2PE3A

Crystal structure of frv operon protein frvx (ph1821)from pyrococcus horikoshii ot3
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
344
structure length
330
Chain Sequence
DWKLMQEIIEAPGVSGYEHLGIRDIVVDVLKEVADEVKVDKLGNVIAHFKGSSPRIMVAAHMDKIGVMVNHIDKDGYLHIVPIGGVLPETLVAQRIRFFTEKGERYGVVGVLPDWDQIVVDVGASSKEEAEEMGFRVGTVGEFAPNFTRLNEHRFATPYLDDRICLYAMIEAARQLGDHEADIYIVGSVQEEVGLRGARVASYAINPEVGIAMDVTFAKQPHDKGKIVPELGKGPVMDVGPNINPKLRAFADEVAKKYEIPLQVEPSPRPTGTDANVMQINREGVATAVLSIPIRYMHSQVELADARDVDNTIKLAKALLEELKPMDFTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 354aa long hypothetical operon protein Frv
publication title Crystal structure of frv operon protein frvx (ph1821)from pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
total genus 97
structure length 330
sequence length 344
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05343 Peptidase_M42 M42 glutamyl aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.40 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Peptidase M42, domain 2 2pe3A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2pe3A01
2PJ5A 1CP6A 2VL1A 2ZEPA 1CP7A 1FNOA 3PEIA 3PB7X 1F57A 4MCSA 2AFZA 1DTDA 4EFDA 2WZNA 2XEFA 3KR4A 2AFMA 1ELLP 3GLJA 3DLJA 3MRUA 4PXDA 4GM5A 3DGVA 3H8FA 3CPAA 4UEZA 3D7FA 1ZLIA 5LYLA 1ZG8A 3BXMA 1LFWA 3L2NA 4MCPA 3D7GA 4FUUA 1PYTB 4ZX8A 3SJGA 1M4LA 3NA6A 1OBRA 4MXUA 3PBBA 4P4FA 3PB9X 1ZLHA 3PB6X 2OR4A 3FH4A 4OP4A 4P6YA 2O4HA 2EK8A 4EWTA 2PJ4A 4W9YA 4OC0A 1LCPA 3D7HA 1Y7EA 4R6TA 4PPZA 3FF3A 2V8DA 1HEEA 5LRGA 3PFOA 1VIXA 2PVVA 4JZ0A 1YMEA 4KSIA 4UEFA 4ZX9A 3BI0A 3D68A 2CTBA 4YWYA 3WC7A 2O53A 1Y0RA 2C6CA 3SJFA 4ZY0A 1R43A 3I1UA 4R76A 5K8NA 1VHOA 4A38A 1KWMA 4H2KA 3D4UA 5HXDA 3FVLA 2AFUA 4P44A 3IO1A 1ARMA 1CX8A 2AFWA 5IB9A 1LOKA 4IHMA 3KI9A 1AMPA 1F2OA 2DEAA 2PJBA 3B3TA 1TKFA 2ZELA 4NGRA 3BI1A 4NGNA 1LAPA 4NFRA 3FX6A 1YW4A 3KQXA 5LYDA 1Z2LA 4A39A 3FECA 3RAMA 3HUVA 2PIYA 2PIZA 4OIDA 2ABZA 4RUHA 1YSJA 3NH4A 3FMCA 1VHEA 4AXVA 2HB6A 2F8HA 2C6GA 2PJCA 2PJAA 1AYEA 3ISXA 5JH9A 3LWUA 2PJ6A 2BOAA 3GB0A 4OC1A 2ZEHA 3GUXA 4OKOA 3SI0A 1IY7A 3PB8X 5F09A 8CPAA 3QNVA 1ARLA 1TXRA 3SJXA 2GU2A 3SJEA 2PJ8A 3H8GA 2F7VA 2WYRA 3RZAA 1HDUA 4CPAA 4ZI6A 2PJ3A 3B3SA 3B3VA 3NFZA 3MN8A 2AFXA 