2PE3A

Crystal structure of frv operon protein frvx (ph1821)from pyrococcus horikoshii ot3
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
344
structure length
330
Chain Sequence
b'DWKLMQEIIEAPGVSGYEHLGIRDIVVDVLKEVADEVKVDKLGNVIAHFKGSSPRIMVAAHMDKIGVMVNHIDKDGYLHIVPIGGVLPETLVAQRIRFFTEKGERYGVVGVLPDWDQIVVDVGASSKEEAEEMGFRVGTVGEFAPNFTRLNEHRFATPYLDDRICLYAMIEAARQLGDHEADIYIVGSVQEEVGLRGARVASYAINPEVGIAMDVTFAKQPHDKGKIVPELGKGPVMDVGPNINPKLRAFADEVAKKYEIPLQVEPSPRPTGTDANVMQINREGVATAVLSIPIRYMHSQVELADARDVDNTIKLAKALLEELKPMDFTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 354aa long hypothetical operon protein Frv
publication title Crystal structure of frv operon protein frvx (ph1821)from pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
total genus 97
structure length 330
sequence length 344
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05343 Peptidase_M42 M42 glutamyl aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.40 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Peptidase M42, domain 2 2pe3A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2pe3A01
3PFEA 5K8PA 3NA6A 1XFOA 1GYTA 2ZEMA 4FBEA 3H8FA 3SJGA 2ZEOA 5JGFA 4IHMA 4NGNA 8CPAA 3B3WA 3IEHA 1QMUA 4F8ZA 3BI1A 2QJ8A 4ZYQA 3BHXA 3BI0A 3KHZA 4GM5A 2GU2A 1LANA 2ABZA 3NH4A 4JYWA 4X2TA 1TKFA 3S9NA 1NSAA 1ZG7A 3VATA 4NGTA 4G1PA 3PB6X 6CPAA 2EWBA 2AFZA 4NFRA 4P4JA 2FVGA 5HVHA 2POKA 1CBXA 4DYOA 4ZX8A 1YSJA 1M4LA 1QQ9A 2G9DA 3DLJA 4UEEA 3V7ZA 3JRUA 4OC1A 2ZOFA 3SI0A 3WABA 1ZG8A 2NYQA 4B6ZA 1Y0RA 1JQGA 3D7FA 3TX8A 2PJ5A 5HVFA 1YMEA 2O53A 1HDUA 3B3SA 5HXDA 3KZWA 4KSIA 2ZOGA 1CPSA 1TKJA 4K3NA 4NGQA 2AFWA 4WJBA 3CT9A 5LYIA 3BXMA 3L2NA 4W9YA 4PXDA 1VHOA 2RB7A 3LWUA 2PJ0A 3WT4A 5ELYA 4ZY0A 1ZLHA 1TXRA 3FVLA 4BD9A 3MRUA 2PJ6A 3H8GA 2PVWA 2AFUA 4A37A 4F9UA 3KGQA 4UIAA 4UEZA 2DEAA 2GREA 2ZEEA 2XEJA 1YLOA 3SJFA 2Q51A 1LOKA 4TWEA 3D66A 3PFOA 2V8GA 4YWYA 3CDXA 5IB9A 2ZEHA 3GB0A 1Y0YA 3CPAA 3IC1A 3CPXA 4PXCA 1FNOA 3PB7X 1XMBA 2V77A 1AMPA 2J9AA 4P4EA 1ELMP 2PJ7A 4IAVA 4NJQA 4FAIA 2PE3A 3PB8X 3IJ3A 4A39A 3FF3A 7CPAA 5CPAA 4ONWA 4PXBA 4MCPA 3KR4A 3K9TA 3QNVA 1CG2A 4TNUA 4P10A 2PJCA 3B2YA 4PXEA 3FEEA 1CPXA 1XJOA 4OC2A 4ZY1A 3NH8A 1Z2LA 2PJ2A 3D7HA 4X8IA 1IY7A 1EE3P 2PJAA 1CP7A 3S9MA 3T8WA 5LRKA 2PJBA 4F9VA 5J1QA 3PRTA 1PYTB 4OC5A 1LFWA 2EK8A 2RFHA 4MCRA 3S9LA 2XEGA 1R3NA 5DS0A 4OKOA 1UWYA 5THWA 4MHYA 4OIDA 2WYRA 2HB6A 5HVGA 3FEDA 3HUVA 1ZLIA 4OC4A 3KQZA 2BOAA 1TF9A 2ANPA 3I1UA 1XBUA 4OIWA 1BLLE 3B3TA 2IJZA 1IGBA 2OOTA 4MMOA 1BAVA 1Y7EA 3SI2A 4ZY2A 4P4BA 5LYLA 3D68A 2ZEGA 1FT7A 1ELLP 1LCPA 5K8MA 1KWMA 2O4HA 4A38A 4P6YA 4ZX9A 2IQ6A 4A94A 4RUHA 2XEIA 3KR5A 4O23A 3KASA 2CF4A 1PCAA 4UF4A 4EFDA 2V8DA 4IK2A 4R7MA 3B7IA 4OC3A 3B35A 2HC9A 1LAPA 2PJ4A 2IMOA 2WZNA 1CP6A 1TKHA 1BPNA 3VH9A 2AFXA 3D67A 2PIYA 5JM6A 3NFZA 1RTQA 2F7VA 4EWTA 5LYDA 3ISZA 2VL1A 2GLFA 4MXUA 3PBBA 4JZ0A 3IFEA 1F57A 4YU9A 5LRJA 3IO1A 2JEWA 1HEEA 4ZI6A 2QYVA 4AXVA 1LAMA 4MCSA 3WC6A 2PJ8A 5D8NA 2BCOA 2GLJA 2PCUA 4P4IA 5K8NA 4R6TA 3PB9X 3LMSA 4P45A 2CTCA 4CPAA 4P4FA 3D7DA 2ZENA 2ZEDA 4FUUA 5F09A 3GLJA 4MRIA 2ZELA 3ISXA 4MHNA 2ZEPA 4R8FA 3DGVA 4Z65A 4NGRA 4NGPA 1Z5RA 1Q7LA 5CBMA 3RZAA 3KI9A 3KL9A 1XRYA 3NH5A 3D4UA 1YW6A 1ARLA 3N5FA 1F2PA 2Q4ZA 2CTBA 3RBUA 3FMCA 4FWUA 1BPMA 4H2KA 3KHXA 4UEFA 3TC8A 2I3CA 2QVPA 4MCQA 4DJLA 3FX6A 1OBRA 5D29A 2PJ1A 1F2OA 2PVVA 3IIBA 4WWVA 3B3CA 1ZG9A 2XEFA 1VGYA 1CX8A 3IWWA 1YW4A 2EK9A 2C6GA 1Z8LA 3K2KA 3GUXA 4EMEA 4NGSA 3FECA 4OMEA 4P44A 3KQXA 2PJ9A 4R76A 2AFOA 2F8HA 3MN8A 4PQAA 4NGMA 3PEIA 2AFSA 1AYEA 3WC7A 2C6CA 2JBKA 5LYFA 2C6PA 4DUKA 4MHZA 3RAMA 1VHEA 2PIZA 2V8VA 4Q7AA 2NSMA 3FH4A 3B3VA 4LQGA 4UIBA 2ZEFA 3HLPA 4OP4A 4NJRA 2Q43A 1R43A 3SJXA 2V8HA 2PRQA 5JH9A 1DE4C 3PB4X 1H8LA 3D7GA 4P4DA 1VIXA 2CIJA 3H8EA 2AFMA 5I4MA 5K8OA 3FJUA 2JBJA 2C1CA 3WC5A 4X3RA 1DTDA 1HDQA 1ARMA 4PPZA 3SI1A 4MHPA 1TF8A 3SJEA 3VARA 2BO9A 3PBEA 4OC0A 3V38A 2PJ3A 2OR4A 5LRGA
chains in the Genus database with same CATH superfamily
4X06A 4PK3A 3P27A 3ZUGA 4KVME 2X85A 3H8FA 4GS4A 4F0XA 1UD5A 4UFXA 4NEXA 3IEHA 4Y9RA 2QJ8A 4XONA 4GQNA 5A89A 4ZYQA 3SLDA 3CXCB 3BHXA 5J35A 3DNSA 3JU4A 2GU2A 3G8WA 3NH4A 1TKFA 3R1KA 4PABA 4XQFA 3VATA 5J8CA 4GXHA 4KUAA 3PB6X 4UFWA 6CPAA 3PENA 1LRZA 1XMTA 1ELOA 5KTDA 4UFVA 1AIPA 5F4OA 5TRDA 3CXSA 3OEEA 2G9DA 2VZZA 2VBSA 1B6BA 5E96A 4KSAA 4L89A 1ZG8A 1I12A 2D3LA 2Z3MA 4B6ZA 4HKFA 1U6MA 2R9VA 3RY8A 5F47A 3S6HA 1YMEA 1EFCA 2DOGA 1HDUA 3ZJ0A 4JMQA 1CNFA 4KSIA 1FNMA 4RI1A 3D26A 1CPSA 2VJJA 5LYIA 2B5GA 1XB2A 1VHOA 2RB7A 3LWUA 2PJ0A 2FSRA 1WSVA 5AN9A 4ZY0A 1ZLHA 2BV3A 3FYNA 5EC4A 4BD9A 1IU8A 5H84A 4B43A 1MRZA 2X6YA 2OBRA 4UEZA 4NBSA 4RD0A 2ZL7A 2Q51A 2ATRA 2B7BA 2Q6OA 4HNWB 2C2WA 3PFOA 2V8GA 4F6AA 3GVLA 1Y0YA 2F5IA 1VQ5B 1YJ9B 1Q81D 1IYKA 3CPXA 4YEJA 4UBRA 3TOBA 4PC1A 2J9AA 2FIAA 4LUAA 4P4EA 2DETA 5FL7A 5A8AA 4DQKA 1ELMP 2PJ7A 4KS9A 1S0UA 4LBVA 4FAIA 1IJEA 3IJ3A 3W2IA 3G4SB 2BSWA 5F4JA 3RO0A 5GCNA 4QUZA 2ZPAA 2VZLA 3GIRA 4A32A 3W5VA 2WSAA 1KJZA 2QMUA 3ZZ0A 4TNUA 4P10A 3OPOA 3W2HA 3B2YA 2HQYA 1B2RA 1CPXA 5IYQA 2ZW5A 2CY2A 3NH8A 2Q6LA 4ZGNB 3TO9A 1Z2LA 2EO8A 1EE3P 1R5OA 3T8WA 5KTCA 2PJBA 3W2GA 3OW7A 4ASUA 4Z4YA 2R98A 1FX0A 4H9GA 4OKOA 5H86A 1Z4EA 3SLNA 1WP6A 4XPLA 2Q0YA 5HVGA 3WYAA 2B3VA 4OC4A 2LZJA 2NPFA 1TF9A 2ANPA 1XBUA 4NCNA 2BSAA 4MFKA 2ZITA 5G1ZA 3OOCA 2PRBA 4M3SA 4Q38A 3FKSA 3UY5A 4BMHA 4HNXB 5HXBA 4HPSA 1Y7EA 2K5TA 4P4BA 2VNKA 4Z4TA 4A38A 2ZZGA 4ONUA 1EWYA 2Q7BA 4XM3A 3VWEA 1YHQB 2ZTGA 3OWCA 2GQFA 4TN1A 4YELA 3KR5A 4L8JA 2VNHA 2AHOA 2CF4A 