2PE3A

Crystal structure of frv operon protein frvx (ph1821)from pyrococcus horikoshii ot3
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
344
structure length
330
Chain Sequence
DWKLMQEIIEAPGVSGYEHLGIRDIVVDVLKEVADEVKVDKLGNVIAHFKGSSPRIMVAAHMDKIGVMVNHIDKDGYLHIVPIGGVLPETLVAQRIRFFTEKGERYGVVGVLPDWDQIVVDVGASSKEEAEEMGFRVGTVGEFAPNFTRLNEHRFATPYLDDRICLYAMIEAARQLGDHEADIYIVGSVQEEVGLRGARVASYAINPEVGIAMDVTFAKQPHDKGKIVPELGKGPVMDVGPNINPKLRAFADEVAKKYEIPLQVEPSPRPTGTDANVMQINREGVATAVLSIPIRYMHSQVELADARDVDNTIKLAKALLEELKPMDFTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of frv operon protein frvx (ph1821)from pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
molecule keywords 354aa long hypothetical operon protein Frv
total genus 97
structure length 330
sequence length 344
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05343 Peptidase_M42 M42 glutamyl aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.40 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Peptidase M42, domain 2 2pe3A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2pe3A01
3PB7X 4OIDA 3D66A 1VHOA 5LYLA 2ANPA 3IWWA 1IGBA 5JGFA 1VIXA 4Z65A 3IIBA 1ZLIA 4MRIA 4ZY0A 1YW6A 3RZAA 2CIJA 3NA6A 4NGQA 3PB6X 3QNVA 2XEJA 2PJ8A 1VHEA 3K2KA 3KZWA 3D67A 1RTQA 3B7IA 4NJQA 3D68A 1LAMA 2O4HA 3LWUA 3IO1A 2ZOGA 5J1QA 2PIZA 4MHNA 2CTCA 3VARA 3IJ3A 3CPAA 3T8WA 4DYOA 2HB6A 4OIWA 2QYVA 3IEHA 2EK8A 1CBXA 5CBMA 4TNUA 4OC1A 1ARLA 2GLFA 2V8HA 5LYFA 5LRGA 5DS0A 3MRUA 2PJCA 2VL1A 4LQGA 4ZY2A 3IFEA 2GREA 1ELMP 3FX6A 1BPNA 4OC5A 2EWBA 1IY7A 5IB9A 1TXRA 4UEFA 1Z5RA 3KL9A 3WC5A 4P4IA 4OC4A 3I1UA 4MHPA 2PVWA 2WZNA 3D4UA 4DJLA 1Y0YA 4MCPA 8CPAA 1YSJA 2PJ6A 2PJ9A 4ZX8A 2AFUA 4ZYQA 2JBJA 1HEEA 1PCAA 1YW4A 3D7GA 2IMOA 5F09A 4K3NA 4X2TA 3PB8X 2JEWA 2I3CA 2AFMA 4PQAA 5D29A 3SJFA 3D7HA 2O53A 3KI9A 1F2OA 4IAVA 4P44A 1Z8LA 3JRUA 4WJBA 4NGSA 1F57A 1LCPA 2NSMA 2HC9A 4ZX9A 3PB4X 3CPXA 2GU2A 3HUVA 4F9UA 3N5FA 3FEEA 3SJGA 4A39A 2C1CA 2BOAA 3NH8A 3DLJA 5I4MA 1TKHA 3H8FA 3KGQA 4MMOA 3BHXA 1CG2A 5LYIA 3B3WA 3KR5A 3PB9X 1UWYA 4MHZA 1AMPA 4GM5A 4R8FA 2CF4A 1LOKA 1NSAA 4P4BA 3V7ZA 2AFOA 4NGPA 4OC3A 2V8VA 1FT7A 3B35A 2PVVA 4P6YA 5JM6A 2Q51A 1XRYA 2C6GA 4R76A 3TC8A 4KSIA 3GUXA 1LAPA 3L2NA 2BCOA 3HLPA 2C6PA 3RBUA 5K8PA 2J9AA 3GB0A 3NFZA 3SI1A 4A38A 1CX8A 1ZLHA 2CTBA 2ZEDA 2ZELA 1DE4C 3B2YA 2ZEOA 4F8ZA 5JH9A 3KQZA 3FJUA 2PJ2A 3KHXA 2AFXA 2AFZA 1VGYA 3MN8A 4A94A 2PRQA 2IQ6A 3BI0A 3PFEA 1JQGA 2PJBA 2EK9A 2ZOFA 2PJ4A 3BXMA 4WWVA 2NYQA 3WC7A 2F8HA 2PJ3A 4MHYA 1ZG8A 1GYTA 2OR4A 1LANA 4A37A 1AYEA 3SJXA 2ZEFA 1CPSA 3ISZA 3S9MA 2ZENA 1ELLP 1R43A 1CP6A 2PCUA 4R6TA 4UIBA 2ZEPA 2RFHA 4FUUA 4MXUA 3VH9A 3H8EA 4JZ0A 2DEAA 3B3SA 3NH5A 3LMSA 2WYRA 4Q7AA 2OOTA 3PFOA 3PBBA 7CPAA 3PRTA 1TKFA 4ZY1A 3DGVA 3BI1A 4X8IA 1QMUA 1EE3P 1XMBA 4PXEA 4UIAA 4NGNA 4CPAA 2V8DA 2ZEGA 2GLJA 2C6CA 4P10A 1BLLE 2XEIA 4NJRA 1YLOA 1ZG7A 4OC0A 4AXVA 4PXDA 4NFRA 3SJEA 3IC1A 3VATA 1R3NA 3PBEA 1CPXA 4G1PA 2QJ8A 5K8MA 4P45A 4P4EA 3V38A 1Q7LA 4X3RA 5K8OA 1XFOA 2XEFA 2PJ0A 2Q4ZA 4NGRA 2AFWA 5ELYA 3H8GA 2IJZA 2ZEHA 4BD9A 1F2PA 3B3VA 3CT9A 3B3CA 3FMCA 4PXBA 1XBUA 4P4JA 3FH4A 2PJ7A 3WABA 2BO9A 4O23A 1H8LA 3D7DA 3WC6A 3WT4A 2ABZA 3S9LA 3KHZA 4DUKA 2FVGA 5CPAA 5HVFA 1HDQA 4FWUA 4OKOA 4PXCA 2PJAA 3ISXA 1BPMA 1TF8A 5THWA 3S9NA 3FVLA 4EMEA 4P4FA 4IHMA 3CDXA 4OMEA 4NGMA 4OC2A 4EWTA 4TWEA 4NGTA 1ZG9A 5K8NA 2AFSA 3SI0A 4YWYA 2F7VA 1XJOA 1HDUA 3GLJA 4RUHA 3K9TA 3PEIA 5LYDA 4EFDA 1KWMA 1BAVA 1M4LA 3D7FA 4B6ZA 2PJ1A 1CP7A 1FNOA 3FEDA 5D8NA 1Y7EA 4H2KA 4OP4A 4MCRA 2V77A 4ONWA 3RAMA 3FF3A 6CPAA 4UF4A 1PYTB 3KR4A 3KQXA 3FECA 1TF9A 1ARMA 4JYWA 4FBEA 2ZEMA 1OBRA 3KASA 2ZEEA 4UEZA 4MCSA 4ZI6A 5HVHA 5HXDA 4P4DA 1Z2LA 3SI2A 5HVGA 4W9YA 4FAIA 2V8GA 3TX8A 5LRJA 2JBKA 4IK2A 2RB7A 4YU9A 1LFWA 2PE3A 1Y0RA 1TKJA 1YMEA 2POKA 2PIYA 1QQ9A 4PPZA 4F9VA 2G9DA 3NH4A 4R7MA 5LRKA 4MCQA 2PJ5A 3B3TA 2Q43A 2XEGA 2QVPA 4UEEA 1DTDA
chains in the Genus database with same CATH superfamily
3PB7X 2P6EA 4ASUA 3P27A 3QAYA 4OIDA 5LYLA 1KK0A 2REEA 1VIXA 4KVME 1E79A 4K1XA 3Q6RA 4NXYA 4Q36A 1K73D 3NA6A 2F1LA 1DARA 3KZWA 2ZPAA 1QSNA 3D67A 2ZZQA 3B7IA 2R9VA 1YITB 4UCMA 4YALA 3CP2A 5E96A 3JTKA 3I1FA 2Z11A 2CTCA 5F4MA 3ZUGA 2DOGA 2VI7A 3IEHA 4AVCA 4XLAA 2ZBVA 1CBXA 5CBMA 1NE9A 1ARLA 1WPCA 1EFUA 4JMQA 2V8HA 1XE4A 5LYFA 5LRGA 3CCUB 4R87A 2JN9A 1MRZA 4OADA 4ZGNB 1UMKA 4LQGA 3IFEA 5H84A 4CGLA 1BPNA 5TY0A 4M1KA 4XNHC 5IB9A 4P9SA 1BJKA 2WSAA 1Z5RA 4UEFA 4KSFA 5HKKA 4OPVA 5KSWB 2PR1A 4L8AA 1YQEA 3I1UA 4AG9A 2FIWA 1Y0YA 1U2RA 3BCDA 2ZTGA 1KUYA 3FPKA 1NB9A 2YNDA 4M4SA 2HCJB 3TO9A 3WR7A 1HEEA 1PCAA 3CC7B 1YK3A 4B13A 4CYQA 3Q3AA 3SJFA 3D7HA 3CCJB 2DPSA 1B87A 2D9RA 4IAVA 5H59A 4P44A 5LMZA 4Z4ZA 4WJBA 2ZL7A 2I1LA 5G21A 4XLFA 1RXTA 4JXQA 1R5OA 2HC9A 4ZX9A 3PB4X 3AGPA 4JJXA 3FEEA 4A39A 1H42A 2C1CA 4XM3A 5FA6A 2EIXA 4MI4A 3CRZA 1FNDA 3GIUA 1E3XA 3ZPNA 4HE6A 4CAFA 1CG2A 4B5PB 4R71A 1EP2B 3GYAA 1IJFA 2V7WA 4MHDA 1BMFA 2X7BA 4PV6A 2OK8A 2PVVA 1TVCA 3CMAB 1TTTA 3BH4A 1XRYA 1FNCA 3S6GA 1WK4A 4BBHA 2PR8A 2DCUA 3ASSA 3LODA 3L2NA 4XMYA 3FJOA 2B5OA 1BX0A 1Q81D 4Z4UA 3RBUA 5B6IA 1JB9A 2J9AA 1IB1E 1Q2CA 1R5BA 4P2NA 4B5OA 3FJUA 2PJ2A 5THXA 2AFXA 4R9MA 3MN8A 2ZL5A 3EO4A 1YJ9B 2J8RA 4E2AA 3AVTA 2Q4VA 2JIZA 2Q7BA 2ZOFA 2PJ4A 1WTHD 4B3GA 4H89A 1OZPA 4WWVA 2NYQA 5J35A 3F8KA 4C7IA 5IYQA 2PJ3A 3IU2A 2V7VA 4ACBA 1GYTA 4Q7JB 1VJSA 1LANA 2X8KA 3A9LA 3WNCA 4PC7A 2ZENA 1R43A 1WWZA 4X07A 4R6TA 4A95A 3OP1A 3SJZA 1N8RD 4QB9A 5IYRA 3VH9A 4JZ0A 2FX3A 3NH5A 3LMSA 2P0WA 3PENA 1WOPA 1VQPB 3F5BA 