4UF4A 1QQ9A 5LYFA 2BO9A 2PJ2A 1NSAA 2ANPA 2I3CA 2PVWA 3IEHA 3D66A 3H8EA 2NSMA 5HVHA 2PJ9A 3BHXA 4ZYQA 5D8NA 4A94A 4Z65A 7CPAA 3D7DA 4UEEA 4DUKA 1YLOA 3IWWA 4WWVA 3V38A 1ELMP 5I4MA 2CTCA 4ZY2A 5CPAA 3JRUA 1Y0YA 2RFHA 3ISZA 3PFEA 4PXEA 2Q51A 4FWUA 3TC8A 4MCRA 3B3CA 3IIBA 4P4JA 5D29A 3IFEA 4IAVA 4OIWA 3WT4A 2AFOA 3D67A 4R8FA 4IK2A 2RB7A 5CBMA 3B35A 3T8WA 1BAVA 1DE4C 4MMOA 2QYVA 2ZEDA 3FEEA 1R3NA 3K9TA 2PJ0A 1HDQA 3KR5A 2PRQA 3SI1A 4NGSA 1BLLE 4NJRA 3VARA 5JM6A 2XEIA 1QMUA 4BD9A 3B7IA 2ZOGA 3WC5A 1PCAA 1TKHA 2JBKA 4TNUA 2ZEEA 3KASA 2GLFA 3KZWA 4OC5A 4P4IA 2IQ6A 1TF9A 1ZG7A 1JQGA 3NH8A 4F8ZA 4K3NA 2CF4A 2QJ8A 5ELYA 4YU9A 4UIBA 5HVFA 6CPAA 2V8GA 1RTQA 3FEDA 1UWYA 4DYOA 5LYIA 2GREA 4MHPA 3VATA 3TX8A 4MCQA 1H8LA 2PJ7A 4ZY1A 2C1CA 4X3RA 1Z8LA 3PRTA 4G1PA 4OC4A 4ONWA 2J9AA 4R7MA 3S9MA 3B2YA 2XEGA 4OMEA 4MHYA 4WJBA 3VH9A 2JEWA 4PXBA 3PBEA 3SI2A 3CPXA 4Q7AA 3KL9A 3V7ZA 5J1QA 3LMSA 1XFOA 1Z5RA 1FT7A 1BPMA 4F9VA 2AFSA 2ZEGA 2CIJA 2C6PA 2GLJA 3KGQA 4P4BA 4P4DA 2EK9A 4P45A 2Q43A 3KHXA 1CG2A 4P10A 3FJUA 3WABA 4MHZA 4FBEA 4PXCA 5JGFA 5THWA 4TWEA 4DJLA 1CPSA 1LAMA 3PB4X 3KHZA 3WC6A 1CPXA 1EE3P 4NGMA 1LANA 4NGPA 4UIAA 2QVPA 2PJ1A 2HC9A 1TF8A 2ZEMA 1IGBA 2XEJA 2FVGA 5DS0A 4X2TA 2BCOA 4NGQA 4MHNA 4PQAA 2ZEFA 1XRYA 4NGTA 1TKJA 1YW6A 1GYTA 4OC2A 3CDXA 4EMEA 4P4EA 3S9NA 4NJQA 3HLPA 2V77A 3KQZA 5HVGA 1BPNA 1XJOA 5LRKA 4FAIA 3B3WA 4F9UA 2OOTA 2ZEOA 2NYQA 3CT9A 1F2PA 1Q7LA 2POKA 2PCUA 2Q4ZA 2ZOFA 3N5FA 4O23A 1CBXA 4LQGA 2IMOA 2ZENA 3RBUA 3IC1A 4OC3A 2IJZA 4B6ZA 4X8IA 2JBJA 1XBUA 2PE3A 1VGYA 3K2KA 3S9LA 2EWBA 5K8PA 3NH5A 3IJ3A 2V8HA 2G9DA 1ZG9A 5LRJA 5K8OA 2V8VA 4A37A 4JYWA 5K8MA 4MRIA 1XMBA
chains in the Genus database with same CATH superfamily
1IYKA 4RD2A 4L8JA 2PIAA 2PC1A 2GQFA 1CP7A 1FNOA 4UFXA 4DNTB 1DTDA 4EFDA 2WZNA 2EFGA 4UCMA 4QVAA 1QX4A 5HXBA 2P3MA 3VMFA 1YREA 1PJ6A 1WSVA 3DGVA 1VQKB 3BCFA 4WZEA 2Z3OA 3WYAA 3BXMA 4MCPA 1PYTB 4ZX8A 5AG4A 3PGPA 3Q39A 4RS2A 2AE6A 2ZTNA 4YGOA 2WZPP 2CNSA 3K9UA 4X05A 2OK8A 2QGGA 4P6YA 4P22A 4EWTA 3CCVB 3QFTA 4B5PB 4AG9A 4R6TA 4PPZA 1IOIA 4XN3A 2YWGA 3Q6QA 2V8DA 1HEEA 4YRHA 4Z1MA 5FNZA 3GVJA 4TMXA 4XQFA 1YMEA 2I79A 4UEFA 2X85A 5F4JA 4ZX9A 3W6SA 1N08A 3W2IA 3I56B 2C6CA 2BM1A 1R43A 4R76A 1G7SA 2BSAA 1VHOA 4A38A 