4MFZA 1M44A 4R87A 3VWDA 4UZFA 4PK2A 4IK2A 1U2RA 4MBUA 2CNTA 4TKOB 2D4PA 4KOVA 1B87A 3B35A 1X12A 2HC9A 4PAAA 4XLAA 2OTJB 3B8GA 3VR6A 4XL9A 2PJ4A 1LAPA 2WZNA 1VQNB 1OGIA 2AFXA 2PIYA 2DEUA 4UZEA 5JBQA 4QVAA 3GVJA 2C77A 4PSXA 1UFHA 3CCLB 3ISZA 4I49A 4XNFA 4FXUA 2QN6A 2I00A 4Y49C 4B3GA 3IO1A 2VJIA 1HEEA 3IWEA 4J0QA 3WC6A 4ACAA 4P9SA 4MFPA 1VLOA 2YWHA 4WZLA 5K8NA 1EP3B 1JA0A 2EIXA 3LMSA 5IYRA 4XLHA 4CPAA 3R6KA 1Z4RA 3D7DA 1PJ6A 4MRIA 1YITB 1IICA 1KD1D 3ISXA 4MHNA 4R8FA 4NGRA 4QVTA 4MY3A 3RZAA 4ZGYB 4MFLA 3SHPA 4CYPA 1XRYA 3D4UA 4RJLA 1YW6A 4X07A 1ARLA 3N5FA 2CTBA 4FWUA 2XNJA 2OK8A 3KHXA 3PA2A 1V5VA 2BUEA 2AE6A 4XD7A 2VXKA 2Z6BD 3BLNA 1E63A 4XOTA 3CD6B 3WNDA 1RQPA 3N7ZA 4X7EA 2FT0A 4BPRA 1F2OA 3IIBA 2CXAA 2HLDA 3U2QA 4KOSA 4P26A 3KEWA 4RD4A 3T90A 1YW4A 1Z9UA 2EK9A 3FPKA 2X6XA 3W2EA 1M4DA 2V7WA 2DPTA 3K2KA 4RN7A 4EMEA 1QVFB 1WOSA 1YLEA 3AGPA 3BH4A 3KQXA 1VQOB 1E3ZA 3MN8A 4XOPA 1P4MA 1QFZA 4RD1A 2C6CA 3W6SA 1VHEA 3T56B 4Z4ZA 4Q7AA 3FH4A 4Q7JB 3RNZA 4OP4A 5JH9A 2F4NA 5G21A 3BY2A 5H5JA 2CIJA 3H8EA 3ASSA 4CGOA 3FJUA 5K8OA 4C43A 4LBWA 2C1CA 3PP9A 3S6KA 4XR6A 3QB8A 4X3RA 5FO0A 4C0SA 4HNYB 4PPZA 3SI1A 3A3BA 2JJ2A 2Q6IA 3QAYA 2VZYA 2C78A 1M90D 3PBEA 1COWA 2RC4A 4OC0A 4FD6A 2XGJA 2YWGA 3TO7A 3D2MA 3BCDA 2Z3NA 3JQPA 4YGOA 4A30A 4B12A 1GYTA 2EUIA 4N3NA 3H5ZA 2C4TA 2G3AA 5AGEA 1WPCA 4IHMA 4NGNA 2WJVA 2X53S 3Q6QA 5IV0A 2ZW4A 3LVBA 1JA1A 4B3XA 3BI1A 2QIRA 4NXYA 2KCWA 4MHDA 1OB2A 1LANA 2P6EA 4TMTA 4XN0A 4X2TA 1ZM3A 3GVKA 4XPKA 5AG6A 2X6WA 3W5HA 1NSAA 4FD4A 5FVJA 2XZPA 5E6TA 2BN4A 4R9MA 3IU1A 2KVOA 1H8HA 4KLVA 4RPBA 2FXFA 4NFRA 2YWEA 1KZLA 4P4JA 1VQ8B 2FVGA 4FN5A 2VEZA 2RC5A 5THXA 5F49A 3W5UA 4DK0A 2GANA 1NE9A 4DYOA 2FX3A 4AVAA 2FL4A 2QA4B 1M4LA 1QQ9A 3MCAA 3DLJA 4UEEA 1W34A 2O28A 3TFYA 1J4JA 1QH0A 4YALA 4OC1A 4KOXA 3SI0A 1VQ6B 3WABA 2CNMA 4XLEA 3QFSA 5KW9A 4DNTB 1M4IA 2YNCA 1JQGA 4UZUA 1WU8A 4QC6A 3TX8A 2B5GB 4Y49B 4TMVA 4DQLA 2O53A 5HXDA 3TTHA 1QGYA 2G0BA 2AJ6A 2ZOGA 4E8OA 3KKWA 4NGQA 2AFWA 5CDFA 2BPOA 1M4GA 2X7BA 2OZGA 3BXMA 3ASPA 3PUMA 4KOWA 3V7AA 1DDIA 1W9XA 3WT4A 5ELYA 2RC6A 1TXRA 4C7IA 5JPHA 3FVLA 2JDIA 1N0VC 2QTLA 1BO4A 4YAWA 2PJ6A 3H8GA 2PVWA 3H94A 2AFUA 4A37A 4NNJA 3I56B 2V4DA 4CQJA 2DEAA 5AG7A 1MJ9A 2ZEEA 3SJFA 3A1PA 1FRQA 4C7HA 1YIJB 1LOKA 4P3YA 1XEBA 4M53A 3D66A 4M6GA 3CDXA 2X8KA 2WPWA 3CPAA 1VQPB 1TTTA 3IC1A 4LQ6A 1FNOA 4UWJA 2J8NA 1GAWA 1EFUA 1XMBA 1Q9SA 5JQ4A 2Y0MA 1BPLA 1AMPA 2GK7A 2GJKA 2BGJA 1Y9WA 4IAVA 1L0CA 3OFNA 4JJXA 4A39A 1H8EA 2VNJA 4PXBA 4MCPA 1Q86D 4M1KA 1YX2A 2CNSA 1VKCA 3FJOA 4TMWA 2F43A 1JWQA 4C68A 3HAGA 4J3GA 1P4NA 1IHMA 2ZW6A 1E64A 4XN3A 4ZV4A 2JLMA 1FY7A 2PJCA 4PXEA 3FEEA 4LC0A 1XJOA 2ZL6A 4MYUA 4QV2A 4JXRA 2OU2A 3D7HA 4C2YA 1E1QA 3S9MA 1YGHA 4ZCLA 2ARHA 5LRKA 4F9VA 1Y9KA 3ZBTA 1S4MA 1VQ4B 3PRTA 1FRNA 1S72B 4BBHA 3OP1A 4OC5A 1UD4A 4RD6A 4YAUA 3GY9A 2Z3PA 3S9LA 4B47A 2XEGA 1R3NA 3SEJA 1UWYA 3F5BA 3PVDA 2V7QA 3PZJA 3CCMB 3NE8A 3FEDA 3B78A 1ZLIA 3HUVA 4QBJA 3IU2A 3OZWA 4ZBGA 3AVWA 1K73D 4DNCA 2F1LA 2F1MA 4PC3A 4P22A 1UD3A 4LBYA 4MMOA 1BAVA 3R6JA 2JN9A 2OZHA 1UD8A 5TR9A 1ELLP 1FT7A 1LCPA 1YVOA 2GFQA 1NJID 4A95A 2D4OA 4R3LA 1IIDA 2IQ6A 4RUHA 2XEIA 1TVCA 5A28A 3EY5A 1GAQA 1ON0A 2WZPP 4E2AA 1MJBA 4EFDA 1Q2DA 4II3A 4R7MA 2GJPA 2YNCC 4OC3A 1BMFA 4G7XA 3A35A 3W2FA 2OTLB 3H4QA 1CP6A 2DIEA 1BPNA 2QEXB 4KLWA 3VH9A 1KTVA 1ZM9A 2J8MA 1KK2A 1DG1G 2QGGA 2CBXA 3U6BA 2F7VA 3JQRA 3FNCA 5LYDA 4CYNA 3ASTA 5C82A 2VL1A 3F0AA 5LMZA 3OE7A 1EP1B 3PBBA 4UAJA 4Z4WA 4JZ0A 3IFEA 1F57A 3CCUB 5LRJA 2PC1A 4K30A 4ORFA 2QYVA 4YHBA 2E1RA 1LAMA 4MCSA 4XKVA 2H5MA 5EMNA 1EFTA 5D8NA 5G22A 2PCUA 3CESA 4P4IA 4CYQA 1N0UA 2VBQA 1R57A 5IYWA 4CRZB 4P45A 4P4FA 4AVZA 3OAAA 4Y9UA 2ZEDA 1PJ7A 2B3UA 1IOIA 1WORA 2WSSA 1MK4A 1S3ZA 2Q04A 1K9MD 3CC2B 2ZEPA 4PSWA 1SKQA 1IB0A 2X3UA 1A8PA 1EP2B 5CBMA 2J8RA 4PGOA 3CB4A 5BSXA 4UCPA 2Z11A 5IYPA 4KOUA 3LQ6A 3I55B 1RQRA 1V0FA 3AVUA 3TC8A 4PC6A 5IYNA 2PLFA 2QVPA 4MCQA 3RYOA 4DJLA 1VLYA 1OBRA 3R96A 2JDDA 1BX0A 1ZG9A 1CQXA 1CX8A 5HZBA 3IWWA 1KUYA 1YREA 2PQ8A 3B82A 4KVOE 4B3FX 3TE4A 1VQLB 3GUXA 4NGSA 4OPOA 4XNHC 1IJFA 4R76A 2AFOA 2WUUA 4A2ZA 3D3SA 2BEIA 4UWIA 4WZEA 1K4JA 4N3GA 4NGMA 2AFSA 1R5BA 5FO1A 1AYEA 3WC7A 4MHZA 3RAMA 1Q7YD 4HE6A 2PIZA 3R95A 1WK4A 2NSMA 3BQJA 3LO8A 3I3GA 3HLPA 3SJXA 4UA3A 1DE4C 4CAEA 4JD6A 2AFMA 4AVCA 2B7CA 3W91A 3WC5A 1NSLA 2I79A 1DTDA 4P1VA 3R9EA 4MHPA 2ZL5A 1TF8A 3SJEA 4MYTA 2BO9A 1EFRA 2BVNA 4CGNA 4EVYA 2OBSA 5AG5A 1K28D 1YJNB 2OR4A 3T9YA 2C4UA 2VQYA 5DSZA 4F7DA 3WBKA 1VQ7B 3AVXA 1W0JA 2ZEOA 5BWAB 2DY1A 5JGFA 4IW3B 1QUEA 4WZKA 1QMUA 4M85A 1I8DA 1RXTA 2WPDA 4Z4UA 3BI0A 3OW2B 3KHZA 4GM5A 2VNIA 2P6GA 1DARA 3WY9A 1KK1A 1QSTA 1G7RA 1IB1E 3S9NA 1HVXA 3CCSB 1YK3A 4NGTA 4G1PA 1I1DA 2DXQA 4OLLA 3BY1A 3WBJA 1Z8WA 1WWZA 2ZXHA 3I9SA 1NMTA 5HVHA 2V31A 2POKA 1CBXA 4ZX8A 2ZXIA 5HMNA 1YSJA 3V8IA 1G7CA 1QFYA 1KQSB 1OB0A 4G1VA 3JRUA 1Q82D 2VI7A 2Z3KA 3CMMA 3CCEB 5TV2A 3F8KA 4UCMA 1HZEA 2NYQA 4RD2A 2FIWA 3D7FA 1KRHA 5HVFA 3ASQA 4CYOA 4OOSA 3GIUA 3DR8A 3JVNA 1FDRA 5A27A 2BM1A 1TKJA 4K3NA 3R9FA 5B6IA 4C2XA 4WJBA 3CT9A 1T6ZA 3T53B 4W9YA 4PXDA 1M1KD 4X7FA 4Z4VA 4NCZA 1S60A 4QFMA 4PC2A 3Q3AA 4KZTA 4F9UA 3OZUA 3KGQA 2GE3A 3EXNA 1WDTA 1D1NA 2XEJA 1YLOA 4P6VF 1KUXA 4TWEA 3C26A 1QG0A 2ZEHA 3GB0A 4G5GA 3OZVA 2VYQA 1QSMA 3FRMA 1KK0A 1E62A 4OAEA 4B44A 1W35A 2CRVA 1BOBA 2WPXA 2HDNB 1UD2A 4NJQA 4ZCMA 2PE3A 3PB8X 3G71B 3QAHA 4QHYA 4F0YA 4HE5A 3FF3A 7CPAA 1N07A 3KR4A 4CRYB 1MJAA 1VQMB 3QNVA 1E79A 3CZXA 4CS0B 2BF4A 3EO4A 4OC2A 4XNHB 5EBVA 4HIZA 2PJ2A 2B5OA 3A3GA 1R5NA 1IY7A 4MY0A 