA 4Z65A 2V8HA 4MCRA 3SJFA 1OBRA 6CPAA 1UWYA 2ZEHA 2EK9A 4PQAA 3KL9A 2PVWA 4UF4A 1LCPA 4OC2A 1XBUA 4PXBA 1ZG9A 2ZEPA 4UIBA 1BLLE 2NSMA 2CF4A 1TF9A 3B2YA 3L2NA 3CPAA 4IHMA 1PYTB 5HVHA 1CX8A 3D7FA 2PJ9A 4DYOA 5HVFA 1QQ9A 4F8ZA 3KI9A 2J9AA 5DS0A 5JGFA 3B35A 4ZYQA 3PB7X 1QMUA 3KZWA 4OC4A 8CPAA 4UEZA 2O53A 4EWTA 5I4MA 4CPAA 2QJ8A 4ONWA 3MRUA 4MRIA 2POKA 4OMEA 4TWEA 1CBXA 2XEFA 3D4UA 4YWYA 2PJ5A 2EK8A 3SJGA 2PJ2A 3NH4A 3GB0A 2PJ8A 1CP7A 3PBBA 3GLJA 3FEDA 2I3CA 2OOTA 3NH8A 1XMBA 4NGNA 5THWA 3IJ3A 4JYWA 3CT9A 3QNVA 1XRYA 1BAVA 1F57A 3I1UA 4UEEA 1CP6A 3KASA 1R43A 4A39A 3VH9A 4OP4A 1LOKA 4MMOA 3IC1A 3WABA 4TNUA 3FEEA 1M4LA 5IB9A 4O23A 4EFDA 3S9MA 2AFSA 3H8FA 2GU2A 1ELLP 3SI0A 1F2PA 3B3TA 3SI1A 1BPNA 4AXVA 3RAMA 3IIBA 2EWBA 5J1QA 2AFUA 1TXRA 1Z2LA 4MHNA 4B6ZA 1ELMP 5D29A 1XFOA 3KR5A 2PE3A 4DUKA 4BD9A 2CTBA 3FJUA 4R8FA 3IFEA 5JM6A 4WJBA 4IK2A 2ANPA 2Q4ZA 2DEAA 1YSJA 4YU9A 3WT4A 4OC0A 2PVVA 2V8VA 1Z8LA 4H2KA 1F2OA 3BI0A 4G1PA 2PJBA 1FT7A 3WC7A 2PIYA 1R3NA 4GM5A 2ZEOA 4P10A 4K3NA 5K8PA 1ZG8A 4X2TA 5LRJA 1IGBA 5HXDA 2F8HA 2ZOGA 7CPAA 3B3WA 1KWMA 4MCQA 2PJCA 4P4DA 3B7IA 3ISXA 4R7MA 1VHOA 4FUUA 4P44A 4WWVA 3V7ZA 2QYVA 4KSIA 3FECA 1Y0YA 3TC8A 4OIDA 2AFOA 2QVPA 4X3RA 1TF8A 3DGVA 1DE4C 1TKHA 3D66A 4A37A 4NJRA 4ZX8A 4RUHA 2WYRA 4Q7AA 3KR4A 2V77A 1RTQA 2JBJA 1YLOA 3RZAA 3BI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BPM A;  2PJA A;  4NGS A;  2PJ1 A;  2RFH A;  2XEJ A;  2IMO A;  2BOA A;  3B3V A;  2AFX A;  4P45 A;  4JZ0 A;  4MHP A;  2BCO A;  3JRU A;  4MHZ A;  4NGM A;  3KGQ A;  3SJX A;  2AFM A;  1Y7E A;  2C6P A;  4P4E A;  5LYL A;  3HUV A;  2ZEG A;  1YW6 A;  2BO9 A;  3FX6 A;  4FWU A;  4ZY1 A;  2PJ6 A;  4PPZ A;  3VAT A;  2GRE A;  2RB7 A;  3IO1 A;  1ZLH A;  4PXC A;  2VL1 A;  4UEF A;  2V8G A;  4OC5 A;  2ABZ A;  2CTC A;  3KHX A;  2OR4 A;  3KQX A;  3B3S A;  4P6Y A;  3K9T A;  3FF3 A;  3HLP A;  5K8N A;  3ISZ A;  4MXU A;  4MCS A;  3D7D A;  1TKF A;  4PXE A;  3NH5 A;  4X8I A;  2F7V A;  1PCA A;  1ARL A;  4NJQ A;  4EME A;  1VHE A;  3BXM A;  3FH4 A;  5ELY A;  3D7H A;  1Q7L A;  3D67 A;  5CPA A;  2C6G A;  3PEI A;  1GYT A;  1AYE A;  2PJ7 A;  3FVL A;  2ZEF A;  1YW4 A;  3PB4 X;  4W9Y A;  2NYQ A;  1AMP A;  4F9U A;  2IJZ A;  1YME A;  1LAP A;  2XEI A;  1LAM A;  4OC1 A;  1HDQ A;  2CIJ A;  4P4I A;  3MN8 A;  1XJO A;  1H8L A;  4A38 A;  4UIA A;  5LRK A;  4A94 A;  4ZI6 A;  3DLJ A;  4PXD A;  4IAV A;  1JQG A;  3BHX A;  5JH9 A;  3PB9 X;  3NA6 A;  1LAN A;  2V8D A;  1IY7 A;  2HC9 A;  2ZOF A;  1TKJ A;  4OIW A;  1Z5R A;  3KHZ A;  2GLF A;  2PJ3 A;  1FNO A;  3SJE A;  2JEW A;  2FVG A;  2ZEL A;  3T8W A;  5D8N A;  1ARM A;  2C1C A;  2ZEE A;  5LRG A;  4DJL A;  5LYF A;  3H8E A;  3LWU A;  3V38 A;  4NGR A;  2Q51 A;  2ZEM A;  3PRT A;  5LYI A;  1ZLI A;  2C6C A;  3S9N A;  4MCP A;  2AFW A;  4ZX9 A;  3NFZ A;  3D7G A;  4NGP A;  3RBU A;  1CPX A;  2G9D A;  3GUX A;  3N5F A;  2O4H A;  3WC6 A;  3D68 A;  3PB6 X;  3PFO A;  1LFW A;  2PIZ A;  4ZY0 A;  2GLJ A;  3B3C A;  3S9L A;  5CBM A;  4P4F A;  3KQZ A;  1ZG7 A;  2AFZ A;  4P4J A;  2XEG A;  4ZY2 A;  3IEH A;  3CDX A;  4NFR A;  1NSA A;  5HVG A;  2WZN A;  1Y0R A;  2PCU A;  2ZEN A;  4OC3 A;  4NGT A;  1CG2 A;  2IQ6 A;  3WC5 A;  4F9V A;  3TX8 A;  1DTD A;  3SI2 A;  3PFE A;  5F09 A;  4P4B A;  3PBE A;  5K8O A;  3CPX A;  2HB6 A;  4FAI A;  3LMS A;  4R76 A;  2PJ4 A;  5LYD A;  4OKO A;  5K8M A;  2ZED A;  4MHY A;  2Q43 A;  