2PE3A

Crystal structure of frv operon protein frvx (ph1821)from pyrococcus horikoshii ot3
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
344
structure length
330
Chain Sequence
DWKLMQEIIEAPGVSGYEHLGIRDIVVDVLKEVADEVKVDKLGNVIAHFKGSSPRIMVAAHMDKIGVMVNHIDKDGYLHIVPIGGVLPETLVAQRIRFFTEKGERYGVVGVLPDWDQIVVDVGASSKEEAEEMGFRVGTVGEFAPNFTRLNEHRFATPYLDDRICLYAMIEAARQLGDHEADIYIVGSVQEEVGLRGARVASYAINPEVGIAMDVTFAKQPHDKGKIVPELGKGPVMDVGPNINPKLRAFADEVAKKYEIPLQVEPSPRPTGTDANVMQINREGVATAVLSIPIRYMHSQVELADARDVDNTIKLAKALLEELKPMDFTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of frv operon protein frvx (ph1821)from pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
molecule keywords 354aa long hypothetical operon protein Frv
total genus 97
structure length 330
sequence length 344
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05343 Peptidase_M42 M42 glutamyl aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.40 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Peptidase M42, domain 2 2pe3A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2pe3A01
1CG2A 4OC1A 2PJ5A 2PJ9A 1HDUA 4UIBA 1YW6A 3D7HA 1F2PA 1BPMA 1LAPA 3KQXA 4MHPA 5CPAA 1CPXA 2JBJA 3KHXA 2FVGA 2PVVA 2EWBA 2PCUA 4NFRA 3B2YA 3IFEA 3ISXA 5THWA 3SJEA 2F8HA 5LRKA 4IAVA 2GREA 3HLPA 4R8FA 2CF4A 3NFZA 4FUUA 2PVWA 1QMUA 2BO9A 2XEFA 4P4FA 4PXEA 4K3NA 1Z5RA 4FBEA 3FVLA 3FF3A 3I1UA 2ZEFA 2QVPA 2NSMA 3TC8A 1H8LA 1ZG8A 1CX8A 2IJZA 4JZ0A 1Z2LA 1TF8A 3NH8A 4P4BA 3CPXA 1EE3P 5J1QA 4OIWA 4MHZA 4NJQA 4O23A 4PQAA 1XJOA 4DUKA 1IY7A 3T8WA 2V8DA 2J9AA 3FX6A 3KASA 1Z8LA 2AFUA 2WZNA 2PJBA 4OIDA 3PBBA 1CPSA 3KL9A 2ZELA 3MN8A 3IWWA 3NH5A 4WJBA 4EFDA 4OP4A 3KZWA 1CP7A 4PXBA 3FJUA 2PJ7A 5K8MA 4H2KA 3VATA 3S9NA 2JEWA 2IQ6A 4NGMA 2OOTA 2PJ8A 2ZEPA 2HC9A 3B3WA 3PB8X 3IJ3A 5K8OA 2ZEDA 1Y7EA 1XBUA 2ABZA 3D68A 4PXCA 2POKA 1BAVA 1NSAA 1LANA 4ONWA 4P6YA 5I4MA 3D7FA 3ISZA 2ZEOA 4YWYA 2PJ6A 4OC2A 3TX8A 3CPAA 1LCPA 4DYOA 1PCAA 2C6GA 4R6TA 3GUXA 5LYIA 1R43A 1R3NA 1TF9A 1TKFA 3SI2A 4BD9A 4MCRA 3IO1A 2PJAA 3PB6X 1ZLHA 1IGBA 8CPAA 2EK9A 3GLJA 3B3CA 2V8GA 3WC7A 4P10A 5D8NA 2OR4A 2PJCA 3BI0A 3PB7X 1HEEA 1ZG9A 4G1PA 2V8VA 4TWEA 1PYTB 5LRGA 1LFWA 2AFXA 2EK8A 2XEIA 4R7MA 4F9UA 3KGQA 5HXDA 4Z65A 3SI0A 2ZOFA 4ZX9A 3D67A 3V38A 4NGTA 4X3RA 4P44A 4NGSA 3PFEA 2RB7A 3HUVA 5IB9A 4UEFA 4UIAA 1BLLE 2VL1A 5HVHA 2AFMA 1LAMA 4NGNA 4A39A 4WWVA 1Q7LA 3FEDA 4NGQA 4GM5A 1AMPA 2C1CA 4P4DA 3H8EA 3D7DA 4B6ZA 4JYWA 4P45A 3SJGA 4W9YA 2QYVA 3RBUA 3B3TA 4F9VA 3D7GA 1ZLIA 1YW4A 3WABA 4MMOA 2DEAA 3CT9A 3MRUA 3NA6A 5LYFA 1VGYA 2PRQA 3KI9A 1DTDA 3BXMA 1DE4C 2O4HA 4MXUA 3PRTA 3B7IA 5F09A 1FT7A 3B3SA 1VHEA 2ZEHA 4EWTA 4ZY0A 4ZY1A 3IC1A 2AFOA 4ZY2A 2PJ0A 2XEGA 2PJ3A 1QQ9A 3H8FA 4FAIA 3DLJA 4IHMA 3N5FA 3QNVA 3LWUA 3BI1A 4OC4A 2ZEMA 1XFOA 3PB9X 4RUHA 2Q51A 3S9MA 4R76A 3B3VA 2CTCA 5K8PA 4Q7AA 1TXRA 3WT4A 4MHNA 5K8NA 2ZEGA 3GB0A 1UWYA 3PBEA 4OMEA 5DS0A 1F2OA 2NYQA 3NH4A 2CTBA 2PIYA 2V77A 4A38A 3RZAA 3VARA 2GLFA 2PJ2A 4AXVA 3S9LA 1GYTA 5LYDA 3V7ZA 4MHYA 4NJRA 2IMOA 2CIJA 2QJ8A 2G9DA 1M4LA 3D4UA 4OC0A 3KQZA 3JRUA 4FWUA 5JGFA 2ZEEA 2C6CA 2WYRA 2O53A 2PE3A 1ELMP 4OKOA 4OC5A 4KSIA 2XEJA 2AFZA 2BCOA 1OBRA 7CPAA 2ANPA 4CPAA 1TKHA 4UEZA 3L2NA 2ZENA 1Y0YA 3FMCA 4P4EA 3PFOA 1ZG7A 1JQGA 4MCPA 1ELLP 3KR5A 3IEHA 4YU9A 1XMBA 5D29A 3CDXA 2BOAA 1BPNA 3SJFA 2Q43A 2Q4ZA 2HB6A 4IK2A 2JBKA 4LQGA 4A37A 4X2TA 1LOKA 2GLJA 3BHXA 5HVGA 4NGPA 2PJ1A 1CP6A 3WC6A 1AYEA 3D66A 4MCQA 5ELYA 1VHOA 3FH4A 3WC5A 4ZX8A 5LRJA 1ARLA 3LMSA 5HVFA 3SI1A 1F57A 3PB4X 4P4IA 4ZYQA 3KHZA 4TNUA 3B35A 2I3CA 5CBMA 3FEEA 3SJXA 1KWMA 3H8GA 4NGRA 1RTQA 6CPAA 1YMEA 2GU2A 2V8HA 1FNOA 1HDQA 1YLOA 3PEIA 2PJ4A 1CBXA 2F7VA 1ARMA 2RFHA 3DGVA 1Y0RA 2AFWA 4UEEA 4DJLA 5JH9A 3VH9A 4ZI6A 2C6PA 2ZOGA 4UF4A 1XRYA 4EMEA 1YSJA 1TKJA 4F8ZA 4OC3A 3KR4A 3K9TA 4X8IA 4MRIA 3RAMA 4PXDA 2AFSA 4P4JA 4A94A 4MCSA 3FECA 4PPZA 2PIZA 5JM6A 3K2KA 5LYLA 3IIBA 1VIXA
chains in the Genus database with same CATH superfamily
2QTLA 1CG2A 2PIAA 1KK3A 2AJ6A 3ZPNA 1ZUNB 1WORA 3VO2A 2R1IA 1I8DA 2D4PA 2ZW5A 2RC6A 1V0FA 4B10A 2PJ9A 1HDUA 2JDCA 1YW6A 4KLVA 1V0EA 1XF8A 4OAEA 2FVGA 4B5PB 2V4DA 2PVVA 4C2ZA 2VI7A 1CM0A 4J3GA 3B2YA 3IFEA 1W87A 4CGPA 3ISXA 3LACA 1YGHA 5DN6A 2F8HA 2Z3LA 1IIDA 4IAVA 3HLPA 5JBQA 4RS2A 2YWGA 5FO0A 2PVWA 2C77A 4PXEA 1SQHA 4K3NA 1Z5RA 4CAEA 4ZGYB 1T5EA 5F4JA 5EBVA 2ZEFA 2NSMA 3R95A 2HV2A 1PJ7A 2AHOA 1WOOA 4MFQA 1OB2A 4AG7A 1KJZA 4QVAA 4NSQA 3R6JA 2P6GA 4UCPA 4AVAA 3EC4A 1IY7A 2V8DA 2WPDA 2PJBA 4PC1A 3MCAA 2VEZA 4ZCMA 5FIUA 3IWWA 3PGPA 1NBMA 3EO4A 4OP4A 1CP7A 4PXBA 3FJUA 1PKVA 2PJ7A 1Q7YD 4X7CA 4QVTA 2E1RA 3TFYA 2XZOA 2FIAA 5AG6A 3WBKA 2VZZA 4K30A 2IQ6A 1KMHA 4NGMA 4MI4A 3CPWB 4E0FA 3A8IA 3KEWA 1Y7EA 1XBUA 2ABZA 4PXCA 4RPDA 4KOVA 1NMTA 3EXNA 3OW7A 1BAVA 1NSAA 1U6MA 2AE6A 3DR6A 2ZEOA 3MHPA 2PJ6A 4CRYB 4L89A 1WPCA 2VNHA 2B58A 3R9GA 2FS5A 2ZXVA 4DYOA 1QUEA 1QH0A 4RLZA 2CW5A 5KTAA 1IJFA 2OZHA 3OAAA 3JQRA 1R3NA 5BWAB 3CC2B 2F1MA 1TF9A 1ZM4A 4ASUA 2NMTA 4E2AA 4TMWA 5GV8A 4YGOA 3I55B 4BD9A 3LD2A 2QMLA 3PB6X 1IGBA 8CPAA 4AF6A 2BF4A 4B13A 1N06A 2OR4A 3LODA 4G1VA 1ON0A 1RQPA 4YAWA 3SEJA 5KTDA 4TT3A 4TWEA 1NB9A 3G05A 4MBUA 2JJ1A 4KOXA 4M6HA 2ZBUA 4NCNA 1CJWA 5HMNA 1QVFB 4XLCA 4XN3A 3CD6B 2XNCA 3SXOA 1BX1A 4NGTA 3ZZIA 4LQ6A 4HNWB 3ES9A 2CK3A 5HZBA 2B7CA 3D26A 4A2ZA 2VL1A 2AFMA 2Z10A 1VQLB 1YLEA 2X3UA 3A1PA 2OBSA 2FT0A 3WYAA 1K9MD 1SKYB 4UFWA 1KUVA 1IYKA 2DEUA 4P45A 4ZGQB 4II2A 4W9YA 2LZJA 3B3TA 2FIWA 2R6HA 4F9VA 3D7GA 3R96A 3WABA 1E3ZA 2C4UA 2ZZEA 4F7DA 4MMOA 4UBRA 2D3LA 