4H6ZA 1CP7A 3AGQA 1PYTB 3TCVA 4B5OA 1H85A 4JWPA 3QE2A 2RFHA 4LBZA 5DS0A 1N06A 5THWA 5DN6A 4OIDA 5IB0A 4Z1MA 3I1FA 3VNVA 2OK7A 1PUAA 2REFA 2HMAA 2BOAA 3I1UA 2JDCA 4OIWA 2REEA 2PDOA 3DR6A 3R9GA 1WOOA 2BM0A 4AB7A 2ODFA 1TLLA 2OOTA 2ZZQA 1FNDA 1KZFA 3CPWB 2DERA 2ZW7A 3D68A 2QMLA 4AF6A 1D2EA 3H9NA 3S6GA 2VBUA 4P6YA 4ZX9A 3E20A 3CC4B 4OP7A 4OOVA 1GHEA 3EC4A 2QE7A 3KASA 5H59A 4UF4A 1E3XA 1T5EA 2M5SA 3QFCA 1G7TA 1F60A 1QSRA 1CJWA 1I18A 4NF1A 4IUSA 2R6HA 4CGMA 4CGLA 4ZGQB 1I21A 2XZOA 2A4NA 2CC2A 3D67A 3E1YE 3SJZA 4P3IA 4XPDC 4P25A 4M6IA 1RTQA 4EWTA 1VHSA 2PIAA 1XE1A 2FCKA 3MMPA 2XOKA 1W87A 1YI2B 4FWTA 2ZZFA 4YFJA 1E1RA 4G1BA 4FD5A 1NB0A 2Z3LA 2B4DA 4TSFA 4AXVA 2NV4A 2E1BA 1WTHD 3V76A 3W6XA 1T6YA 4R6TA 3PB9X 2Z10A 2DPSA 3WNCA 3CP2A 4A33A 3LODA 4FUUA 2YWFA 4CAWA 1MABA 4DNRB 1VJSA 3ONYA 2GPJA 2NMTA 5IX3A 3DGVA 4Z65A 3CXPA 1Z5RA 4Q36A 4FK8A 3QFRA 3DDYA 2FE7A 2DYIA 3IGRA 3KI9A 3KL9A 1OZPA 5CNPA 3NH5A 4Z4RA 4Z4SA 4KOYA 3BCFA 2FS5A 3OKXA 5GV8A 4Y7CA 1F2PA 3U6KA 2Q4ZA 1VQKB 3RBUA 3FMCA 3Q39A 3CC7B 4JXQA 2D9RA 4UEFA 3OJWA 1G7SA 1NB9A 3GSIA 4B14A 1RO5A 2V7TA 5D29A 2PJ1A 2P6FA 4B13A 1S7NA 2XEFA 1ZM2A 3ONUA 4YAOA 1TIQA 2IL4A 3J81k 1IYLA 4ACBA 1X10A 2JEVA 4U9ZA 2C5BA 3E0KA 1QGZA 2OBTA 4U9UA 4P44A 4XLFA 3SJPA 1PU9A 2QDXA 4OOXA 3A8JA 4P2NA 4PQAA 3PEIA 3NE7A 1SQHA 5LYFA 2C6PA 2PR8A 4DUKA 2V8VA 1K8AD 3WR7A 1Z8XA 3B3VA 4LQGA 4H6UA 1R43A 2P3MA 2V8HA 5F4MA 2PRQA 2ZXVA 4R57A 1A2ZA 3D7GA 4RD3A 5I4MA 3S6FA 2JBJA 4KKTA 1YJWB 1ARMA 3DSBA 3ZC3A 3A8IA 4CGPA 2Q4VA 3D8PA 2JIZA 3V38A 3ZIAA 4MJ8A 1S7KA 4BINA 3PFEA 2Q44A 5K8PA 1BLIA 3NA6A 1XFOA 2R7HA 3JQQA 2Z0ZA 2ZEMA 4FBEA 2R1IA 3SJGA 1Z8TA 3VMFA 3OJXA 3B3WA 5DWNA 8CPAA 3IWGA 4KUBA 2ZZEA 4F8ZA 1Y7RA 3ZPNA 3FIXA 3P26A 4B5PA 1W0KA 3PUNA 3MGDA 1XQBA 1T6XA 4NSQA 3CRZA 1XE4A 2ABZA 4JYWA 2B58A 1BX1A 4OADA 1ZG7A 4L8AA 3K9UA 3JUWA 2DF5A 3MHPA 4QUSA 4X0CA 2EWBA 2AFZA 2EFGA 2JJ1A 4YRHA 4AVBA 2X0KA 1ZO0A 4X05A 3FPPA 3CCVB 3CMEB 4WZTA 4B11A 3CCJB 2VBTA 2D74A 5FA6A 4QB9A 1QVGB 1QGAA 3V7ZA 4RDKA 2YNEA 3Q6RA 2ZOFA 5KTAA 1V0EA 4XPDB 4CAVA 2BL1A 1Y0RA 4OPVA 5A88A 2VBVA 2PJ5A 3BNWA 3ZZTA 1GR1A 4M4SA 1QX4A 1NBMA 1QFJA 4MFQA 5GV7A 4B4DA 4A31A 4AG9A 1V0CA 2EBJA 3ASRA 3B3SA 3FXTA 3KZWA 2V7VA 5DWMA 1WSRA 2D3NA 4XKWA 1XIXA 2Q6KA 1KMHA 3L2NA 3AVTA 5J3OA 5C88A 4II9A 2YGWA 1XF8A 2C5HA 2QECA 4P12A 3MRUA 1YR0A 2PR1A 4B10A 4UIAA 5J8FA 1I7PA 2GREA 3CP8A 4G7WA 1TUIA 3B8HA 1IOFA 3WXMA 3EFAA 5I0CA 2W6JA 4YWYA 1ZUNB 5IB9A 3G3SA 4CAFA 2Z3OA 4PXCA 1KK3A 4XMYA 3PB7X 2V77A 3VNUA 1OGJA 1S5KA 4RDJA 3T51B 1ZM4A 3CMAB 1HA3A 4OPSA 3LD2A 1F20A 3GQBA 4R71A 1S7LA 2DCUA 4ONWA 5CPAA 1S7FA 4YAFA 3GKRA 3K9TA 1CG2A 1YX0A 1M1DA 3CCQB 2P0WA 4QVJA 4ZY1A 4IF5A 2CK3A 1JB9A 4X8IA 3LQEA 2PJAA 1VQ9B 3LACA 3CW2A 1UD6A 4XORA 4AC9A 2HV2A 1D8TA 5J1QA 2HCJB 2OZUA 1PJ5A 1LFWA 2EK8A 5G20A 5HH1A 4MCRA 3A8KA 4MHYA 4YXWA 1J9ZA 4EH1A 2CNDA 2WYRA 5F48A 2HB6A 2BGIA 4X7CA 1W2BB 3KQZA 5F46A 1BLLE 3B3TA 4KVXA 3FB3A 2IJZA 4PC7A 1IGBA 4X5KA 3CXQA 5IK2A 1AMOA 3SI2A 4ZY2A 1AUGA 2XNCA 5LYLA 2ZEGA 2ZBVA 5K8MA 2B4BA 1JNYA 1KWMA 1YVKA 2O4HA 4MI4A 5FIUA 2CW5A 4RLZA 1WOPA 2QTZA 4TMZA 4A94A 1KC8D 5KSWB 4II2A 3QFTA 4O23A 2PSWA 1B23P 1PCAA 1UMKA 2J7KA 2W6IA 2V8DA 5HZAA 2I1LA 3PA1A 4KKUA 4AF7A 3NE5B 3B7IA 4RPDA 2Q4YA 2OB0A 4UCNA 4K1XA 2IMOA 3SKBA 2B4DB 1TKHA 2WJYA 3DDDA 3WQZA 2PMDA 1GVHA 5BSYA 5JM6A 4RDLA 3NFZA 2XZLA 1N71A 1GJRA 3P2HA 3SXOA 3TO6A 1GO2A 2GLFA 4MXUA 4U9YA 4YU9A 3TT2A 4X7DA 1QSNA 2JEWA 1Q2CA 4ZI6A 4E0AA 1PKVA 3PGPA 2YNDA 2OYNA 2PJ8A 3ZZIA 2BCOA 2GLJA 2C27A 5EMIA 1N8RD 1KUVA 4WQMA 4FD7A 1OHHA 2CTCA 3P2FA 4KOTA 2HUZA 4XLCA 2ZENA 3BJ8A 2BMWA 5F09A 3GLJA 3A9LA 3CCRB 2ZELA 4RS2A 1YQEA 1FNBA 4M0LA 2OH1A 2V7XA 3ZZUA 1N05A 3OEHA 2GK6A 4AG7A 3AVYA 4NGPA 3Q38A 1SM4A 4TT3A 3WNBA 1Q7LA 5AG4A 4KORA 1H42A 1EXMA 4ZCIA 1XOVA 3CTAA 4U5YA 1P0HA 1N08A 4G6IA 4E0FA 1BPMA 4H2KA 4LX9A 2XNDA 4DK1A 1JJ2B 4ROXA 1SKYB 2I3CA 4JLYA 3FX6A 3SXNA 3GYAA 3BJ7A 2PVVA 4WWVA 1FNCA 3B3CA 2GJRA 1VGYA 1Q2YA 3FBUA 4M6HA 4B48A 2C6GA 3QSYA 1Z8LA 4RCZA 3ZBUA 1QSOA 3VO2A 3AVVA 4KSFA 1QUFA 3FECA 3ES9A 4OMEA 3TOAA 2PJ9A 2EVNA 4MFJA 1CNEA 2F8HA 4TMXA 2XEXA 1NDHA 1BJKA 4C2ZA 4RM0A 5ISVA 1CM0A 4RCYA 4KKSA 2JBKA 4M2LA 3G05A 2GIVA 3VO1A 4R3KA 1BQEA 2ZBUA 2ZTNA 1DDGA 4UIBA 2ZEFA 4H89A 1NRKA 4NJRA 2Q43A 4CAXA 3PB4X 1H8LA 5KNLA 4P4DA 1VIXA 3D2PA 5HKKA 3BC9A 4PV6A 2Q7SA 2R8VA 1E43A 3LNNA 3JTKA 1HDQA 2V7UA 2WR8A 5L46A 3G6EB 1VF7A 3VARA 5TY0A 2PJ3A 2G3TA 5FNZA 1OB5A 5LRGA 4B5PB
chains in the Genus database with same CATH topology
3PFEA 5K8PA 3NA6A 1XFOA 1GYTA 2ZEMA 4FBEA 3H8FA 3SJGA 2ZEOA 5JGFA 4IHMA 4NGNA 8CPAA 3B3WA 3IEHA 1QMUA 4F8ZA 3BI1A 2QJ8A 4ZYQA 3BHXA 3BI0A 3KHZA 4GM5A 2GU2A 1LANA 2ABZA 3NH4A 4JYWA 4X2TA 1TKFA 3S9NA 1NSAA 1ZG7A 3VATA 4NGTA 4G1PA 3PB6X 6CPAA 2EWBA 2AFZA 4NFRA 4P4JA 2FVGA 5HVHA 2POKA 1CBXA 4DYOA 4ZX8A 1YSJA 1M4LA 1QQ9A 2G9DA 3DLJA 4UEEA 3V7ZA 3JRUA 4OC1A 2ZOFA 3SI0A 3WABA 1ZG8A 2NYQA 4B6ZA 1Y0RA 1JQGA 3D7FA 3TX8A 2PJ5A 5HVFA 1YMEA 2O53A 1HDUA 3B3SA 5HXDA 3KZWA 4KSIA 2ZOGA 1CPSA 1TKJA 4K3NA 4NGQA 2AFWA 4WJBA 3CT9A 5LYIA 3BXMA 3L2NA 4W9YA 4PXDA 1VHOA 2RB7A 3LWUA 2PJ0A 3WT4A 5ELYA 4ZY0A 1ZLHA 1TXRA 3FVLA 4BD9A 3MRUA 2PJ6A 3H8GA 2PVWA 2AFUA 4A37A 4F9UA 3KGQA 4UIAA 4UEZA 2DEAA 2GREA 2ZEEA 2XEJA 1YLOA 3SJFA 2Q51A 1LOKA 4TWEA 3D66A 3PFOA 2V8GA 4YWYA 3CDXA 5IB9A 2ZEHA 3GB0A 1Y0YA 3CPAA 3IC1A 3CPXA 4PXCA 1FNOA 3PB7X 1XMBA 2V77A 1AMPA 2J9AA 4P4EA 1ELMP 2PJ7A 4IAVA 4NJQA 4FAIA 2PE3A 3PB8X 3IJ3A 4A39A 3FF3A 7CPAA 5CPAA 4ONWA 4PXBA 4MCPA 3KR4A 3K9TA 3QNVA 1CG2A 4TNUA 4P10A 2PJCA 