4CAEA 4B11A 3G05A 2OOTA 3D26A 4QV2A 2DF5A 1B2RA 4LBZA 4EVYA 2RC5A 3F0AA 4HE5A 2B4DB 3DGVA 4PC3A 3OZVA 3I56B 1KC8D 1I21A 4NGNA 4QUSA 2BN4A 2LZJA 2NMTA 4PK3A 1W9XA 3CW2A 4CYPA 4LX9A 2J7KA 3W6XA 1HA3A 1YLOA 3S6HA 5KTCA 3A8JA 4XR6A 3TCVA 3W2HA 4NFRA 3SJEA 3CXSA 1NBMA 1E63A 5G20A 3PBEA 4I49A 2R6HA 2ATRA 1F60A 1Z9UA 2VBQA 4B48A 4X3RA 4YAFA 2XEFA 2OYNA 1X12A 3I55B 5DWNA 1ZM9A 2BEIA 4NGRA 1BOBA 4Z4RA 5ELYA 1NSLA 4U5YA 1E1QA 4CYOA 4OOSA 3B3VA 3B3CA 1QSRA 2OU2A 3CD6B 4TT3A 2PJ7A 1TIQA 2BO9A 3I9SA 3BQJA 4KKUA 1NDHA 4ZGQB 1H8LA 4IF5A 4TMVA 3D7DA 4YAUA 5FO0A 4Z4SA 1V0FA 4FD5A 4PC2A 4TMTA 3JU4A 3S9LA 1E3ZA 5CNPA 4MFQA 4U9YA 2FVGA 5EMIA 3B78A 5HVFA 1HDQA 1D2EA 2Q6LA 2AE6A 4Z4YA 4OKOA 1N71A 4XLEA 1VQMB 4PXCA 1ON0A 1TF8A 5A89A 2BUEA 4EMEA 2OH1A 4IHMA 4NCZA 3OAAA 4AVAA 1XMTA 3BCFA 4OMEA 2C5HA 2O28A 3FB3A 3FRMA 4EWTA 5J8FA 2EUIA 2P6FA 4H6UA 2K5TA 4A32A 4XOTA 2ZXVA 3SI0A 2F7VA 1VQ5B 4G1VA 1HDUA 1KJZA 3G8WA 3GLJA 2CK3A 4ACAA 4ZBGA 4RUHA 3A35A 4FD4A 1BAVA 2C4TA 1M4LA 5F47A 1XE1A 4B6ZA 1VF7A 4HNWB 5DWMA 4H2KA 1QUFA 4MCRA 2E1RA 1SM4A 2DY1A 4UF4A 2XNJA 3OW2B 3KQXA 4LBVA 3FECA 2Z0ZA 3IU1A 4B4DA 4M3SA 4FBEA 2ZEMA 3FYNA 3KASA 1G7RA 1HZEA 1E1RA 5HVHA 3DR8A 2QEXB 3V76A 4P4DA 2G3AA 4FD6A 3NE8A 3NE5B 4FAIA 2V8GA 2CBXA 4DNTB 4H6ZA 4TMWA 5TR9A 4IK2A 1LFWA 1K28D 3CCVB 5F46A 1IB0A 3GSIA 4JD6A 4RPDA 4QC6A 4XL9A 1EP3B 1Y9KA 4QVAA 2POKA 3SLNA 2PIYA 3ES9A 1T6YA 4F9VA 4KVOE 5LRKA 4EH1A 5HZBA 4WZLA 1Z4RA 1WOOA 2PJ5A 4UEEA 3T51B 2CNTA 1OB2A 1VHOA 1EP1B 4LQ6A 5JGFA 4M0LA 3WNBA 1Y7RA 4MRIA 4ZY0A 1YW6A 3GKRA 3N7ZA 4NGQA 1YIJB 2XEJA 3EY5A 3K2KA 3JQQA 3VO2A 1RTQA 1GO2A 1ZM3A 1Q7YD 3D68A 1J4JA 4UCNA 3GVJA 3QSYA 3BJ7A 2HQYA 3RYOA 2V31A 4M6GA 5F4JA 4MJ8A 4MHNA 3BNWA 2ZBUA 4DYOA 2HDNB 2W6IA 2QYVA 3D2PA 1BLIA 2PMDA 2EK8A 2ARHA 2Q6IA 3H4QA 3MRUA 2PJCA 4ONUA 3FKSA 4M2LA 1XOVA 4ZY2A 2GREA 3FX6A 2PRBA 2B7BA 3ASRA 1J9ZA 4KLVA 4B3XA 3OW7A 3QFSA 4PC1A 1YX2A 4RM0A 2DXQA 2WZNA 1IYKA 4RD1A 4DQKA 2VEZA 1QGAA 2PJ6A 4ZX8A 4Y49B 4ZYQA 4HNYB 1YW4A 4MBUA 3W5UA 5F09A 3W2GA 2OBSA 2JEWA 1AMOA 5D29A 4YFJA 2VYQA 3G6EB 4XONA 1YHQB 3UY5A 3W2FA 3I3GA 3BY2A 1Z8LA 3JRUA 1N06A 4M6HA 3T56B 2F5IA 4N3NA 4UZUA 4XKWA 2WPWA 1LCPA 2NSMA 3E1YE 1QSOA 3CPXA 4F9UA 2Z3KA 3SJGA 1Q2YA 1IJEA 2QDXA 1MJ9A 3CCLB 5I4MA 2V7UA 4GS4A 4OPOA 4Z1MA 4MMOA 1EWYA 2BF4A 3KR5A 3PVDA 2DETA 4MHZA 4NCNA 4R8FA 1NSAA 4R57A 4OC3A 1XEBA 3B35A 4HNXB 4R76A 3MCAA 3OFNA 4KSIA 3GUXA 4HIZA 1WDTA 4YEJA 1JJ2B 1LAPA 3KKWA 4Y9UA 4QFMA 3R6JA 3GB0A 3NFZA 4PK2A 2CTBA 1G7SA 2ZELA 4L89A 3QFTA 1K8AD 5JH9A 1K4JA 3JUWA 3KHXA 3KEWA 2AFZA 2XNDA 2VNIA 2B3VA 2JLMA 4RD4A 3WY9A 3BI0A 1AIPA 2DEUA 5H86A 1JQGA 1GR1A 4PSWA 2JEVA 2F8HA 4RD0A 3D2MA 3A3BA 3SLDA 4P3YA 5IYWA 2QTZA 4UFWA 2X3UA 4A37A 4ZCLA 2R98A 2XZOA 3D8PA 4PC6A 2PIAA 1CPSA 3BJ8A 1KK3A 5IYNA 1FNMA 1ELLP 3A1PA 2BL1A 4X0CA 2ZW4A 2ZEPA 3ASQA 1S7KA 1YJNB 2RFHA 3IWEA 3JVNA 3K9UA 4KOXA 4FUUA 1PJ6A 3EXNA 4MXUA 4LBWA 2DEAA 3B3SA 4KOUA 2FSRA 2X6YA 3WBJA 1WU8A 2CXAA 4XN0A 4RI1A 3B8GA 4F0XA 1P4NA 4ZY1A 1KK2A 5HZAA 1NMTA 4G1BA 1EE3P 4PXEA 2Z3MA 1QFYA 4BPRA 2V8DA 1GVHA 2FIAA 2GLJA 3H94A 3OWCA 4P10A 4OP7A 1Y9WA 4NJRA 4OC0A 5BWAB 3HAGA 3ZZUA 2GK6A 3G4SB 1S3ZA 4UA3A 1CPXA 4G1PA 4CGOA 2B7CA 2P3MA 2GANA 5K8MA 4P4EA 2WPDA 1Q7LA 1XFOA 2XNCA 2VBSA 3ONUA 1VKCA 3OZUA 5GV8A 1D1NA 4P26A 4A33A 3QE2A 2Q4ZA 4MY0A 2WSSA 1Q86D 5EBVA 3P2HA 5FVJA 4CAVA 4CGNA 2B58A 2BM1A 1KZFA 4X7EA 2ZTNA 3CT9A 5EC4A 2YWEA 4PXBA 4II2A 1HVXA 4YELA 3WT4A 2VBTA 4RDKA 4B5PA 1QGYA 4U9UA 5JPHA 4QBJA 4DUKA 4XPDC 4AVBA 4JWPA 3CCQB 4A30A 2DYIA 1IOIA 3G3SA 1IYLA 3IGRA 1KMHA 5THWA 3S9NA 1QSTA 3TOBA 4NGMA 4F0YA 3V8IA 1CNEA 1V0EA 4XOPA 1PKVA 4NGTA 4BINA 1UD5A 5K8NA 3FPPA 2W6JA 5FO1A 2FXFA 4M6IA 5JQ4A 3K9TA 1KWMA 3V7AA 2Q6KA 3LQ6A 3BLNA 2Z6BD 5D8NA 1Y7EA 3OEHA 2ZXIA 4RN7A 2V77A 4QVJA 3FF3A 6CPAA 3CPWB 4Q38A 1I1DA 1M44A 4Z4TA 2Q6OA 4JYWA 4AC9A 3AVUA 4MCSA 3GIRA 4YAWA 2QA4B 3CMMA 5HXDA 2BGJA 4XNHB 1N05A 3AVWA 2FS5A 5LRJA 5A27A 3D3SA 2V7QA 1Y0RA 1KQSB 3PP9A 1W87A 4RCYA 1XQBA 3QAHA 1QQ9A 1S60A 4Y7CA 3B8HA 4R7MA 4MCQA 1E62A 3B3TA 1L0CA 2Q43A 2B3UA 3TTHA 2RC6A 4M85A 1IICA 1IGBA 4Z65A 2NPFA 3IIBA 4KOSA 2CC2A 2REFA 2D3NA 3QNVA 4DK1A 3LD2A 2H5MA 3OEEA 2PJ8A 1VHEA 2EFGA 4E0AA 1YVKA 2OZUA 1QFZA 5AG4A 2R1IA 1LAMA 2O4HA 5G22A 3R9GA 2ZZFA 5J1QA 5EMNA 5ISVA 2PIZA 4J0QA 1W34A 3RY8A 3R1KA 3FNCA 4AB7A 5IK2A 3VARA 3IJ3A 3CPAA 1JNYA 2QIRA 4MFKA 1Q82D 4NNJA 2VBVA 4TNUA 2GLFA 2B4BA 2FL4A 1I7PA 1ZUNB 4E8OA 5GV7A 3FIXA 5C82A 5DS0A 4UAJA 3ONYA 1OGJA 4C2YA 1N0UA 4ZGYB 4G6IA 1ELMP 3AVXA 5TV2A 4P3IA 2VXKA 1KD1D 2Z3OA 4OC5A 3CCRB 4RLZA 1TXRA 2J8NA 3CXQA 3W6SA 1CNFA 2ZITA 2P6GA 1ZO0A 4NSQA 4F6AA 3WC5A 1QSMA 5F48A 4DJLA 2JJ2A 4MCPA 4RS2A 8CPAA 2VNHA 2XGJA 4ROXA 3FBUA 3R9EA 3R9FA 4UZEA 1YREA 1QVFB 2PJ9A 2AFUA 2JBJA 4A31A 2FE7A 3ZZTA 4KOYA 2KCWA 2EVNA 1QUEA 2I3CA 2AFMA 1KUXA 3DSBA 2ZW5A 3A8IA 2O53A 4ZCIA 4Z4VA 3CCEB 3WNDA 1OB5A 4NGSA 1QVGB 5IX3A 4RD6A 3ZJ0A 2C4UA 4CYNA 3HUVA 2PC1A 1VHSA 4ZCMA 3N5FA 3S6FA 3CXPA 3NH8A 4CRYB 5H5JA 1TKHA 2PDOA 1EFTA 1FRQA 4OPSA 4KOTA 2GJPA 3KGQA 1TLLA 3PB9X 1UWYA 1NB0A 1AMPA 4GM5A 2CF4A 4B43A 3PUNA 4C68A 3ASPA 4NGPA 3CC4B 2BM0A 3TE4A 4QUZA 4UFXA 3OKXA 4P6YA 2WUUA 1GAWA 3VNVA 4JXRA 1VQ6B 3ZIAA 5BSYA 3JQPA 3SXNA 1DG1G 2YWHA 3E0KA 2BPOA 4OOXA 3VR6A 5K8PA 4J3GA 2BGIA 3SI1A 4A38A 1CX8A 2VJJA 3PUMA 1WORA 1QFJA 2PLFA 1DE4C 1WSRA 4C43A 3B2YA 2ZEOA 1VQ4B 3QFCA 3NE7A 2QTLA 3KQZA 4XNFA 2AHOA 1VGYA 3OPOA 4CAXA 1PJ5A 4A94A 2JJ1A 4XD7A 1T6ZA 2PRQA 1KTVA 1P4MA 3PFEA 2QMUA 4DK0A 5AG6A 2VZLA 3WXMA 3MHPA 2PJBA 4DNCA 3BXMA 1UD2A 