4RD1A 4U9ZA 3NA6A 1VGYA 4P3IA 1DTDA 3BXMA 5DSZA 3E20A 4X07A 1BLIA 4JWPA 4XMYA 1V0CA 1XIXA 3DSBA 4HE5A 5G22A 4OP7A 2C5HA 1A8PA 3A8KA 4XONA 2XEGA 1M4DA 3H8FA 3DLJA 3N5FA 4XD7A 3W6SA 4C2XA 3LWUA 1BPLA 1MJBA 3SJPA 1OB5A 2ZEMA 1P4MA 2Q51A 4UZEA 1UMKA 2XZLA 3B3VA 4RD0A 4P1VA 2QEXB 4Y49B 2W6JA 2X6WA 4TMZA 1UD2A 2JEVA 4Q7AA 4PC6A 4Z4SA 2VBUA 1FNMA 4UCMA 1XE4A 4CGMA 2CNSA 4OADA 1UWYA 2OK7A 3PBEA 3ZUGA 4AF7A 3RO0A 3DDDA 2NPFA 4L8AA 5AG5A 3NH4A 3OW2B 4UZFA 4U9YA 1R57A 2CTBA 2GLFA 2GK7A 3BQJA 5HKKA 1JWQA 5LYDA 3AVTA 3QAHA 4OOXA 2VBSA 4X7FA 3AVXA 2G9DA 4BPRA 4UWJA 4U5YA 4QC6A 4FWUA 3OJXA 4A33A 4B44A 2ZEEA 3FPPA 4F0YA 2Z3PA 4XPKA 5KW9A 3TTHA 2GE3A 4TN1A 1UFHA 2XEJA 1E3XA 4PABA 3RNZA 2VBQA 5G21A 1FNBA 1VQOB 2DCUA 4Z4TA 2Q6IA 3B82A 4BBHA 2C4TA 5DWMA 5JQ4A 2H5MA 4UZUA 4P25A 1JQGA 2EIXA 4XLEA 2OK8A 4XOPA 4MFKA 1QGYA 3GSIA 4FN5A 4NF1A 5D29A 1YX2A 3T90A 2X0KA 1ZM3A 4H89A 3ZIAA 4B48A 3VO1A 3W2GA 4HIZA 4IK2A 1Q2CA 2JBKA 3F8KA 4HNXB 3PP9A 2PRBA 3ZZUA 1K28D 1BQEA 1FNCA 4XN0A 2Q6OA 5ELYA 2J8MA 4ONUA 4ZX8A 2F4NA 1VQPB 5LRJA 1ARLA 5C82A 3AVVA 3IWGA 2BMWA 1MK4A 1F57A 5KNLA 3ASRA 3CCMB 3GVLA 2P6EA 3B35A 4II3A 2I3CA 3P26A 5CBMA 4RCYA 1YX0A 3H8GA 4FD6A 4XL9A 3B78A 5EMNA 6CPAA 3BCFA 2V7TA 3OZUA 1HDQA 2F5IA 2WPXA 4EH1A 3CC4B 1IB1E 3SKBA 4XNHC 1ARMA 2RFHA 3FPKA 2AFWA 2Q44A 4QUSA 2C6PA 1XRYA 3CCUB 4EMEA 4F8ZA 4CQJA 4JLYA 5TR9A 1OB0A 4A94A 3W2FA 3ONYA 2BSWA 4ZBGA 4PPZA 5FVJA 4RD4A 4BMHA 4YELA 1DG1G 2XGJA 5LYLA 3FB3A 4CAVA 1I21A 4XOTA 1VIXA 1UD3A 1RXTA 5FL7A 3BNWA 4J0QA 2B3VA 4UIBA 2OBTA 4MFJA 2X6YA 2FSRA 4P6VF 1DDIA 1F2PA 2JN9A 4YXWA 3KQXA 4PV6A 2ATRA 2YNCC 1COWA 2C5BA 3KHXA 3CCQB 1S7KA 1VQ7B 2DPSA 2PCUA 2VBVA 1SKQA 1P0HA 3TT2A 2JJ2A 2ARHA 3GIRA 4UFVA 2YWFA 2GJPA 1QFZA 3CMEB 1VQKB 1N0VC 1H8HA 5G20A 5LRKA 4XNFA 2GREA 4R8FA 1N08A 1PUAA 4LC0A 1TUIA 5CDFA 4Z1MA 1E79A 4FBEA 4E0AA 1CNFA 1HVXA 3FF3A 1R5OA 1Z4EA 2QVPA 4M0LA 3WXMA 1MJ9A 3TC8A 1T6ZA 2D3NA 1ELOA 2C78A 2ZTNA 4PK3A 1Q82D 3NH8A 2Q04A 3D8PA 3CPXA 2QA4B 3OEEA 4MHZA 4NJQA 4O23A 4DUKA 3P2FA 1Y9WA 3A8JA 3BJ7A 3FX6A 3KASA 3TO6A 1Z8LA 2AFUA 3Q39A 1CPSA 3KL9A 3OPOA 1S7FA 3OOCA 4GS4A 1B87A 4KZTA 4WJBA 4EFDA 4LBVA 2HCJB 2WZPP 1H85A 5J8CA 3LO8A 3S9NA 3OWCA 1I1DA 2CNTA 2OOTA 1R5BA 3OE7A 2BPOA 2ZEPA 3PB8X 1WK4A 1YITB 4RDKA 2ZEDA 3D68A 3QAYA 4RD2A 1GVHA 1M4GA 1YJWB 4YWYA 4RD6A 3W5UA 2OBRA 4OC2A 2XNJA 4XQFA 4B3GA 3TX8A 2QGGA 4FXUA 1BOBA 4XLFA 2GQFA 2QECA 3GVJA 4Y9UA 4FD7A 2FE7A 4YEJA 3EY5A 4XPDC 4C7HA 1J4JA 1G7SA 2WR8A 4KVME 3JVNA 3J81k 5IK2A 5CNPA 4WZTA 4YALA 2YNCA 4MCRA 2JDDA 3PA2A 2PJAA 3ASTA 2EUIA 2EK9A 1NB0A 3CTAA 1B2RA 1KUYA 1ZO0A 2V8GA 1JA0A 4ZCIA 1VLOA 4P10A 3SXNA 1OZPA 4M3SA 4C2YA 2EVNA 3RY8A 4KOTA 1PYTB 2Z6BD 2ZZFA 1Y9KA 1BO4A 2AFXA 4ROXA 4FWTA 3QSYA 1VQ5B 3KGQA 4KORA 1VJSA 4KSAA 4XPLA 4ZX9A 3CXPA 5DWNA 4YAFA 1S4MA 2OTLB 2Q4YA 4X3RA 4NGSA 2RB7A 1QVGB 2X6XA 5IB9A 2QN6A 3CMMA 3GY9A 4UIAA 1UD8A 1BLLE 4JJXA 4Z4WA 4AG9A 2DIEA 1Q7LA 2OZUA 1D8TA 1V5VA 1AMPA 1S72B 5I0CA 2GJKA 4JYWA 4X5KA 2OB0A 4A95A 2WUUA 2XOKA 3CP8A 4M6IA 1G7CA 1YHQB 1I7PA 1BMFA 2DPTA 4Y49C 3IU1A 1QSOA 3ASPA 3MRUA 3SJZA 1I12A 4LBYA 1IICA 2BL1A 3R1KA 5LYFA 5F48A 2PRQA 1YVOA 2O4HA 2DY1A 3PRTA 1FRNA 3B7IA 5GV7A 5F09A 1FT7A 1FY7A 1VHEA 3CP2A 4ZY0A 3D2MA 1GR1A 2B3UA 2I1LA 4KS9A 3BI1A 4OOSA 4FK8A 3BJ8A 4RUHA 4B43A 3SLNA 4CYOA 3LQ6A 2CTCA 3S6GA 2D74A 1GAQA 4M4SA 3ASQA 1TXRA 4MFPA 2VJIA 5IB0A 4QBJA 5K8NA 1IHMA 2ZEGA 2VNIA 2ZW6A 3BY1A 5H86A 4Y9RA 4JD6A 3PVDA 2WJYA 1VQNB 4UAJA 2PIYA 4A38A 3RZAA 1QFYA 3WNDA 3V8IA 4BINA 3AGPA 4Z4UA 5AN9A 4MHYA 1FDRA 3CCEB 1ZM2A 4Z4RA 4OC0A 1M4IA 5A27A 5JGFA 5J3OA 3QFRA 2C6CA 1TIQA 2V31A 4NEXA 2BUEA 2X7BA 1KTVA 1OBRA 5L46A 7CPAA 3H4QA 3V76A 3U6KA 1CQXA 4NCZA 2R9VA 4RJLA 2ZENA 4P4EA 5KSWB 1ZG7A 2VQYA 2B4BA 1ELLP 4YU9A 1GHEA 3BC9A 4KOUA 3CCLB 4XLAA 4P3YA 3VWEA 2ZITA 4A37A 2CC2A 1HZEA 4LX9A 3ZBTA 1CP6A 4H6UA 1AYEA 2ZW7A 1HA3A 4CYPA 3FH4A 3WC5A 2C27A 3JU4A 3VWDA 3WR7A 3LVBA 3SI1A 2QDXA 4P4IA 2ZW4A 1H42A 2D4OA 4ZYQA 3KHZA 4KUAA 1QG0A 4TNUA 1KK0A 1W9XA 5F49A 1W35A 1GAWA 4NGRA 3CCSB 1YMEA 2GU2A 3P27A 1YLOA 2B4DB 1IOIA 1CBXA 4TMVA 3CXSA 2DXQA 3DGVA 3NE5B 4JMQA 2XEXA 3FIXA 4I49A 1YSJA 4IF5A 1TKJA 1IOFA 4OC3A 2CY2A 2REEA 4X8IA 4YAUA 4P4JA 1WOPA 3G71B 1JA1A 3FECA 4MCSA 3K2KA 4DNTB 3W2EA 3TOAA 2FX3A 3T51B 2QTZA 2JLMA 4AVBA 2R98A 2PJ5A 4TSFA 4TMXA 4XLHA 4LBZA 5IYRA 4AC9A 3ZJ0A 4MHPA 1QX4A 1LAPA 4G7XA 4Z4VA 1K73D 5CPAA 2JBJA 3GYAA 4NFRA 2CXAA 2GFQA 1E62A 5ISVA 4LUAA 5THWA 3SJEA 1Y7RA 2I79A 2B5GB 1RO5A 2BV3A 4NBSA 4B14A 1KC8D 4P26A 2NV4A 3NFZA 3QB8A 3A35A 2ZZQA 1QMUA 4R3LA 3OZVA 2XEFA 4P4FA 4KKUA 3FVLA 3I1FA 1KQSB 1XOVA 4YFJA 1VQ6B 4CGLA 4CYQA 1Z8TA 4X0CA 2VZYA 1W2BB 1G7TA 1H8LA 1ZG8A 1CX8A 3CCVB 2FL4A 3PZJA 4PC3A 4YRHA 2P3MA 1OHHA 4OIWA 1G7RA 1XJOA 4AVZA 4RI1A 3WY9A 2WJVA 2J9AA 3OEHA 1E63A 2WZNA 3V7AA 1KRHA 1WTHD 2M5SA 5EMIA 3JQQA 4M1KA 4Q36A 2V7XA 1K8AD 2PSWA 2BGIA 4X7EA 4CAFA 4C68A 4NXYA 4H2KA 2V7UA 1MRZA 3ZZ0A 2JEWA 5F47A 2WSSA 4N3GA 2PJ8A 4HNYB 1MJAA 3MMPA 1B6BA 4PK2A 2POKA 1LANA 4ORFA 4ONWA 5I4MA 2Z11A 3D7FA 4PGOA 3ISZA 5A28A 1YK3A 3CPAA 1JNYA 2PQ8A 3T9YA 5AGEA 1EXMA 2BVNA 1WOSA 1PCAA 4KVXA 3GUXA 2HLDA 1R43A 1TKFA 1VHSA 3WQZA 1W0JA 2BN4A 3IO1A 5F46A 2DETA 4XKVA 1BJKA 4IW3B 3B3CA 1E1RA 2E1BA 2B5OA 3OJWA 3WC7A 5D8NA 1AMOA 4MHDA 2I00A 4E8OA 2V7QA 3BI0A 3PB7X 1Z8XA 2CNMA 1P4NA 1L0CA 4X06A 3C26A 3GIUA 4N3NA 2GK6A 2P0WA 2XZPA 1LFWA 1EFUA 2CBXA 2XEIA 3D2PA 3A3BA 5HXDA 3SHPA 4Z65A 3SI0A 4P22A 1Q81D 2ZOFA 1IYLA 2HMAA 2YWEA 3V38A 4X05A 3NE8A 4WQMA 4ACAA 2HQYA 1EP1B 2EFGA 3PFEA 4OLLA 4UEFA 