3B2YA 4PXEA 3FEEA 1CPXA 1XJOA 4OC2A 4ZY1A 3NH8A 1Z2LA 2PJ2A 3D7HA 4X8IA 1IY7A 1EE3P 2PJAA 1CP7A 3S9MA 3T8WA 5LRKA 2PJBA 4F9VA 5J1QA 3PRTA 1PYTB 4OC5A 1LFWA 2EK8A 2RFHA 4MCRA 3S9LA 2XEGA 1R3NA 5DS0A 4OKOA 1UWYA 5THWA 4MHYA 4OIDA 2WYRA 2HB6A 5HVGA 3FEDA 3HUVA 1ZLIA 4OC4A 3KQZA 2BOAA 1TF9A 2ANPA 3I1UA 1XBUA 4OIWA 1BLLE 3B3TA 2IJZA 1IGBA 2OOTA 4MMOA 1BAVA 1Y7EA 3SI2A 4ZY2A 4P4BA 5LYLA 3D68A 2ZEGA 1FT7A 1ELLP 1LCPA 5K8MA 1KWMA 2O4HA 4A38A 4P6YA 4ZX9A 2IQ6A 4A94A 4RUHA 2XEIA 3KR5A 4O23A 3KASA 2CF4A 1PCAA 4UF4A 4EFDA 2V8DA 4IK2A 4R7MA 3B7IA 4OC3A 3B35A 2HC9A 1LAPA 2PJ4A 2IMOA 2WZNA 1CP6A 1TKHA 1BPNA 3VH9A 2AFXA 3D67A 2PIYA 5JM6A 3NFZA 1RTQA 2F7VA 4EWTA 5LYDA 3ISZA 2VL1A 2GLFA 4MXUA 3PBBA 4JZ0A 3IFEA 1F57A 4YU9A 5LRJA 3IO1A 2JEWA 1HEEA 4ZI6A 2QYVA 4AXVA 1LAMA 4MCSA 3WC6A 2PJ8A 5D8NA 2BCOA 2GLJA 2PCUA 4P4IA 5K8NA 4R6TA 3PB9X 3LMSA 4P45A 2CTCA 4CPAA 4P4FA 3D7DA 2ZENA 2ZEDA 4FUUA 5F09A 3GLJA 4MRIA 2ZELA 3ISXA 4MHNA 2ZEPA 4R8FA 3DGVA 4Z65A 4NGRA 4NGPA 1Z5RA 1Q7LA 5CBMA 3RZAA 3KI9A 3KL9A 1XRYA 3NH5A 3D4UA 1YW6A 1ARLA 3N5FA 1F2PA 2Q4ZA 2CTBA 3RBUA 3FMCA 4FWUA 1BPMA 4H2KA 3KHXA 4UEFA 3TC8A 2I3CA 2QVPA 4MCQA 4DJLA 3FX6A 1OBRA 5D29A 2PJ1A 1F2OA 2PVVA 3IIBA 4WWVA 3B3CA 1ZG9A 2XEFA 1VGYA 1CX8A 3IWWA 1YW4A 2EK9A 2C6GA 1Z8LA 3K2KA 3GUXA 4EMEA 4NGSA 3FECA 4OMEA 4P44A 3KQXA 2PJ9A 4R76A 2AFOA 2F8HA 3MN8A 4PQAA 4NGMA 3PEIA 2AFSA 1AYEA 3WC7A 2C6CA 2JBKA 5LYFA 2C6PA 4DUKA 4MHZA 3RAMA 1VHEA 2PIZA 2V8VA 4Q7AA 2NSMA 3FH4A 3B3VA 4LQGA 4UIBA 2ZEFA 3HLPA 4OP4A 4NJRA 2Q43A 1R43A 3SJXA 2V8HA 2PRQA 5JH9A 1DE4C 3PB4X 1H8LA 3D7GA 4P4DA 1VIXA 2CIJA 3H8EA 2AFMA 5I4MA 5K8OA 3FJUA 2JBJA 2C1CA 3WC5A 4X3RA 1DTDA 1HDQA 1ARMA 4PPZA 3SI1A 4MHPA 1TF8A 3SJEA 3VARA 2BO9A 3PBEA 4OC0A 3V38A 2PJ3A 2OR4A 5LRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PFE A;  5K8P A;  3NA6 A;  1XFO A;  1GYT A;  2ZEM A;  4FBE A;  3H8F A;  3SJG A;  2ZEO A;  5JGF A;  4IHM A;  4NGN A;  8CPA A;  3B3W A;  3IEH A;  1QMU A;  4F8Z A;  3BI1 A;  2QJ8 A;  4ZYQ A;  3BHX A;  3BI0 A;  3KHZ A;  4GM5 A;  2GU2 A;  1LAN A;  2ABZ A;  3NH4 A;  4JYW A;  4X2T A;  1TKF A;  3S9N A;  1NSA A;  1ZG7 A;  3VAT A;  4NGT A;  4G1P A;  3PB6 X;  6CPA A;  2EWB A;  2AFZ A;  4NFR A;  4P4J A;  2FVG A;  5HVH A;  2POK A;  1CBX A;  4DYO A;  4ZX8 A;  1YSJ A;  1M4L A;  1QQ9 A;  2G9D A;  3DLJ A;  4UEE A;  3V7Z A;  3JRU A;  4OC1 A;  2ZOF A;  3SI0 A;  3WAB A;  1ZG8 A;  2NYQ A;  4B6Z A;  1Y0R A;  1JQG A;  3D7F A;  3TX8 A;  2PJ5 A;  5HVF A;  1YME A;  2O53 A;  1HDU A;  3B3S A;  5HXD A;  3KZW A;  4KSI A;  2ZOG A;  1CPS A;  1TKJ A;  4K3N A;  4NGQ A;  2AFW A;  4WJB A;  3CT9 A;  5LYI A;  3BXM A;  3L2N A;  4W9Y A;  4PXD A;  1VHO A;  2RB7 A;  3LWU A;  2PJ0 A;  3WT4 A;  5ELY A;  4ZY0 A;  1ZLH A;  1TXR A;  3FVL A;  4BD9 A;  3MRU A;  2PJ6 A;  3H8G A;  2PVW A;  2AFU A;  4A37 A;  4F9U A;  3KGQ A;  4UIA A;  4UEZ A;  2DEA A;  2GRE A;  2ZEE A;  2XEJ A;  1YLO A;  3SJF A;  2Q51 A;  1LOK A;  4TWE A;  3D66 A;  3PFO A;  2V8G A;  4YWY A;  3CDX A;  5IB9 A;  2ZEH A;  3GB0 A;  1Y0Y A;  3CPA A;  3IC1 A;  3CPX A;  4PXC A;  1FNO A;  3PB7 X;  1XMB A;  2V77 A;  1AMP A;  2J9A A;  4P4E A;  1ELM P;  2PJ7 A;  4IAV A;  4NJQ A;  4FAI A;  2PE3 A;  3PB8 X;  3IJ3 A;  4A39 A;  3FF3 A;  7CPA A;  5CPA A;  4ONW A;  4PXB A;  4MCP A;  3KR4 A;  3K9T A;  3QNV A;  1CG2 A;  4TNU A;  4P10 A;  2PJC A;  3B2Y A;  4PXE A;  3FEE A;  1CPX A;  1XJO A;  4OC2 A;  4ZY1 A;  3NH8 A;  1Z2L A;  2PJ2 A;  3D7H A;  4X8I A;  1IY7 A;  1EE3 P;  2PJA A;  1CP7 A;  3S9M A;  3T8W A;  5LRK A;  2PJB A;  4F9V A;  5J1Q A;  3PRT A;  1PYT B;  4OC5 A;  1LFW A;  2EK8 A;  2RFH A;  4MCR A;  3S9L A;  2XEG A;  1R3N A;  5DS0 A;  4OKO A;  1UWY A;  5THW A;  4MHY A;  4OID A;  2WYR A;  2HB6 A;  5HVG A;  3FED A;  3HUV A;  1ZLI A;  4OC4 A;  3KQZ A;  2BOA A;  1TF9 A;  2ANP A;  3I1U A;  1XBU A;  4OIW A;  1BLL E;  3B3T A;  2IJZ A;  1IGB A;  2OOT A;  4MMO A;  1BAV A;  1Y7E A;  3SI2 A;  4ZY2 A;  4P4B A;  5LYL A;  3D68 A;  2ZEG A;  1FT7 A;  1ELL P;  1LCP A;  5K8M A;  1KWM A;  2O4H A;  4A38 A;  4P6Y A;  4ZX9 A;  2IQ6 A;  4A94 A;  4RUH A;  2XEI A;  3KR5 A;  4O23 A;  3KAS A;  2CF4 A;  1PCA A;  4UF4 A;  4EFD A;  2V8D A;  4IK2 A;  4R7M A;  3B7I A;  4OC3 A;  3B35 A;  2HC9 A;  1LAP A;  2PJ4 A;  2IMO A;  2WZN A;  1CP6 A;  1TKH A;  1BPN A;  3VH9 A;  2AFX A;  3D67 A;  2PIY A;  5JM6 A;  3NFZ A;  1RTQ A;  2F7V A;  4EWT A;  5LYD A;  3ISZ A;  2VL1 A;  2GLF A;  4MXU A;  3PBB A;  4JZ0 A;  3IFE A;  1F57 A;  4YU9 A;  5LRJ A;  3IO1 A;  2JEW A;  1HEE A;  4ZI6 A;  2QYV A;  4AXV A;  1LAM A;  4MCS A;  3WC6 A;  2PJ8 A;  5D8N A;  2BCO A;  2GLJ A;  2PCU A;  4P4I A;  5K8N A;  4R6T A;  3PB9 X;  3LMS A;  4P45 A;  2CTC A;  4CPA A;  4P4F A;  3D7D A;  2ZEN A;  2ZED A;  4FUU A;  5F09 A;  3GLJ A;  4MRI A;  2ZEL A;  3ISX A;  4MHN A;  2ZEP A;  4R8F A;  3DGV A;  4Z65 A;  4NGR A;  4NGP A;  1Z5R A;  1Q7L A;  5CBM A;  3RZA A;  3KI9 A;  3KL9 A;  1XRY A;  3NH5 A;  3D4U A;  1YW6 A;  1ARL A;  3N5F A;  1F2P A;  2Q4Z A;  2CTB A;  3RBU A;  3FMC A;  4FWU A;  1BPM A;  4H2K A;  3KHX A;  4UEF A;  3TC8 A;  2I3C A;  2QVP A;  4MCQ A;  4DJL A;  3FX6 A;  1OBR A;  5D29 A;  2PJ1 A;  1F2O A;  2PVV A;  3IIB A;  4WWV A;  3B3C A;  1ZG9 A;  2XEF A;  1VGY A;  1CX8 A;  3IWW A;  1YW4 A;  2EK9 A;  2C6G A;  1Z8L A;  3K2K A;  3GUX A;  4EME A;  4NGS A;  3FEC A;  4OME A;  4P44 A;  3KQX A;  2PJ9 A;  4R76 A;  2AFO A;  2F8H A;  3MN8 A;  4PQA A;  4NGM A;  3PEI A;  2AFS A;  1AYE A;  3WC7 A;  2C6C A;  2JBK A;  5LYF A;  2C6P A;  4DUK A;  4MHZ A;  3RAM A;  1VHE A;  2PIZ A;  2V8V A;  4Q7A A;  2NSM A;  3FH4 A;  3B3V A;  4LQG A;  4UIB A;  2ZEF A;  3HLP A;  4OP4 A;  4NJR A;  2Q43 A;  1R43 A;  3SJX A;  2V8H A;  2PRQ A;  5JH9 A;  1DE4 C;  3PB4 X;  1H8L A;  3D7G A;  4P4D A;  1VIX A;  2CIJ A;  3H8E A;  2AFM A;  5I4M A;  5K8O A;  3FJU A;  2JBJ A;  2C1C A;  3WC5 A;  4X3R A;  1DTD A;  1HDQ A;  1ARM A;  4PPZ A;  3SI1 A;  4MHP A;  1TF8 A;  3SJE A;  3VAR A;  2BO9 A;  3PBE A;  4OC0 A;  3V38 A;  2PJ3 A;  2OR4 A;  5LRG A; 