1N0VC 1BPLA 1W34A 4E8OA 4PK2A 5HXDA 3B8HA 3IO1A 1Z9UA 1LOKA 1OHHA 4YFJA 3S6FA 4HE6A 4OPVA 4IHMA 1R5BA 1AMPA 4Y49C 1NBMA 3A8JA 2OBSA 3CXPA 2D3NA 1KJZA 2D4PA 1DARA 4XORA 4GQNA 1QSRA 1VHSA 1LAPA 4R87A 2Q44A 5LYDA 1AUGA 1TIQA 1UD2A 3CZXA 5FA6A 1Z2LA 2OU2A 2KCWA 2O28A 3HUVA 5C88A 2XNJA 1TLLA 4OIDA 1VQ7B 1H8EA 2ABZA 3D8PA 3FPKA 1QFJA 3FMCA 2BF4A 4UCPA 3AGQA 2BL1A 2VQYA 4Z4WA 4FD7A 4AXVA 4NNJA 3G4SB 3ISXA 4X0CA 2PJ6A 4BMHA 3C26A 2QMUA 2ZEHA 4GS4A 2ZZFA 3IGRA 4OKOA 2GK7A 2I00A 3F0AA 2ZZGA 1QUEA 4G1VA 3PB8X 5F09A 1YJWB 2EBJA 4YAWA 5H59A 1T5EA 1HDUA 1WU8A 2VNHA 2JDDA 1IB1E 1B6BA 3ZBUA 1M44A 1WOOA 3EXNA 4RDLA 2AFXA 1E79A 4M1KA 1QQ9A 2Q4VA 2BO9A 5H5JA 4U9ZA 3PUNA 2ZW6A 4YAFA 2GPJA 2OYNA 2I3CA 2WJYA 4CGNA 4Z4YA 1J9ZA 4QV2A 3BHXA 3W91A 4JD6A 4RD4A 3WBJA 3EO4A 5D8NA 4KOUA 5E6TA 4B3GA 3D7DA 2G3AA 3CD6B 2ZL6A 1Z4EA 3V38A 5CPAA 3JRUA 2RFHA 2EUIA 4QUZA 1SKQA 3LO8A 4ZGNB 4KVOE 1X12A 1Q2CA 3TC8A 4MCRA 2JEVA 3B3CA 1UD8A 3BY2A 4NF1A 4M6HA 1V0FA 5LMZA 4MI4A 4IK2A 2RB7A 1FNBA 3W5HA 3B35A 4MFKA 3CCJB 4XKVA 4X06A 2G0BA 3LQEA 4AG7A 2PJ0A 3GIRA 1HDQA 2P0WA 4PC6A 2B7BA 1E1RA 1F20A 4PC2A 4U9UA 2Q7SA 4MFQA 3VARA 3R6JA 5JM6A 5DN6A 4UA3A 2Q0YA 3B7IA 2ZOGA 1ON0A 3WY9A 4DNCA 3QFSA 4NCNA 4M3SA 5H86A 2WSSA 4B5OA 4TMWA 3KZWA 4KOSA 4OC5A 4OOXA 3CCMB 3TTHA 2B4DA 2C27A 2DOGA 3KEWA 1GJRA 2XZPA 2PRBA 2RC6A 1VQPB 1QSMA 5J8FA 1EFRA 6CPAA 3FEDA 2BPOA 2J8MA 2YWEA 1UWYA 4PSWA 1Q2DA 2Z10A 3H9NA 4X07A 5G22A 4MHPA 4M6IA 4QUSA 3TX8A 4EVYA 4RDJA 5F47A 3TO9A 4ZY1A 3W2HA 4CRZB 2Q6LA 3PRTA 4G1PA 4OC4A 3T53B 4ONWA 1Q2YA 2J9AA 1DDIA 3PA1A 4B4DA 3LODA 1R5OA 4R9MA 2BEIA 1P4MA 4WJBA 2FCKA 3SI2A 4P25A 5A27A 4Q7AA 4KKSA 2V4DA 4B11A 3LMSA 2QEXB 4XPKA 1FT7A 1BPMA 1W35A 5F46A 3QFRA 1BQEA 2CIJA 1YIJB 4WQMA 3EC4A 4P4DA 1UMKA 2BV3A 4XLAA 4J3GA 1ZM3A 3FJUA 3VO1A 5JGFA 4KOWA 1S3ZA 4XPLA 1WPCA 3D2MA 4CAEA 3BJ8A 3WC6A 1CPXA 4NGMA 2DXQA 4X7FA 3CTAA 3RO0A 2R9VA 1TF8A 4X2TA 3OW2B 2BCOA 1HA3A 2QDXA 4MHNA 2X7BA 2ZEFA 1XRYA 4R57A 1JB9A 4OOVA 4NCZA 4MFZA 1S0UA 4OC2A 1NE9A 3CDXA 4HNXB 5EC4A 3ASRA 2VJIA 4CYOA 1OGJA 3HLPA 5EMIA 5L46A 1BPNA 4TKOB 3B3WA 2HCJB 4OP7A 3DR6A 3W6XA 2ZBVA 2NYQA 4XMYA 1F2PA 3N5FA 3JU4A 1TVCA 1MK4A 2B4BA 5IB0A 4IF5A 5BSYA 4LQGA 2IMOA 3IC1A 2CY2A 2IJZA 1WOPA 4B6ZA 4X8IA 2YWFA 3V8IA 