3S6FA 2GANA 2QMUA 4DNRB 5HVHA 2BEIA 1LAMA 3FJOA 1X10A 4JXQA 4NGNA 4A39A 4WWVA 4B3XA 4B12A 3FEDA 4NGQA 1CNEA 4P4DA 3H8EA 3D7DA 2Q6LA 1Q9SA 3OP1A 3Q38A 4F6AA 3CW2A 2Z3OA 1S7LA 1YW4A 3CZXA 3RYOA 3GVKA 2EBJA 1XQBA 2PR1A 2JIZA 3R6KA 2DEAA 3CT9A 4Q38A 1Z8WA 3G3SA 4II9A 3JUWA 3B3SA 4EWTA 1RQRA 1IU8A 1W0KA 1UD5A 2AFOA 2ZTGA 1QQ9A 4QHYA 3TO7A 4UFXA 4DNCA 1VLYA 4KUBA 4F0XA 2OZGA 3PB9X 3S9MA 4R76A 2BM1A 1GJRA 4RN7A 4QVJA 1Z4RA 2A4NA 3I9SA 5K8PA 2IL4A 4H9GA 2KVOA 1DDGA 2PMDA 3WT4A 4MHNA 4ACBA 1KK1A 4G5GA 2YNDA 1NDHA 5DS0A 2NYQA 2GJRA 5IYWA 1EWYA 4ZCLA 1KZLA 2Z3KA 5A8AA 4R9MA 5AG7A 2V77A 3VARA 1FRQA 1SM4A 2PJ2A 4AXVA 4ZV4A 1YREA 1MABA 3V7ZA 5IYQA 2IMOA 2GIVA 1ZM9A 1KZFA 1M4LA 3DNSA 4MYTA 4C43A 3KQZA 3S6HA 3U2QA 3JRUA 2PE3A 2OU2A 4KSIA 3T56B 1WWZA 3G6EB 1WSVA 1S0UA 4M6GA 4PC7A 2OTJB 3FKSA 1TKHA 1KD1D 1NJID 4UEZA 1EP2B 1T6YA 3L2NA 1Y0YA 2FXFA 3PFOA 3VNVA 3GKRA 3CDXA 3SJFA 2Q43A 4X7DA 1M44A 1VKCA 2REFA 1KK2A 1XB2A 3AVYA 2HB6A 4LBWA 4TMTA 2DERA 4B3FX 3FYNA 2ZBVA 4LQGA 4TKOB 2V7VA 1LOKA 4X2TA 2GLJA 4KKSA 3BHXA 1W34A 3I3GA 3HAGA 2Z3NA 5HVGA 1E1QA 2C2WA 5E6TA 3GQBA 3ASSA 4Z4ZA 4NGPA 5EC4A 5H5JA 3D66A 2Q7SA 1YJNB 3LMSA 1XEBA 1YVKA 2WPWA 1R5NA 3PB4X 3OZWA 4PAAA 4C7IA 4MYUA 2PLFA 2ZL5A 5GCNA 3CRZA 1U2RA 1RTQA 3JTKA 4B11A 1KUXA 1FNOA 4Y7CA 1M90D 1H8EA 1VQMB 2VJJA 3WNBA 4UEEA 2R8VA 1D1NA 2ZL7A 1YR0A 4DJLA 2J7KA 3VH9A 3W91A 4CAWA 2ZOGA 4QFMA 5KTCA 3JQPA 1TLLA 5C88A 1VF7A 3RAMA 4OOVA 2AFSA 4B47A 3AVUA 1EFTA 3NE7A 2BGJA 2PIZA 2D9RA 5JM6A 4QUZA 1GO2A 4QB9A 2G0BA 3LNNA 2PDOA 4OC1A 2DOGA 1S3ZA 4M53A 2G3TA 2Q6KA 1QGZA 4B4DA 3CB4A 1J9ZA 2ZPAA 3D7HA 1BPMA 4PSWA 1CPXA 2R7HA 4UA3A 2EWBA 4Z4YA 1EFCA 4P9SA 1YQEA 3D3SA 3CESA 3DR8A 2F1LA 2VXKA 4HKFA 2CNDA 4C0SA 3F0AA 4HE6A 4HPSA 2YWHA 4B5OA 2CF4A 4A32A 4FUUA 3Q3AA 2HDNB 2BO9A 4CGOA 3VMFA 3H94A 3I1UA 4EVYA 1B23P 3A3GA 3BH4A 1N05A 2BSAA 5FO1A 2IJZA 3PA1A 4JZ0A 4RM0A 1Z2LA 1TF8A 4KOSA 4P4BA 1PU9A 1X12A 3WBJA 3PUMA 2J8NA 5J1QA 1EE3P 4K1XA 1Q86D 4PQAA 1OGJA 2K5TA 3T8WA 4MY0A 4WZEA 4OIDA 2X85A 3PBBA 1XE1A 2ZELA 4XM3A 3MN8A 3NH5A 5HZAA 3KZWA 4UWIA 3CCJB 1F60A 5K8MA 3VATA 4R87A 1YJ9B 1TVCA 3TE4A 2O28A 2HC9A 2VNKA 1Q2YA 3B3WA 3IJ3A 4AVCA 5K8OA 4G7WA 4RPBA 1N8RD 3AVWA 3CXCB 4A30A 2DYIA 2P6FA 1OGIA 2Z3MA 4P6YA 1A2ZA 1IB0A 4DQKA 3T53B 5AG4A 4RD3A 2X53S 3VR6A 1QSNA 1LCPA 3TOBA 3W2IA 1DARA 1AIPA 1VQ8B 2C6GA 4R6TA 3EFAA 3TO9A 4MY3A 3S6KA 1M1KD 5G1ZA 2Q0YA 5LYIA 2KCWA 1XMTA 3W5HA 3SI2A 2YGWA 3E1YE 2Q7BA 1IJEA 1S60A 4DK1A 1WU8A 2ZXIA 1ZLHA 3WNCA 5TY0A 5J8FA 3GLJA 4MJ8A 1QSRA 2PJCA 3W5VA 3CCRB 1HEEA 2XNDA 5JPHA 1PJ5A 1ZG9A 4OPOA 4G1PA 4KSFA 2V8VA 3FRMA 5LRGA 5A88A 2EK8A 3CMAB 4R7MA 4KKTA 4F9UA 4NNJA 3KKWA 4G1BA 4GQNA 1Q2DA 4CRZB 4XR6A 1YI2B 3D67A 1BX0A 2Y0MA 3P2HA 2EO8A 2ODFA 3FNCA 1N71A 4P44A 4DK0A 3HUVA 2W6IA 3E0KA 2J8RA 5TV2A 3CXQA 4CS0B 5J35A 2RC5A 1TTTA 1YIJB 2VYQA 4CYNA 4GM5A 3ONUA 2C1CA 4QV2A 3LQEA 2WSAA 4B6ZA 2HUZA 4RCZA 2B5GA 3SJGA 2QYVA 3RBUA 2CRVA 3K9UA 2ZL6A 3I56B 1ZLIA 4R71A 1E43A 4UCNA 5HH1A 1UD6A 1UD4A 1PJ6A 2GPJA 4M85A 3OFNA 5BSYA 1NE9A 3KI9A 1K4JA 1DE4C 4MXUA 4KOWA 2JDIA 3UY5A 2QIRA 1Z9UA 2VBTA 1WDTA 4Q7JB 2ZEHA 3QFSA 2V7WA 4PSXA 4ZY1A 3U6BA 3IC1A 4ZY2A 3QE2A 2PJ0A 5F4MA 2PJ3A 1E64A 4FAIA 3IGRA 3AGQA 4IHMA 3QNVA 1S7NA 5LMZA 5E96A 2PC1A 4OC4A 1EFRA 2Q4VA 4FD5A 1XFOA 3DDYA 5TRDA 3G8WA 4XORA 4L8JA 2Z0ZA 1WP6A 4P2NA 4XNHB 1VQ4B 1QSMA 4XPDB 1FNDA 3GB0A 2B4DA 4OMEA 2VNJA 1F2OA 3FXTA 5IYNA 3FBUA 4KVOE 4CGNA 3IU2A 4IUSA 4JXRA 2RC4A 2ZXHA 4KLWA 4OPVA 4MFZA 1T6XA 1S5KA 3B8HA 2OYNA 3S9LA 1GYTA 3W2HA 3N7ZA 4M2LA 3R9FA 2X8KA 4NJRA 4B5PA 2CIJA 2QJ8A 5THXA 2QE7A 2DF5A 1JJ2B 4DQLA 3D4UA 3G4SB 2F43A 4G6IA 3H9NA 5FA6A 2WYRA 4H6ZA 2O53A 1ELMP 4OKOA 4MFLA 4OC5A 4A31A 2PR8A 4R57A 2AFZA 2BCOA 2G3AA 4KOYA 3ZBUA 2OH1A 3W6XA 2ANPA 4CPAA 4P12A 1QUFA 1QFJA 4CAXA 3IWEA 4GXHA 3FMCA 3BLNA 3QFCA 4RDLA 1AUGA 4U9UA 4MCPA 4FD4A 5H59A 1JB9A 3KR5A 5IX3A 1D2EA 2FCKA 3IEHA 1XMBA 2BOAA 3SLDA 1BPNA 1EP3B 2Q4ZA 3A9LA 5IV0A 5A89A 4WZKA 1FX0A 2YNEA 3BCDA 5F4OA 1QSTA 4YHBA 2PJ1A 3F5BA 3WC6A 4MCQA 1VHOA 4WZLA 1I18A 4RDJA 5HVFA 2VZLA 3VNUA 4PC2A 4YAOA 1VQ9B 5H84A 3ZZTA 3OKXA 3H5ZA 4ZGNB 3Q6QA 1NSLA 5HXBA 4R3KA 1LRZA 3FEEA 3SJXA 1KWMA 1F20A 2ZZGA 5FNZA 3ZC3A 4AB7A 2V8HA 1N0UA 2B7BA 3PENA 3PEIA 2PJ4A 3BY2A 2F7VA 5B6IA 3CC7B 5IYPA 1Y0RA 4OPSA 5JH9A 3QFTA 4ZI6A 4UF4A 3B8GA 1WSRA 3MGDA 2BM0A 1N07A 1QGAA 3KR4A 3K9TA 1M1DA 4MRIA 5BSXA 4PXDA 3R9EA 1NRKA 3Q6RA 4XKWA 3TCVA 3PUNA 3IIBA
chains in the Genus database with same CATH topology
1CG2A 4OC1A 2PJ5A 2PJ9A 1HDUA 4UIBA 1YW6A 3D7HA 1F2PA 1BPMA 1LAPA 3KQXA 4MHPA 5CPAA 1CPXA 2JBJA 3KHXA 2FVGA 2PVVA 2EWBA 2PCUA 4NFRA 3B2YA 3IFEA 3ISXA 5THWA 3SJEA 2F8HA 5LRKA 4IAVA 2GREA 3HLPA 4R8FA 2CF4A 3NFZA 4FUUA 2PVWA 1QMUA 2BO9A 2XEFA 4P4FA 4PXEA 4K3NA 1Z5RA 4FBEA 3FVLA 3FF3A 3I1UA 2ZEFA 2QVPA 2NSMA 3TC8A 1H8LA 1ZG8A 1CX8A 2IJZA 4JZ0A 1Z2LA 1TF8A 3NH8A 4P4BA 3CPXA 1EE3P 5J1QA 4OIWA 4MHZA 4NJQA 4O23A 4PQAA 1XJOA 4DUKA 1IY7A 3T8WA 2V8DA 2J9AA 3FX6A 3KASA 1Z8LA 2AFUA 2WZNA 2PJBA 4OIDA 3PBBA 1CPSA 3KL9A 2ZELA 3MN8A 3IWWA 3NH5A 4WJBA 4EFDA 4OP4A 3KZWA 1CP7A 4PXBA 3FJUA 2PJ7A 5K8MA 4H2KA 3VATA 3S9NA 2JEWA 2IQ6A 4NGMA 2OOTA 2PJ8A 2ZEPA 2HC9A 3B3WA 3PB8X 3IJ3A 5K8OA 2ZEDA 1Y7EA 1XBUA 2ABZA 3D68A 4PXCA 2POKA 1BAVA 1NSAA 1LANA 4ONWA 4P6YA 5I4MA 3D7FA 3ISZA 2ZEOA 4YWYA 2PJ6A 4OC2A 3TX8A 3CPAA 1LCPA 4DYOA 1PCAA 2C6GA 4R6TA 3GUXA 5LYIA 1R43A 1R3NA 1TF9A 1TKFA 3SI2A 4BD9A 4MCRA 3IO1A 2PJAA 3PB6X 1ZLHA 1IGBA 8CPAA 2EK9A 3GLJA 3B3CA 2V8GA 3WC7A 4P10A 5D8NA 2OR4A 2PJCA 3BI0A 3PB7X 1HEEA 