#chains in the Genus database with same CATH topology
 4X06 A;  4PK3 A;  3P27 A;  3ZUG A;  4KVM E;  2X85 A;  3H8F A;  4GS4 A;  4F0X A;  1UD5 A;  4UFX A;  4NEX A;  3IEH A;  4Y9R A;  2QJ8 A;  4XON A;  4GQN A;  5A89 A;  4ZYQ A;  3SLD A;  3CXC B;  3BHX A;  5J35 A;  3DNS A;  3JU4 A;  2GU2 A;  3G8W A;  3NH4 A;  1TKF A;  3R1K A;  4PAB A;  4XQF A;  3VAT A;  5J8C A;  4GXH A;  4KUA A;  3PB6 X;  4UFW A;  6CPA A;  3PEN A;  1LRZ A;  1XMT A;  1ELO A;  5KTD A;  4UFV A;  1AIP A;  5F4O A;  5TRD A;  3CXS A;  3OEE A;  2G9D A;  2VZZ A;  2VBS A;  1B6B A;  5E96 A;  4KSA A;  4L89 A;  1ZG8 A;  1I12 A;  2D3L A;  2Z3M A;  4B6Z A;  4HKF A;  1U6M A;  2R9V A;  3RY8 A;  5F47 A;  3S6H A;  1YME A;  1EFC A;  2DOG A;  1HDU A;  3ZJ0 A;  4JMQ A;  1CNF A;  4KSI A;  1FNM A;  4RI1 A;  3D26 A;  1CPS A;  2VJJ A;  5LYI A;  2B5G A;  1XB2 A;  1VHO A;  2RB7 A;  3LWU A;  2PJ0 A;  2FSR A;  1WSV A;  5AN9 A;  4ZY0 A;  1ZLH A;  2BV3 A;  3FYN A;  5EC4 A;  4BD9 A;  1IU8 A;  5H84 A;  4B43 A;  1MRZ A;  2X6Y A;  2OBR A;  4UEZ A;  4NBS A;  4RD0 A;  2ZL7 A;  2Q51 A;  2ATR A;  2B7B A;  2Q6O A;  4HNW B;  2C2W A;  3PFO A;  2V8G A;  4F6A A;  3GVL A;  1Y0Y A;  2F5I A;  1VQ5 B;  1YJ9 B;  1Q81 D;  1IYK A;  3CPX A;  4YEJ A;  4UBR A;  3TOB A;  4PC1 A;  2J9A A;  2FIA A;  4LUA A;  4P4E A;  2DET A;  5FL7 A;  5A8A A;  4DQK A;  1ELM P;  2PJ7 A;  4KS9 A;  1S0U A;  4LBV A;  4FAI A;  1IJE A;  3IJ3 A;  3W2I A;  3G4S B;  2BSW A;  5F4J A;  3RO0 A;  5GCN A;  4QUZ A;  2ZPA A;  2VZL A;  3GIR A;  4A32 A;  3W5V A;  2WSA A;  1KJZ A;  2QMU A;  3ZZ0 A;  4TNU A;  4P10 A;  3OPO A;  3W2H A;  3B2Y A;  2HQY A;  1B2R A;  1CPX A;  5IYQ A;  2ZW5 A;  2CY2 A;  3NH8 A;  2Q6L A;  4ZGN B;  3TO9 A;  1Z2L A;  2EO8 A;  1EE3 P;  1R5O A;  3T8W A;  5KTC A;  2PJB A;  3W2G A;  3OW7 A;  4ASU A;  4Z4Y A;  2R98 A;  1FX0 A;  4H9G A;  4OKO A;  5H86 A;  1Z4E A;  3SLN A;  1WP6 A;  4XPL A;  2Q0Y A;  5HVG A;  3WYA A;  2B3V A;  4OC4 A;  2LZJ A;  2NPF A;  1TF9 A;  2ANP A;  1XBU A;  4NCN A;  2BSA A;  4MFK A;  2ZIT A;  5G1Z A;  3OOC A;  2PRB A;  4M3S A;  4Q38 A;  3FKS A;  3UY5 A;  4BMH A;  4HNX B;  5HXB A;  4HPS A;  1Y7E A;  2K5T A;  4P4B A;  2VNK A;  4Z4T A;  4A38 A;  2ZZG A;  4ONU A;  1EWY A;  2Q7B A;  4XM3 A;  3VWE A;  1YHQ B;  2ZTG A;  3OWC A;  2GQF A;  4TN1 A;  4YEL A;  3KR5 A;  4L8J A;  2VNH A;  2AHO A;  2CF4 A;  4MFZ A;  1M44 A;  4R87 A;  3VWD A;  4UZF A;  4PK2 A;  4IK2 A;  1U2R A;  4MBU A;  2CNT A;  4TKO B;  2D4P A;  4KOV A;  1B87 A;  3B35 A;  1X12 A;  2HC9 A;  4PAA A;  4XLA A;  2OTJ B;  3B8G A;  3VR6 A;  4XL9 A;  2PJ4 A;  1LAP A;  2WZN A;  1VQN B;  1OGI A;  2AFX A;  2PIY A;  2DEU A;  4UZE A;  5JBQ A;  4QVA A;  3GVJ A;  2C77 A;  4PSX A;  1UFH A;  3CCL B;  3ISZ A;  4I49 A;  4XNF A;  4FXU A;  2QN6 A;  2I00 A;  4Y49 C;  4B3G A;  3IO1 A;  2VJI A;  1HEE A;  3IWE A;  4J0Q A;  3WC6 A;  4ACA A;  4P9S A;  4MFP A;  1VLO A;  2YWH A;  4WZL A;  5K8N A;  1EP3 B;  1JA0 A;  2EIX A;  3LMS A;  5IYR A;  4XLH A;  4CPA A;  3R6K A;  1Z4R A;  3D7D A;  1PJ6 A;  4MRI A;  1YIT B;  1IIC A;  1KD1 D;  3ISX A;  4MHN A;  4R8F A;  4NGR A;  4QVT A;  4MY3 A;  3RZA A;  4ZGY B;  4MFL A;  3SHP A;  4CYP A;  1XRY A;  3D4U A;  4RJL A;  1YW6 A;  4X07 A;  1ARL A;  3N5F A;  2CTB A;  4FWU A;  2XNJ A;  2OK8 A;  3KHX A;  3PA2 A;  1V5V A;  2BUE A;  2AE6 A;  4XD7 A;  2VXK A;  2Z6B D;  3BLN A;  1E63 A;  4XOT A;  3CD6 B;  3WND A;  1RQP A;  3N7Z A;  4X7E A;  2FT0 A;  4BPR A;  1F2O A;  3IIB A;  2CXA A;  2HLD A;  3U2Q A;  4KOS A;  4P26 A;  3KEW A;  4RD4 A;  3T90 A;  1YW4 A;  1Z9U A;  2EK9 A;  3FPK A;  2X6X A;  3W2E A;  1M4D A;  2V7W A;  2DPT A;  3K2K A;  4RN7 A;  4EME A;  1QVF B;  1WOS A;  1YLE A;  3AGP A;  3BH4 A;  3KQX A;  1VQO B;  1E3Z A;  3MN8 A;  4XOP A;  1P4M A;  1QFZ A;  4RD1 A;  2C6C A;  3W6S A;  1VHE A;  3T56 B;  4Z4Z A;  4Q7A A;  3FH4 A;  4Q7J B;  3RNZ A;  4OP4 A;  5JH9 A;  2F4N A;  5G21 A;  3BY2 A;  5H5J A;  2CIJ A;  3H8E A;  3ASS A;  4CGO A;  3FJU A;  5K8O A;  4C43 A;  4LBW A;  2C1C A;  3PP9 A;  3S6K A;  4XR6 A;  3QB8 A;  4X3R A;  5FO0 A;  4C0S A;  4HNY B;  4PPZ A;  3SI1 A;  3A3B A;  2JJ2 A;  2Q6I A;  3QAY A;  2VZY A;  2C78 A;  1M90 D;  3PBE A;  1COW A;  2RC4 A;  4OC0 A;  4FD6 A;  2XGJ A;  2YWG A;  3TO7 A;  3D2M A;  3BCD A;  2Z3N A;  3JQP A;  4YGO A;  4A30 A;  4B12 A;  1GYT A;  2EUI A;  4N3N A;  3H5Z A;  2C4T A;  2G3A A;  5AGE A;  1WPC A;  4IHM A;  4NGN A;  2WJV A;  2X53 S;  3Q6Q A;  5IV0 A;  2ZW4 A;  3LVB A;  1JA1 A;  4B3X A;  3BI1 A;  2QIR A;  4NXY A;  2KCW A;  4MHD A;  1OB2 A;  1LAN A;  2P6E A;  4TMT A;  4XN0 A;  4X2T A;  1ZM3 A;  3GVK A;  4XPK A;  5AG6 A;  2X6W A;  3W5H A;  1NSA A;  4FD4 A;  5FVJ A;  2XZP A;  5E6T A;  2BN4 A;  4R9M A;  3IU1 A;  2KVO A;  1H8H A;  4KLV A;  4RPB A;  2FXF A;  4NFR A;  2YWE A;  1KZL A;  4P4J A;  1VQ8 B;  2FVG A;  4FN5 A;  2VEZ A;  2RC5 A;  5THX A;  5F49 A;  3W5U A;  4DK0 A;  2GAN A;  1NE9 A;  4DYO A;  2FX3 A;  4AVA A;  2FL4 A;  2QA4 B;  1M4L A;  1QQ9 A;  3MCA A;  3DLJ A;  4UEE A;  1W34 A;  2O28 A;  3TFY A;  1J4J A;  1QH0 A;  