1XF8A 3LQEA 4MHYA 2QN6A 4KS9A 5IB0A 4C7HA 4PGOA 5G1ZA 4A2ZA 4B47A 3SJXA 4F7DA 4C2XA 5C88A 1V0CA 1CP6A 2PCUA 1DDIA 4MFZA 1M90D 3E20A 2CW5A 2WJYA 1S5KA 2AJ6A 4CS0B 2WYRA 4G5GA 4Q7AA 2NV4A 3PFOA 1Z4EA 3T53B 3PBBA 1Z8TA 3W2EA 3SJPA 1BO4A 1WP6A 1TKFA 3SEJA 3H5ZA 2B5GB 1XMBA 4UIAA 2RC4A 4CPAA 2VQYA 4K30A 4PSXA 1B23P 1I8DA 2ZEGA 3CTAA 1JWQA 2VNKA 2BSWA 4UWIA 2BSAA 5AGEA 1BLLE 1F20A 2X6WA 3WYAA 2JDCA 1ZM2A 4PXDA 2M5SA 5L46A 4FWTA 3VATA 2WR8A 4P1VA 1OHHA 1M1KD 2XOKA 4XKVA 4P25A 4HKFA 4P45A 5K8OA 1W0JA 5KNLA 2QGGA 2Q44A 2GK7A 2X6XA 2AFWA 2VZYA 3P26A 4X7DA 3TO6A 2PSWA 1BQEA 2ZZGA 2X0KA 1F2PA 4IUSA 4P4JA 3FH4A 3WABA 1YI2B 1RO5A 3JQRA 2ABZA 2DPTA 1VQ9B 1V5VA 3A8KA 4DQLA 1VQOB 3KHZA 1UD4A 5F4OA 4LBYA 4FWUA 1H8EA 4RCZA 1GHEA 3CESA 4U9ZA 2YNCC 1Q2DA 3CXCB 2DERA 4KZTA 1K9MD 3FVLA 2XZPA 2WJVA 3CDXA 3ZZ0A 1H85A 1VQLB 4OC2A 4AG7A 2OBRA 4UFVA 3CP8A 4KKSA 3TFYA 2Z10A 2V7XA 5A8AA 1QGZA 2VNJA 2GJKA 3PEIA 5LYDA 4EFDA 4QVTA 2IL4A 3OOCA 3D7FA 1JA0A 4UCPA 4B14A 1FNOA 3FEDA 3J81k 4KOVA 2GFQA 3RAMA 2BV3A 1R5NA 4CAWA 3OZWA 3KR4A 5JBQA 5E6TA 2F43A 5J8CA 1GJRA 4H9GA 4RDLA 1EFCA 1CJWA 3W91A 4ZI6A 2ZW6A 4GQNA 4DNRB 3SXOA 3PGPA 3H9NA 1RQRA 3ASTA 3QB8A 1QH0A 1A2ZA 1KZLA 2B5GA 5HVGA 4AVZA 4QHYA 1IHMA 4YU9A 2RB7A 5HMNA 1UD8A 1I18A 2OB0A 2CRVA 4LC0A 1WOSA 4R3KA 2ZXHA 1YMEA 2GQFA 2B4DA 1S7NA 1M4DA 4RD3A 5IV0A 4AF7A 4TMZA 2XEGA 4AF6A 1VLOA 5A88A 1N0VC 3D66A 4TSFA 2ANPA 3R96A 2VJIA 2YWGA 3IWWA 4NEXA 4RPBA 2R7HA 3QFRA 2WZPP 1ZLIA 2YNEA 3RZAA 4CGMA 4N3GA 2CIJA 2G3TA 4FXUA 3LACA 2I00A 3PB6X 2X85A 3U6KA 4KLWA 1FDRA 3C26A 3CCSB 4XPLA 1SQHA 3R95A 4BMHA 3DDDA 5AG7A 1WSVA 3MMPA 4XN3A 2FCKA 4NJQA 3TT2A 1S7LA 3LWUA 4WZEA 3IO1A 2ZOGA 1DDGA 5KTAA 3ZC3A 4Y9RA 3T8WA 2FT0A 2HB6A 3T9YA 1FNBA 4OIWA 2CNDA 3BC9A 3U6BA 3BY1A 4OC1A 4NF1A 5FL7A 4XLCA 2VL1A 2GPJA 2Q04A 1Z8WA 3A3GA 3EC4A 1M4GA 2QMLA 1COWA 2OK7A 2EWBA 2D3LA 1UFHA 1IY7A 4MYUA 2ODFA 2YNCA 3DDYA 2QE7A 3KL9A 3AVVA 4P4IA 4OC4A 4MHPA 1UD6A 1W0KA 3LNNA 2PVWA 3D4UA 3PA1A 2I79A 4R3LA 3TO7A 3MGDA 1Q9SA 1ELOA 1YSJA 1EFRA 2XEXA 2CNSA 1H8HA 2F4NA 4JLYA 3AVYA 4CRZB 1S4MA 3SHPA 1G7CA 2YWFA 1MK4A 3D7GA 2HV2A 3WBKA 1JA1A 2IMOA 4K3NA 5IYPA 4X2TA 3PB8X 4PQAA 4MYTA 4TN1A 4B12A 4MFJA 3KI9A 1F2OA 1M1DA 2Z3NA 2BVNA 1F57A 2PQ8A 4KVXA 3FXTA 1SKYB 3T90A 3W2IA 2Y0MA 2GU2A 1FRNA 2V4DA 4GXHA 2BMWA 1OGIA 2BOAA 1G7TA 1VLYA 3DLJA 4RJLA 4G7XA 2ZW7A 3LO8A 3H8FA 5LYIA 3BHXA 4X7FA 1YLEA 3B3WA 2HLDA 3VMFA 1W2BB 2CNMA 1YX0A 1SKQA 3VWDA 4MFPA 1LOKA 4P4BA 4CGPA 3V7ZA 2AFOA 2V7TA 1P0HA 1B6BA 2V8VA 1FT7A 2WPXA 4XLHA 3ZZIA 5JM6A 5HH1A 2Q51A 1VQNB 4XPDB 2C6GA 5DN6A 3TC8A 1FY7A 2BCOA 5HXBA 1T6XA 3HLPA 1MJAA 2OZHA 1YGHA 2C6PA 3Q39A 4XPKA 1ZLHA 4UZFA 4KUAA 2ZEDA 1BX1A 4UBRA 2F1MA 4F8ZA 2EO8A 3DR6A 2QECA 4OOVA 1AUGA 3PA2A 4YXWA 2IQ6A 3TOAA 2CY2A 5KTDA 2EK9A 1U6MA 1S0UA 3AGQA 3WC7A 3DNSA 5F49A 5CDFA 1ZG8A 2OR4A 2GJRA 4II9A 1QG0A 1IOFA 1AYEA 2VZZA 1KRHA 2JDDA 4XQFA 1A8PA 4XORA 3W5HA 2ZEFA 5FNZA 3ISZA 4IW3B 1QX4A 3S9MA 3VWEA 2E1BA 1GAQA 1N08A 2DIEA 1S72B 1PJ7A 4UIBA 4X05A 4PABA 3OJXA 3SKBA 3H8EA 3CC2B 1IU8A 3W5VA 2OTLB 1T5EA 4KOWA 4X7CA 4C0SA 7CPAA 3PRTA 1VQKB 2YGWA 1MABA 3BI1A 4X8IA 4CQJA 1QMUA 1FX0A 3RO0A 2J8MA 2ZL6A 2C6CA 1CM0A 1E64A 2XEIA 2D4OA 4X5KA 5A28A 4YAOA 1ZG7A 3CZXA 4ORFA 1RQPA 4AXVA 2R8VA 3EFAA 3R6KA 3IC1A 3P2FA 1R3NA 4X06A 3ZBTA 2QJ8A 1YR0A 3V38A 1KK1A 2Z3PA 4KSAA 4M53A 5TRDA 2PJ0A 3IWGA 1N07A 2Q4YA 3H8GA 4P12A 1VQ8B 2IJZA 2ZZEA 3WQZA 4OAEA 4OLLA 3VO1A 1S7FA 2ZEHA 4BD9A 3Q38A 1ZM4A 2A4NA 3GVKA 2GIVA 5J3OA 3FMCA 4C2ZA 1NJID 1XBUA 2C27A 3OJWA 3B82A 2GE3A 4O23A 4TMXA 4KKTA 3WC6A 1LRZA 5AN9A 4B10A 2X53S 4B3FX 4ZV4A 1NRKA 5CPAA 4P22A 3ZBUA 3CB4A 1D8TA 2PJAA 3ISXA 1YVOA 2HUZA 1BPMA 5DSZA 1E43A 1XIXA 4WQMA 3LVBA 4P4FA 2C5BA 2XZLA 1OB0A 3GVLA 2JDIA 1XB2A 1W35A 4L8JA 5FIUA 5AG5A 4RDJA 4TWEA 1R57A 4KORA 4YGOA 1ZG9A 2AFSA 1Z8XA 3RNZA 1YJWB 1MJBA 4YWYA 1XJOA 2D4PA 1I12A 4WZKA 1BPLA 2C78A 1KUVA 1VQ7B 2OTJB 2KVOA 2PJ1A 4B44A 2HMAA 1CP7A 4MY3A 4OP4A 3CMEB 4ONWA 3GQBA 4HPSA 1PYTB 3VNUA 2EBJA 1TUIA 2Z3LA 4NBSA 2Q0YA 4KUBA 4G7WA 1TF9A 2OZGA 1IIDA 3S6KA 4WZTA 1ARMA 4Y49C 3OE7A 1OBRA 2OBTA 1CQXA 4PAAA 5GCNA 4TKOB 2ZEEA 4UEZA 4YRHA 3PZJA 4E0FA 1EXMA 2VBUA 1Z2LA 4P6VF 1UD3A 3SI2A 4W9YA 4Z4WA 3CCMB 3Q6QA 3G71B 3TX8A 1PUAA 4FK8A 4RD2A 2D74A 4MFLA 2JBKA 4YHBA 2C77A 1PU9A 4UWJA 2PE3A 5KW9A 1TKJA 1X10A 2Q7SA 5I0CA 4LUAA 4FN5A 4PPZA 3U2QA 4II3A 2G9DA 3NH4A 3GY9A 4FD7A 2C2WA 1M4IA 5BSXA 2QVPA 1DTDA 2G0BA
chains in the Genus database with same CATH topology
3PB7X 4OIDA 3D66A 1VHOA 5LYLA 2ANPA 3IWWA 1IGBA 5JGFA 1VIXA 4Z65A 3IIBA 1ZLIA 4MRIA 4ZY0A 1YW6A 3RZAA 2CIJA 3NA6A 4NGQA 3PB6X 3QNVA 2XEJA 2PJ8A 1VHEA 3K2KA 3KZWA 3D67A 1RTQA 3B7IA 4NJQA 3D68A 1LAMA 2O4HA 3LWUA 3IO1A 2ZOGA 5J1QA 2PIZA 4MHNA 2CTCA 3VARA 3IJ3A 3CPAA 3T8WA 4DYOA 2HB6A 4OIWA 2QYVA 3IEHA 2EK8A 1CBXA 5CBMA 4TNUA 4OC1A 1ARLA 2GLFA 2V8HA 5LYFA 5LRGA 5DS0A 3MRUA 2PJCA 2VL1A 4LQGA 4ZY2A 3IFEA 2GREA 1ELMP 3FX6A 1BPNA 4OC5A 2EWBA 1IY7A 5IB9A 1TXRA 4UEFA 1Z5RA 3KL9A 3WC5A 4P4IA 4OC4A 3I1UA 4MHPA 2PVWA 2WZNA 3D4UA 4DJLA 1Y0YA 4MCPA 8CPAA 1YSJA 2PJ6A 2PJ9A 4ZX8A 2AFUA 4ZYQA 2JBJA 1HEEA 1PCAA 1YW4A 3D7GA 2IMOA 5F09A 4K3NA 4X2TA 3PB8X 2JEWA 2I3CA 2AFMA 4PQAA 5D29A 3SJFA 3D7HA 2O53A 3KI9A 1F2OA 4IAVA 4P44A 1Z8LA 3JRUA 4WJBA 4NGSA 1F57A 1LCPA 2NSMA 2HC9A 4ZX9A 3PB4X 3CPXA 2GU2A 3HUVA 4F9UA 3N5FA 3FEEA 3SJGA 4A39A 2C1CA 2BOAA 3NH8A 3DLJA 5I4MA 1TKHA 3H8FA 3KGQA 4MMOA 3BHXA 1CG2A 5LYIA 3B3WA 3KR5A 3PB9X 1UWYA 4MHZA 1AMPA 4GM5A 4R8FA 2CF4A 1LOKA 1NSAA 4P4BA 3V7ZA 2AFOA 4NGPA 4OC3A 