1ZG9A 4G1PA 2V8VA 4TWEA 1PYTB 5LRGA 1LFWA 2AFXA 2EK8A 2XEIA 4R7MA 4F9UA 3KGQA 5HXDA 4Z65A 3SI0A 2ZOFA 4ZX9A 3D67A 3V38A 4NGTA 4X3RA 4P44A 4NGSA 3PFEA 2RB7A 3HUVA 5IB9A 4UEFA 4UIAA 1BLLE 2VL1A 5HVHA 2AFMA 1LAMA 4NGNA 4A39A 4WWVA 1Q7LA 3FEDA 4NGQA 4GM5A 1AMPA 2C1CA 4P4DA 3H8EA 3D7DA 4B6ZA 4JYWA 4P45A 3SJGA 4W9YA 2QYVA 3RBUA 3B3TA 4F9VA 3D7GA 1ZLIA 1YW4A 3WABA 4MMOA 2DEAA 3CT9A 3MRUA 3NA6A 5LYFA 1VGYA 2PRQA 3KI9A 1DTDA 3BXMA 1DE4C 2O4HA 4MXUA 3PRTA 3B7IA 5F09A 1FT7A 3B3SA 1VHEA 2ZEHA 4EWTA 4ZY0A 4ZY1A 3IC1A 2AFOA 4ZY2A 2PJ0A 2XEGA 2PJ3A 1QQ9A 3H8FA 4FAIA 3DLJA 4IHMA 3N5FA 3QNVA 3LWUA 3BI1A 4OC4A 2ZEMA 1XFOA 3PB9X 4RUHA 2Q51A 3S9MA 4R76A 3B3VA 2CTCA 5K8PA 4Q7AA 1TXRA 3WT4A 4MHNA 5K8NA 2ZEGA 3GB0A 1UWYA 3PBEA 4OMEA 5DS0A 1F2OA 2NYQA 3NH4A 2CTBA 2PIYA 2V77A 4A38A 3RZAA 3VARA 2GLFA 2PJ2A 4AXVA 3S9LA 1GYTA 5LYDA 3V7ZA 4MHYA 4NJRA 2IMOA 2CIJA 2QJ8A 2G9DA 1M4LA 3D4UA 4OC0A 3KQZA 3JRUA 4FWUA 5JGFA 2ZEEA 2C6CA 2WYRA 2O53A 2PE3A 1ELMP 4OKOA 4OC5A 4KSIA 2XEJA 2AFZA 2BCOA 1OBRA 7CPAA 2ANPA 4CPAA 1TKHA 4UEZA 3L2NA 2ZENA 1Y0YA 3FMCA 4P4EA 3PFOA 1ZG7A 1JQGA 4MCPA 1ELLP 3KR5A 3IEHA 4YU9A 1XMBA 5D29A 3CDXA 2BOAA 1BPNA 3SJFA 2Q43A 2Q4ZA 2HB6A 4IK2A 2JBKA 4LQGA 4A37A 4X2TA 1LOKA 2GLJA 3BHXA 5HVGA 4NGPA 2PJ1A 1CP6A 3WC6A 1AYEA 3D66A 4MCQA 5ELYA 1VHOA 3FH4A 3WC5A 4ZX8A 5LRJA 1ARLA 3LMSA 5HVFA 3SI1A 1F57A 3PB4X 4P4IA 4ZYQA 3KHZA 4TNUA 3B35A 2I3CA 5CBMA 3FEEA 3SJXA 1KWMA 3H8GA 4NGRA 1RTQA 6CPAA 1YMEA 2GU2A 2V8HA 1FNOA 1HDQA 1YLOA 3PEIA 2PJ4A 1CBXA 2F7VA 1ARMA 2RFHA 3DGVA 1Y0RA 2AFWA 4UEEA 4DJLA 5JH9A 3VH9A 4ZI6A 2C6PA 2ZOGA 4UF4A 1XRYA 4EMEA 1YSJA 1TKJA 4F8ZA 4OC3A 3KR4A 3K9TA 4X8IA 4MRIA 3RAMA 4PXDA 2AFSA 4P4JA 4A94A 4MCSA 3FECA 4PPZA 2PIZA 5JM6A 3K2KA 5LYLA 3IIBA 1VIXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CG2 A;  4OC1 A;  2PJ5 A;  2PJ9 A;  1HDU A;  4UIB A;  1YW6 A;  3D7H A;  1F2P A;  1BPM A;  1LAP A;  3KQX A;  4MHP A;  5CPA A;  1CPX A;  2JBJ A;  3KHX A;  2FVG A;  2PVV A;  2EWB A;  2PCU A;  4NFR A;  3B2Y A;  3IFE A;  3ISX A;  5THW A;  3SJE A;  2F8H A;  5LRK A;  4IAV A;  2GRE A;  3HLP A;  4R8F A;  2CF4 A;  3NFZ A;  4FUU A;  2PVW A;  1QMU A;  2BO9 A;  2XEF A;  4P4F A;  4PXE A;  4K3N A;  1Z5R A;  4FBE A;  3FVL A;  3FF3 A;  3I1U A;  2ZEF A;  2QVP A;  2NSM A;  3TC8 A;  1H8L A;  1ZG8 A;  1CX8 A;  2IJZ A;  4JZ0 A;  1Z2L A;  1TF8 A;  3NH8 A;  4P4B A;  3CPX A;  1EE3 P;  5J1Q A;  4OIW A;  4MHZ A;  4NJQ A;  4O23 A;  4PQA A;  1XJO A;  4DUK A;  1IY7 A;  3T8W A;  2V8D A;  2J9A A;  3FX6 A;  3KAS A;  1Z8L A;  2AFU A;  2WZN A;  2PJB A;  4OID A;  3PBB A;  1CPS A;  3KL9 A;  2ZEL A;  3MN8 A;  3IWW A;  3NH5 A;  4WJB A;  4EFD A;  4OP4 A;  3KZW A;  1CP7 A;  4PXB A;  3FJU A;  2PJ7 A;  5K8M A;  4H2K A;  3VAT A;  3S9N A;  2JEW A;  2IQ6 A;  4NGM A;  2OOT A;  2PJ8 A;  2ZEP A;  2HC9 A;  3B3W A;  3PB8 X;  3IJ3 A;  5K8O A;  2ZED A;  1Y7E A;  1XBU A;  2ABZ A;  3D68 A;  4PXC A;  2POK A;  1BAV A;  1NSA A;  1LAN A;  4ONW A;  4P6Y A;  5I4M A;  3D7F A;  3ISZ A;  2ZEO A;  4YWY A;  2PJ6 A;  4OC2 A;  3TX8 A;  3CPA A;  1LCP A;  4DYO A;  1PCA A;  2C6G A;  4R6T A;  3GUX A;  5LYI A;  1R43 A;  1R3N A;  1TF9 A;  1TKF A;  3SI2 A;  4BD9 A;  4MCR A;  3IO1 A;  2PJA A;  3PB6 X;  1ZLH A;  1IGB A;  8CPA A;  2EK9 A;  3GLJ A;  3B3C A;  2V8G A;  3WC7 A;  4P10 A;  5D8N A;  2OR4 A;  2PJC A;  3BI0 A;  3PB7 X;  1HEE A;  1ZG9 A;  4G1P A;  2V8V A;  4TWE A;  1PYT B;  5LRG A;  1LFW A;  2AFX A;  2EK8 A;  2XEI A;  4R7M A;  4F9U A;  3KGQ A;  5HXD A;  4Z65 A;  3SI0 A;  2ZOF A;  4ZX9 A;  3D67 A;  3V38 A;  4NGT A;  4X3R A;  4P44 A;  4NGS A;  3PFE A;  2RB7 A;  3HUV A;  5IB9 A;  4UEF A;  4UIA A;  1BLL E;  2VL1 A;  5HVH A;  2AFM A;  1LAM A;  4NGN A;  4A39 A;  4WWV A;  1Q7L A;  3FED A;  4NGQ A;  4GM5 A;  1AMP A;  2C1C A;  4P4D A;  3H8E A;  3D7D A;  4B6Z A;  4JYW A;  4P45 A;  3SJG A;  4W9Y A;  2QYV A;  3RBU A;  3B3T A;  4F9V A;  3D7G A;  1ZLI A;  1YW4 A;  3WAB A;  4MMO A;  2DEA A;  3CT9 A;  3MRU A;  3NA6 A;  5LYF A;  1VGY A;  2PRQ A;  3KI9 A;  1DTD A;  3BXM A;  1DE4 C;  2O4H A;  4MXU A;  3PRT A;  3B7I A;  5F09 A;  1FT7 A;  3B3S A;  1VHE A;  2ZEH A;  4EWT A;  4ZY0 A;  4ZY1 A;  3IC1 A;  2AFO A;  4ZY2 A;  2PJ0 A;  2XEG A;  2PJ3 A;  1QQ9 A;  3H8F A;  4FAI A;  3DLJ A;  4IHM A;  3N5F A;  3QNV A;  3LWU A;  3BI1 A;  4OC4 A;  2ZEM A;  1XFO A;  3PB9 X;  4RUH A;  2Q51 A;  3S9M A;  4R76 A;  3B3V A;  2CTC A;  5K8P A;  4Q7A A;  1TXR A;  3WT4 A;  4MHN A;  5K8N A;  2ZEG A;  3GB0 A;  1UWY A;  3PBE A;  4OME A;  5DS0 A;  1F2O A;  2NYQ A;  3NH4 A;  2CTB A;  2PIY A;  2V77 A;  4A38 A;  3RZA A;  3VAR A;  2GLF A;  2PJ2 A;  4AXV A;  3S9L A;  1GYT A;  5LYD A;  3V7Z A;  4MHY A;  4NJR A;  2IMO A;  2CIJ A;  2QJ8 A;  2G9D A;  1M4L A;  3D4U A;  4OC0 A;  3KQZ A;  3JRU A;  4FWU A;  5JGF A;  2ZEE A;  2C6C A;  2WYR A;  2O53 A;  2PE3 A;  1ELM P;  4OKO A;  4OC5 A;  4KSI A;  2XEJ A;  2AFZ A;  2BCO A;  1OBR A;  7CPA A;  2ANP A;  4CPA A;  1TKH A;  4UEZ A;  3L2N A;  2ZEN A;  1Y0Y A;  3FMC A;  4P4E A;  3PFO A;  1ZG7 A;  1JQG A;  4MCP A;  1ELL P;  3KR5 A;  3IEH A;  4YU9 A;  1XMB A;  5D29 A;  3CDX A;  2BOA A;  1BPN A;  3SJF A;  2Q43 A;  2Q4Z A;  2HB6 A;  4IK2 A;  2JBK A;  4LQG A;  4A37 A;  4X2T A;  1LOK A;  2GLJ A;  3BHX A;  5HVG A;  4NGP A;  2PJ1 A;  1CP6 A;  3WC6 A;  1AYE A;  3D66 A;  4MCQ A;  5ELY A;  1VHO A;  3FH4 A;  3WC5 A;  4ZX8 A;  5LRJ A;  1ARL A;  3LMS A;  5HVF A;  3SI1 A;  1F57 A;  3PB4 X;  4P4I A;  4ZYQ A;  3KHZ A;  4TNU A;  3B35 A;  2I3C A;  5CBM A;  3FEE A;  3SJX A;  1KWM A;  3H8G A;  4NGR A;  1RTQ A;  6CPA A;  1YME A;  2GU2 A;  2V8H A;  1FNO A;  1HDQ A;  1YLO A;  3PEI A;  2PJ4 A;  1CBX A;  2F7V A;  1ARM A;  2RFH A;  3DGV A;  1Y0R A;  2AFW A;  4UEE A;  4DJL A;  5JH9 A;  3VH9 A;  4ZI6 A;  2C6P A;  2ZOG A;  4UF4 A;  1XRY A;  4EME A;  1YSJ A;  1TKJ A;  4F8Z A;  4OC3 A;  3KR4 A;  3K9T A;  4X8I A;  4MRI A;  3RAM A;  4PXD A;  2AFS A;  4P4J A;  4A94 A;  4MCS A;  3FEC A;  4PPZ A;  2PIZ A;  5JM6 A;  3K2K A;  5LYL A;  3IIB A;  1VIX A; 