1EP1B 3G8WA 1KUVA 3SKBA 3GKRA 1MJ9A 5HMNA 4UZFA 5K8PA 3TO7A 3NH5A 3PZJA 1KK3A 1B87A 2EIXA 5LRJA 2V8VA 3CP8A 4A37A 1QVGB 4AVBA 2NMTA 2OB0A 1Z8WA 2VBQA 3ZZIA 2ZPAA 2ZEPA 4B14A 4YAUA 4KZTA 2H5MA 1E3XA 2IL4A 2B5GB 1F57A 4MCSA 2PSWA 4ORFA 1YK3A 2FXFA 1BOBA 2F43A 1Y9KA 4LBZA 2OBTA 2C4UA 4PXDA 3W2GA 1M4DA 4KOXA 4GM5A 3FPPA 1PKVA 1VQNB 2BN4A 3CPAA 4UEZA 3TOBA 1ZLIA 5J8CA 4FD4A 4FUUA 3TE4A 4JWPA 3VWDA 2RC5A 5EBVA 1D8TA 3SJZA 5G21A 4B5PA 3PBBA 4P4FA 4C2YA 3BY1A 3PB9X 3PB6X 2OR4A 3FH4A 4RCYA 2FL4A 3VNVA 1E1QA 3R9EA 4OPSA 4TSFA 2PJ4A 3WNBA 1KC8D 4OC0A 2QTLA 1OB2A 1Y7EA 1TTTA 1FRNA 4R71A 4FWTA 4QVJA 4WZLA 3F5BA 5FL7A 4KUAA 3BH4A 3ASTA 4FD5A 2Z0ZA 2X6WA 1BLIA 4RN7A 1Q82D 5KTCA 4MBUA 4KLVA 2FIAA 4KSIA 4J0QA 2NV4A 3OE7A 3BI0A 3D68A 3DDYA 4Z4TA 2CTBA 5DWNA 4YWYA 2J8RA 4JXRA 1Y0RA 2X6YA 3WBKA 1Y9WA 4DK0A 1XE4A 3DDDA 4DQKA 4EH1A 5IB9A 4ZCMA 2C78A 5J3OA 1VLOA 1W9XA 4DNRB 2QECA 1QG0A 4M53A 1XE1A 1V0CA 1F2OA 2DEAA 1Q9SA 2ZXHA 4MFJA 2CNTA 4CRYB 4XLFA 1CQXA 2ZW4A 2VNJA 4NFRA 1G7TA 3SLNA 1KD1D 4B3FX 3FX6A 3WR7A 2F4NA 2ATRA 1R5NA 3KQXA 2YNEA 3GSIA 3FECA 3RAMA 3ONYA 1IICA 2PIZA 4F0XA 1XEBA 2ZITA 1I7PA 4CGOA 4RUHA 1YSJA 2PR1A 3NH4A 3N7ZA 3OWCA 1NDHA 4Y7CA 3SXOA 3TT2A 2BOAA 3GB0A 5IV0A 1Y7RA 2JIZA 4OC1A 4XNFA 1XQBA 2DERA 4MYTA 1N71A 8CPAA 3QNVA 3FXTA 1MABA 1TXRA 2REEA 2PJ8A 2WYRA 3RZAA 2JJ1A 4KVME 1W0JA 3D3SA 3R96A 4K30A 4ZI6A 1YJNB 2VBSA 2Z3MA 3B3VA 3CCUB 3E1YE 2BUEA 2X0KA 3NFZA 3MN8A 4UF4A 5LYFA 3JQRA 1U6MA 2ANPA 4UZEA 3HAGA 3CCEB 3IEHA 3CMAB 3W5VA 1FDRA 4YHBA 4Z4UA 5F48A 4RJLA 4ZYQA 4A94A 2R98A 1QH0A 2D3LA 4M4SA 4UEEA 4YXWA 1QSNA 4ZGYB 1EFUA 2OTLB 5TV2A 1EWYA 2CRVA 4MYUA 3IWEA 4RD1A 2AJ6A 1IJEA 5HH1A 3T56B 1GHEA 3T9YA 4H6UA 1YQEA 5THXA 4M2LA 2XNDA 3ZPNA 2D4OA 3VR6A 5I0CA 3J81k 3IIBA 5BSXA 5D29A 1NJID 2VBUA 3V76A 3WT4A 2AFOA 4R8FA 5KNLA 3TFYA 4H6ZA 3JQPA 1KUYA 5A28A 3MCAA 5IYNA 2B3VA 3R9FA 3T8WA 3U2QA 1BAVA 4ACAA 4MMOA 2QYVA 2VNKA 2ZEDA 3FEEA 3A1PA 1KRHA 2CC2A 1AIPA 3OKXA 1J4JA 4XN0A 2PRQA 4FXUA 3SI1A 4PC1A 4AVZA 1BLLE 4X7CA 4UWIA 4NJRA 3A3GA 1FNMA 4B10A 1OB5A 4KSAA 1N0UA 2XEIA 1QMUA 1S7FA 2BMWA 4YAOA 3CB4A 3AVYA 1PCAA 3CXSA 1KUXA 2ZEEA 3KASA 4QFMA 3SEJA 2GLFA 4P4IA 2IQ6A 1ZG7A 2A4NA 1JQGA 3Q3AA 1KQSB 4WZTA 4F8ZA 2CF4A 2NPFA 2QJ8A 4KLWA 3PVDA 