2V8VA 1FT7A 3B35A 2PVVA 4P6YA 5JM6A 2Q51A 1XRYA 2C6GA 4R76A 3TC8A 4KSIA 3GUXA 1LAPA 3L2NA 2BCOA 3HLPA 2C6PA 3RBUA 5K8PA 2J9AA 3GB0A 3NFZA 3SI1A 4A38A 1CX8A 1ZLHA 2CTBA 2ZEDA 2ZELA 1DE4C 3B2YA 2ZEOA 4F8ZA 5JH9A 3KQZA 3FJUA 2PJ2A 3KHXA 2AFXA 2AFZA 1VGYA 3MN8A 4A94A 2PRQA 2IQ6A 3BI0A 3PFEA 1JQGA 2PJBA 2EK9A 2ZOFA 2PJ4A 3BXMA 4WWVA 2NYQA 3WC7A 2F8HA 2PJ3A 4MHYA 1ZG8A 1GYTA 2OR4A 1LANA 4A37A 1AYEA 3SJXA 2ZEFA 1CPSA 3ISZA 3S9MA 2ZENA 1ELLP 1R43A 1CP6A 2PCUA 4R6TA 4UIBA 2ZEPA 2RFHA 4FUUA 4MXUA 3VH9A 3H8EA 4JZ0A 2DEAA 3B3SA 3NH5A 3LMSA 2WYRA 4Q7AA 2OOTA 3PFOA 3PBBA 7CPAA 3PRTA 1TKFA 4ZY1A 3DGVA 3BI1A 4X8IA 1QMUA 1EE3P 1XMBA 4PXEA 4UIAA 4NGNA 4CPAA 2V8DA 2ZEGA 2GLJA 2C6CA 4P10A 1BLLE 2XEIA 4NJRA 1YLOA 1ZG7A 4OC0A 4AXVA 4PXDA 4NFRA 3SJEA 3IC1A 3VATA 1R3NA 3PBEA 1CPXA 4G1PA 2QJ8A 5K8MA 4P45A 4P4EA 3V38A 1Q7LA 4X3RA 5K8OA 1XFOA 2XEFA 2PJ0A 2Q4ZA 4NGRA 2AFWA 5ELYA 3H8GA 2IJZA 2ZEHA 4BD9A 1F2PA 3B3VA 3CT9A 3B3CA 3FMCA 4PXBA 1XBUA 4P4JA 3FH4A 2PJ7A 3WABA 2BO9A 4O23A 1H8LA 3D7DA 3WC6A 3WT4A 2ABZA 3S9LA 3KHZA 4DUKA 2FVGA 5CPAA 5HVFA 1HDQA 4FWUA 4OKOA 4PXCA 2PJAA 3ISXA 1BPMA 1TF8A 5THWA 3S9NA 3FVLA 4EMEA 4P4FA 4IHMA 3CDXA 4OMEA 4NGMA 4OC2A 4EWTA 4TWEA 4NGTA 1ZG9A 5K8NA 2AFSA 3SI0A 4YWYA 2F7VA 1XJOA 1HDUA 3GLJA 4RUHA 3K9TA 3PEIA 5LYDA 4EFDA 1KWMA 1BAVA 1M4LA 3D7FA 4B6ZA 2PJ1A 1CP7A 1FNOA 3FEDA 5D8NA 1Y7EA 4H2KA 4OP4A 4MCRA 2V77A 4ONWA 3RAMA 3FF3A 6CPAA 4UF4A 1PYTB 3KR4A 3KQXA 3FECA 1TF9A 1ARMA 4JYWA 4FBEA 2ZEMA 1OBRA 3KASA 2ZEEA 4UEZA 4MCSA 4ZI6A 5HVHA 5HXDA 4P4DA 1Z2LA 3SI2A 5HVGA 4W9YA 4FAIA 2V8GA 3TX8A 5LRJA 2JBKA 4IK2A 2RB7A 4YU9A 1LFWA 2PE3A 1Y0RA 1TKJA 1YMEA 2POKA 2PIYA 1QQ9A 4PPZA 4F9VA 2G9DA 3NH4A 4R7MA 5LRKA 4MCQA 2PJ5A 3B3TA 2Q43A 2XEGA 2QVPA 4UEEA 1DTDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PB7 X;  4OID A;  3D66 A;  1VHO A;  5LYL A;  2ANP A;  3IWW A;  1IGB A;  5JGF A;  1VIX A;  4Z65 A;  3IIB A;  1ZLI A;  4MRI A;  4ZY0 A;  1YW6 A;  3RZA A;  2CIJ A;  3NA6 A;  4NGQ A;  3PB6 X;  3QNV A;  2XEJ A;  2PJ8 A;  1VHE A;  3K2K A;  3KZW A;  3D67 A;  1RTQ A;  3B7I A;  4NJQ A;  3D68 A;  1LAM A;  2O4H A;  3LWU A;  3IO1 A;  2ZOG A;  5J1Q A;  2PIZ A;  4MHN A;  2CTC A;  3VAR A;  3IJ3 A;  3CPA A;  3T8W A;  4DYO A;  2HB6 A;  4OIW A;  2QYV A;  3IEH A;  2EK8 A;  1CBX A;  5CBM A;  4TNU A;  4OC1 A;  1ARL A;  2GLF A;  2V8H A;  5LYF A;  5LRG A;  5DS0 A;  3MRU A;  2PJC A;  2VL1 A;  4LQG A;  4ZY2 A;  3IFE A;  2GRE A;  1ELM P;  3FX6 A;  1BPN A;  4OC5 A;  2EWB A;  1IY7 A;  5IB9 A;  1TXR A;  4UEF A;  1Z5R A;  3KL9 A;  3WC5 A;  4P4I A;  4OC4 A;  3I1U A;  4MHP A;  2PVW A;  2WZN A;  3D4U A;  4DJL A;  1Y0Y A;  4MCP A;  8CPA A;  1YSJ A;  2PJ6 A;  2PJ9 A;  4ZX8 A;  2AFU A;  4ZYQ A;  2JBJ A;  1HEE A;  1PCA A;  1YW4 A;  3D7G A;  2IMO A;  5F09 A;  4K3N A;  4X2T A;  3PB8 X;  2JEW A;  2I3C A;  2AFM A;  4PQA A;  5D29 A;  3SJF A;  3D7H A;  2O53 A;  3KI9 A;  1F2O A;  4IAV A;  4P44 A;  1Z8L A;  3JRU A;  4WJB A;  4NGS A;  1F57 A;  1LCP A;  2NSM A;  2HC9 A;  4ZX9 A;  3PB4 X;  3CPX A;  2GU2 A;  3HUV A;  4F9U A;  3N5F A;  3FEE A;  3SJG A;  4A39 A;  2C1C A;  2BOA A;  3NH8 A;  3DLJ A;  5I4M A;  1TKH A;  3H8F A;  3KGQ A;  4MMO A;  3BHX A;  1CG2 A;  5LYI A;  3B3W A;  3KR5 A;  3PB9 X;  1UWY A;  4MHZ A;  1AMP A;  4GM5 A;  4R8F A;  2CF4 A;  1LOK A;  1NSA A;  4P4B A;  3V7Z A;  2AFO A;  4NGP A;  4OC3 A;  2V8V A;  1FT7 A;  3B35 A;  2PVV A;  4P6Y A;  5JM6 A;  2Q51 A;  1XRY A;  2C6G A;  4R76 A;  3TC8 A;  4KSI A;  3GUX A;  1LAP A;  3L2N A;  2BCO A;  3HLP A;  2C6P A;  3RBU A;  5K8P A;  2J9A A;  3GB0 A;  3NFZ A;  3SI1 A;  4A38 A;  1CX8 A;  1ZLH A;  2CTB A;  2ZED A;  2ZEL A;  1DE4 C;  3B2Y A;  2ZEO A;  4F8Z A;  5JH9 A;  3KQZ A;  3FJU A;  2PJ2 A;  3KHX A;  2AFX A;  2AFZ A;  1VGY A;  3MN8 A;  4A94 A;  2PRQ A;  2IQ6 A;  3BI0 A;  3PFE A;  1JQG A;  2PJB A;  2EK9 A;  2ZOF A;  2PJ4 A;  3BXM A;  4WWV A;  2NYQ A;  3WC7 A;  2F8H A;  2PJ3 A;  4MHY A;  1ZG8 A;  1GYT A;  2OR4 A;  1LAN A;  4A37 A;  1AYE A;  3SJX A;  2ZEF A;  1CPS A;  3ISZ A;  3S9M A;  2ZEN A;  1ELL P;  1R43 A;  1CP6 A;  2PCU A;  4R6T A;  4UIB A;  2ZEP A;  2RFH A;  4FUU A;  4MXU A;  3VH9 A;  3H8E A;  4JZ0 A;  2DEA A;  3B3S A;  3NH5 A;  3LMS A;  2WYR A;  4Q7A A;  2OOT A;  3PFO A;  3PBB A;  7CPA A;  3PRT A;  1TKF A;  4ZY1 A;  3DGV A;  3BI1 A;  4X8I A;  1QMU A;  1EE3 P;  1XMB A;  4PXE A;  4UIA A;  4NGN A;  4CPA A;  2V8D A;  2ZEG A;  2GLJ A;  2C6C A;  4P10 A;  1BLL E;  2XEI A;  4NJR A;  1YLO A;  1ZG7 A;  4OC0 A;  4AXV A;  4PXD A;  4NFR A;  3SJE A;  3IC1 A;  3VAT A;  1R3N A;  3PBE A;  1CPX A;  4G1P A;  2QJ8 A;  5K8M A;  4P45 A;  4P4E A;  3V38 A;  1Q7L A;  4X3R A;  5K8O A;  1XFO A;  2XEF A;  2PJ0 A;  2Q4Z A;  4NGR A;  2AFW A;  5ELY A;  3H8G A;  2IJZ A;  2ZEH A;  4BD9 A;  1F2P A;  3B3V A;  3CT9 A;  3B3C A;  3FMC A;  4PXB A;  1XBU A;  4P4J A;  3FH4 A;  2PJ7 A;  3WAB A;  2BO9 A;  4O23 A;  1H8L A;  3D7D A;  3WC6 A;  3WT4 A;  2ABZ A;  3S9L A;  3KHZ A;  4DUK A;  2FVG A;  5CPA A;  5HVF A;  1HDQ A;  4FWU A;  4OKO A;  4PXC A;  2PJA A;  3ISX A;  1BPM A;  1TF8 A;  5THW A;  3S9N A;  3FVL A;  4EME A;  4P4F A;  4IHM A;  3CDX A;  4OME A;  4NGM A;  4OC2 A;  4EWT A;  4TWE A;  4NGT A;  1ZG9 A;  5K8N A;  2AFS A;  3SI0 A;  4YWY A;  2F7V A;  1XJO A;  1HDU A;  3GLJ A;  4RUH A;  3K9T A;  3PEI A;  5LYD A;  4EFD A;  1KWM A;  1BAV A;  1M4L A;  3D7F A;  4B6Z A;  2PJ1 A;  1CP7 A;  1FNO A;  3FED A;  5D8N A;  1Y7E A;  4H2K A;  4OP4 A;  4MCR A;  2V77 A;  4ONW A;  3RAM A;  3FF3 A;  6CPA A;  4UF4 A;  1PYT B;  3KR4 A;  3KQX A;  3FEC A;  1TF9 A;  1ARM A;  4JYW A;  4FBE A;  2ZEM A;  1OBR A;  3KAS A;  2ZEE A;  4UEZ A;  4MCS A;  4ZI6 A;  5HVH A;  5HXD A;  4P4D A;  1Z2L A;  3SI2 A;  5HVG A;  4W9Y A;  4FAI A;  2V8G A;  3TX8 A;  5LRJ A;  2JBK A;  4IK2 A;  2RB7 A;  4YU9 A;  1LFW A;  2PE3 A;  1Y0R A;  1TKJ A;  1YME A;  2POK A;  2PIY A;  1QQ9 A;  4PPZ A;  4F9V A;  2G9D A;  3NH4 A;  4R7M A;  5LRK A;  4MCQ A;  2PJ5 A;  3B3T A;  2Q43 A;  2XEG A;  2QVP A;  4UEE A;  1DTD A; 