3K2K A;  1VGY A;  3H8G A;  1CPS A;  3VAR A;  1EE3 P;  4FBE A;  1HEE A;  3FMC A;  4LQG A;  2PJ0 A;  4R6T A;  2PRQ A;  2JBK A;  3PB8 X;  4NGQ A;  3IWW A;  1HDU A;  1VIX A;  4Z65 A;  2V8H A;  4MCR A;  3SJF A;  1OBR A;  6CPA A;  1UWY A;  2ZEH A;  2EK9 A;  4PQA A;  3KL9 A;  2PVW A;  4UF4 A;  1LCP A;  4OC2 A;  1XBU A;  4PXB A;  1ZG9 A;  2ZEP A;  4UIB A;  1BLL E;  2NSM A;  2CF4 A;  1TF9 A;  3B2Y A;  3L2N A;  3CPA A;  4IHM A;  1PYT B;  5HVH A;  1CX8 A;  3D7F A;  2PJ9 A;  4DYO A;  5HVF A;  1QQ9 A;  4F8Z A;  3KI9 A;  2J9A A;  5DS0 A;  5JGF A;  3B35 A;  4ZYQ A;  3PB7 X;  1QMU A;  3KZW A;  4OC4 A;  8CPA A;  4UEZ A;  2O53 A;  4EWT A;  5I4M A;  4CPA A;  2QJ8 A;  4ONW A;  3MRU A;  4MRI A;  2POK A;  4OME A;  4TWE A;  1CBX A;  2XEF A;  3D4U A;  4YWY A;  2PJ5 A;  2EK8 A;  3SJG A;  2PJ2 A;  3NH4 A;  3GB0 A;  2PJ8 A;  1CP7 A;  3PBB A;  3GLJ A;  3FED A;  2I3C A;  2OOT A;  3NH8 A;  1XMB A;  4NGN A;  5THW A;  3IJ3 A;  4JYW A;  3CT9 A;  3QNV A;  1XRY A;  1BAV A;  1F57 A;  3I1U A;  4UEE A;  1CP6 A;  3KAS A;  1R43 A;  4A39 A;  3VH9 A;  4OP4 A;  1LOK A;  4MMO A;  3IC1 A;  3WAB A;  4TNU A;  3FEE A;  1M4L A;  5IB9 A;  4O23 A;  4EFD A;  3S9M A;  2AFS A;  3H8F A;  2GU2 A;  1ELL P;  3SI0 A;  1F2P A;  3B3T A;  3SI1 A;  1BPN A;  4AXV A;  3RAM A;  3IIB A;  2EWB A;  5J1Q A;  2AFU A;  1TXR A;  1Z2L A;  4MHN A;  4B6Z A;  1ELM P;  5D29 A;  1XFO A;  3KR5 A;  2PE3 A;  4DUK A;  4BD9 A;  2CTB A;  3FJU A;  4R8F A;  3IFE A;  5JM6 A;  4WJB A;  4IK2 A;  2ANP A;  2Q4Z A;  2DEA A;  1YSJ A;  4YU9 A;  3WT4 A;  4OC0 A;  2PVV A;  2V8V A;  1Z8L A;  4H2K A;  1F2O A;  3BI0 A;  4G1P A;  2PJB A;  1FT7 A;  3WC7 A;  2PIY A;  1R3N A;  4GM5 A;  2ZEO A;  4P10 A;  4K3N A;  5K8P A;  1ZG8 A;  4X2T A;  5LRJ A;  1IGB A;  5HXD A;  2F8H A;  2ZOG A;  7CPA A;  3B3W A;  1KWM A;  4MCQ A;  2PJC A;  4P4D A;  3B7I A;  3ISX A;  4R7M A;  1VHO A;  4FUU A;  4P44 A;  4WWV A;  3V7Z A;  2QYV A;  4KSI A;  3FEC A;  1Y0Y A;  3TC8 A;  4OID A;  2AFO A;  2QVP A;  4X3R A;  1TF8 A;  3DGV A;  1DE4 C;  1TKH A;  3D66 A;  4A37 A;  4NJR A;  4ZX8 A;  4RUH A;  2WYR A;  4Q7A A;  3KR4 A;  2V77 A;  1RTQ A;  2JBJ A;  1YLO A;  3RZA A;  3BI1 A; 
#chains in the Genus database with same CATH topology
 1BPM A;  1WU8 A;  3T51 B;  2PJ1 A;  3U6K A;  2RFH A;  2XEJ A;  2IMO A;  2BOA A;  4JXR A;  3Q6R A;  3JRU A;  3BCD A;  4II2 A;  5GV8 A;  1UMK A;  3GQB A;  2GIV A;  1TVC A;  2PR8 A;  3PP9 A;  5LYL A;  1ZO0 A;  3HUV A;  2QTZ A;  3FX6 A;  4HKF A;  2VZY A;  4OAD A;  3EC4 A;  4PPZ A;  2AE6 A;  4OLL A;  2Z3K A;  4H9G A;  3ES9 A;  1ZLH A;  3OJW A;  4PXC A;  5KTD A;  3GKR A;  2DF5 A;  2V8G A;  4YEJ A;  2CTC A;  2ZBV A;  3AGQ A;  3KHX A;  3KQX A;  4P6Y A;  3LQ6 A;  3FF3 A;  3HLP A;  2D3L A;  3ISZ A;  4RI1 A;  3I1F A;  1E3X A;  2GE3 A;  1XE1 A;  1E62 A;  2C5B A;  4MY3 A;  3W5H A;  3D7D A;  2HQY A;  4R9M A;  4X8I A;  4CYQ A;  3F8K A;  1T5E A;  4NJQ A;  4EME A;  4JMQ A;  1VHE A;  2GK7 A;  4B47 A;  1Q81 D;  3PVD A;  1R57 A;  3ONU A;  1JA0 A;  3D7H A;  3Q38 A;  3D67 A;  3VO2 A;  3CXQ A;  2C6G A;  3PEI A;  1GYT A;  3PUM A;  1AYE A;  5HMN A;  3PB4 X;  2DY1 A;  4YEL A;  4W9Y A;  3P27 A;  4U9Z A;  5I0C A;  1YME A;  1LAP A;  1LAM A;  2ZIT A;  4B3G A;  5C82 A;  4XD7 A;  2ZW4 A;  4UIA A;  1VQ8 B;  3B8G A;  3ZBU A;  3ZUG A;  3NA6 A;  1UD8 A;  1LAN A;  2ZZE A;  5A28 A;  2REE A;  4XOP A;  1H8E A;  3TOB A;  2ZOF