2OBRA 1RTQA 3AVTA 5FIUA 2V7WA 5LYIA 2ZTGA 5JBQA 2GREA 4PC3A 1GAWA 5AG7A 2Z11A 2JJ2A 4E2AA 3Q38A 1S5KA 5TRDA 4PGOA 2PJ7A 4Z4RA 3CESA 4X3RA 4DK1A 5C82A 3P26A 1VQ6B 4ACBA 4CYPA 3B2YA 2R7HA 1SKYB 1M90D 3WNDA 4RPBA 3VH9A 2C5HA 3H94A 1LRZA 1IU8A 5J1QA 1Z5RA 2AFSA 1UD6A 4L89A 2V7VA 1UFHA 4KS9A 2YNDA 4R3KA 2Q43A 1CG2A 2X53S 3ZBTA 4MHZA 1FNCA 5JPHA 4FBEA 4PXCA 1XF8A 4OAEA 4QB9A 1CPSA 1LAMA 2X3UA 3GQBA 1EE3P 4C43A 4NXYA 1KTVA 1LANA 4NGPA 2Q4YA 2PJ1A 2Z3KA 4XM3A 3FYNA 4Z4SA 1IGBA 5DS0A 4RD6A 1T6XA 3ZC3A 4PQAA 2PMDA 1BO4A 1TKJA 3AVUA 3RNZA 1ZM9A 1UD4A 4KSFA 1XMTA 1Z8XA 5LRKA 1H8HA 4F9UA 1E64A 4CYNA 1YJ9B 3CT9A 1Q7LA 1COWA 4O23A 4UAJA 1QUFA 1CBXA 1PJ7A 4TT3A 3SLDA 1ZUNB 3RBUA 1S72B 4HKFA 4OC3A 3ZJ0A 4ZCIA 2JBJA 1P0HA 3B78A 1QVFB 2PE3A 4KUBA 2QMLA 1WDTA 1VGYA 3S9LA 2YNCC 1N06A 5G20A 2P6GA 2EWBA 4WZKA 2V7UA 1DDGA 2VI7A 4KVXA 3SHPA 3QSYA 3AVWA 3IJ3A 4C0SA 2B5GA 3OJXA 3W2FA 2VEZA 4BPRA 4KOTA 3LD2A 1QSOA 4TWEA 3S6KA 4RI1A 3ES9A 3CC2B 3PEIA 3PB7X 3WQZA 1IOFA 3ZZUA 3OEHA 4PV6A 2W6IA 2F1LA 3R9GA 1ELLP 4LQ6A 3DLJA 1I12A 3MRUA 1XOVA 4ASUA 2ZZQA 4KORA 4NBSA 2XZOA 4I49A 3D7FA 5LYLA 1ZG8A 3A35A 3L2NA 3JTKA 5FO1A 3SJGA 1WWZA 1OGIA 1M4LA 3H5ZA 1OBRA 3FB3A 4Q7JB 3ASPA 2ZL7A 1RO5A 1ZLHA 1IB0A 4RM0A 1YITB 1EFTA 2O4HA 2EK8A 3U6KA 2CNDA 4MY3A 2CXAA 1P4NA 5H84A 1FX0A 4C7HA 3D7HA 3EY5A 4G1BA 3GIUA 4PC7A 5IYQA 3WNCA 2R1IA 3FF3A 1WTHD 4QHYA 3CC4B 5FVJA 1RQRA 1PJ5A 3OOCA 1VIXA 2PVVA 4A31A 4JZ0A 1S7NA 2DPSA 4FN5A 3ONUA 2V7TA 1VKCA 4XPDB 3CPWB 2DCUA 1JNYA 4ZGQB 2O53A 3SJFA 3GVKA 1VJSA 3I1UA 5K8NA 2FIWA 2QN6A 4M6GA 3IU1A 4H2KA 3D4UA 2B3UA 1A8PA 3VNUA 2AFUA 4P44A 5J35A 1VQLB 2XGJA 4UBRA 3KI9A 2PJBA 4MJ8A 1VQ5B 3QB8A 4NEXA 2Z3PA 5KW9A 4NGRA 3BI1A 1EFCA 3SXNA 4XOTA 1MRZA 2FSRA 4II2A 3TO6A 3PUMA 4A39A 2PIYA 4N3NA 4G5GA 4XLCA 4CS0B 2XEXA 4CAWA 1VHEA 1GR1A 4H89A 2F8HA 2C6GA 3SJPA 2GANA 2PJCA 2YNCA 1W87A 3LWUA 2VYQA 1V5VA 3JVNA 2VZZA 4A30A 3GUXA 3OEEA 2GE3A 2D9RA 4IW3B 3SJEA 3FBUA 3H8GA 4ONUA 3R6KA 3OZVA 3CXQA 4CGPA 2FE7A 2Z3LA 4P9SA 3S6GA 2Q6KA 2Z3NA 1ZM4A 2W6JA 1A2ZA 3CW2A 2PJ3A 4B44A 1X10A 1NMTA 2PJ2A 4CYQA 1YLEA 4A2ZA 1QFZA 2C4TA 1CNFA 4HE5A 2PVWA 2OTJB 3H8EA 4FD6A 5HVHA 1TUIA 2G3TA 4M85A 4U5YA 3H4QA 4XD7A 7CPAA 4G7XA 2VNIA 4X5KA 1D2EA 4P1VA 1YLOA 2VJJA 3P2FA 4E0AA 