#chains in the Genus database with same CATH topology
 2QTL A;  1CG2 A;  2PIA A;  1KK3 A;  2AJ6 A;  3ZPN A;  1ZUN B;  1WOR A;  3VO2 A;  2R1I A;  1I8D A;  2D4P A;  2ZW5 A;  2RC6 A;  1V0F A;  4B10 A;  2PJ9 A;  1HDU A;  2JDC A;  1YW6 A;  4KLV A;  1V0E A;  1XF8 A;  4OAE A;  2FVG A;  4B5P B;  2V4D A;  2PVV A;  4C2Z A;  2VI7 A;  1CM0 A;  4J3G A;  3B2Y A;  3IFE A;  1W87 A;  4CGP A;  3ISX A;  3LAC A;  1YGH A;  5DN6 A;  2F8H A;  2Z3L A;  1IID A;  4IAV A;  3HLP A;  5JBQ A;  4RS2 A;  2YWG A;  5FO0 A;  2PVW A;  2C77 A;  4PXE A;  1SQH A;  4K3N A;  1Z5R A;  4CAE A;  4ZGY B;  1T5E A;  5F4J A;  5EBV A;  2ZEF A;  2NSM A;  3R95 A;  2HV2 A;  1PJ7 A;  2AHO A;  1WOO A;  4MFQ A;  1OB2 A;  4AG7 A;  1KJZ A;  4QVA A;  4NSQ A;  3R6J A;  2P6G A;  4UCP A;  4AVA A;  3EC4 A;  1IY7 A;  2V8D A;  2WPD A;  2PJB A;  4PC1 A;  3MCA A;  2VEZ A;  4ZCM A;  5FIU A;  3IWW A;  3PGP A;  1NBM A;  3EO4 A;  4OP4 A;  1CP7 A;  4PXB A;  3FJU A;  1PKV A;  2PJ7 A;  1Q7Y D;  4X7C A;  4QVT A;  2E1R A;  3TFY A;  2XZO A;  2FIA A;  5AG6 A;  3WBK A;  2VZZ A;  4K30 A;  2IQ6 A;  1KMH A;  4NGM A;  4MI4 A;  3CPW B;  4E0F A;  3A8I A;  3KEW A;  1Y7E A;  1XBU A;  2ABZ A;  4PXC A;  4RPD A;  4KOV A;  1NMT A;  3EXN A;  3OW7 A;  1BAV A;  1NSA A;  1U6M A;  2AE6 A;  3DR6 A;  2ZEO A;  3MHP A;  2PJ6 A;  4CRY B;  4L89 A;  1WPC A;  2VNH A;  2B58 A;  3R9G A;  2FS5 A;  2ZXV A;  4DYO A;  1QUE A;  1QH0 A;  4RLZ A;  2CW5 A;  5KTA A;  1IJF A;  2OZH A;  3OAA A;  3JQR A;  1R3N A;  5BWA B;  3CC2 B;  2F1M A;  1TF9 A;  1ZM4 A;  4ASU A;  2NMT A;  4E2A A;  4TMW A;  5GV8 A;  4YGO A;  3I55 B;  4BD9 A;  3LD2 A;  2QML A;  3PB6 X;  1IGB A;  8CPA A;  4AF6 A;  2BF4 A;  4B13 A;  1N06 A;  2OR4 A;  3LOD A;  4G1V A;  1ON0 A;  1RQP A;  4YAW A;  3SEJ A;  5KTD A;  4TT3 A;  4TWE A;  1NB9 A;  3G05 A;  4MBU A;  2JJ1 A;  4KOX A;  4M6H A;  2ZBU A;  4NCN A;  1CJW A;  5HMN A;  1QVF B;  4XLC A;  4XN3 A;  3CD6 B;  2XNC A;  3SXO A;  1BX1 A;  4NGT A;  3ZZI A;  4LQ6 A;  4HNW B;  3ES9 A;  2CK3 A;  5HZB A;  2B7C A;  3D26 A;  4A2Z A;  2VL1 A;  2AFM A;  2Z10 A;  1VQL B;  1YLE A;  2X3U A;  3A1P A;  2OBS A;  2FT0 A;  3WYA A;  1K9M D;  1SKY B;  4UFW A;  1KUV A;  1IYK A;  2DEU A;  4P45 A;  4ZGQ B;  4II2 A;  4W9Y A;  2LZJ A;  3B3T A;  2FIW A;  2R6H A;  4F9V A;  3D7G A;  3R96 A;  3WAB A;  1E3Z A;  2C4U A;  2ZZE A;  4F7D A;  4MMO A;  4UBR A;  2D3L A;  4RD1 A;  4U9Z A;  3NA6 A;  1VGY A;  4P3I A;  1DTD A;  3BXM A;  5DSZ A;  3E20 A;  4X07 A;  1BLI A;  4JWP A;  4XMY A;  1V0C A;  1XIX A;  3DSB A;  4HE5 A;  5G22 A;  4OP7 A;  2C5H A;  1A8P A;  3A8K A;  4XON A;  2XEG A;  1M4D A;  3H8F A;  3DLJ A;  3N5F A;  4XD7 A;  3W6S A;  4C2X A;  3LWU A;  1BPL A;  1MJB A;  3SJP A;  1OB5 A;  2ZEM A;  1P4M A;  2Q51 A;  4UZE A;  1UMK A;  2XZL A;  3B3V A;  4RD0 A;  4P1V A;  2QEX B;  4Y49 B;  2W6J A;  2X6W A;  4TMZ A;  1UD2 A;  2JEV A;  4Q7A A;  4PC6 A;  4Z4S A;  2VBU A;  1FNM A;  4UCM A;  1XE4 A;  4CGM A;  2CNS A;  4OAD A;  1UWY A;  2OK7 A;  3PBE A;  3ZUG A;  4AF7 A;  3RO0 A;  3DDD A;  2NPF A;  4L8A A;  5AG5 A;  3NH4 A;  3OW2 B;  4UZF A;  4U9Y A;  1R57 A;  2CTB A;  2GLF A;  2GK7 A;  3BQJ A;  5HKK A;  1JWQ A;  5LYD A;  3AVT A;  3QAH A;  4OOX A;  2VBS A;  4X7F A;  3AVX A;  2G9D A;  4BPR A;  4UWJ A;  4U5Y A;  4QC6 A;  4FWU A;  3OJX A;  4A33 A;  4B44 A;  2ZEE A;  3FPP A;  4F0Y A;  2Z3P A;  4XPK A;  5KW9 A;  3TTH A;  2GE3 A;  4TN1 A;  1UFH A;  2XEJ A;  1E3X A;  4PAB A;  3RNZ A;  2VBQ A;  5G21 A;  1FNB A;  1VQO B;  2DCU A;  4Z4T A;  2Q6I A;  3B82 A;  4BBH A;  2C4T A;  5DWM A;  5JQ4 A;  2H5M A;  4UZU A;  4P25 A;  1JQG A;  2EIX A;  4XLE A;  2OK8 A;  4XOP A;  4MFK A;  1QGY A;  3GSI A;  4FN5 A;  4NF1 A;  5D29 A;  1YX2 A;  3T90 A;  2X0K A;  1ZM3 A;  4H89 A;  3ZIA A;  4B48 A;  3VO1 A;  3W2G A;  4HIZ A;  4IK2 A;  1Q2C A;  2JBK A;  3F8K A;  4HNX B;  3PP9 A;  2PRB A;  3ZZU A;  1K28 D;  1BQE A;  1FNC A;  4XN0 A;  2Q6O A;  5ELY A;  2J8M A;  4ONU A;  4ZX8 A;  2F4N A;  1VQP B;  5LRJ A;  1ARL A;  5C82 A;  3AVV A;  3IWG A;  2BMW A;  1MK4 A;  1F57 A;  5KNL A;  3ASR A;  3CCM B;  3GVL A;  2P6E A;  3B35 A;  4II3 A;  2I3C A;  3P26 A;  5CBM A;  4RCY A;  1YX0 A;  3H8G A;  4FD6 A;  4XL9 A;  3B78 A;  5EMN A;  6CPA A;  3BCF A;  2V7T A;  3OZU A;  1HDQ A;  2F5I A;  2WPX A;  4EH1 A;  3CC4 B;  1IB1 E;  3SKB A;  4XNH C;  1ARM A;  2RFH A;  3FPK A;  2AFW A;  2Q44 A;  4QUS A;  2C6P A;  1XRY A;  3CCU B;  4EME A;  4F8Z A;  4CQJ A;  4JLY A;  5TR9 A;  1OB0 A;  4A94 A;  3W2F A;  3ONY A;  2BSW A;  4ZBG A;  4PPZ A;  5FVJ A;  4RD4 A;  4BMH A;  4YEL A;  1DG1 G;  2XGJ A;  5LYL A;  3FB3 A;  4CAV A;  1I21 A;  4XOT A;  1VIX A;  1UD3 A;  1RXT A;  5FL7 A;  3BNW A;  4J0Q A;  2B3V A;  4UIB A;  2OBT A;  4MFJ A;  2X6Y A;  2FSR A;  4P6V F;  1DDI A;  1F2P A;  2JN9 A;  4YXW A;  3KQX A;  4PV6 A;  2ATR A;  2YNC C;  1COW A;  2C5B A;  3KHX A;  3CCQ B;  1S7K A;  1VQ7 B;  2DPS A;  2PCU A;  2VBV A;  1SKQ A;  1P0H A;  3TT2 A;  2JJ2 A;  2ARH A;  3GIR A;  4UFV A;  2YWF A;  2GJP A;  1QFZ A;  3CME B;  1VQK B;  1N0V C;  1H8H A;  5G20 