A;  3QB8 A;  1IIC A;  2PJ3 A;  2M5S A;  1XE4 A;  5HKK A;  2B3V A;  3TO9 A;  4MFK A;  3ZZU A;  3FJO A;  3VNV A;  1DDG A;  4XPL A;  4Y49 B;  5D8N A;  3D3S A;  4XKV A;  1NB9 A;  1E1R A;  5F4J A;  5EMI A;  5FIU A;  2CNM A;  1WWZ A;  3W6X A;  5DWN A;  4KOS A;  3JU4 A;  4KKT A;  3JQP A;  1ZLI A;  1FNB A;  2AFW A;  4JXQ A;  3Q6Q A;  4QHY A;  4CAV A;  4ZX9 A;  4H6Z A;  2WPW A;  4M2L A;  2NPF A;  2DYI A;  4XON A;  3MMP A;  4KVX A;  4CGM A;  3A8I A;  3WC6 A;  1P4N A;  2B5G B;  3ZZT A;  4ZY0 A;  2GLJ A;  3B3C A;  1EFU A;  5CBM A;  3S9L A;  4XOR A;  1ZG7 A;  2AFZ A;  4LBW A;  2BPO A;  1GJR A;  3IEH A;  5E96 A;  4OP7 A;  1Y0R A;  1QST A;  1G7T A;  2FCK A;  2PCU A;  4OC3 A;  1CG2 A;  3U2Q A;  4NGT A;  2IQ6 A;  2X6X A;  2QMU A;  3BY1 A;  2OBT A;  3PFE A;  3SI2 A;  3R9F A;  4BBH A;  1YI2 B;  2WR8 A;  3ZIA A;  4RS2 A;  4C2Z A;  2V7U A;  1QX4 A;  3CPX A;  4X0C A;  3P2H A;  5JPH A;  1VQ5 B;  4OKO A;  4MHY A;  1Y9K A;  3CCL B;  3H8G A;  1XB2 A;  4UCM A;  1I8D A;  5HZA A;  4FBE A;  1J9Z A;  1V0C A;  3H94 A;  4Z4R A;  2H5M A;  2FIW A;  2FX3 A;  1KK2 A;  3PB8 X;  2JBK A;  1HDU A;  1FY7 A;  1EFT A;  2PC1 A;  1W34 A;  1Z8X A;  1OBR A;  4U5Y A;  2R8V A;  6CPA A;  3G3S A;  1QSO A;  3SHP A;  2EK9 A;  3KL9 A;  2P6E A;  3FIX A;  4DK1 A;  1XBU A;  3CXP A;  4PXB A;  1ZG9 A;  3SEJ A;  2WPD A;  4FK8 A;  5IK2 A;  1WK4 A;  3L2N A;  3PGP A;  2R9V A;  4DYO A;  4NF1 A;  2FE7 A;  5HVF A;  2B4B A;  1QVF B;  2GQF A;  2J9A A;  2YWF A;  3ZBT A;  4ZYQ A;  1QMU A;  1QFJ A;  1N8R D;  4MHD A;  5I4M A;  2XZL A;  2RC4 A;  4BPR A;  4TWE A;  3GIU A;  1YJN B;  2ZPA A;  2LZJ A;  4UFX A;  4K1X A;  2ZBU A;  1V0F A;  2PJ8 A;  2VBS A;  3SXO A;  1Q7Y D;  4NGN A;  3H5Z A;  1PKV A;  4R71 A;  3CT9 A;  4A95 A;  2Z6B D;  2OTJ B;  3JUW A;  4TMT A;  2VNI A;  4XMY A;  4ZV4 A;  3VH9 A;  4ASU A;  1YVK A;  2OTL B;  4PV6 A;  5KNL A;  1M4L A;  1RO5 A;  5KTA A;  3F0A A;  4F0X A;  5IB9 A;  4O23 A;  4LBV A;  2GFQ A;  2GU2 A;  4E8O A;  5L46 A;  3SI0 A;  4QVT A;  3RAM A;  1E1Q A;  1XMT A;  3QFC A;  4C2X A;  4X05 A;  5J35 A;  1ELM P;  3GY9 A;  1N0V C;  2X0K A;  2PE3 A;  4CYN A;  1EP3 B;  1R5B A;  3DSB A;  3WND A;  2CBX A;  5KTC A;  3NE8 A;  2Q4Z A;  4MFQ A;  4A30 A;  1M1D A;  2I1L A;  3VR6 A;  3WT4 A;  4MFL A;  2VNH A;  2ZZG A;  1I21 A;  4N3N A;  4YAL A;  4C7I A;  3BI0 A;  4B43 A;  1W0K A;  2PQ8 A;  2PJB A;  3S6G A;  4PC1 A;  1R3N A;  2ZEO A;  5K8P A;  2WSS A;  1IGB A;  3TTH A;  2JLM A;  3B3W A;  5HH1 A;  1PU9 A;  1A2Z A;  4WZT A;  2D74 A;  4MCQ A;  4TKO B;  4G7W A;  2PJC A;  3DDD A;  3B7I A;  4Y9U A;  5IB0 A;  2B5O A;  3EXN A;  4R7M A;  1DDI A;  2BN4 A;  1VHO A;  4FD7 A;  4WWV A;  3SJZ A;  4B48 A;  1UFH A;  4CGN A;  4KSI A;  3FEC A;  1Y0Y A;  3TC8 A;  2QVP A;  3PA2 A;  1S7N A;  1RQR A;  4E0F A;  4YFJ A;  2V7W A;  3PUN A;  3PA1 A;  3T53 B;  2X8K A;  2Q6I A;  4NNJ A;  4UZE A;  4II9 A;  1RTQ A;  4CGP A;  1YLO A;  4B4D A;  4KOY A;  3H9N A;  2B7C A;  2ZW7 A;  5FL7 A;  4R3K A;  1I12 A;  3W2H A;  3B3V A;  2AFX A;  4P45 A;  1NBM A;  1S5K A;  2VQY A;  4WZL A;  3SJX A;  1Y7E A;  4P4E A;  3MCA A;  4P12 A;  1YW6 A;  5J8C A;  4XLA A;  4FWU A;  2ZL5 A;  2PJ6 A;  3VAT A;  2GJR A;  1M44 A;  2FL4 A;  1M4D A;  3CCE B;  5LMZ A;  5FO1 A;  4NSQ A;  4YAO A;  4G6I A;  3G71 B;  1ZM3 A;  4JWP A;  4GS4 A;  4AG7 A;  2JIZ A;  4C43 A;  1TKF A;  3J81 k;  5J8F A;  1L0C A;  4TSF A;  3RYO