4YAL A;  4OC1 A;  4KOX A;  3SI0 A;  1VQ6 B;  3WAB A;  2CNM A;  4XLE A;  3QFS A;  5KW9 A;  4DNT B;  1M4I A;  2YNC A;  1JQG A;  4UZU A;  1WU8 A;  4QC6 A;  3TX8 A;  2B5G B;  4Y49 B;  4TMV A;  4DQL A;  2O53 A;  5HXD A;  3TTH A;  1QGY A;  2G0B A;  2AJ6 A;  2ZOG A;  4E8O A;  3KKW A;  4NGQ A;  2AFW A;  5CDF A;  2BPO A;  1M4G A;  2X7B A;  2OZG A;  3BXM A;  3ASP A;  3PUM A;  4KOW A;  3V7A A;  1DDI A;  1W9X A;  3WT4 A;  5ELY A;  2RC6 A;  1TXR A;  4C7I A;  5JPH A;  3FVL A;  2JDI A;  1N0V C;  2QTL A;  1BO4 A;  4YAW A;  2PJ6 A;  3H8G A;  2PVW A;  3H94 A;  2AFU A;  4A37 A;  4NNJ A;  3I56 B;  2V4D A;  4CQJ A;  2DEA A;  5AG7 A;  1MJ9 A;  2ZEE A;  3SJF A;  3A1P A;  1FRQ A;  4C7H A;  1YIJ B;  1LOK A;  4P3Y A;  1XEB A;  4M53 A;  3D66 A;  4M6G A;  3CDX A;  2X8K A;  2WPW A;  3CPA A;  1VQP B;  1TTT A;  3IC1 A;  4LQ6 A;  1FNO A;  4UWJ A;  2J8N A;  1GAW A;  1EFU A;  1XMB A;  1Q9S A;  5JQ4 A;  2Y0M A;  1BPL A;  1AMP A;  2GK7 A;  2GJK A;  2BGJ A;  1Y9W A;  4IAV A;  1L0C A;  3OFN A;  4JJX A;  4A39 A;  1H8E A;  2VNJ A;  4PXB A;  4MCP A;  1Q86 D;  4M1K A;  1YX2 A;  2CNS A;  1VKC A;  3FJO A;  4TMW A;  2F43 A;  1JWQ A;  4C68 A;  3HAG A;  4J3G A;  1P4N A;  1IHM A;  2ZW6 A;  1E64 A;  4XN3 A;  4ZV4 A;  2JLM A;  1FY7 A;  2PJC A;  4PXE A;  3FEE A;  4LC0 A;  1XJO A;  2ZL6 A;  4MYU A;  4QV2 A;  4JXR A;  2OU2 A;  3D7H A;  4C2Y A;  1E1Q A;  3S9M A;  1YGH A;  4ZCL A;  2ARH A;  5LRK A;  4F9V A;  1Y9K A;  3ZBT A;  1S4M A;  1VQ4 B;  3PRT A;  1FRN A;  1S72 B;  4BBH A;  3OP1 A;  4OC5 A;  1UD4 A;  4RD6 A;  4YAU A;  3GY9 A;  2Z3P A;  3S9L A;  4B47 A;  2XEG A;  1R3N A;  3SEJ A;  1UWY A;  3F5B A;  3PVD A;  2V7Q A;  3PZJ A;  3CCM B;  3NE8 A;  3FED A;  3B78 A;  1ZLI A;  3HUV A;  4QBJ A;  3IU2 A;  3OZW A;  4ZBG A;  3AVW A;  1K73 D;  4DNC A;  2F1L A;  2F1M A;  4PC3 A;  4P22 A;  1UD3 A;  4LBY A;  4MMO A;  1BAV A;  3R6J A;  2JN9 A;  2OZH A;  1UD8 A;  5TR9 A;  1ELL P;  1FT7 A;  1LCP A;  1YVO A;  2GFQ A;  1NJI D;  4A95 A;  2D4O A;  4R3L A;  1IID A;  2IQ6 A;  4RUH A;  2XEI A;  1TVC A;  5A28 A;  3EY5 A;  1GAQ A;  1ON0 A;  2WZP P;  4E2A A;  1MJB A;  4EFD A;  1Q2D A;  4II3 A;  4R7M A;  2GJP A;  2YNC C;  4OC3 A;  1BMF A;  4G7X A;  3A35 A;  3W2F A;  2OTL B;  3H4Q A;  1CP6 A;  2DIE A;  1BPN A;  2QEX B;  4KLW A;  3VH9 A;  1KTV A;  1ZM9 A;  2J8M A;  1KK2 A;  1DG1 G;  2QGG A;  2CBX A;  3U6B A;  2F7V A;  3JQR A;  3FNC A;  5LYD A;  4CYN A;  3AST A;  5C82 A;  2VL1 A;  3F0A A;  5LMZ A;  3OE7 A;  1EP1 B;  3PBB A;  4UAJ A;  4Z4W A;  4JZ0 A;  3IFE A;  1F57 A;  3CCU B;  5LRJ A;  2PC1 A;  4K30 A;  4ORF A;  2QYV A;  4YHB A;  2E1R A;  1LAM A;  4MCS A;  4XKV A;  2H5M A;  5EMN A;  1EFT A;  5D8N A;  5G22 A;  2PCU A;  3CES A;  4P4I A;  4CYQ A;  1N0U A;  2VBQ A;  1R57 A;  5IYW A;  4CRZ B;  4P45 A;  4P4F A;  4AVZ A;  3OAA A;  4Y9U A;  2ZED A;  1PJ7 A;  2B3U A;  1IOI A;  1WOR A;  2WSS A;  1MK4 A;  1S3Z A;  2Q04 A;  1K9M D;  3CC2 B;  2ZEP A;  4PSW A;  1SKQ A;  1IB0 A;  2X3U A;  1A8P A;  1EP2 B;  5CBM A;  2J8R A;  4PGO A;  3CB4 A;  5BSX A;  4UCP A;  2Z11 A;  5IYP A;  4KOU A;  3LQ6 A;  3I55 B;  1RQR A;  1V0F A;  3AVU A;  3TC8 A;  4PC6 A;  5IYN A;  2PLF A;  2QVP A;  4MCQ A;  3RYO A;  4DJL A;  1VLY A;  1OBR A;  3R96 A;  2JDD A;  1BX0 A;  1ZG9 A;  1CQX A;  1CX8 A;  5HZB A;  3IWW A;  1KUY A;  1YRE A;  2PQ8 A;  3B82 A;  4KVO E;  4B3F X;  3TE4 A;  1VQL B;  3GUX A;  4NGS A;  4OPO A;  4XNH C;  1IJF A;  4R76 A;  2AFO A;  2WUU A;  4A2Z A;  3D3S A;  2BEI A;  4UWI A;  4WZE A;  1K4J A;  4N3G A;  4NGM A;  2AFS A;  1R5B A;  5FO1 A;  1AYE A;  3WC7 A;  4MHZ A;  3RAM A;  1Q7Y D;  4HE6 A;  2PIZ A;  3R95 A;  1WK4 A;  2NSM A;  3BQJ A;  3LO8 A;  3I3G A;  3HLP A;  3SJX A;  4UA3 A;  1DE4 C;  4CAE A;  4JD6 A;  2AFM A;  4AVC A;  2B7C A;  3W91 A;  3WC5 A;  1NSL A;  2I79 A;  1DTD A;  4P1V A;  3R9E A;  4MHP A;  2ZL5 A;  1TF8 A;  3SJE A;  4MYT A;  2BO9 A;  1EFR A;  2BVN A;  4CGN A;  4EVY A;  2OBS A;  5AG5 A;  1K28 D;  1YJN B;  2OR4 A;  3T9Y A;  2C4U A;  2VQY A;  5DSZ A;  4F7D A;  3WBK A;  1VQ7 B;  3AVX A;  1W0J A;  2ZEO A;  5BWA B;  2DY1 A;  5JGF A;  4IW3 B;  1QUE A;  4WZK A;  1QMU A;  4M85 A;  1I8D A;  1RXT A;  2WPD A;  4Z4U A;  3BI0 A;  3OW2 B;  3KHZ A;  4GM5 A;  2VNI A;  2P6G A;  1DAR A;  3WY9 A;  1KK1 A;  1QST A;  1G7R A;  1IB1 E;  3S9N A;  1HVX A;  3CCS B;  1YK3 A;  4NGT A;  4G1P A;  1I1D A;  2DXQ A;  4OLL A;  3BY1 A;  3WBJ A;  1Z8W A;  1WWZ A;  2ZXH A;  3I9S A;  1NMT A;  5HVH A;  2V31 A;  2POK A;  1CBX A;  4ZX8 A;  2ZXI A;  5HMN A;  1YSJ A;  3V8I A;  1G7C A;  1QFY A;  1KQS B;  1OB0 A;  4G1V A;  3JRU A;  1Q82 D;  2VI7 A;  2Z3K A;  3CMM A;  3CCE B;  5TV2 A;  3F8K A;  4UCM A;  1HZE A;  2NYQ A;  4RD2 A;  2FIW A;  3D7F A;  1KRH A;  5HVF A;  3ASQ A;  4CYO A;  4OOS A;  3GIU A;  3DR8 A;  3JVN A;  1FDR A;  5A27 A;  2BM1 A;  1TKJ A;  4K3N A;  3R9F A;  5B6I A;  4C2X A;  4WJB A;  3CT9 A;  1T6Z A;  3T53 B;  4W9Y A;  4PXD A;  1M1K D;  4X7F A;  4Z4V A;  4NCZ A;  1S60 A;  4QFM A;  4PC2 A;  3Q3A A;  4KZT A;  4F9U A;  3OZU A;  3KGQ A;  2GE3 A;  3EXN A;  1WDT A;  1D1N A;  2XEJ A;  1YLO A;  4P6V F;  1KUX A;  4TWE A;  3C26 A;  1QG0 A;  2ZEH A;  3GB0 A;  4G5G A;  3OZV A;  2VYQ A;  1QSM A;  3FRM A;  1KK0 A;  1E62 A;  4OAE A;  4B44 A;  1W35 A;  2CRV A;  1BOB A;  2WPX A;  2HDN B;  1UD2 A;  4NJQ A;  4ZCM A;  2PE3 A;  3PB8 X;  3G71 B;  3QAH A;  4QHY A;  4F0Y A;  4HE5 A;  3FF3 A;  7CPA A;  1N07 A;  3KR4 A;  4CRY B;  1MJA A;  1VQM B;  3QNV A;  1E79 A;  3CZX A;  4CS0 B;  2BF4 A;  3EO4 A;  4OC2 A;  4XNH B;  