3IWWA 1YX0A 4TN1A 1ELMP 2CTCA 1KZFA 4ZY2A 2J7KA 1Y0YA 3CMEB 3DR8A 3PP9A 3TCVA 3PFEA 4PXEA 5KTAA 2Q51A 3OJWA 1WP6A 4A95A 1VQMB 5AGEA 2B5OA 4P4JA 4IAVA 4OIWA 5CBMA 4YALA 3JQQA 2Q6OA 1DE4C 4X7DA 3FJOA 3EFAA 3NE8A 2DF5A 3MGDA 4C2ZA 1T6ZA 1R3NA 2Z6BD 5IYPA 2EVNA 4LBWA 4RD3A 1VQ4B 1KZLA 5G1ZA 1ZM2A 1Q7YD 2BVNA 5DSZA 3W2EA 4BD9A 4Y9RA 4B43A 3JUWA 3CP2A 2XOKA 3WC5A 1JWQA 1IYLA 4ZBGA 3OFNA 2JBKA 4TNUA 4YEJA 4RDKA 2FT0A 3UY5A 4OOSA 5FO0A 4LBVA 1TF9A 3I9SA 1R57A 4G7WA 3NH8A 4UCNA 4K3NA 3MHPA 1NSLA 1I18A 3IU2A 1N07A 4TMZA 3LQ6A 2V8GA 2VZYA 3RY8A 4QBJA 1VLYA 3BCDA 4DQLA 4TMTA 3AVXA 4MCQA 1H8LA 3CCQB 2C1CA 1Z8LA 4PABA 1QGZA 1HVXA 3S9MA 3FRMA 1VQOB 4CAFA 5IYWA 1BJKA 1YHQB 4AVAA 4MHYA 2GIVA 1EXMA 2R6HA 2JEWA 1WK4A 3CPXA 2P6FA 1Q81D 4B3XA 4XPDC 1S4MA 4N3GA 1YR0A 3V7ZA 3LVBA 4B47A 2WSAA 1S7LA 2ZEGA 1I8DA 1K8AD 1NB0A 2E1RA 2JDIA 2X8KA 2EK9A 1M4GA 4P26A 4P45A 3KHXA 3WABA 4ROXA 3BJ7A 3OZUA 3CCRB 4DJLA 3PB4X 4JJXA 2CBXA 2ZXIA 5F4OA 4XLEA 4RD0A 2PLFA 3ZUGA 3GVLA 4AF7A 4UIAA 3U6BA 2QVPA 4XOPA 4QC6A 5F4MA 2HC9A 2ZEMA 5CDFA 4NGQA 2JLMA 4CGMA 4NSQA 2OZUA 3ZIAA 1H42A 3CMMA 2DY1A 4F7DA 4KKUA 1Z8TA 2ODFA 2V77A 5HVGA 1EP3B 2C2WA 1SQHA 4UZUA 4FAIA 1NRKA 2OOTA 2OZHA 4CGLA 2ZOFA 2K5TA 1FY7A 2PQ8A 4M0LA 4B13A 4U9YA 4G6IA 5IK2A 1K9MD 3G71B 5A8AA 4P2NA 4C68A 2YGWA 1H85A 1E3ZA 2DEUA 1XBUA 1JA1A 3MMPA 3A3BA 1V0EA 3S6HA 1T6YA 3OPOA 4LC0A 1DG1G 3QFCA 3CRZA 5JQ4A 1ZG9A 3GYAA 5K8OA 3AGPA 4F6AA 5K8MA 2XNCA 2PJ5A 4QVTA 1WORA 1CP6A 2BSWA 4YELA 2VL1A 2ZW7A 4CAVA 3ASQA 1S7KA 2AFZA 2XEFA 3KR4A 2E1BA 2AFMA 3GLJA 1M1KD 4H9GA 5B6IA 3DSBA 3LACA 3T51B 3H8FA 5HZBA 4MFLA 1KK2A 1LFWA 2WPDA 1QGYA 3D7GA 1BX0A 1UD5A 2QA4B 2FX3A 4ZCLA 4ZV4A 1BX1A 3NA6A 4MXUA 1F60A 3WXMA 1L0CA 1E43A 3P27A 2YWHA 3KKWA 1JA0A 4XKWA 2WUUA 4OP4A 4C7IA 1I1DA 1PU9A 2QTZA 2V7QA 4W9YA 5IX3A 2ZL5A 1LCPA 1JJ2B 5KTDA 2P6EA 5TR9A 4UFWA 4KOYA 2BGIA 4XONA 4Q38A 5LRGA 3PFOA 4HNYB 4B48A 1VQ9B 3G6EB 3AVVA 3Q6RA 1XB2A 3WC7A 4ZY0A 4HPSA 2F5IA 1XIXA 4K1XA 1KWMA 4B12A 3E20A 2X6XA 1I21A 3FVLA 3IWGA 2Q6IA 2DPTA 2I1LA 1YGHA 1ARMA 1CX8A 4AVCA 2AFWA 2WJVA 3B8GA 4KOVA 3ZZTA 4Y9UA 2DIEA 3B3TA 3OAAA 1KK0A 1BMFA 3OP1A 4FK8A 1TKFA 2ZELA 2GJPA 3R95A 4MHDA 4NGNA 5EMNA 2XZLA 1CM0A 4AB7A 1RXTA 2JN9A 1YW4A 3G3SA 2ARHA 2OZGA 2V31A 