A;  1D8T A;  2W6I A;  1ZM9 A;  3EO4 A;  1PCA A;  5A8A A;  3BXM A;  4U9Y A;  4N3G A;  2REF A;  3TOA A;  1GAW A;  3U6B A;  2CC2 A;  3OZU A;  1W87 A;  2CND A;  2ZEF A;  3OE7 A;  1YW4 A;  2F1M A;  1AMP A;  3CW2 A;  3R9G A;  4B14 A;  3GVJ A;  2YNE A;  4P4I A;  4XQF A;  5A88 A;  4ZCM A;  3R95 A;  3OPO A;  3A3G A;  1H8L A;  1XJO A;  4LUA A;  4CYO A;  5H59 A;  2O28 A;  5LRK A;  1M1K D;  4PXD A;  3B82 A;  4UZU A;  3LQE A;  5AG7 A;  4AF6 A;  4G7X A;  3G05 A;  3BHX A;  1N07 A;  1BOB A;  2VEZ A;  1IYK A;  1M4G A;  1XF8 A;  3GIR A;  1EFR A;  3TFY A;  2R98 A;  1M4I A;  2GLF A;  2I79 A;  3SJE A;  3CP8 A;  2Q7S A;  2JEW A;  4MFZ A;  4RD6 A;  3CD6 B;  3T8W A;  4KKS A;  2VNK A;  1D1N A;  1EXM A;  1ARM A;  1Z8W A;  2C1C A;  5LRG A;  4AVB A;  2YWE A;  3AVU A;  1B87 A;  3V38 A;  3T56 B;  4NGR A;  3CC2 B;  4KOU A;  2Q51 A;  5F46 A;  2QIR A;  3OOC A;  3S9N A;  4WZE A;  3I9S A;  2BF4 A;  2J8M A;  2PDO A;  1YJW B;  1W0J A;  1X12 A;  3G4S B;  3D7G A;  3GYA A;  2Q6L A;  4B10 A;  4NGP A;  2ZL6 A;  3OAA A;  1F60 A;  5F49 A;  5TY0 A;  5IYN A;  2G9D A;  2OK8 A;  4PC2 A;  4HNY B;  3P26 A;  1Y7R A;  2FS5 A;  2B5G A;  1N08 A;  4TMW A;  5GV7 A;  3VWD A;  4P4J A;  5FVJ A;  2HMA A;  2XEG A;  3FNC A;  2B58 A;  1UD5 A;  5F4O A;  1NSA A;  1JB9 A;  2WZN A;  4AB7 A;  2B7B A;  1KK0 A;  2ZEN A;  4L8A A;  4FD5 A;  5EC4 A;  1EP2 B;  3I56 B;  4KOT A;  4KOR A;  3WC5 A;  3TX8 A;  1DTD A;  4YGO A;  5F09 A;  2VXK A;  3CXC B;  3PBE A;  2HB6 A;  4B11 A;  3LMS A;  4CGL A;  1S7L A;  1QG0 A;  3NE5 B;  4X5K A;  2C77 A;  1NMT A;  4UWI A;  4MBU A;  2Q43 A;  3JTK A;  2P3M A;  3OFN A;  4PAA A;  1HEE A;  4Z4U A;  2PJ0 A;  2Z0Z A;  4M4S A;  2OB0 A;  2ZW6 A;  2PRQ A;  2DCU A;  4IF5 A;  3IWW A;  5H86 A;  4RDK A;  3A35 A;  1VIX A;  4M3S A;  3OKX A;  4P22 A;  4MCR A;  3R9E A;  2J8R A;  4Z4T A;  2V4D A;  1CNE A;  1OB2 A;  1IYL A;  2ZEH A;  4F0Y A;  5IYQ A;  4P1V A;  4UWJ A;  2XEX A;  2BEI A;  1D2E A;  1S4M A;  3R1K A;  3NE7 A;  1LCP A;  1Z8T A;  2D4O A;  5FO0 A;  4TT3 A;  2V7V A;  1GO2 A;  3V7A A;  4UIB A;  2ZTG A;  2BM0 A;  4X7D A;  4IHM A;  4KOX A;  3VNU A;  3LO8 A;  4OOS A;  4AC9 A;  1SKY B;  3OP1 A;  4XLH A;  1XOV A;  3VWE A;  4G1V A;  1YVO A;  5JBQ A;  1OGI A;  2B4D B;  2C2W A;  4HNX B;  4EWT A;  4DNR B;  4Z4V A;  4LQ6 A;  2QJ8 A;  4CPA A;  4ONW A;  1VQ7 B;  1E3Z A;  5IYP A;  4QUZ A;  3MRU A;  4KZT A;  4MRI A;  2X6W A;  4OME A;  2A4N A;  3KEW A;  4L89 A;  4PC6 A;  4AVC A;  2XEF A;  3D4U A;  1TLL A;  3NH4 A;  3G8W A;  3W2E A;  4ACB A;  4H89 A;  2GJP A;  5EBV A;  2OOT A;  5THW A;  4M85 A;  3IJ3 A;  1W9X A;  4JYW A;  3DNS A;  3D2M A;  2Y0M A;  1XRY A;  1BAV A;  1EFC A;  4RDJ A;  4UEE A;  4LBZ A;  3ASQ A;  3AGP A;  1OZP A;  4UBR A;  4NXY A;  5KSW B;  1QVG B;  4HE5 A;  2X7B A;  1CQX A;  4RN7 A;  4MMO A;  1PUA A;  4NCZ A;  4HPS A;  3D26 A;  2R7H A;  4PC3 A;  3QAY A;  1KUX A;  1MJ9 A;  2Z3L A;  4EFD A;  1WSR A;  1N06 A;  2C5H A;  1FX0 A;  2ZXV A;  1ELL P;  2EIX A;  4L8J A;  2EFG A;  3JVN A;  3MGD A;  5J1Q A;  1Z4R A;  1E63 A;  1QGY A;  4TMV A;  2BM1 A;  4G1B A;  1MK4 A;  3LNN A;  4AVA A;  4DNT B;  4R8F A;  3IFE A;  5JM6 A;  2JN9 A;  2XZP A;  2ANP A;  2X53 S;  4CRY B;  4DK0 A;  4EVY A;  1YX2 A;  2QGG A;  3DR6 A;  1Z8L A;  2Z3O A;  4H2K A;  1BQE A;  1F2O A;  1VQP B;  5FA6 A;  2X6Y A;  2YWH A;  2GJK A;  3RNZ A;  1UD6 A;  3A8K A;  4GM5 A;  3T9Y A;  