#chains in the Genus database with same CATH topology
 3PB7 X;  2P6E A;  4ASU A;  3P27 A;  3QAY A;  4OID A;  5LYL A;  1KK0 A;  2REE A;  1VIX A;  4KVM E;  1E79 A;  4K1X A;  3Q6R A;  4NXY A;  4Q36 A;  1K73 D;  3NA6 A;  2F1L A;  1DAR A;  3KZW A;  2ZPA A;  1QSN A;  3D67 A;  2ZZQ A;  3B7I A;  2R9V A;  1YIT B;  4UCM A;  4YAL A;  3CP2 A;  5E96 A;  3JTK A;  3I1F A;  2Z11 A;  2CTC A;  5F4M A;  3ZUG A;  2DOG A;  2VI7 A;  3IEH A;  4AVC A;  4XLA A;  2ZBV A;  1CBX A;  5CBM A;  1NE9 A;  1ARL A;  1WPC A;  1EFU A;  4JMQ A;  2V8H A;  1XE4 A;  5LYF A;  5LRG A;  3CCU B;  4R87 A;  2JN9 A;  1MRZ A;  4OAD A;  4ZGN B;  1UMK A;  4LQG A;  3IFE A;  5H84 A;  4CGL A;  1BPN A;  5TY0 A;  4M1K A;  4XNH C;  5IB9 A;  4P9S A;  1BJK A;  2WSA A;  1Z5R A;  4UEF A;  4KSF A;  5HKK A;  4OPV A;  5KSW B;  2PR1 A;  4L8A A;  1YQE A;  3I1U A;  4AG9 A;  2FIW A;  1Y0Y A;  1U2R A;  3BCD A;  2ZTG A;  1KUY A;  3FPK A;  1NB9 A;  2YND A;  4M4S A;  2HCJ B;  3TO9 A;  3WR7 A;  1HEE A;  1PCA A;  3CC7 B;  1YK3 A;  4B13 A;  4CYQ A;  3Q3A A;  3SJF A;  3D7H A;  3CCJ B;  2DPS A;  1B87 A;  2D9R A;  4IAV A;  5H59 A;  4P44 A;  5LMZ A;  4Z4Z A;  4WJB A;  2ZL7 A;  2I1L A;  5G21 A;  4XLF A;  1RXT A;  4JXQ A;  1R5O A;  2HC9 A;  4ZX9 A;  3PB4 X;  3AGP A;  4JJX A;  3FEE A;  4A39 A;  1H42 A;  2C1C A;  4XM3 A;  5FA6 A;  2EIX A;  4MI4 A;  3CRZ A;  1FND A;  3GIU A;  1E3X A;  3ZPN A;  4HE6 A;  4CAF A;  1CG2 A;  4B5P B;  4R71 A;  1EP2 B;  3GYA A;  1IJF A;  2V7W A;  4MHD A;  1BMF A;  2X7B A;  4PV6 A;  2OK8 A;  2PVV A;  1TVC A;  3CMA B;  1TTT A;  3BH4 A;  1XRY A;  1FNC A;  3S6G A;  1WK4 A;  4BBH A;  2PR8 A;  2DCU A;  3ASS A;  3LOD A;  3L2N A;  4XMY A;  3FJO A;  2B5O A;  1BX0 A;  1Q81 D;  4Z4U A;  3RBU A;  5B6I A;  1JB9 A;  2J9A A;  1IB1 E;  1Q2C A;  1R5B A;  4P2N A;  4B5O A;  3FJU A;  2PJ2 A;  5THX A;  2AFX A;  4R9M A;  3MN8 A;  2ZL5 A;  3EO4 A;  1YJ9 B;  2J8R A;  4E2A A;  3AVT A;  2Q4V A;  2JIZ A;  2Q7B A;  2ZOF A;  2PJ4 A;  1WTH D;  4B3G A;  4H89 A;  1OZP A;  4WWV A;  2NYQ A;  5J35 A;  3F8K A;  4C7I A;  5IYQ A;  2PJ3 A;  3IU2 A;  2V7V A;  4ACB A;  1GYT A;  4Q7J B;  1VJS A;  1LAN A;  2X8K A;  3A9L A;  3WNC A;  4PC7 A;  2ZEN A;  1R43 A;  1WWZ A;  4X07 A;  4R6T A;  4A95 A;  3OP1 A;  3SJZ A;  1N8R D;  4QB9 A;  5IYR A;  3VH9 A;  4JZ0 A;  2FX3 A;  3NH5 A;  3LMS A;  2P0W A;  3PEN A;  1WOP A;  1VQP B;  3F5B A;  4CAE A;  4B11 A;  3G05 A;  2OOT A;  3D26 A;  4QV2 A;  2DF5 A;  1B2R A;  4LBZ A;  4EVY A;  2RC5 A;  3F0A A;  4HE5 A;  2B4D B;  3DGV A;  4PC3 A;  3OZV A;  3I56 B;  1KC8 D;  1I21 A;  4NGN A;  4QUS A;  2BN4 A;  2LZJ A;  2NMT A;  4PK3 A;  1W9X A;  3CW2 A;  4CYP A;  4LX9 A;  2J7K A;  3W6X A;  1HA3 A;  1YLO A;  3S6H A;  5KTC A;  3A8J A;  4XR6 A;  3TCV A;  3W2H A;  4NFR A;  3SJE A;  3CXS A;  1NBM A;  1E63 A;  5G20 A;  3PBE A;  4I49 A;  2R6H A;  2ATR A;  1F60 A;  1Z9U A;  2VBQ A;  4B48 A;  4X3R A;  4YAF A;  2XEF A;  2OYN A;  1X12 A;  3I55 B;  5DWN A;  1ZM9 A;  2BEI A;  4NGR A;  1BOB A;  4Z4R A;  5ELY A;  1NSL A;  4U5Y A;  1E1Q A;  4CYO A;  4OOS A;  3B3V A;  3B3C A;  1QSR A;  2OU2 A;  3CD6 B;  4TT3 A;  2PJ7 A;  1TIQ A;  2BO9 A;  3I9S A;  3BQJ A;  4KKU A;  1NDH A;  4ZGQ B;  1H8L A;  4IF5 A;  4TMV A;  3D7D A;  4YAU A;  5FO0 A;  4Z4S A;  1V0F A;  4FD5 A;  4PC2 A;  4TMT A;  3JU4 A;  3S9L A;  1E3Z A;  5CNP A;  4MFQ A;  4U9Y A;  2FVG A;  5EMI A;  3B78 A;  5HVF A;  1HDQ A;  1D2E A;  2Q6L A;  2AE6 A;  4Z4Y A;  4OKO A;  1N71 A;  4XLE A;  1VQM B;  4PXC A;  1ON0 A;  1TF8 A;  5A89 A;  2BUE A;  4EME A;  2OH1 A;  4IHM A;  4NCZ A;  3OAA A;  4AVA A;  1XMT A;  3BCF A;  4OME A;  2C5H A;  2O28 A;  3FB3 A;  3FRM A;  4EWT A;  5J8F A;  2EUI A;  2P6F A;  4H6U A;  2K5T A;  4A32 A;  4XOT A;  2ZXV A;  3SI0 A;  2F7V A;  1VQ5 B;  4G1V A;  1HDU A;  1KJZ A;  3G8W A;  3GLJ A;  2CK3 A;  4ACA A;  4ZBG A;  4RUH A;  3A35 A;  4FD4 A;  1BAV A;  2C4T A;  1M4L A;  5F47 A;  1XE1 A;  4B6Z A;  1VF7 A;  4HNW B;  5DWM A;  4H2K A;  1QUF A;  4MCR A;  2E1R A;  1SM4 A;  2DY1 A;  4UF4 A;  2XNJ A;  3OW2 B;  3KQX A;  4LBV A;  3FEC A;  2Z0Z A;  3IU1 A;  4B4D A;  4M3S A;  4FBE A;  2ZEM A;  3FYN A;  3KAS A;  1G7R A;  1HZE A;  1E1R A;  5HVH A;  3DR8 A;  2QEX B;  3V76 A;  4P4D A;  2G3A A;  4FD6 A;  3NE8 A;  3NE5 B;  4FAI A;  2V8G A;  2CBX A;  4DNT B;  4H6Z A;  4TMW A;  5TR9 A;  4IK2 A;  1LFW A;  1K28 D;  3CCV B;  5F46 A;  1IB0 A;  3GSI A;  4JD6 A;  4RPD A;  4QC6 A;  4XL9 A;  1EP3 B;  1Y9K A;  4QVA A;  2POK A;  3SLN A;  2PIY A;  3ES9 A;  1T6Y A;  4F9V A;  4KVO E;  5LRK A;  4EH1 A;  5HZB A;  4WZL A;  1Z4R A;  1WOO A;  2PJ5 A;  4UEE A;  3T51 B;  2CNT A;  1OB2 A;  1VHO A;  1EP1 B;  4LQ6 A;  5JGF A;  4M0L A;  3WNB A;  1Y7R A;  4MRI A;  4ZY0 A;  1YW6 A;  3GKR A;  3N7Z A;  4NGQ A;  1YIJ B;  2XEJ A;  3EY5 A;  3K2K A;  3JQQ A;  3VO2 A;  1RTQ A;  1GO2 A;  1ZM3 A;  1Q7Y D;  3D68 A;  1J4J A;  4UCN A;  3GVJ A;  3QSY A;  3BJ7 A;  2HQY A;  3RYO A;  2V31 A;  4M6G A;  5F4J A;  4MJ8 A;  4MHN A;  3BNW A;  2ZBU A;  4DYO A;  2HDN B;  2W6I A;  2QYV A;  3D2P A;  1BLI A;  2PMD