5EBV A;  4HIZ A;  2PJ2 A;  2B5O A;  3A3G A;  1R5N A;  1IY7 A;  4MY0 A;  4H6Z A;  1CP7 A;  3AGQ A;  1PYT B;  3TCV A;  4B5O A;  1H85 A;  4JWP A;  3QE2 A;  2RFH A;  4LBZ A;  5DS0 A;  1N06 A;  5THW A;  5DN6 A;  4OID A;  5IB0 A;  4Z1M A;  3I1F A;  3VNV A;  2OK7 A;  1PUA A;  2REF A;  2HMA A;  2BOA A;  3I1U A;  2JDC A;  4OIW A;  2REE A;  2PDO A;  3DR6 A;  3R9G A;  1WOO A;  2BM0 A;  4AB7 A;  2ODF A;  1TLL A;  2OOT A;  2ZZQ A;  1FND A;  1KZF A;  3CPW B;  2DER A;  2ZW7 A;  3D68 A;  2QML A;  4AF6 A;  1D2E A;  3H9N A;  3S6G A;  2VBU A;  4P6Y A;  4ZX9 A;  3E20 A;  3CC4 B;  4OP7 A;  4OOV A;  1GHE A;  3EC4 A;  2QE7 A;  3KAS A;  5H59 A;  4UF4 A;  1E3X A;  1T5E A;  2M5S A;  3QFC A;  1G7T A;  1F60 A;  1QSR A;  1CJW A;  1I18 A;  4NF1 A;  4IUS A;  2R6H A;  4CGM A;  4CGL A;  4ZGQ B;  1I21 A;  2XZO A;  2A4N A;  2CC2 A;  3D67 A;  3E1Y E;  3SJZ A;  4P3I A;  4XPD C;  4P25 A;  4M6I A;  1RTQ A;  4EWT A;  1VHS A;  2PIA A;  1XE1 A;  2FCK A;  3MMP A;  2XOK A;  1W87 A;  1YI2 B;  4FWT A;  2ZZF A;  4YFJ A;  1E1R A;  4G1B A;  4FD5 A;  1NB0 A;  2Z3L A;  2B4D A;  4TSF A;  4AXV A;  2NV4 A;  2E1B A;  1WTH D;  3V76 A;  3W6X A;  1T6Y A;  4R6T A;  3PB9 X;  2Z10 A;  2DPS A;  3WNC A;  3CP2 A;  4A33 A;  3LOD A;  4FUU A;  2YWF A;  4CAW A;  1MAB A;  4DNR B;  1VJS A;  3ONY A;  2GPJ A;  2NMT A;  5IX3 A;  3DGV A;  4Z65 A;  3CXP A;  1Z5R A;  4Q36 A;  4FK8 A;  3QFR A;  3DDY A;  2FE7 A;  2DYI A;  3IGR A;  3KI9 A;  3KL9 A;  1OZP A;  5CNP A;  3NH5 A;  4Z4R A;  4Z4S A;  4KOY A;  3BCF A;  2FS5 A;  3OKX A;  5GV8 A;  4Y7C A;  1F2P A;  3U6K A;  2Q4Z A;  1VQK B;  3RBU A;  3FMC A;  3Q39 A;  3CC7 B;  4JXQ A;  2D9R A;  4UEF A;  3OJW A;  1G7S A;  1NB9 A;  3GSI A;  4B14 A;  1RO5 A;  2V7T A;  5D29 A;  2PJ1 A;  2P6F A;  4B13 A;  1S7N A;  2XEF A;  1ZM2 A;  3ONU A;  4YAO A;  1TIQ A;  2IL4 A;  3J81 k;  1IYL A;  4ACB A;  1X10 A;  2JEV A;  4U9Z A;  2C5B A;  3E0K A;  1QGZ A;  2OBT A;  4U9U A;  4P44 A;  4XLF A;  3SJP A;  1PU9 A;  2QDX A;  4OOX A;  3A8J A;  4P2N A;  4PQA A;  3PEI A;  3NE7 A;  1SQH A;  5LYF A;  2C6P A;  2PR8 A;  4DUK A;  2V8V A;  1K8A D;  3WR7 A;  1Z8X A;  3B3V A;  4LQG A;  4H6U A;  1R43 A;  2P3M A;  2V8H A;  5F4M A;  2PRQ A;  2ZXV A;  4R57 A;  1A2Z A;  3D7G A;  4RD3 A;  5I4M A;  3S6F A;  2JBJ A;  4KKT A;  1YJW B;  1ARM A;  3DSB A;  3ZC3 A;  3A8I A;  4CGP A;  2Q4V A;  3D8P A;  2JIZ A;  3V38 A;  3ZIA A;  4MJ8 A;  1S7K A;  4BIN A;  3PFE A;  2Q44 A;  5K8P A;  1BLI A;  3NA6 A;  1XFO A;  2R7H A;  3JQQ A;  2Z0Z A;  2ZEM A;  4FBE A;  2R1I A;  3SJG A;  1Z8T A;  3VMF A;  3OJX A;  3B3W A;  5DWN A;  8CPA A;  3IWG A;  4KUB A;  2ZZE A;  4F8Z A;  1Y7R A;  3ZPN A;  3FIX A;  3P26 A;  4B5P A;  1W0K A;  3PUN A;  3MGD A;  1XQB A;  1T6X A;  4NSQ A;  3CRZ A;  1XE4 A;  2ABZ A;  4JYW A;  2B58 A;  1BX1 A;  4OAD A;  1ZG7 A;  4L8A A;  3K9U A;  3JUW A;  2DF5 A;  3MHP A;  4QUS A;  4X0C A;  2EWB A;  2AFZ A;  2EFG A;  2JJ1 A;  4YRH A;  4AVB A;  2X0K A;  1ZO0 A;  4X05 A;  3FPP A;  3CCV B;  3CME B;  4WZT A;  4B11 A;  3CCJ B;  2VBT A;  2D74 A;  5FA6 A;  4QB9 A;  1QVG B;  1QGA A;  3V7Z A;  4RDK A;  2YNE A;  3Q6R A;  2ZOF A;  5KTA A;  1V0E A;  4XPD B;  4CAV A;  2BL1 A;  1Y0R A;  4OPV A;  5A88 A;  2VBV A;  2PJ5 A;  3BNW A;  3ZZT A;  1GR1 A;  4M4S A;  1QX4 A;  1NBM A;  1QFJ A;  4MFQ A;  5GV7 A;  4B4D A;  4A31 A;  4AG9 A;  1V0C A;  2EBJ A;  3ASR A;  3B3S A;  3FXT A;  3KZW A;  2V7V A;  5DWM A;  1WSR A;  2D3N A;  4XKW A;  1XIX A;  2Q6K A;  1KMH A;  3L2N A;  3AVT A;  5J3O A;  5C88 A;  4II9 A;  2YGW A;  1XF8 A;  2C5H A;  2QEC A;  4P12 A;  3MRU A;  1YR0 A;  2PR1 A;  4B10 A;  4UIA A;  5J8F A;  1I7P A;  2GRE A;  3CP8 A;  4G7W A;  1TUI A;  3B8H A;  1IOF A;  3WXM A;  3EFA A;  5I0C A;  2W6J A;  4YWY A;  1ZUN B;  5IB9 A;  3G3S A;  4CAF A;  2Z3O A;  4PXC A;  1KK3 A;  4XMY A;  3PB7 X;  2V77 A;  3VNU A;  1OGJ A;  1S5K A;  4RDJ A;  3T51 B;  1ZM4 A;  3CMA B;  1HA3 A;  4OPS A;  3LD2 A;  1F20 A;  3GQB A;  4R71 A;  1S7L A;  2DCU A;  4ONW A;  5CPA A;  1S7F A;  4YAF A;  3GKR A;  3K9T A;  1CG2 A;  1YX0 A;  1M1D A;  3CCQ B;  2P0W A;  4QVJ A;  4ZY1 A;  4IF5 A;  2CK3 A;  1JB9 A;  4X8I A;  3LQE A;  2PJA A;  1VQ9 B;  3LAC A;  3CW2 A;  1UD6 A;  4XOR A;  4AC9 A;  2HV2 A;  1D8T A;  5J1Q A;  2HCJ B;  2OZU A;  1PJ5 A;  1LFW A;  2EK8 A;  5G20 A;  5HH1 A;  4MCR A;  3A8K A;  4MHY A;  4YXW A;  1J9Z A;  4EH1 A;  2CND A;  2WYR A;  5F48 A;  2HB6 A;  2BGI A;  4X7C A;  1W2B B;  3KQZ A;  5F46 A;  1BLL E;  3B3T A;  4KVX A;  3FB3 A;  2IJZ A;  4PC7 A;  1IGB A;  4X5K A;  3CXQ A;  5IK2 A;  1AMO A;  3SI2 A;  4ZY2 A;  1AUG A;  2XNC A;  5LYL A;  2ZEG A;  2ZBV A;  5K8M A;  2B4B A;  1JNY A;  1KWM A;  1YVK A;  2O4H A;  4MI4 A;  5FIU A;  2CW5 A;  4RLZ A;  1WOP A;  2QTZ A;  4TMZ A;  4A94 A;  1KC8 D;  5KSW B;  4II2 A;  3QFT A;  4O23 A;  2PSW A;  1B23 P;  1PCA A;  1UMK A;  2J7K A;  2W6I A;  2V8D A;  5HZA A;  2I1L A;  3PA1 A;  4KKU A;  4AF7 A;  3NE5 B;  3B7I A;  4RPD A;  2Q4Y A;  2OB0 A;  4UCN A;  4K1X A;  2IMO A;  3SKB A;  2B4D B;  1TKH A;  2WJY A;  3DDD A;  3WQZ A;  2PMD A;  1GVH A;  5BSY A;  5JM6 A;  4RDL A;  3NFZ A;  2XZL A;  1N71 A;  1GJR A;  3P2H A;  3SXO A;  3TO6 A;  1GO2 A;  2GLF A;  4MXU A;  4U9Y A;  4YU9 A;  3TT2 A;  4X7D A;  1QSN A;  2JEW A;  1Q2C A;  4ZI6 A;  4E0A A;  1PKV A;  3PGP A;  2YND A;  2OYN A;  2PJ8 A;  3ZZI A;  2BCO A;  2GLJ A;  2C27 A;  5EMI A;  1N8R D;  1KUV A;  4WQM A;  4FD7 A;  1OHH A;  2CTC A;  3P2F A;  4KOT A;  2HUZ A;  4XLC A;  2ZEN A;  3BJ8 A;  2BMW A;  5F09 A;  3GLJ A;  3A9L A;  3CCR