1QSTA 4L8AA 1K28D 3PA2A 2HQYA 3BQJA 3QAYA 2FS5A 1CJWA 4Z4VA 3D2PA 5KSWB 3FIXA 2C77A 1G7CA 5IYRA 2R8VA 1GO2A 1PUAA 2HB6A 2PJAA 1AYEA 5JH9A 3G05A 1IIDA 4GXHA 3SI0A 1IY7A 2Y0MA 1Z4RA 2QIRA 4BBHA 3CXCB 1ARLA 3SJXA 2GU2A 4XNHB 5DWMA 3V7AA 3GY9A 2F7VA 2HDNB 1IJFA 4CPAA 4MY0A 4A33A 3FKSA 3I1FA 3B3SA 1E62A 1ELOA 3CCSB 5AG5A 2OK7A 3BC9A 4RCZA 1NSAA 4RLZA 1S60A 1HZEA 3D66A 2NSMA 4R3LA 2PJ9A 3VO2A 4JMQA 4AC9A 2DYIA 4Z65A 2LZJA 5TY0A 5AG6A 2Q04A 4DUKA 1ZO0A 4UWJA 2JDCA 4JLYA 2GK6A 3A8KA 4WWVA 1FRQA 5I4MA 3A8IA 3QAHA 3ISZA 1W0KA 2GFQA 4F0YA 5BWAB 1YX2A 1D1NA 4FWUA 5A88A 2B7CA 3LNNA 3W5UA 2ZW5A 4RPDA 3B82A 4AF6A 2CK3A 4PSXA 1N8RD 5E96A 2WPXA 4A32A 4JXQA 1RQPA 4LBYA 1U2RA 3P2HA 3IFEA 4P6VF 3F8KA 5HKKA 3D67A 2RC4A 1B23P 2ZBUA 3ZZ0A 1YVOA 3NE5B 2CW5A 1E63A 3NE7A 2PDOA 2WR8A 4PAAA 1VF7A 3K9TA 3KR5A 4NGSA 2BM0A 4HIZA 2B58A 2HV2A 3VWEA 3D26A 2GJKA 5GCNA 3BNWA 2REFA 1EP2B 3FNCA 2VBVA 1SM4A 2WPWA 5A89A 1TKHA 5AN9A 3E0KA 3RYOA 1UD3A 2OH1A 2ZZEA 1AMOA 4IUSA 1K73D 2C5BA 5F49A 3I55B 5ELYA 4YU9A 3T90A 1MJBA 4UIBA 5HVFA 4II9A 3CCLB 1QFYA 3BLNA 4DYOA 1K4JA 2B4DB 1FNDA 3VATA 2BGJA 4CAXA 4Z4ZA 4E0FA 1YI2B 4Y49B 2M5SA 1KK1A 1KMHA 4R7MA 3DNSA 3ASSA 2XEGA 4OMEA 5GV8A 2F1MA 4UFVA 4TMVA 4PXBA 3PBEA 3A9LA 1Q86D 3KL9A 4OLLA 1XFOA 3R1KA 4XL9A 1MJAA 1N05A 4F9VA 2C6PA 2GLJA 2VXKA 3KGQA 2QE7A 4P4BA 3OZWA 4P12A 4P10A 1M4IA 4BINA 5THWA 4MFPA 2CNMA 1VQ8B 4P3YA 2D74A 3KHZA 3QE2A 2PR8A 4II3A 3CC7B 5HZAA 2VBTA 4OADA 1NB9A 1B2RA 4PK3A 2XEJA 2FVGA 2VZLA 2HLDA 2HUZA 3TOAA 4C2XA 4NGTA 1QGAA 2ZXVA 1YW6A 2DETA 1GYTA 1IHMA 1WSRA 5CNPA 3I3GA 4P4EA 4EMEA 1GVHA 4NJQA 3S9NA 3KQZA 3PENA 1CNEA 4P3IA 5GV7A 1XJOA 4LX9A 2Q7BA 4HNWB 4LUAA 2ZEOA 1OB0A 1GAQA 2POKA 2PCUA 2Q4ZA 5ISVA 1OZPA 1G7RA 2HMAA 1W2BB 2ZENA 2KVOA 4OPOA 1M1DA 2J8NA 1WOSA 3OW7A 4XLHA 4KKTA 2GJRA 3K2KA 4XNHC 2EO8A 4Q36A 4XR6A 4X7EA 2V8HA 2G9DA 2AHOA 2V7XA 1YVKA 4CQJA 4JYWA 4MRIA 1XMBA
chains in the Genus database with same CATH topology