5LRJ A;  1IOF A;  3LD2 A;  4B12 A;  4TMX A;  3OJX A;  2F8H A;  2BUE A;  2D3N A;  3CCU B;  2I00 A;  4MYU A;  1KWM A;  1YLE A;  4P4D A;  4YAW A;  1X10 A;  2PIA A;  4P44 A;  3WBJ A;  1AUG A;  2DXQ A;  2QYV A;  2QTL A;  3GSI A;  2IL4 A;  4X3R A;  3DGV A;  3D66 A;  2OZU A;  4A37 A;  3E20 A;  1VQ4 B;  3QFR A;  4RUH A;  3ASP A;  4ZGY B;  3ZPN A;  2DEU A;  2YGW A;  3WR7 A;  1YQE A;  4KOW A;  1Q9S A;  4HIZ A;  3KR4 A;  1E64 A;  4GXH A;  4IUS A;  3R96 A;  4ONU A;  1QH0 A;  4KUB A;  4MYT A;  4NGS A;  1AMO A;  1P0H A;  1GR1 A;  4JLY A;  2PR1 A;  4B13 A;  4F7D A;  4MHZ A;  4QBJ A;  2OU2 A;  4NGM A;  1NRK A;  3KGQ A;  2AFM A;  1QSR A;  3QFT A;  2ZEG A;  4M6H A;  2BO9 A;  4ZY1 A;  2AJ6 A;  2GRE A;  2XNC A;  3S6F A;  4RPD A;  3IO1 A;  4OC5 A;  2ABZ A;  4B5P B;  3QE2 A;  1SM4 A;  2ZL7 A;  4P26 A;  3B3S A;  2RC6 A;  2ATR A;  5K8N A;  1KK3 A;  4MXU A;  1VQO B;  1SQH A;  4MY0 A;  4CAW A;  3Q3A A;  3W2F A;  1W35 A;  4Z4Y A;  4MCS A;  3CMM A;  1EWY A;  1OHH A;  4PXE A;  3NH5 A;  1AIP A;  2F7V A;  4UFV A;  1ARL A;  2NV4 A;  5FNZ A;  1MAB A;  2Z3N A;  3FH4 A;  5AGE A;  1I18 A;  4OPS A;  5ELY A;  4Y7C A;  2Z11 A;  1OB5 A;  1IJF A;  5G20 A;  2HDN B;  4M6G A;  4Z1M A;  5CPA A;  2JJ2 A;  3BJ7 A;  4KUA A;  1E79 A;  1G7C A;  3FVL A;  2CXA A;  4C2Y A;  4YRH A;  3SXN A;  2NYQ A;  3V8I A;  3CZX A;  2IJZ A;  2XEI A;  2WZP P;  2CIJ A;  5AG5 A;  1V5V A;  2VZZ A;  2QA4 B;  2Z3M A;  2WUU A;  1KUY A;  2CNS A;  4QB9 A;  4ZI6 A;  2BL1 A;  2DPT A;  4ZBG A;  1WPC A;  5JH9 A;  1RQP A;  1U2R A;  1WOS A;  3DR8 A;  3PZJ A;  2HC9 A;  3W91 A;  4B44 A;  5GCN A;  3S6H A;  3KHZ A;  3LOD A;  5THX A;  4M6I A;  1XQB A;  4Q36 A;  4QC6 A;  1VQ6 B;  3CTA A;  2VI7 A;  4CRZ B;  2FVG A;  2ZEL A;  1CJW A;  3OW7 A;  2DET A;  1S0U A;  1S7K A;  2EBJ A;  2DER A;  2C4T A;  3E1Y E;  2QML A;  4DJL A;  1VF7 A;  5LYF A;  2GK6 A;  4AVZ A;  3H8E A;  1TTT A;  1NJI D;  3LWU A;  2WJY A;  2Q7B A;  2C6C A;  4B3X A;  4MCP A;  1KUV A;  4QVJ A;  2R1I A;  1YJ9 B;  1CPX A;  3GUX A;  1IOI A;  4ZCI A;  2D9R A;  3N5F A;  2O4H A;  5DN6 A;  1KK1 A;  2YNC A;  3PB6 X;  3PFO A;  1LFW A;  1VQN B;  1OB0 A;  3A8J A;  4XNH C;  4P4F A;  4FN5 A;  2P6F A;  3OEE A;  4KSA A;  1XIX A;  4ZY2 A;  3CDX A;  4RLZ A;  4NFR A;  1HVX A;  4KVO E;  2PRB A;  5C88 A;  1FDR A;  2ZZF A;  1BO4 A;  4P6V F;  3A3B A;  2HV2 A;  3B78 A;  2Q6K A;  5HXB A;  1U6M A;  4P3I A;  3CB4 A;  1YRE A;  1QUE A;  4FAI A;  4R76 A;  3N7Z A;  2WSA A;  3D8P A;  4AG9 A;  3CMA B;  2FSR A;  3G6E B;  5K8M A;  3ZZ0 A;  1YR0 A;  2G0B A;  3K2K A;  4C68 A;  5TR9 A;  3QSY A;  4E0A A;  1CPS A;  4XOT A;  4MFJ A;  3VAR A;  4KSF A;  1N0U A;  3FMC A;  5HZB A;  1QGA A;  4B5O A;  1W2B B;  3ZC3 A;  3UY5 A;  2OK7 A;  1CNF A;  1JNY A;  2F4N A;  4R6T A;  4Z65 A;  2B3U A;  4TN1 A;  2QEX B;  1QUF A;  1CM0 A;  3TT2 A;  2QE7 A;  2OZH A;  3CCM B;  4RJL A;  4II3 A;  4WQM A;  1B6B A;  1VLO A;  4X07 A;  3W2I A;  3FYN A;  4PC7 A;  4QVA A;  2ZEP A;  1BLL E;  1TF9 A;  4R57 A;  3B2Y A;  4Q7J B;  4XKW A;  3CPA A;  5HVH A;  3AVT A;  4M53 A;  4PK2 A;  4RCY A;  1S72 B;  3KI9 A;  2BV3 A;  2CRV A;  3BC9 A;  5DS0 A;  5JGF A;  4LC0 A;  4CS0 B;  3PB7 X;  3K9U A;  2B4D A;  4TMZ A;  3FKS A;  4UEZ A;  4QV2 A;  1LRZ A;  3RO0 A;  3IWG A;  4KVM E;  1M90 D;  1CBX A;  1HA3 A;  4YWY A;  2PJ5 A;  1N05 A;  1GAQ A;  3GB0 A;  2VBT A;  4XR6 A;  3ASR A;  1CP7 A;  4PK3 A;  