A;  2EK8 A;  2ARH A;  2Q6I A;  3H4Q A;  3MRU A;  2PJC A;  4ONU A;  3FKS A;  4M2L A;  1XOV A;  4ZY2 A;  2GRE A;  3FX6 A;  2PRB A;  2B7B A;  3ASR A;  1J9Z A;  4KLV A;  4B3X A;  3OW7 A;  3QFS A;  4PC1 A;  1YX2 A;  4RM0 A;  2DXQ A;  2WZN A;  1IYK A;  4RD1 A;  4DQK A;  2VEZ A;  1QGA A;  2PJ6 A;  4ZX8 A;  4Y49 B;  4ZYQ A;  4HNY B;  1YW4 A;  4MBU A;  3W5U A;  5F09 A;  3W2G A;  2OBS A;  2JEW A;  1AMO A;  5D29 A;  4YFJ A;  2VYQ A;  3G6E B;  4XON A;  1YHQ B;  3UY5 A;  3W2F A;  3I3G A;  3BY2 A;  1Z8L A;  3JRU A;  1N06 A;  4M6H A;  3T56 B;  2F5I A;  4N3N A;  4UZU A;  4XKW A;  2WPW A;  1LCP A;  2NSM A;  3E1Y E;  1QSO A;  3CPX A;  4F9U A;  2Z3K A;  3SJG A;  1Q2Y A;  1IJE A;  2QDX A;  1MJ9 A;  3CCL B;  5I4M A;  2V7U A;  4GS4 A;  4OPO A;  4Z1M A;  4MMO A;  1EWY A;  2BF4 A;  3KR5 A;  3PVD A;  2DET A;  4MHZ A;  4NCN A;  4R8F A;  1NSA A;  4R57 A;  4OC3 A;  1XEB A;  3B35 A;  4HNX B;  4R76 A;  3MCA A;  3OFN A;  4KSI A;  3GUX A;  4HIZ A;  1WDT A;  4YEJ A;  1JJ2 B;  1LAP A;  3KKW A;  4Y9U A;  4QFM A;  3R6J A;  3GB0 A;  3NFZ A;  4PK2 A;  2CTB A;  1G7S A;  2ZEL A;  4L89 A;  3QFT A;  1K8A D;  5JH9 A;  1K4J A;  3JUW A;  3KHX A;  3KEW A;  2AFZ A;  2XND A;  2VNI A;  2B3V A;  2JLM A;  4RD4 A;  3WY9 A;  3BI0 A;  1AIP A;  2DEU A;  5H86 A;  1JQG A;  1GR1 A;  4PSW A;  2JEV A;  2F8H A;  4RD0 A;  3D2M A;  3A3B A;  3SLD A;  4P3Y A;  5IYW A;  2QTZ A;  4UFW A;  2X3U A;  4A37 A;  4ZCL A;  2R98 A;  2XZO A;  3D8P A;  4PC6 A;  2PIA A;  1CPS A;  3BJ8 A;  1KK3 A;  5IYN A;  1FNM A;  1ELL P;  3A1P A;  2BL1 A;  4X0C A;  2ZW4 A;  2ZEP A;  3ASQ A;  1S7K A;  1YJN B;  2RFH A;  3IWE A;  3JVN A;  3K9U A;  4KOX A;  4FUU A;  1PJ6 A;  3EXN A;  4MXU A;  4LBW A;  2DEA A;  3B3S A;  4KOU A;  2FSR A;  2X6Y A;  3WBJ A;  1WU8 A;  2CXA A;  4XN0 A;  4RI1 A;  3B8G A;  4F0X A;  1P4N A;  4ZY1 A;  1KK2 A;  5HZA A;  1NMT A;  4G1B A;  1EE3 P;  4PXE A;  2Z3M A;  1QFY A;  4BPR A;  2V8D A;  1GVH A;  2FIA A;  2GLJ A;  3H94 A;  3OWC A;  4P10 A;  4OP7 A;  1Y9W A;  4NJR A;  4OC0 A;  5BWA B;  3HAG A;  3ZZU A;  2GK6 A;  3G4S B;  1S3Z A;  4UA3 A;  1CPX A;  4G1P A;  4CGO A;  2B7C A;  2P3M A;  2GAN A;  5K8M A;  4P4E A;  2WPD A;  1Q7L A;  1XFO A;  2XNC A;  2VBS A;  3ONU A;  1VKC A;  3OZU A;  5GV8 A;  1D1N A;  4P26 A;  4A33 A;  3QE2 A;  2Q4Z A;  4MY0 A;  2WSS A;  1Q86 D;  5EBV A;  3P2H A;  5FVJ A;  4CAV A;  4CGN A;  2B58 A;  2BM1 A;  1KZF A;  4X7E A;  2ZTN A;  3CT9 A;  5EC4 A;  2YWE A;  4PXB A;  4II2 A;  1HVX A;  4YEL A;  3WT4 A;  2VBT A;  4RDK A;  4B5P A;  1QGY A;  4U9U A;  5JPH A;  4QBJ A;  4DUK A;  4XPD C;  4AVB A;  4JWP A;  3CCQ B;  4A30 A;  2DYI A;  1IOI A;  3G3S A;  1IYL A;  3IGR A;  1KMH A;  5THW A;  3S9N A;  1QST A;  3TOB A;  4NGM A;  4F0Y A;  3V8I A;  1CNE A;  1V0E A;  4XOP A;  1PKV A;  4NGT A;  4BIN A;  1UD5 A;  5K8N A;  3FPP A;  2W6J A;  5FO1 A;  2FXF A;  4M6I A;  5JQ4 A;  3K9T A;  1KWM A;  3V7A A;  2Q6K A;  3LQ6 A;  3BLN A;  2Z6B D;  5D8N A;  1Y7E A;  3OEH A;  2ZXI A;  4RN7 A;  2V77 A;  4QVJ A;  3FF3 A;  6CPA A;  3CPW B;  4Q38 A;  1I1D A;  1M44 A;  4Z4T A;  2Q6O A;  4JYW A;  4AC9 A;  3AVU A;  4MCS A;  3GIR A;  4YAW A;  2QA4 B;  3CMM A;  5HXD A;  2BGJ A;  4XNH B;  1N05 A;  3AVW A;  2FS5 A;  5LRJ A;  5A27 A;  3D3S A;  2V7Q A;  1Y0R A;  1KQS B;  3PP9 A;  1W87 A;  4RCY A;  1XQB A;  3QAH A;  1QQ9 A;  1S60 A;  4Y7C A;  3B8H A;  4R7M A;  4MCQ A;  1E62 A;  3B3T A;  1L0C A;  2Q43 A;  2B3U A;  3TTH A;  2RC6 A;  4M85 A;  1IIC A;  1IGB A;  4Z65 A;  2NPF A;  3IIB A;  4KOS A;  2CC2 A;  2REF A;  2D3N A;  3QNV A;  4DK1 A;  3LD2 A;  2H5M A;  3OEE A;  2PJ8 A;  1VHE A;  2EFG A;  4E0A A;  1YVK A;  2OZU A;  1QFZ A;  5AG4 A;  2R1I A;  1LAM A;  2O4H A;  5G22 A;  3R9G A;  2ZZF A;  5J1Q A;  5EMN A;  5ISV A;  2PIZ A;  4J0Q A;  1W34 A;  3RY8 A;  3R1K A;  3FNC A;  4AB7 A;  5IK2 A;  3VAR A;  3IJ3 A;  3CPA A;  1JNY A;  2QIR A;  4MFK A;  1Q82 D;  4NNJ A;  2VBV A;  4TNU A;  2GLF A;  2B4B A;  2FL4 A;  1I7P A;  1ZUN B;  4E8O A;  5GV7 A;  3FIX A;  5C82 A;  5DS0 A;  4UAJ A;  3ONY A;  1OGJ A;  4C2Y A;  1N0U A;  4ZGY B;  4G6I A;  1ELM P;  3AVX A;  5TV2 A;  4P3I A;  2VXK A;  1KD1 D;  2Z3O A;  4OC5 A;  3CCR B;  4RLZ A;  1TXR A;  2J8N A;  3CXQ A;  3W6S A;  1CNF A;  2ZIT A;  2P6G A;  1ZO0 A;  4NSQ A;  4F6A A;  3WC5 A;  1QSM A;  5F48 A;  4DJL A;  2JJ2 A;  4MCP A;  4RS2 A;  8CPA A;  2VNH A;  2XGJ A;  4ROX A;  3FBU A;  3R9E A;  3R9F A;  4UZE A;  1YRE A;  1QVF B;  2PJ9 A;  2AFU A;  2JBJ A;  4A31 A;  2FE7 A;  3ZZT A;  4KOY A;  2KCW A;  2EVN A;  1QUE A;  2I3C A;  2AFM A;  1KUX A;  3DSB A;  2ZW5 A;  3A8I A;  2O53 A;  4ZCI A;  4Z4V A;  3CCE B;  3WND A;  1OB5 A;  4NGS A;  1QVG B;  5IX3 A;  4RD6 A;  3ZJ0 A;  2C4U A;  4CYN A;  3HUV A;  2PC1 A;  1VHS A;  4ZCM A;  3N5F A;  3S6F A;  3CXP A;  3NH8 A;  4CRY B;  5H5J A;  1TKH A;  2PDO A;  1EFT A;  1FRQ A;  4OPS A;  4KOT A;  2GJP A;  3KGQ A;  1TLL A;  3PB9 X;  1UWY A;  1NB0 A;  1AMP A;  4GM5 A;  2CF4 A;  4B43 A;  3PUN A;  4C68 A;  3ASP A;  4NGP A;  3CC4 B;  2BM0 A;  3TE4 A;  4QUZ A;  4UFX A;  3OKX A;  4P6Y A;  2WUU A;  1GAW A;  3VNV A;  4JXR A;  1VQ6 B;  3ZIA A;  5BSY A;  3JQP A;  3SXN A;  1DG1 G;  2YWH A;  3E0K A;  2BPO A;  4OOX A;  3VR6 A;  5K8P A;  4J3G A;  2BGI A;  3SI1 A;  4A38 A;  1CX8 A;  2VJJ A;  3PUM A;  1WOR A;  1QFJ A;  2PLF A;  1DE4 C;  1WSR A;  4C43 A;  3B2Y A;  2ZEO A;  1VQ4 B;  3QFC A;  3NE7 A;  2QTL A;  3KQZ A;  4XNF A;  2AHO A;  1VGY A;  3OPO A;  4CAX A;  1PJ5 A;  4A94 A;  2JJ1 A;  4XD7 A;  1T6Z A;  2PRQ A;  1KTV A;  1P4M A;  3PFE