A;  5LRK A;  4XNF A;  2GRE A;  4R8F A;  1N08 A;  1PUA A;  4LC0 A;  1TUI A;  5CDF A;  4Z1M A;  1E79 A;  4FBE A;  4E0A A;  1CNF A;  1HVX A;  3FF3 A;  1R5O A;  1Z4E A;  2QVP A;  4M0L A;  3WXM A;  1MJ9 A;  3TC8 A;  1T6Z A;  2D3N A;  1ELO A;  2C78 A;  2ZTN A;  4PK3 A;  1Q82 D;  3NH8 A;  2Q04 A;  3D8P A;  3CPX A;  2QA4 B;  3OEE A;  4MHZ A;  4NJQ A;  4O23 A;  4DUK A;  3P2F A;  1Y9W A;  3A8J A;  3BJ7 A;  3FX6 A;  3KAS A;  3TO6 A;  1Z8L A;  2AFU A;  3Q39 A;  1CPS A;  3KL9 A;  3OPO A;  1S7F A;  3OOC A;  4GS4 A;  1B87 A;  4KZT A;  4WJB A;  4EFD A;  4LBV A;  2HCJ B;  2WZP P;  1H85 A;  5J8C A;  3LO8 A;  3S9N A;  3OWC A;  1I1D A;  2CNT A;  2OOT A;  1R5B A;  3OE7 A;  2BPO A;  2ZEP A;  3PB8 X;  1WK4 A;  1YIT B;  4RDK A;  2ZED A;  3D68 A;  3QAY A;  4RD2 A;  1GVH A;  1M4G A;  1YJW B;  4YWY A;  4RD6 A;  3W5U A;  2OBR A;  4OC2 A;  2XNJ A;  4XQF A;  4B3G A;  3TX8 A;  2QGG A;  4FXU A;  1BOB A;  4XLF A;  2GQF A;  2QEC A;  3GVJ A;  4Y9U A;  4FD7 A;  2FE7 A;  4YEJ A;  3EY5 A;  4XPD C;  4C7H A;  1J4J A;  1G7S A;  2WR8 A;  4KVM E;  3JVN A;  3J81 k;  5IK2 A;  5CNP A;  4WZT A;  4YAL A;  2YNC A;  4MCR A;  2JDD A;  3PA2 A;  2PJA A;  3AST A;  2EUI A;  2EK9 A;  1NB0 A;  3CTA A;  1B2R A;  1KUY A;  1ZO0 A;  2V8G A;  1JA0 A;  4ZCI A;  1VLO A;  4P10 A;  3SXN A;  1OZP A;  4M3S A;  4C2Y A;  2EVN A;  3RY8 A;  4KOT A;  1PYT B;  2Z6B D;  2ZZF A;  1Y9K A;  1BO4 A;  2AFX A;  4ROX A;  4FWT A;  3QSY A;  1VQ5 B;  3KGQ A;  4KOR A;  1VJS A;  4KSA A;  4XPL A;  4ZX9 A;  3CXP A;  5DWN A;  4YAF A;  1S4M A;  2OTL B;  2Q4Y A;  4X3R A;  4NGS A;  2RB7 A;  1QVG B;  2X6X A;  5IB9 A;  2QN6 A;  3CMM A;  3GY9 A;  4UIA A;  1UD8 A;  1BLL E;  4JJX A;  4Z4W A;  4AG9 A;  2DIE A;  1Q7L A;  2OZU A;  1D8T A;  1V5V A;  1AMP A;  1S72 B;  5I0C A;  2GJK A;  4JYW A;  4X5K A;  2OB0 A;  4A95 A;  2WUU A;  2XOK A;  3CP8 A;  4M6I A;  1G7C A;  1YHQ B;  1I7P A;  1BMF A;  2DPT A;  4Y49 C;  3IU1 A;  1QSO A;  3ASP A;  3MRU A;  3SJZ A;  1I12 A;  4LBY A;  1IIC A;  2BL1 A;  3R1K A;  5LYF A;  5F48 A;  2PRQ A;  1YVO A;  2O4H A;  2DY1 A;  3PRT A;  1FRN A;  3B7I A;  5GV7 A;  5F09 A;  1FT7 A;  1FY7 A;  1VHE A;  3CP2 A;  4ZY0 A;  3D2M A;  1GR1 A;  2B3U A;  2I1L A;  4KS9 A;  3BI1 A;  4OOS A;  4FK8 A;  3BJ8 A;  4RUH A;  4B43 A;  3SLN A;  4CYO A;  3LQ6 A;  2CTC A;  3S6G A;  2D74 A;  1GAQ A;  4M4S A;  3ASQ A;  1TXR A;  4MFP A;  2VJI A;  5IB0 A;  4QBJ A;  5K8N A;  1IHM A;  2ZEG A;  2VNI A;  2ZW6 A;  3BY1 A;  5H86 A;  4Y9R A;  4JD6 A;  3PVD A;  2WJY A;  1VQN B;  4UAJ A;  2PIY A;  4A38 A;  3RZA A;  1QFY A;  3WND A;  3V8I A;  4BIN A;  3AGP A;  4Z4U A;  5AN9 A;  4MHY A;  1FDR A;  3CCE B;  1ZM2 A;  4Z4R A;  4OC0 A;  1M4I A;  5A27 A;  5JGF A;  5J3O A;  3QFR A;  2C6C A;  1TIQ A;  2V31 A;  4NEX A;  2BUE A;  2X7B A;  1KTV A;  1OBR A;  5L46 A;  7CPA A;  3H4Q A;  3V76 A;  3U6K A;  1CQX A;  4NCZ A;  2R9V A;  4RJL A;  2ZEN A;  4P4E A;  5KSW B;  1ZG7 A;  2VQY A;  2B4B A;  1ELL P;  4YU9 A;  1GHE A;  3BC9 A;  4KOU A;  3CCL B;  4XLA A;  4P3Y A;  3VWE A;  2ZIT A;  4A37 A;  2CC2 A;  1HZE A;  4LX9 A;  3ZBT A;  1CP6 A;  4H6U A;  1AYE A;  2ZW7 A;  1HA3 A;  4CYP A;  3FH4 A;  3WC5 A;  2C27 A;  3JU4 A;  3VWD A;  3WR7 A;  3LVB A;  3SI1 A;  2QDX A;  4P4I A;  2ZW4 A;  1H42 A;  2D4O A;  4ZYQ A;  3KHZ A;  4KUA A;  1QG0 A;  4TNU A;  1KK0 A;  1W9X A;  5F49 A;  1W35 A;  1GAW A;  4NGR A;  3CCS B;  1YME A;  2GU2 A;  3P27 A;  1YLO A;  2B4D B;  1IOI A;  1CBX A;  4TMV A;  3CXS A;  2DXQ A;  3DGV A;  3NE5 B;  4JMQ A;  2XEX A;  3FIX A;  4I49 A;  1YSJ A;  4IF5 A;  1TKJ A;  1IOF A;  4OC3 A;  2CY2 A;  2REE A;  4X8I A;  4YAU A;  4P4J A;  1WOP A;  3G71 B;  1JA1 A;  3FEC A;  4MCS A;  3K2K A;  4DNT B;  3W2E A;  3TOA A;  2FX3 A;  3T51 B;  2QTZ A;  2JLM A;  4AVB A;  2R98 A;  2PJ5 A;  4TSF A;  4TMX A;  4XLH A;  4LBZ A;  5IYR A;  4AC9 A;  3ZJ0 A;  4MHP A;  1QX4 A;  1LAP A;  4G7X A;  4Z4V A;  1K73 D;  5CPA A;  2JBJ A;  3GYA A;  4NFR A;  2CXA A;  2GFQ A;  1E62 A;  5ISV A;  4LUA A;  5THW A;  3SJE A;  1Y7R A;  2I79 A;  2B5G B;  1RO5 A;  2BV3 A;  4NBS A;  4B14 A;  1KC8 D;  4P26 A;  2NV4 A;  3NFZ A;  3QB8 A;  3A35 A;  2ZZQ A;  1QMU A;  4R3L A;  3OZV A;  2XEF A;  4P4F A;  4KKU A;  3FVL A;  3I1F A;  1KQS B;  1XOV A;  4YFJ A;  1VQ6 B;  4CGL A;  4CYQ A;  1Z8T A;  4X0C A;  2VZY A;  1W2B B;  1G7T A;  1H8L A;  1ZG8 A;  1CX8 A;  3CCV B;  2FL4 A;  3PZJ A;  4PC3 A;  4YRH A;  2P3M A;  1OHH A;  4OIW A;  1G7R A;  1XJO A;  4AVZ A;  4RI1 A;  3WY9 A;  2WJV A;  2J9A A;  3OEH A;  1E63 A;  2WZN A;  3V7A A;  1KRH A;  1WTH D;  2M5S A;  5EMI A;  3JQQ A;  4M1K A;  4Q36 A;  2V7X A;  1K8A D;  2PSW A;  2BGI A;  4X7E A;  4CAF A;  4C68 A;  4NXY A;  4H2K A;  2V7U A;  1MRZ A;  3ZZ0 A;  2JEW A;  5F47 A;  2WSS A;  4N3G A;  2PJ8 A;  4HNY B;  1MJA A;  3MMP A;  1B6B A;  4PK2 A;  2POK A;  1LAN A;  4ORF A;  4ONW A;  5I4M A;  2Z11 A;  3D7F A;  4PGO A;  3ISZ A;  5A28 A;  1YK3 A;  3CPA A;  1JNY A;  2PQ8 A;  3T9Y A;  5AGE A;  1EXM A;  2BVN A;  1WOS A;  1PCA A;  4KVX A;  3GUX A;  2HLD A;  1R43 A;  1TKF A;  1VHS A;  3WQZ A;  1W0J A;  2BN4 A;  3IO1 A;  5F46 A;  2DET A;  4XKV A;  1BJK A;  4IW3 B;  3B3C A;  1E1R A;  2E1B A;  2B5O A;  3OJW A;  3WC7 A;  5D8N A;  1AMO A;  4MHD A;  2I00 A;  4E8O A;  2V7Q A;  3BI0 A;  3PB7 X;  1Z8X A;  2CNM A;  1P4N A;  1L0C A;  4X06 A;  3C26 A;  3GIU A;  4N3N A;  2GK6 A;  2P0W A;  2XZP A;  1LFW A;  1EFU A;  2CBX A;  2XEI A;  3D2P A;  3A3B A;  5HXD A;  3SHP A;  4Z65 A;  3SI0 A;  4P22 A;  1Q81 D;  2ZOF A;  1IYL A;  2HMA A;  2YWE A;  3V38 