2I3C A;  4RD4 A;  3SJP A;  5F4M A;  3I55 B;  3QNV A;  1PJ6 A;  1J4J A;  2OZG A;  2V7Q A;  5CNP A;  3I1U A;  1CP6 A;  3KAS A;  5KW9 A;  1UD4 A;  2V31 A;  4A39 A;  2BSA A;  5A27 A;  1COW A;  4XLC A;  4OP4 A;  4PAB A;  1LOK A;  1ELO A;  3IC1 A;  2JDD A;  1VLY A;  3A1P A;  3FEE A;  4ACA A;  1QFZ A;  3S9M A;  2AFS A;  3BNW A;  4UZF A;  1TUI A;  1Z4E A;  2GPJ A;  3SI1 A;  1YGH A;  3IIB A;  1DAR A;  2EWB A;  4IW3 B;  2AFU A;  2ZXH A;  4B6Z A;  3MHP A;  1WSV A;  5AG4 A;  3BQJ A;  5D29 A;  3ZZI A;  4X7F A;  3KR5 A;  4DUK A;  3P2F A;  2CTB A;  3FJU A;  5F48 A;  2BGI A;  4PGO A;  4WJB A;  4IK2 A;  1YIJ B;  5TV2 A;  4YXW A;  1Q82 D;  2DEA A;  4XNH B;  3F5B A;  5G21 A;  3S6K A;  3OZV A;  1YSJ A;  4RDL A;  4KLV A;  4OPO A;  2V8V A;  3TO7 A;  3CC7 B;  1N71 A;  1IB0 A;  4OAE A;  2VJJ A;  3HAG A;  4C0S A;  2CK3 A;  2KCW A;  3BY2 A;  4G1P A;  4Q38 A;  2JJ1 A;  1FT7 A;  2PIY A;  1JA1 A;  4K3N A;  4UCP A;  4X2T A;  3BCF A;  3GVL A;  1QGZ A;  2J7K A;  4QFM A;  5IX3 A;  1P4M A;  1NE9 A;  2HUZ A;  3SKB A;  2BVN A;  2PSW A;  2OBR A;  1VQ9 B;  3I3G A;  3T90 A;  1VKC A;  2FXF A;  4FUU A;  1WTH D;  4OOX A;  2ZXI A;  2ODF A;  4F6A A;  2WJV A;  2GAN A;  4CYP A;  4CAE A;  3W6S A;  1Q2D A;  4XPD B;  2XNJ A;  5JQ4 A;  4Y9R A;  2V7X A;  1RXT A;  4NJR A;  4ZX8 A;  3FRM A;  1K9M D;  4OPV A;  1K4J A;  1JWQ A;  2VNJ A;  2OH1 A;  1YHQ B;  4U9U A;  2WYR A;  1FRQ A;  1PJ7 A;  4RPB A;  1KC8 D;  4FD4 A;  1XEB A;  2V77 A;  2Q6O A;  4X7E A;  4Z4Z A;  3AVV A;  4P9S A;  4CGO A;  3BI1 A;  1T6Z A;  1UD3 A;  2PJA A;  4GQN A;  3QFS A;  3OW2 B;  3JQQ A;  2Q44 A;  4JZ0 A;  4MHP A;  2G3A A;  3OZW A;  1VQL B;  4R3L A;  2C78 A;  2BCO A;  3C26 A;  4DQK A;  4UA3 A;  2DPS A;  2C6P A;  3R6J A;  5AG6 A;  4M0L A;  3VO1 A;  4JJX A;  2C4U A;  4ZGQ B;  2RC5 A;  4PSX A;  4XM3 A;  2RB7 A;  1K73 D;  1A8P A;  2VL1 A;  2BGJ A;  4UEF A;  1GHE A;  1T6X A;  4B5P A;  2X3U A;  4A33 A;  1G7S A;  1FNC A;  2ZW5 A;  2OR4 A;  3CCS B;  4P3Y A;  1WOP A;  1H8H A;  3K9T A;  1BX1 A;  3WYA A;  2CY2 A;  4UFW A;  3V76 A;  2Q0Y A;  3WNB A;  1BPL A;  5E6T A;  5BWA B;  5CDF A;  4RD3 A;  2XZO A;  2DIE A;  1I1D A;  1EP1 B;  4I49 A;  5DWM A;  3IU2 A;  2V7T A;  5BSY A;  3CXS A;  1Q7L A;  2Q04 A;  2PJ7 A;  3WQZ A;  1ZM2 A;  1UD2 A;  1KQS B;  4RM0 A;  4F9U A;  4J3G A;  2K5T A;  1HZE A;  2QEC A;  1WOO A;  4OC1 A;  1HDQ A;  2OYN A;  1ZUN B;  3OEH A;  2E1R A;  2XGJ A;  1H42 A;  3MN8 A;  2F1L A;  3FPP A;  1VQM B;  1ON0 A;  4A38 A;  4A94 A;  3CCV B;  3DLJ A;  1FND A;  4IAV A;  1JQG A;  3GVK A;  1MRZ A;  1MJA A;  2G3T A;  2HCJ B;  4BIN A;  3PB9 X;  5B6I A;  3AST A;  4DNC A;  1IHM A;  2EO8 A;  2V8D A;  5H5J A;  1IY7 A;  1KZL A;  1Z9U A;  4HE6 A;  1TKJ A;  3WXM A;  3WY9 A;  4OIW A;  1Z5R A;  2AHO A;  1FNO A;  2CW5 A;  1OGJ A;  1I7P A;  4RD1 A;  1GVH A;  1VJS A;  3AVX A;  5G1Z A;  1H85 A;  5AN9 A;  2ZEE A;  3RY8 A;  1QSN A;  2VBQ A;  3IU1 A;  4KS9 A;  5G22 A;  4M1K A;  3B8H A;  4C7H A;  2ZEM A;  2XOK A;  4ZGN B;  1IID A;  2X85 A;  3A9L A;  3PRT A;  5LYI A;  2PMD A;  5ISV A;  1S60 A;  1MJB A;  3KKW A;  3NFZ A;  2Z10 A;  1ZM4 A;  5J3O A;  4JD6 A;  2PLF A;  4KLW A;  2J8N A;  3RBU A;  2BMW A;  3Q39 A;  3D68 A;  2PIZ A;  3JQR A;  3CME B;  1KTV A;  1FNM A;  3KQZ A;  1YIT B;  1K28 D;  2QDX A;  1KRH A;  2KVO A;  3AVY A;  3CCR B;  2C27 A;  5HVG A;  4CQJ A;  2JDI A;  4NEX A;  4UAJ A;  1FRN A;  