A;  2QMU A;  4DK0 A;  5AG6 A;  2VZL A;  3WXM A;  3MHP A;  2PJB A;  4DNC A;  3BXM A;  1UD2 A;  1XF8 A;  3LQE A;  4MHY A;  2QN6 A;  4KS9 A;  5IB0 A;  4C7H A;  4PGO A;  5G1Z A;  4A2Z A;  4B47 A;  3SJX A;  4F7D A;  4C2X A;  5C88 A;  1V0C A;  1CP6 A;  2PCU A;  1DDI A;  4MFZ A;  1M90 D;  3E20 A;  2CW5 A;  2WJY A;  1S5K A;  2AJ6 A;  4CS0 B;  2WYR A;  4G5G A;  4Q7A A;  2NV4 A;  3PFO A;  1Z4E A;  3T53 B;  3PBB A;  1Z8T A;  3W2E A;  3SJP A;  1BO4 A;  1WP6 A;  1TKF A;  3SEJ A;  3H5Z A;  2B5G B;  1XMB A;  4UIA A;  2RC4 A;  4CPA A;  2VQY A;  4K30 A;  4PSX A;  1B23 P;  1I8D A;  2ZEG A;  3CTA A;  1JWQ A;  2VNK A;  2BSW A;  4UWI A;  2BSA A;  5AGE A;  1BLL E;  1F20 A;  2X6W A;  3WYA A;  2JDC A;  1ZM2 A;  4PXD A;  2M5S A;  5L46 A;  4FWT A;  3VAT A;  2WR8 A;  4P1V A;  1OHH A;  1M1K D;  2XOK A;  4XKV A;  4P25 A;  4HKF A;  4P45 A;  5K8O A;  1W0J A;  5KNL A;  2QGG A;  2Q44 A;  2GK7 A;  2X6X A;  2AFW A;  2VZY A;  3P26 A;  4X7D A;  3TO6 A;  2PSW A;  1BQE A;  2ZZG A;  2X0K A;  1F2P A;  4IUS A;  4P4J A;  3FH4 A;  3WAB A;  1YI2 B;  1RO5 A;  3JQR A;  2ABZ A;  2DPT A;  1VQ9 B;  1V5V A;  3A8K A;  4DQL A;  1VQO B;  3KHZ A;  1UD4 A;  5F4O A;  4LBY A;  4FWU A;  1H8E A;  4RCZ A;  1GHE A;  3CES A;  4U9Z A;  2YNC C;  1Q2D A;  3CXC B;  2DER A;  4KZT A;  1K9M D;  3FVL A;  2XZP A;  2WJV A;  3CDX A;  3ZZ0 A;  1H85 A;  1VQL B;  4OC2 A;  4AG7 A;  2OBR A;  4UFV A;  3CP8 A;  4KKS A;  3TFY A;  2Z10 A;  2V7X A;  5A8A A;  1QGZ A;  2VNJ A;  2GJK A;  3PEI A;  5LYD A;  4EFD A;  4QVT A;  2IL4 A;  3OOC A;  3D7F A;  1JA0 A;  4UCP A;  4B14 A;  1FNO A;  3FED A;  3J81 k;  4KOV A;  2GFQ A;  3RAM A;  2BV3 A;  1R5N A;  4CAW A;  3OZW A;  3KR4 A;  5JBQ A;  5E6T A;  2F43 A;  5J8C A;  1GJR A;  4H9G A;  4RDL A;  1EFC A;  1CJW A;  3W91 A;  4ZI6 A;  2ZW6 A;  4GQN A;  4DNR B;  3SXO A;  3PGP A;  3H9N A;  1RQR A;  3AST A;  3QB8 A;  1QH0 A;  1A2Z A;  1KZL A;  2B5G A;  5HVG A;  4AVZ A;  4QHY A;  1IHM A;  4YU9 A;  2RB7 A;  5HMN A;  1UD8 A;  1I18 A;  2OB0 A;  2CRV A;  4LC0 A;  1WOS A;  4R3K A;  2ZXH A;  1YME A;  2GQF A;  2B4D A;  1S7N A;  1M4D A;  4RD3 A;  5IV0 A;  4AF7 A;  4TMZ A;  2XEG A;  4AF6 A;  1VLO A;  5A88 A;  1N0V C;  3D66 A;  4TSF A;  2ANP A;  3R96 A;  2VJI A;  2YWG A;  3IWW A;  4NEX A;  4RPB A;  2R7H A;  3QFR A;  2WZP P;  1ZLI A;  2YNE A;  3RZA A;  4CGM A;  4N3G A;  2CIJ A;  2G3T A;  4FXU A;  3LAC A;  2I00 A;  3PB6 X;  2X85 A;  3U6K A;  4KLW A;  1FDR A;  3C26 A;  3CCS B;  4XPL A;  1SQH A;  3R95 A;  4BMH A;  3DDD A;  5AG7 A;  1WSV A;  3MMP A;  4XN3 A;  2FCK A;  4NJQ A;  3TT2 A;  1S7L A;  3LWU A;  4WZE A;  3IO1 A;  2ZOG A;  1DDG A;  5KTA A;  3ZC3 A;  4Y9R A;  3T8W A;  2FT0 A;  2HB6 A;  3T9Y A;  1FNB A;  4OIW A;  2CND A;  3BC9 A;  3U6B A;  3BY1 A;  4OC1 A;  4NF1 A;  5FL7 A;  4XLC A;  2VL1 A;  2GPJ A;  2Q04 A;  1Z8W A;  3A3G A;  3EC4 A;  1M4G A;  2QML A;  1COW A;  2OK7 A;  2EWB A;  2D3L A;  1UFH A;  1IY7 A;  4MYU A;  2ODF A;  2YNC A;  3DDY A;  2QE7 A;  3KL9 A;  3AVV A;  4P4I A;  4OC4 A;  4MHP A;  1UD6 A;  1W0K A;  3LNN A;  2PVW A;  3D4U A;  3PA1 A;  2I79 A;  4R3L A;  3TO7 A;  3MGD A;  1Q9S A;  1ELO A;  1YSJ A;  1EFR A;  2XEX A;  2CNS A;  1H8H A;  2F4N A;  4JLY A;  3AVY A;  4CRZ B;  1S4M A;  3SHP A;  1G7C A;  2YWF A;  1MK4 A;  3D7G A;  2HV2 A;  3WBK A;  1JA1 A;  2IMO A;  4K3N A;  5IYP A;  4X2T A;  3PB8 X;  4PQA A;  4MYT A;  4TN1 A;  4B12 A;  4MFJ A;  3KI9 A;  1F2O A;  1M1D A;  2Z3N A;  2BVN A;  1F57 A;  2PQ8 A;  4KVX A;  3FXT A;  1SKY B;  3T90 A;  3W2I A;  2Y0M A;  2GU2 A;  1FRN A;  2V4D A;  4GXH A;  2BMW A;  1OGI A;  2BOA A;  1G7T A;  1VLY A;  3DLJ A;  4RJL A;  4G7X A;  2ZW7 A;  3LO8 A;  3H8F A;  5LYI A;  3BHX A;  4X7F A;  1YLE A;  3B3W A;  2HLD A;  3VMF A;  1W2B B;  2CNM A;  1YX0 A;  1SKQ A;  3VWD A;  4MFP A;  1LOK A;  4P4B A;  4CGP A;  3V7Z A;  2AFO A;  2V7T A;  1P0H A;  1B6B A;  2V8V A;  1FT7 A;  2WPX A;  4XLH A;  3ZZI A;  5JM6 A;  5HH1 A;  2Q51 A;  1VQN B;  4XPD B;  2C6G A;  5DN6 A;  3TC8 A;  1FY7 A;  2BCO A;  5HXB A;  1T6X A;  3HLP A;  1MJA A;  2OZH A;  1YGH A;  2C6P A;  3Q39 A;  4XPK A;  1ZLH A;  4UZF A;  4KUA A;  2ZED A;  1BX1 A;  4UBR A;  2F1M A;  4F8Z A;  2EO8 A;  3DR6 A;  2QEC A;  4OOV A;  1AUG A;  3PA2 A;  4YXW A;  2IQ6 A;  3TOA A;  2CY2 A;  5KTD A;  2EK9 A;  1U6M A;  1S0U A;  3AGQ A;  3WC7 A;  3DNS A;  5F49 A;  5CDF A;  1ZG8 A;  2OR4 A;  2GJR A;  4II9 A;  1QG0 A;  1IOF A;  1AYE A;  2VZZ A;  1KRH A;  2JDD A;  4XQF A;  1A8P A;  4XOR A;  3W5H A;  2ZEF A;  5FNZ A;  3ISZ A;  4IW3 B;  1QX4 A;  3S9M A;  3VWE A;  2E1B A;  1GAQ A;  1N08 A;  2DIE A;  1S72 B;  1PJ7 A;  4UIB A;  4X05 A;  4PAB A;  3OJX A;  3SKB A;  3H8E A;  3CC2 B;  1IU8 A;  3W5V A;  2OTL B;  1T5E A;  4KOW A;  4X7C A;  4C0S A;  7CPA A;  3PRT A;  1VQK B;  2YGW A;  1MAB A;  3BI1 A;  4X8I A;  4CQJ A;  1QMU A;  1FX0 A;  3RO0 A;  2J8M A;  2ZL6 A;  2C6C A;  1CM0 A;  1E64 A;  2XEI A;  2D4O A;  4X5K A;  5A28 A;  4YAO A;  1ZG7 A;  3CZX A;  4ORF A;  1RQP A;  4AXV A;  2R8V A;  3EFA A;  3R6K A;  3IC1 A;  3P2F A;  1R3N A;  4X06 A;  3ZBT A;  2QJ8 A;  1YR0 A;  3V38 A;  1KK1 A;  2Z3P A;  4KSA A;  4M53 A;  5TRD A;  2PJ0 A;  3IWG A;  1N07 A;  2Q4Y A;  3H8G A;  4P12 A;  1VQ8 B;  2IJZ A;  2ZZE A;  3WQZ A;  4OAE A;  4OLL A;  3VO1 A;  1S7F A;  2ZEH A;  4BD9 A;  3Q38 A;  1ZM4 A;  2A4N A;  3GVK A;  2GIV A;  5J3O A;  3FMC A;  4C2Z A;  1NJI D;  1XBU A;  2C27 A;  3OJW A;  3B82 A;  2GE3 A;  4O23 A;  4TMX A;  4KKT A;  3WC6 A;  1LRZ A;  5AN9 A;  4B10 A;  2X53 S;  4B3F X;  4ZV4 A;  1NRK A;  