A;  4X05 A;  3NE8 A;  4WQM A;  4ACA A;  2HQY A;  1EP1 B;  2EFG A;  3PFE A;  4OLL A;  4UEF A;  3S6F A;  2GAN A;  2QMU A;  4DNR B;  5HVH A;  2BEI A;  1LAM A;  3FJO A;  1X10 A;  4JXQ A;  4NGN A;  4A39 A;  4WWV A;  4B3X A;  4B12 A;  3FED A;  4NGQ A;  1CNE A;  4P4D A;  3H8E A;  3D7D A;  2Q6L A;  1Q9S A;  3OP1 A;  3Q38 A;  4F6A A;  3CW2 A;  2Z3O A;  1S7L A;  1YW4 A;  3CZX A;  3RYO A;  3GVK A;  2EBJ A;  1XQB A;  2PR1 A;  2JIZ A;  3R6K A;  2DEA A;  3CT9 A;  4Q38 A;  1Z8W A;  3G3S A;  4II9 A;  3JUW A;  3B3S A;  4EWT A;  1RQR A;  1IU8 A;  1W0K A;  1UD5 A;  2AFO A;  2ZTG A;  1QQ9 A;  4QHY A;  3TO7 A;  4UFX A;  4DNC A;  1VLY A;  4KUB A;  4F0X A;  2OZG A;  3PB9 X;  3S9M A;  4R76 A;  2BM1 A;  1GJR A;  4RN7 A;  4QVJ A;  1Z4R A;  2A4N A;  3I9S A;  5K8P A;  2IL4 A;  4H9G A;  2KVO A;  1DDG A;  2PMD A;  3WT4 A;  4MHN A;  4ACB A;  1KK1 A;  4G5G A;  2YND A;  1NDH A;  5DS0 A;  2NYQ A;  2GJR A;  5IYW A;  1EWY A;  4ZCL A;  1KZL A;  2Z3K A;  5A8A A;  4R9M A;  5AG7 A;  2V77 A;  3VAR A;  1FRQ A;  1SM4 A;  2PJ2 A;  4AXV A;  4ZV4 A;  1YRE A;  1MAB A;  3V7Z A;  5IYQ A;  2IMO A;  2GIV A;  1ZM9 A;  1KZF A;  1M4L A;  3DNS A;  4MYT A;  4C43 A;  3KQZ A;  3S6H A;  3U2Q A;  3JRU A;  2PE3 A;  2OU2 A;  4KSI A;  3T56 B;  1WWZ A;  3G6E B;  1WSV A;  1S0U A;  4M6G A;  4PC7 A;  2OTJ B;  3FKS A;  1TKH A;  1KD1 D;  1NJI D;  4UEZ A;  1EP2 B;  1T6Y A;  3L2N A;  1Y0Y A;  2FXF A;  3PFO A;  3VNV A;  3GKR A;  3CDX A;  3SJF A;  2Q43 A;  4X7D A;  1M44 A;  1VKC A;  2REF A;  1KK2 A;  1XB2 A;  3AVY A;  2HB6 A;  4LBW A;  4TMT A;  2DER A;  4B3F X;  3FYN A;  2ZBV A;  4LQG A;  4TKO B;  2V7V A;  1LOK A;  4X2T A;  2GLJ A;  4KKS A;  3BHX A;  1W34 A;  3I3G A;  3HAG A;  2Z3N A;  5HVG A;  1E1Q A;  2C2W A;  5E6T A;  3GQB A;  3ASS A;  4Z4Z A;  4NGP A;  5EC4 A;  5H5J A;  3D66 A;  2Q7S A;  1YJN B;  3LMS A;  1XEB A;  1YVK A;  2WPW A;  1R5N A;  3PB4 X;  3OZW A;  4PAA A;  4C7I A;  4MYU A;  2PLF A;  2ZL5 A;  5GCN A;  3CRZ A;  1U2R A;  1RTQ A;  3JTK A;  4B11 A;  1KUX A;  1FNO A;  4Y7C A;  1M90 D;  1H8E A;  1VQM B;  2VJJ A;  3WNB A;  4UEE A;  2R8V A;  1D1N A;  2ZL7 A;  1YR0 A;  4DJL A;  2J7K A;  3VH9 A;  3W91 A;  4CAW A;  2ZOG A;  4QFM A;  5KTC A;  3JQP A;  1TLL A;  5C88 A;  1VF7 A;  3RAM A;  4OOV A;  2AFS A;  4B47 A;  3AVU A;  1EFT A;  3NE7 A;  2BGJ A;  2PIZ A;  2D9R A;  5JM6 A;  4QUZ A;  1GO2 A;  4QB9 A;  2G0B A;  3LNN A;  2PDO A;  4OC1 A;  2DOG A;  1S3Z A;  4M53 A;  2G3T A;  2Q6K A;  1QGZ A;  4B4D A;  3CB4 A;  1J9Z A;  2ZPA A;  3D7H A;  1BPM A;  4PSW A;  1CPX A;  2R7H A;  4UA3 A;  2EWB A;  4Z4Y A;  1EFC A;  4P9S A;  1YQE A;  3D3S A;  3CES A;  3DR8 A;  2F1L A;  2VXK A;  4HKF A;  2CND A;  4C0S A;  3F0A A;  4HE6 A;  4HPS A;  2YWH A;  4B5O A;  2CF4 A;  4A32 A;  4FUU A;  3Q3A A;  2HDN B;  2BO9 A;  4CGO A;  3VMF A;  3H94 A;  3I1U A;  4EVY A;  1B23 P;  3A3G A;  3BH4 A;  1N05 A;  2BSA A;  5FO1 A;  2IJZ A;  3PA1 A;  4JZ0 A;  4RM0 A;  1Z2L A;  1TF8 A;  4KOS A;  4P4B A;  1PU9 A;  1X12 A;  3WBJ A;  3PUM A;  2J8N A;  5J1Q A;  1EE3 P;  4K1X A;  1Q86 D;  4PQA A;  1OGJ A;  2K5T A;  3T8W A;  4MY0 A;  4WZE A;  4OID A;  2X85 A;  3PBB A;  1XE1 A;  2ZEL A;  4XM3 A;  3MN8 A;  3NH5 A;  5HZA A;  3KZW A;  4UWI A;  3CCJ B;  1F60 A;  5K8M A;  3VAT A;  4R87 A;  1YJ9 B;  1TVC A;  3TE4 A;  2O28 A;  2HC9 A;  2VNK A;  1Q2Y A;  3B3W A;  3IJ3 A;  4AVC A;  5K8O A;  4G7W A;  4RPB A;  1N8R D;  3AVW A;  3CXC B;  4A30 A;  2DYI A;  2P6F A;  1OGI A;  2Z3M A;  4P6Y A;  1A2Z A;  1IB0 A;  4DQK A;  3T53 B;  5AG4 A;  4RD3 A;  2X53 S;  3VR6 A;  1QSN A;  1LCP A;  3TOB A;  3W2I A;  1DAR A;  1AIP A;  1VQ8 B;  2C6G A;  4R6T A;  3EFA A;  3TO9 A;  4MY3 A;  3S6K A;  1M1K D;  5G1Z A;  2Q0Y A;  5LYI A;  2KCW A;  1XMT A;  3W5H A;  3SI2 A;  2YGW A;  3E1Y E;  2Q7B A;  1IJE A;  1S60 A;  4DK1 A;  1WU8 A;  2ZXI A;  1ZLH A;  3WNC A;  5TY0 A;  5J8F A;  3GLJ A;  4MJ8 A;  1QSR A;  2PJC A;  3W5V A;  3CCR B;  1HEE A;  2XND A;  5JPH A;  1PJ5 A;  1ZG9 A;  4OPO A;  4G1P A;  4KSF A;  2V8V A;  3FRM A;  5LRG A;  5A88 A;  2EK8 A;  3CMA B;  4R7M A;  4KKT A;  4F9U A;  4NNJ A;  3KKW A;  4G1B A;  4GQN A;  1Q2D A;  4CRZ B;  4XR6 A;  1YI2 B;  3D67 A;  1BX0 A;  2Y0M A;  3P2H A;  2EO8 A;  2ODF A;  3FNC A;  1N71 A;  4P44 A;  4DK0 A;  3HUV A;  2W6I A;  3E0K A;  2J8R A;  5TV2 A;  3CXQ A;  4CS0 B;  5J35 A;  2RC5 A;  1TTT A;  1YIJ B;  2VYQ A;  4CYN A;  4GM5 A;  3ONU A;  2C1C A;  4QV2 A;  3LQE A;  2WSA A;  4B6Z A;  2HUZ A;  4RCZ A;  2B5G A;  3SJG A;  2QYV A;  3RBU A;  2CRV A;  3K9U A;  2ZL6 A;  3I56 B;  1ZLI A;  4R71 A;  1E43 A;  4UCN A;  5HH1 A;  1UD6 A;  1UD4 A;  1PJ6 A;  2GPJ A;  4M85 A;  3OFN A;  5BSY A;  1NE9 A;  3KI9 A;  1K4J A;  1DE4 C;  4MXU A;  4KOW A;  2JDI A;  3UY5 A;  2QIR A;  1Z9U A;  2VBT A;  1WDT A;  4Q7J B;  2ZEH A;  3QFS A;  2V7W A;  4PSX A;  4ZY1 A;  3U6B A;  3IC1 A;  4ZY2 A;  3QE2 A;  2PJ0 A;  5F4M A;  2PJ3 A;  1E64 A;  4FAI A;  3IGR A;  3AGQ A;  4IHM A;  3QNV A;  1S7N A;  5LMZ A;  5E96 A;  2PC1 A;  4OC4 A;  1EFR A;  2Q4V A;  4FD5 A;  1XFO A;  3DDY A;  5TRD A;  3G8W A;  4XOR A;  4L8J A;  2Z0Z A;  1WP6 A;  4P2N A;  4XNH B;  1VQ4 B;  1QSM A;  4XPD B;  1FND A;  3GB0 A;  2B4D A;  4OME A;  2VNJ A;  1F2O A;  3FXT A;  5IYN A;  3FBU A;  4KVO E;  4CGN A;  3IU2 A;  4IUS A;  4JXR A;  2RC4 A;  2ZXH A;  4KLW A;  4OPV A;  4MFZ A;  1T6X A;  1S5K A;  3B8H A;  2OYN A;  3S9L A;  1GYT A;  3W2H A;  3N7Z A;  4M2L A;  3R9F A;  2X8K A;  4NJR A;  4B5P A;  2CIJ A;  2QJ8 A;  5THX A;  2QE7 A;  2DF5 A;  1JJ2 B;  4DQL A;  3D4U A;  