4NBS A;  2VYQ A;  1BJK A;  3BJ8 A;  4XN0 A;  1KMH A;  1NSL A;  4F9V A;  4A32 A;  4Z4W A;  2D4P A;  4P4B A;  5K8O A;  1BMF A;  3LAC A;  1R5O A;  1WDT A;  4HNW B;  4ROX A;  2PJ4 A;  3H4Q A;  3DDY A;  5LYD A;  3CPW B;  3ASS A;  3W5U A;  1F20 A;  2ZED A;  3EFA A;  3TE4 A;  4RCZ A;  1VGY A;  2YND A;  4E2A A;  1EE3 P;  3CES A;  4Z4S A;  4LQG A;  3VMF A;  4WZK A;  3QAH A;  3W5V A;  4NGQ A;  3EY5 A;  1B2R A;  2V8H A;  3D2P A;  1Q86 D;  3SJF A;  1T6Y A;  1UWY A;  4X7C A;  4BMH A;  2Z3P A;  3FBU A;  4B3F X;  4P25 A;  4PQA A;  2P6G A;  5IV0 A;  3OWC A;  3BLN A;  2PVW A;  1IJE A;  3BH4 A;  4UF4 A;  3CP2 A;  4CAX A;  4KOV A;  4OC2 A;  3W2G A;  2NSM A;  2CF4 A;  1IB1 E;  3CCQ B;  4KKU A;  5EMN A;  4XNF A;  4ZCL A;  1PYT B;  2YNC C;  1CX8 A;  1IU8 A;  3D7F A;  2PJ9 A;  4P2N A;  4XLF A;  3IGR A;  2NMT A;  1QQ9 A;  4F8Z A;  3B35 A;  3SLN A;  1E43 A;  5IYR A;  4MI4 A;  3KZW A;  4OC4 A;  8CPA A;  2O53 A;  1Q2Y A;  1YK3 A;  4RD0 A;  1V0E A;  4G5G A;  3WNC A;  2F5I A;  4XL9 A;  2POK A;  4K30 A;  1B23 P;  2VJI A;  4NCN A;  1G7R A;  2EK8 A;  3SJG A;  2PJ2 A;  3PBB A;  3GLJ A;  3FED A;  4H6U A;  1WOR A;  3NH8 A;  4DQL A;  1XMB A;  2E1B A;  1K8A D;  4J0Q A;  1F57 A;  2FIA A;  1R43 A;  5IYW A;  2ARH A;  2FT0 A;  3ONY A;  2YWG A;  2OBS A;  1TIQ A;  1Q2C A;  3WAB A;  3FPK A;  4TNU A;  2W6J A;  4LX9 A;  4FD6 A;  3E0K A;  5A89 A;  5TRD A;  2CNT A;  1BLI A;  3H8F A;  4AF7 A;  2QN6 A;  1F2P A;  4MFP A;  3B3T A;  1BPN A;  4AXV A;  4ORF A;  1S3Z A;  4X06 A;  1TXR A;  1Z2L A;  3TCV A;  4MHN A;  4YAF A;  5H84 A;  1XFO A;  4YHB A;  4BD9 A;  3ZJ0 A;  1SKQ A;  5DSZ A;  2P0W A;  4PSW A;  4RD2 A;  4YU9 A;  4FWT A;  3CCJ B;  3LVB A;  5BSX A;  3PEN A;  4YAU A;  3AVW A;  4OC0 A;  2PVV A;  4XPD C;  4EH1 A;  1QSM A;  1VHS A;  4MJ8 A;  2R6H A;  4CAF A;  3SLD A;  1NB0 A;  3FXT A;  3IWE A;  4R87 A;  1PJ5 A;  3WC7 A;  4XN3 A;  2VBV A;  1VQK B;  4P10 A;  1R5N A;  1ZG8 A;  4OOV A;  4Y49 C;  2VZL A;  5HXD A;  2ZOG A;  7CPA A;  2JEV A;  4A31 A;  1WP6 A;  2Q4V A;  3TO6 A;  3ISX A;  1KZF A;  4XPK A;  1QFY A;  2HLD A;  2F43 A;  3V7Z A;  1Y9W A;  1BX0 A;  2Q4Y A;  3FB3 A;  4OID A;  4A2Z A;  2JDC A;  2AFO A;  3WBK A;  2WPX A;  2ZZQ A;  1JJ2 B;  1DG1 G;  1TF8 A;  3CRZ A;  4UCN A;  1DE4 C;  1TKH A;  1NDH A;  2DOG A;  2BSW A;  4LBY A;  3CC4 B;  1YX0 A;  2ZTN A;  2XND A;  4QUS A;  2EVN A;  4FXU A;  1KD1 D;  2VBU A;  1KJZ A;  4Q7A A;  3R6K A;  5F47 A;  1S7F A;  2EUI A;  2JBJ A;  3RZA A;  4XLE A; 
#chains in the Genus database with same CATH homology
 1BPM A;  2PJA A;  4NGS A;  2PJ1 A;  2RFH A;  2XEJ A;  2IMO A;  2BOA A;  3B3V A;  2AFX A;  4P45 A;  4JZ0 A;  4MHP A;  2BCO A;  3JRU A;  4MHZ A;  4NGM A;  3KGQ A;  3SJX A;  2AFM A;  1Y7E A;  2C6P A;  4P4E A;  5LYL A;  3HUV A;  2ZEG A;  1YW6 A;  2BO9 A;  3FX6 A;  4FWU A;  4ZY1 A;  2PJ6 A;  4PPZ A;  3VAT A;  2GRE A;  2RB7 A;  3IO1 A;  1ZLH A;  4PXC A;  2VL1 A;  4UEF A;  2V8G A;  4OC5 A;  2ABZ A;  2CTC A;  3KHX A;  2OR4 A;  3KQX A;  3B3S A;  4P6Y A;  3K9T A;  3FF3 A;  3HLP A;  5K8N A;  3ISZ A;  4MXU A;  4MCS A;  3D7D A;  1TKF A;  4PXE A;  3NH5 A;  4X8I A;  2F7V A;  1PCA A;  1ARL A;  4NJQ A;  4EME A;  1VHE A;  3BXM A;  3FH4 A;  5ELY A;  3D7H A;  1Q7L A;  3D67 A;  5CPA A;  2C6G A;  3PEI A;  1GYT A;  1AYE A;  2PJ7 A;  3FVL A;  2ZEF A;  1YW4 A;  3PB4 X;  4W9Y A;  2NYQ A;  1AMP A;  4F9U A;  2IJZ A;  1YME