B;  2ZEL A;  4RS2 A;  1YQE A;  1FNB A;  4M0L A;  2OH1 A;  2V7X A;  3ZZU A;  1N05 A;  3OEH A;  2GK6 A;  4AG7 A;  3AVY A;  4NGP A;  3Q38 A;  1SM4 A;  4TT3 A;  3WNB A;  1Q7L A;  5AG4 A;  4KOR A;  1H42 A;  1EXM A;  4ZCI A;  1XOV A;  3CTA A;  4U5Y A;  1P0H A;  1N08 A;  4G6I A;  4E0F A;  1BPM A;  4H2K A;  4LX9 A;  2XND A;  4DK1 A;  1JJ2 B;  4ROX A;  1SKY B;  2I3C A;  4JLY A;  3FX6 A;  3SXN A;  3GYA A;  3BJ7 A;  2PVV A;  4WWV A;  1FNC A;  3B3C A;  2GJR A;  1VGY A;  1Q2Y A;  3FBU A;  4M6H A;  4B48 A;  2C6G A;  3QSY A;  1Z8L A;  4RCZ A;  3ZBU A;  1QSO A;  3VO2 A;  3AVV A;  4KSF A;  1QUF A;  3FEC A;  3ES9 A;  4OME A;  3TOA A;  2PJ9 A;  2EVN A;  4MFJ A;  1CNE A;  2F8H A;  4TMX A;  2XEX A;  1NDH A;  1BJK A;  4C2Z A;  4RM0 A;  5ISV A;  1CM0 A;  4RCY A;  4KKS A;  2JBK A;  4M2L A;  3G05 A;  2GIV A;  3VO1 A;  4R3K A;  1BQE A;  2ZBU A;  2ZTN A;  1DDG A;  4UIB A;  2ZEF A;  4H89 A;  1NRK A;  4NJR A;  2Q43 A;  4CAX A;  3PB4 X;  1H8L A;  5KNL A;  4P4D A;  1VIX A;  3D2P A;  5HKK A;  3BC9 A;  4PV6 A;  2Q7S A;  2R8V A;  1E43 A;  3LNN A;  3JTK A;  1HDQ A;  2V7U A;  2WR8 A;  5L46 A;  3G6E B;  1VF7 A;  3VAR A;  5TY0 A;  2PJ3 A;  2G3T A;  5FNZ A;  1OB5 A;  5LRG A;  4B5P B; 
#chains in the Genus database with same CATH homology
 3PFE A;  5K8P A;  3NA6 A;  1XFO A;  1GYT A;  2ZEM A;  4FBE A;  3H8F A;  3SJG A;  2ZEO A;  5JGF A;  4IHM A;  4NGN A;  8CPA A;  3B3W A;  3IEH A;  1QMU A;  4F8Z A;  3BI1 A;  2QJ8 A;  4ZYQ A;  3BHX A;  3BI0 A;  3KHZ A;  4GM5 A;  2GU2 A;  1LAN A;  2ABZ A;  3NH4 A;  4JYW A;  4X2T A;  1TKF A;  3S9N A;  1NSA A;  1ZG7 A;  3VAT A;  4NGT A;  4G1P A;  3PB6 X;  6CPA A;  2EWB A;  2AFZ A;  4NFR A;  4P4J A;  2FVG A;  5HVH A;  2POK A;  1CBX A;  4DYO A;  4ZX8 A;  1YSJ A;  1M4L A;  1QQ9 A;  2G9D A;  3DLJ A;  4UEE A;  3V7Z A;  3JRU A;  4OC1 A;  2ZOF A;  3SI0 A;  3WAB A;  1ZG8 A;  2NYQ A;  4B6Z A;  1Y0R A;  1JQG A;  3D7F A;  3TX8 A;  2PJ5 A;  5HVF A;  1YME A;  2O53 A;  1HDU A;  3B3S A;  5HXD A;  3KZW A;  4KSI A;  2ZOG A;  1CPS A;  1TKJ A;  4K3N A;  4NGQ A;  2AFW A;  4WJB A;  3CT9 A;  5LYI A;  3BXM A;  3L2N A;  4W9Y A;  4PXD A;  1VHO A;  2RB7 A;  3LWU A;  2PJ0 A;  3WT4 A;  5ELY A;  4ZY0 A;  1ZLH A;  1TXR A;  3FVL A;  4BD9 A;  3MRU A;  2PJ6 A;  3H8G A;  2PVW A;  2AFU A;  4A37 A;  4F9U A;  3KGQ A;  4UIA A;  4UEZ A;  2DEA A;  2GRE A;  2ZEE A;  2XEJ A;  1YLO A;  3SJF A;  2Q51 A;  1LOK A;  4TWE A;  3D66 A;  3PFO A;  2V8G A;  4YWY A;  3CDX A;  5IB9 A;  2ZEH A;  3GB0 A;  1Y0Y A;  3CPA A;  3IC1 A;  3CPX A;  4PXC A;  1FNO A;  3PB7 X;  1XMB A;  2V77 A;  1AMP A;  2J9A A;  4P4E A;  1ELM P;  2PJ7 A;  4IAV A;  4NJQ A;  4FAI A;  2PE3 A;  3PB8 X;  3IJ3 A;  4A39 A;  3FF3 A;  7CPA A;  5CPA A;  4ONW A;  4PXB A;  4MCP A;  3KR4 A;  3K9T A;  3QNV A;  1CG2 A;  4TNU A;  4P10 A;  2PJC A;  3B2Y A;  4PXE A;  3FEE A;  1CPX A;  1XJO A;  4OC2 A;  4ZY1 A;  3NH8 A;  1Z2L A;  2PJ2 A;  3D7H A;  4X8I A;  1IY7 A;  1EE3 P;  2PJA A;  1CP7 A;  3S9M A;  3T8W A;  5LRK A;  2PJB A;  4F9V A;  5J1Q A;  3PRT A;  1PYT B;  4OC5 A;  1LFW A;  2EK8 A;  2RFH A;  4MCR A;  3S9L A;  2XEG A;  1R3N A;  5DS0 A;  4OKO A;  1UWY A;  5THW A;  4MHY A;  4OID A;  2WYR A;  2HB6 A;  5HVG A;  3FED A;  3HUV A;  1ZLI A;  4OC4 A;  3KQZ A;  2BOA A;  1TF9 A;  2ANP A;  3I1U A;  1XBU A;  4OIW A;  1BLL E;  3B3T A;  2IJZ A;  1IGB A;  2OOT A;  4MMO A;  1BAV A;  1Y7E A;  3SI2 A;  4ZY2 A;  4P4B A;  5LYL A;  3D68 A;  2ZEG A;  1FT7 A;  1ELL P;  1LCP A;  5K8M A;  1KWM A;  2O4H A;  4A38 A;  4P6Y A;  4ZX9 A;  2IQ6 A;  4A94 A;  4RUH A;  2XEI A;  3KR5 A;  4O23 A;  3KAS A;  2CF4 A;  1PCA A;  4UF4 A;  4EFD A;  2V8D A;  4IK2 A;  4R7M A;  3B7I A;  4OC3 A;  3B35 A;  2HC9 A;  1LAP A;  2PJ4 A;  2IMO A;  2WZN A;  1CP6 A;  1TKH A;  1BPN A;  3VH9 A;  2AFX A;  3D67 A;  2PIY A;  5JM6 A;  3NFZ A;  1RTQ A;  2F7V A;  4EWT A;  5LYD A;  3ISZ A;  2VL1 A;  2GLF A;  4MXU A;  3PBB A;  4JZ0 A;  3IFE A;  1F57 A;  4YU9 A;  5LRJ A;  3IO1 A;  2JEW A;  1HEE A;  4ZI6 A;  2QYV A;  4AXV A;  1LAM A;  4MCS A;  3WC6 A;  2PJ8 A;  5D8N A;  2BCO A;  2GLJ A;  2PCU A;  4P4I A;  5K8N A;  4R6T A;  3PB9 X;  3LMS A;  4P45 A;  2CTC A;  4CPA A;  4P4F A;  3D7D A;  2ZEN A;  2ZED A;  4FUU A;  5F09 A;  3GLJ A;  4MRI A;  2ZEL A;  3ISX A;  4MHN A;  2ZEP A;  4R8F A;  3DGV A;  4Z65 A;  4NGR A;  4NGP A;  1Z5R A;  1Q7L A;  5CBM A;  3RZA A;  3KI9 A;  3KL9 A;  1XRY A;  3NH5 A;  3D4U A;  1YW6 A;  1ARL A;  3N5F A;  1F2P A;  2Q4Z A;  2CTB A;  3RBU A;  3FMC A;  4FWU A;  1BPM A;  4H2K A;  3KHX A;  4UEF A;  3TC8 A;  2I3C A;  2QVP A;  4MCQ A;  4DJL A;  3FX6 A;  1OBR A;  5D29 A;  2PJ1 A;  1F2O A;  2PVV A;  3IIB A;  4WWV A;  3B3C A;  1ZG9 A;  2XEF A;  1VGY A;  1CX8 A;  3IWW A;  1YW4 A;  2EK9 A;  2C6G A;  1Z8L A;  3K2K A;  3GUX A;  4EME A;  4NGS A;  3FEC A;  4OME A;  4P44 A;  3KQX A;  2PJ9 A;  4R76 A;  2AFO A;  2F8H A;  3MN8 A;  4PQA A;  4NGM A;  3PEI A;  2AFS A;  1AYE A;  3WC7 A;  2C6C A;  2JBK A;  5LYF A;  2C6P A;  4DUK A;  4MHZ A;  3RAM A;  1VHE A;  2PIZ A;  2V8V A;  4Q7A A;  2NSM A;  3FH4 A;  3B3V A;  4LQG A;  4UIB A;  2ZEF A;  3HLP A;  4OP4 A;  4NJR A;  2Q43 A;  1R43 A;  3SJX A;  2V8H A;  2PRQ A;  5JH9 A;  1DE4 C;  3PB4 X;  1H8L A;  3D7G A;  4P4D A;  1VIX A;  2CIJ A;  3H8E A;  2AFM A;  5I4M A;  5K8O A;  3FJU A;  2JBJ A;  2C1C A;  3WC5 A;  4X3R A;  1DTD A;  1HDQ A;  1ARM A;  4PPZ A;  3SI1 A;  4MHP A;  1TF8 A;  3SJE A;  3VAR A;  2BO9 A;  3PBE A;  4OC0 A;  3V38 A;  2PJ3 A;  2OR4 A;  5LRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...