3G4S B;  2F43 A;  4G6I A;  3H9N A;  5FA6 A;  2WYR A;  4H6Z A;  2O53 A;  1ELM P;  4OKO A;  4MFL A;  4OC5 A;  4A31 A;  2PR8 A;  4R57 A;  2AFZ A;  2BCO A;  2G3A A;  4KOY A;  3ZBU A;  2OH1 A;  3W6X A;  2ANP A;  4CPA A;  4P12 A;  1QUF A;  1QFJ A;  4CAX A;  3IWE A;  4GXH A;  3FMC A;  3BLN A;  3QFC A;  4RDL A;  1AUG A;  4U9U A;  4MCP A;  4FD4 A;  5H59 A;  1JB9 A;  3KR5 A;  5IX3 A;  1D2E A;  2FCK A;  3IEH A;  1XMB A;  2BOA A;  3SLD A;  1BPN A;  1EP3 B;  2Q4Z A;  3A9L A;  5IV0 A;  5A89 A;  4WZK A;  1FX0 A;  2YNE A;  3BCD A;  5F4O A;  1QST A;  4YHB A;  2PJ1 A;  3F5B A;  3WC6 A;  4MCQ A;  1VHO A;  4WZL A;  1I18 A;  4RDJ A;  5HVF A;  2VZL A;  3VNU A;  4PC2 A;  4YAO A;  1VQ9 B;  5H84 A;  3ZZT A;  3OKX A;  3H5Z A;  4ZGN B;  3Q6Q A;  1NSL A;  5HXB A;  4R3K A;  1LRZ A;  3FEE A;  3SJX A;  1KWM A;  1F20 A;  2ZZG A;  5FNZ A;  3ZC3 A;  4AB7 A;  2V8H A;  1N0U A;  2B7B A;  3PEN A;  3PEI A;  2PJ4 A;  3BY2 A;  2F7V A;  5B6I A;  3CC7 B;  5IYP A;  1Y0R A;  4OPS A;  5JH9 A;  3QFT A;  4ZI6 A;  4UF4 A;  3B8G A;  1WSR A;  3MGD A;  2BM0 A;  1N07 A;  1QGA A;  3KR4 A;  3K9T A;  1M1D A;  4MRI A;  5BSX A;  4PXD A;  3R9E A;  1NRK A;  3Q6R A;  4XKW A;  3TCV A;  3PUN A;  3IIB A; 
#chains in the Genus database with same CATH homology
 1CG2 A;  4OC1 A;  2PJ5 A;  2PJ9 A;  1HDU A;  4UIB A;  1YW6 A;  3D7H A;  1F2P A;  1BPM A;  1LAP A;  3KQX A;  4MHP A;  5CPA A;  1CPX A;  2JBJ A;  3KHX A;  2FVG A;  2PVV A;  2EWB A;  2PCU A;  4NFR A;  3B2Y A;  3IFE A;  3ISX A;  5THW A;  3SJE A;  2F8H A;  5LRK A;  4IAV A;  2GRE A;  3HLP A;  4R8F A;  2CF4 A;  3NFZ A;  4FUU A;  2PVW A;  1QMU A;  2BO9 A;  2XEF A;  4P4F A;  4PXE A;  4K3N A;  1Z5R A;  4FBE A;  3FVL A;  3FF3 A;  3I1U A;  2ZEF A;  2QVP A;  2NSM A;  3TC8 A;  1H8L A;  1ZG8 A;  1CX8 A;  2IJZ A;  4JZ0 A;  1Z2L A;  1TF8 A;  3NH8 A;  4P4B A;  3CPX A;  1EE3 P;  5J1Q A;  4OIW A;  4MHZ A;  4NJQ A;  4O23 A;  4PQA A;  1XJO A;  4DUK A;  1IY7 A;  3T8W A;  2V8D A;  2J9A A;  3FX6 A;  3KAS A;  1Z8L A;  2AFU A;  2WZN A;  2PJB A;  4OID A;  3PBB A;  1CPS A;  3KL9 A;  2ZEL A;  3MN8 A;  3IWW A;  3NH5 A;  4WJB A;  4EFD A;  4OP4 A;  3KZW A;  1CP7 A;  4PXB A;  3FJU A;  2PJ7 A;  5K8M A;  4H2K A;  3VAT A;  3S9N A;  2JEW A;  2IQ6 A;  4NGM A;  2OOT A;  2PJ8 A;  2ZEP A;  2HC9 A;  3B3W A;  3PB8 X;  3IJ3 A;  5K8O A;  2ZED A;  1Y7E A;  1XBU A;  2ABZ A;  3D68 A;  4PXC A;  2POK A;  1BAV A;  1NSA A;  1LAN A;  4ONW A;  4P6Y A;  5I4M A;  3D7F A;  3ISZ A;  2ZEO A;  4YWY A;  2PJ6 A;  4OC2 A;  3TX8 A;  3CPA A;  1LCP A;  4DYO A;  1PCA A;  2C6G A;  4R6T A;  3GUX A;  5LYI A;  1R43 A;  1R3N A;  1TF9 A;  1TKF A;  3SI2 A;  4BD9 A;  4MCR A;  3IO1 A;  2PJA A;  3PB6 X;  1ZLH A;  1IGB A;  8CPA A;  2EK9 A;  3GLJ A;  3B3C A;  2V8G A;  3WC7 A;  4P10 A;  5D8N A;  2OR4 A;  2PJC A;  3BI0 A;  3PB7 X;  1HEE A;  1ZG9 A;  4G1P A;  2V8V A;  4TWE A;  1PYT B;  5LRG A;  1LFW A;  2AFX A;  2EK8 A;  2XEI A;  4R7M A;  4F9U A;  3KGQ A;  5HXD A;  4Z65 A;  3SI0 A;  2ZOF A;  4ZX9 A;  3D67 A;  3V38 A;  4NGT A;  4X3R A;  4P44 A;  4NGS A;  3PFE A;  2RB7 A;  3HUV A;  5IB9 A;  4UEF A;  4UIA A;  1BLL E;  2VL1 A;  5HVH A;  2AFM A;  1LAM A;  4NGN A;  4A39 A;  4WWV A;  1Q7L A;  3FED A;  4NGQ A;  4GM5 A;  1AMP A;  2C1C A;  4P4D A;  3H8E A;  3D7D A;  4B6Z A;  4JYW A;  4P45 A;  3SJG A;  4W9Y A;  2QYV A;  3RBU A;  3B3T A;  4F9V A;  3D7G A;  1ZLI A;  1YW4 A;  3WAB A;  4MMO A;  2DEA A;  3CT9 A;  3MRU A;  3NA6 A;  5LYF A;  1VGY A;  2PRQ A;  3KI9 A;  1DTD A;  3BXM A;  1DE4 C;  2O4H A;  4MXU A;  3PRT A;  3B7I A;  5F09 A;  1FT7 A;  3B3S A;  1VHE A;  2ZEH A;  4EWT A;  4ZY0 A;  4ZY1 A;  3IC1 A;  2AFO A;  4ZY2 A;  2PJ0 A;  2XEG A;  2PJ3 A;  1QQ9 A;  3H8F A;  4FAI A;  3DLJ A;  4IHM A;  3N5F A;  3QNV A;  3LWU A;  3BI1 A;  4OC4 A;  2ZEM A;  1XFO A;  3PB9 X;  4RUH A;  2Q51 A;  3S9M A;  4R76 A;  3B3V A;  2CTC A;  5K8P A;  4Q7A A;  1TXR A;  3WT4 A;  4MHN A;  5K8N A;  2ZEG A;  3GB0 A;  1UWY A;  3PBE A;  4OME A;  5DS0 A;  1F2O A;  2NYQ A;  3NH4 A;  2CTB A;  2PIY A;  2V77 A;  4A38 A;  3RZA A;  3VAR A;  2GLF A;  2PJ2 A;  4AXV A;  3S9L A;  1GYT A;  5LYD A;  3V7Z A;  4MHY A;  4NJR A;  2IMO A;  2CIJ A;  2QJ8 A;  2G9D A;  1M4L A;  3D4U A;  4OC0 A;  3KQZ A;  3JRU A;  4FWU A;  5JGF A;  2ZEE A;  2C6C A;  2WYR A;  2O53 A;  2PE3 A;  1ELM P;  4OKO A;  4OC5 A;  4KSI A;  2XEJ A;  2AFZ A;  2BCO A;  1OBR A;  7CPA A;  2ANP A;  4CPA A;  1TKH A;  4UEZ A;  3L2N A;  2ZEN A;  1Y0Y A;  3FMC A;  4P4E A;  3PFO A;  1ZG7 A;  1JQG A;  4MCP A;  1ELL P;  3KR5 A;  3IEH A;  4YU9 A;  1XMB A;  5D29 A;  3CDX A;  2BOA A;  1BPN A;  3SJF A;  2Q43 A;  2Q4Z A;  2HB6 A;  4IK2 A;  2JBK A;  4LQG A;  4A37 A;  4X2T A;  1LOK A;  2GLJ A;  3BHX A;  5HVG A;  4NGP A;  2PJ1 A;  1CP6 A;  3WC6 A;  1AYE A;  3D66 A;  4MCQ A;  5ELY A;  1VHO A;  3FH4 A;  3WC5 A;  4ZX8 A;  5LRJ A;  1ARL A;  3LMS A;  5HVF A;  3SI1 A;  1F57 A;  3PB4 X;  4P4I A;  4ZYQ A;  3KHZ A;  4TNU A;  3B35 A;  2I3C A;  5CBM A;  3FEE A;  3SJX A;  1KWM A;  3H8G A;  4NGR A;  1RTQ A;  6CPA A;  1YME A;  2GU2 A;  2V8H A;  1FNO A;  1HDQ A;  1YLO A;  3PEI A;  2PJ4 A;  1CBX A;  2F7V A;  1ARM A;  2RFH A;  3DGV A;  1Y0R A;  2AFW A;  4UEE A;  4DJL A;  5JH9 A;  3VH9 A;  4ZI6 A;  2C6P A;  2ZOG A;  4UF4 A;  1XRY A;  4EME A;  1YSJ A;  1TKJ A;  4F8Z A;  4OC3 A;  3KR4 A;  3K9T A;  4X8I A;  4MRI A;  3RAM A;  4PXD A;  2AFS A;  4P4J A;  4A94 A;  4MCS A;  3FEC A;  4PPZ A;  2PIZ A;  5JM6 A;  3K2K A;  5LYL A;  3IIB A;  1VIX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...