A;  1LAP A;  2XEI A;  1LAM A;  4OC1 A;  1HDQ A;  2CIJ A;  4P4I A;  3MN8 A;  1XJO A;  1H8L A;  4A38 A;  4UIA A;  5LRK A;  4A94 A;  4ZI6 A;  3DLJ A;  4PXD A;  4IAV A;  1JQG A;  3BHX A;  5JH9 A;  3PB9 X;  3NA6 A;  1LAN A;  2V8D A;  1IY7 A;  2HC9 A;  2ZOF A;  1TKJ A;  4OIW A;  1Z5R A;  3KHZ A;  2GLF A;  2PJ3 A;  1FNO A;  3SJE A;  2JEW A;  2FVG A;  2ZEL A;  3T8W A;  5D8N A;  1ARM A;  2C1C A;  2ZEE A;  5LRG A;  4DJL A;  5LYF A;  3H8E A;  3LWU A;  3V38 A;  4NGR A;  2Q51 A;  2ZEM A;  3PRT A;  5LYI A;  1ZLI A;  2C6C A;  3S9N A;  4MCP A;  2AFW A;  4ZX9 A;  3NFZ A;  3D7G A;  4NGP A;  3RBU A;  1CPX A;  2G9D A;  3GUX A;  3N5F A;  2O4H A;  3WC6 A;  3D68 A;  3PB6 X;  3PFO A;  1LFW A;  2PIZ A;  4ZY0 A;  2GLJ A;  3B3C A;  3S9L A;  5CBM A;  4P4F A;  3KQZ A;  1ZG7 A;  2AFZ A;  4P4J A;  2XEG A;  4ZY2 A;  3IEH A;  3CDX A;  4NFR A;  1NSA A;  5HVG A;  2WZN A;  1Y0R A;  2PCU A;  2ZEN A;  4OC3 A;  4NGT A;  1CG2 A;  2IQ6 A;  3WC5 A;  4F9V A;  3TX8 A;  1DTD A;  3SI2 A;  3PFE A;  5F09 A;  4P4B A;  3PBE A;  5K8O A;  3CPX A;  2HB6 A;  4FAI A;  3LMS A;  4R76 A;  2PJ4 A;  5LYD A;  4OKO A;  5K8M A;  2ZED A;  4MHY A;  2Q43 A;  3K2K A;  1VGY A;  3H8G A;  1CPS A;  3VAR A;  1EE3 P;  4FBE A;  1HEE A;  3FMC A;  4LQG A;  2PJ0 A;  4R6T A;  2PRQ A;  2JBK A;  3PB8 X;  4NGQ A;  3IWW A;  1HDU A;  1VIX A;  4Z65 A;  2V8H A;  4MCR A;  3SJF A;  1OBR A;  6CPA A;  1UWY A;  2ZEH A;  2EK9 A;  4PQA A;  3KL9 A;  2PVW A;  4UF4 A;  1LCP A;  4OC2 A;  1XBU A;  4PXB A;  1ZG9 A;  2ZEP A;  4UIB A;  1BLL E;  2NSM A;  2CF4 A;  1TF9 A;  3B2Y A;  3L2N A;  3CPA A;  4IHM A;  1PYT B;  5HVH A;  1CX8 A;  3D7F A;  2PJ9 A;  4DYO A;  5HVF A;  1QQ9 A;  4F8Z A;  3KI9 A;  2J9A A;  5DS0 A;  5JGF A;  3B35 A;  4ZYQ A;  3PB7 X;  1QMU A;  3KZW A;  4OC4 A;  8CPA A;  4UEZ A;  2O53 A;  4EWT A;  5I4M A;  4CPA A;  2QJ8 A;  4ONW A;  3MRU A;  4MRI A;  2POK A;  4OME A;  4TWE A;  1CBX A;  2XEF A;  3D4U A;  4YWY A;  2PJ5 A;  2EK8 A;  3SJG A;  2PJ2 A;  3NH4 A;  3GB0 A;  2PJ8 A;  1CP7 A;  3PBB A;  3GLJ A;  3FED A;  2I3C A;  2OOT A;  3NH8 A;  1XMB A;  4NGN A;  5THW A;  3IJ3 A;  4JYW A;  3CT9 A;  3QNV A;  1XRY A;  1BAV A;  1F57 A;  3I1U A;  4UEE A;  1CP6 A;  3KAS A;  1R43 A;  4A39 A;  3VH9 A;  4OP4 A;  1LOK A;  4MMO A;  3IC1 A;  3WAB A;  4TNU A;  3FEE A;  1M4L A;  5IB9 A;  4O23 A;  4EFD A;  3S9M A;  2AFS A;  3H8F A;  2GU2 A;  1ELL P;  3SI0 A;  1F2P A;  3B3T A;  3SI1 A;  1BPN A;  4AXV A;  3RAM A;  3IIB A;  2EWB A;  5J1Q A;  2AFU A;  1TXR A;  1Z2L A;  4MHN A;  4B6Z A;  1ELM P;  5D29 A;  1XFO A;  3KR5 A;  2PE3 A;  4DUK A;  4BD9 A;  2CTB A;  3FJU A;  4R8F A;  3IFE A;  5JM6 A;  4WJB A;  4IK2 A;  2ANP A;  2Q4Z A;  2DEA A;  1YSJ A;  4YU9 A;  3WT4 A;  4OC0 A;  2PVV A;  2V8V A;  1Z8L A;  4H2K A;  1F2O A;  3BI0 A;  4G1P A;  2PJB A;  1FT7 A;  3WC7 A;  2PIY A;  1R3N A;  4GM5 A;  2ZEO A;  4P10 A;  4K3N A;  5K8P A;  1ZG8 A;  4X2T A;  5LRJ A;  1IGB A;  5HXD A;  2F8H A;  2ZOG A;  7CPA A;  3B3W A;  1KWM A;  4MCQ A;  2PJC A;  4P4D A;  3B7I A;  3ISX A;  4R7M A;  1VHO A;  4FUU A;  4P44 A;  4WWV A;  3V7Z A;  2QYV A;  4KSI A;  3FEC A;  1Y0Y A;  3TC8 A;  4OID A;  2AFO A;  2QVP A;  4X3R A;  1TF8 A;  3DGV A;  1DE4 C;  1TKH A;  3D66 A;  4A37 A;  4NJR A;  4ZX8 A;  4RUH A;  2WYR A;  4Q7A A;  3KR4 A;  2V77 A;  1RTQ A;  2JBJ A;  1YLO A;  3RZA A;  3BI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...