5CPA A;  4P22 A;  3ZBU A;  3CB4 A;  1D8T A;  2PJA A;  3ISX A;  1YVO A;  2HUZ A;  1BPM A;  5DSZ A;  1E43 A;  1XIX A;  4WQM A;  3LVB A;  4P4F A;  2C5B A;  2XZL A;  1OB0 A;  3GVL A;  2JDI A;  1XB2 A;  1W35 A;  4L8J A;  5FIU A;  5AG5 A;  4RDJ A;  4TWE A;  1R57 A;  4KOR A;  4YGO A;  1ZG9 A;  2AFS A;  1Z8X A;  3RNZ A;  1YJW B;  1MJB A;  4YWY A;  1XJO A;  2D4P A;  1I12 A;  4WZK A;  1BPL A;  2C78 A;  1KUV A;  1VQ7 B;  2OTJ B;  2KVO A;  2PJ1 A;  4B44 A;  2HMA A;  1CP7 A;  4MY3 A;  4OP4 A;  3CME B;  4ONW A;  3GQB A;  4HPS A;  1PYT B;  3VNU A;  2EBJ A;  1TUI A;  2Z3L A;  4NBS A;  2Q0Y A;  4KUB A;  4G7W A;  1TF9 A;  2OZG A;  1IID A;  3S6K A;  4WZT A;  1ARM A;  4Y49 C;  3OE7 A;  1OBR A;  2OBT A;  1CQX A;  4PAA A;  5GCN A;  4TKO B;  2ZEE A;  4UEZ A;  4YRH A;  3PZJ A;  4E0F A;  1EXM A;  2VBU A;  1Z2L A;  4P6V F;  1UD3 A;  3SI2 A;  4W9Y A;  4Z4W A;  3CCM B;  3Q6Q A;  3G71 B;  3TX8 A;  1PUA A;  4FK8 A;  4RD2 A;  2D74 A;  4MFL A;  2JBK A;  4YHB A;  2C77 A;  1PU9 A;  4UWJ A;  2PE3 A;  5KW9 A;  1TKJ A;  1X10 A;  2Q7S A;  5I0C A;  4LUA A;  4FN5 A;  4PPZ A;  3U2Q A;  4II3 A;  2G9D A;  3NH4 A;  3GY9 A;  4FD7 A;  2C2W A;  1M4I A;  5BSX A;  2QVP A;  1DTD A;  2G0B A; 
#chains in the Genus database with same CATH homology
 3PB7 X;  4OID A;  3D66 A;  1VHO A;  5LYL A;  2ANP A;  3IWW A;  1IGB A;  5JGF A;  1VIX A;  4Z65 A;  3IIB A;  1ZLI A;  4MRI A;  4ZY0 A;  1YW6 A;  3RZA A;  2CIJ A;  3NA6 A;  4NGQ A;  3PB6 X;  3QNV A;  2XEJ A;  2PJ8 A;  1VHE A;  3K2K A;  3KZW A;  3D67 A;  1RTQ A;  3B7I A;  4NJQ A;  3D68 A;  1LAM A;  2O4H A;  3LWU A;  3IO1 A;  2ZOG A;  5J1Q A;  2PIZ A;  4MHN A;  2CTC A;  3VAR A;  3IJ3 A;  3CPA A;  3T8W A;  4DYO A;  2HB6 A;  4OIW A;  2QYV A;  3IEH A;  2EK8 A;  1CBX A;  5CBM A;  4TNU A;  4OC1 A;  1ARL A;  2GLF A;  2V8H A;  5LYF A;  5LRG A;  5DS0 A;  3MRU A;  2PJC A;  2VL1 A;  4LQG A;  4ZY2 A;  3IFE A;  2GRE A;  1ELM P;  3FX6 A;  1BPN A;  4OC5 A;  2EWB A;  1IY7 A;  5IB9 A;  1TXR A;  4UEF A;  1Z5R A;  3KL9 A;  3WC5 A;  4P4I A;  4OC4 A;  3I1U A;  4MHP A;  2PVW A;  2WZN A;  3D4U A;  4DJL A;  1Y0Y A;  4MCP A;  8CPA A;  1YSJ A;  2PJ6 A;  2PJ9 A;  4ZX8 A;  2AFU A;  4ZYQ A;  2JBJ A;  1HEE A;  1PCA A;  1YW4 A;  3D7G A;  2IMO A;  5F09 A;  4K3N A;  4X2T A;  3PB8 X;  2JEW A;  2I3C A;  2AFM A;  4PQA A;  5D29 A;  3SJF A;  3D7H A;  2O53 A;  3KI9 A;  1F2O A;  4IAV A;  4P44 A;  1Z8L A;  3JRU A;  4WJB A;  4NGS A;  1F57 A;  1LCP A;  2NSM A;  2HC9 A;  4ZX9 A;  3PB4 X;  3CPX A;  2GU2 A;  3HUV A;  4F9U A;  3N5F A;  3FEE A;  3SJG A;  4A39 A;  2C1C A;  2BOA A;  3NH8 A;  3DLJ A;  5I4M A;  1TKH A;  3H8F A;  3KGQ A;  4MMO A;  3BHX A;  1CG2 A;  5LYI A;  3B3W A;  3KR5 A;  3PB9 X;  1UWY A;  4MHZ A;  1AMP A;  4GM5 A;  4R8F A;  2CF4 A;  1LOK A;  1NSA A;  4P4B A;  3V7Z A;  2AFO A;  4NGP A;  4OC3 A;  2V8V A;  1FT7 A;  3B35 A;  2PVV A;  4P6Y A;  5JM6 A;  2Q51 A;  1XRY A;  2C6G A;  4R76 A;  3TC8 A;  4KSI A;  3GUX A;  1LAP A;  3L2N A;  2BCO A;  3HLP A;  2C6P A;  3RBU A;  5K8P A;  2J9A A;  3GB0 A;  3NFZ A;  3SI1 A;  4A38 A;  1CX8 A;  1ZLH A;  2CTB A;  2ZED A;  2ZEL A;  1DE4 C;  3B2Y A;  2ZEO A;  4F8Z A;  5JH9 A;  3KQZ A;  3FJU A;  2PJ2 A;  3KHX A;  2AFX A;  2AFZ A;  1VGY A;  3MN8 A;  4A94 A;  2PRQ A;  2IQ6 A;  3BI0 A;  3PFE A;  1JQG A;  2PJB A;  2EK9 A;  2ZOF A;  2PJ4 A;  3BXM A;  4WWV A;  2NYQ A;  3WC7 A;  2F8H A;  2PJ3 A;  4MHY A;  1ZG8 A;  1GYT A;  2OR4 A;  1LAN A;  4A37 A;  1AYE A;  3SJX A;  2ZEF A;  1CPS A;  3ISZ A;  3S9M A;  2ZEN A;  1ELL P;  1R43 A;  1CP6 A;  2PCU A;  4R6T A;  4UIB A;  2ZEP A;  2RFH A;  4FUU A;  4MXU A;  3VH9 A;  3H8E A;  4JZ0 A;  2DEA A;  3B3S A;  3NH5 A;  3LMS A;  2WYR A;  4Q7A A;  2OOT A;  3PFO A;  3PBB A;  7CPA A;  3PRT A;  1TKF A;  4ZY1 A;  3DGV A;  3BI1 A;  4X8I A;  1QMU A;  1EE3 P;  1XMB A;  4PXE A;  4UIA A;  4NGN A;  4CPA A;  2V8D A;  2ZEG A;  2GLJ A;  2C6C A;  4P10 A;  1BLL E;  2XEI A;  4NJR A;  1YLO A;  1ZG7 A;  4OC0 A;  4AXV A;  4PXD A;  4NFR A;  3SJE A;  3IC1 A;  3VAT A;  1R3N A;  3PBE A;  1CPX A;  4G1P A;  2QJ8 A;  5K8M A;  4P45 A;  4P4E A;  3V38 A;  1Q7L A;  4X3R A;  5K8O A;  1XFO A;  2XEF A;  2PJ0 A;  2Q4Z A;  4NGR A;  2AFW A;  5ELY A;  3H8G A;  2IJZ A;  2ZEH A;  4BD9 A;  1F2P A;  3B3V A;  3CT9 A;  3B3C A;  3FMC A;  4PXB A;  1XBU A;  4P4J A;  3FH4 A;  2PJ7 A;  3WAB A;  2BO9 A;  4O23 A;  1H8L A;  3D7D A;  3WC6 A;  3WT4 A;  2ABZ A;  3S9L A;  3KHZ A;  4DUK A;  2FVG A;  5CPA A;  5HVF A;  1HDQ A;  4FWU A;  4OKO A;  4PXC A;  2PJA A;  3ISX A;  1BPM A;  1TF8 A;  5THW A;  3S9N A;  3FVL A;  4EME A;  4P4F A;  4IHM A;  3CDX A;  4OME A;  4NGM A;  4OC2 A;  4EWT A;  4TWE A;  4NGT A;  1ZG9 A;  5K8N A;  2AFS A;  3SI0 A;  4YWY A;  2F7V A;  1XJO A;  1HDU A;  3GLJ A;  4RUH A;  3K9T A;  3PEI A;  5LYD A;  4EFD A;  1KWM A;  1BAV A;  1M4L A;  3D7F A;  4B6Z A;  2PJ1 A;  1CP7 A;  1FNO A;  3FED A;  5D8N A;  1Y7E A;  4H2K A;  4OP4 A;  4MCR A;  2V77 A;  4ONW A;  3RAM A;  3FF3 A;  6CPA A;  4UF4 A;  1PYT B;  3KR4 A;  3KQX A;  3FEC A;  1TF9 A;  1ARM A;  4JYW A;  4FBE A;  2ZEM A;  1OBR A;  3KAS A;  2ZEE A;  4UEZ A;  4MCS A;  4ZI6 A;  5HVH A;  5HXD A;  4P4D A;  1Z2L A;  3SI2 A;  5HVG A;  4W9Y A;  4FAI A;  2V8G A;  3TX8 A;  5LRJ A;  2JBK A;  4IK2 A;  2RB7 A;  4YU9 A;  1LFW A;  2PE3 A;  1Y0R A;  1TKJ A;  1YME A;  2POK A;  2PIY A;  1QQ9 A;  4PPZ A;  4F9V A;  2G9D A;  3NH4 A;  4R7M A;  5LRK A;  4MCQ A;  2PJ5 A;  3B3T A;  2Q43 A;  2XEG A;  2QVP A;  4UEE A;  1DTD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...