2PJ5A 1CP6A 2VL1A 2ZEPA 1CP7A 1FNOA 3PEIA 3PB7X 1F57A 4MCSA 2AFZA 1DTDA 4EFDA 2WZNA 2XEFA 3KR4A 2AFMA 1ELLP 3GLJA 3DLJA 3MRUA 4PXDA 4GM5A 3DGVA 3H8FA 3CPAA 4UEZA 3D7FA 1ZLIA 5LYLA 1ZG8A 3BXMA 1LFWA 3L2NA 4MCPA 3D7GA 4FUUA 1PYTB 4ZX8A 3SJGA 1M4LA 3NA6A 1OBRA 4MXUA 3PBBA 4P4FA 3PB9X 1ZLHA 3PB6X 2OR4A 3FH4A 4OP4A 4P6YA 2O4HA 2EK8A 4EWTA 2PJ4A 4W9YA 4OC0A 1LCPA 3D7HA 1Y7EA 4R6TA 4PPZA 3FF3A 2V8DA 1HEEA 5LRGA 3PFOA 1VIXA 2PVVA 4JZ0A 1YMEA 4KSIA 4UEFA 4ZX9A 3BI0A 3D68A 2CTBA 4YWYA 3WC7A 2O53A 1Y0RA 2C6CA 3SJFA 4ZY0A 1R43A 3I1UA 4R76A 5K8NA 1VHOA 4A38A 1KWMA 4H2KA 3D4UA 5HXDA 3FVLA 2AFUA 4P44A 3IO1A 1ARMA 1CX8A 2AFWA 5IB9A 1LOKA 4IHMA 3KI9A 1AMPA 1F2OA 2DEAA 2PJBA 3B3TA 1TKFA 2ZELA 4NGRA 3BI1A 4NGNA 1LAPA 4NFRA 3FX6A 1YW4A 3KQXA 5LYDA 1Z2LA 4A39A 3FECA 3RAMA 3HUVA 2PIYA 2PIZA 4OIDA 2ABZA 4RUHA 1YSJA 3NH4A 3FMCA 1VHEA 4AXVA 2HB6A 2F8HA 2C6GA 2PJCA 2PJAA 1AYEA 3ISXA 5JH9A 3LWUA 2PJ6A 2BOAA 3GB0A 4OC1A 2ZEHA 3GUXA 4OKOA 3SI0A 1IY7A 3PB8X 5F09A 8CPAA 3QNVA 1ARLA 1TXRA 3SJXA 2GU2A 3SJEA 2PJ8A 3H8GA 2F7VA 2WYRA 3RZAA 1HDUA 4CPAA 4ZI6A 2PJ3A 3B3SA 3B3VA 3NFZA 3MN8A 2AFXA 4UF4A 1QQ9A 5LYFA 2BO9A 2PJ2A 1NSAA 2ANPA 2I3CA 2PVWA 3IEHA 3D66A 3H8EA 2NSMA 5HVHA 2PJ9A 3BHXA 4ZYQA 5D8NA 4A94A 4Z65A 7CPAA 3D7DA 4UEEA 4DUKA 1YLOA 3IWWA 4WWVA 3V38A 1ELMP 5I4MA 2CTCA 4ZY2A 5CPAA 3JRUA 1Y0YA 2RFHA 3ISZA 3PFEA 4PXEA 2Q51A 4FWUA 3TC8A 4MCRA 3B3CA 3IIBA 4P4JA 5D29A 3IFEA 4IAVA 4OIWA 3WT4A 2AFOA 3D67A 4R8FA 4IK2A 2RB7A 5CBMA 3B35A 3T8WA 1BAVA 1DE4C 4MMOA 2QYVA 2ZEDA 3FEEA 1R3NA 3K9TA 2PJ0A 1HDQA 3KR5A 2PRQA 3SI1A 4NGSA 1BLLE 4NJRA 3VARA 5JM6A 2XEIA 1QMUA 4BD9A 3B7IA 2ZOGA 3WC5A 1PCAA 1TKHA 2JBKA 4TNUA 2ZEEA 3KASA 2GLFA 3KZWA 4OC5A 4P4IA 2IQ6A 1TF9A 1ZG7A 1JQGA 3NH8A 4F8ZA 4K3NA 2CF4A 2QJ8A 5ELYA 4YU9A 4UIBA 5HVFA 6CPAA 2V8GA 1RTQA 3FEDA 1UWYA 4DYOA 5LYIA 2GREA 4MHPA 3VATA 3TX8A 4MCQA 1H8LA 2PJ7A 4ZY1A 2C1CA 4X3RA 1Z8LA 3PRTA 4G1PA 4OC4A 4ONWA 2J9AA 4R7MA 3S9MA 3B2YA 2XEGA 4OMEA 4MHYA 4WJBA 3VH9A 2JEWA 4PXBA 3PBEA 3SI2A 3CPXA 4Q7AA 3KL9A 3V7ZA 5J1QA 3LMSA 1XFOA 1Z5RA 1FT7A 1BPMA 4F9VA 2AFSA 2ZEGA 2CIJA 2C6PA 2GLJA 3KGQA 4P4BA 4P4DA 2EK9A 4P45A 2Q43A 3KHXA 1CG2A 4P10A 3FJUA 3WABA 4MHZA 4FBEA 4PXCA 5JGFA 5THWA 4TWEA 4DJLA 1CPSA 1LAMA 3PB4X 3KHZA 3WC6A 1CPXA 1EE3P 4NGMA 1LANA 4NGPA 4UIAA 2QVPA 2PJ1A 2HC9A 1TF8A 2ZEMA 1IGBA 2XEJA 2FVGA 5DS0A 4X2TA 2BCOA 4NGQA 4MHNA 4PQAA 2ZEFA 1XRYA 4NGTA 1TKJA 1YW6A 1GYTA 4OC2A 3CDXA 4EMEA 4P4EA 3S9NA 4NJQA 3HLPA 2V77A 3KQZA 5HVGA 1BPNA 1XJOA 5LRKA 4FAIA 3B3WA 4F9UA 2OOTA 2ZEOA 2NYQA 3CT9A 1F2PA 1Q7LA 2POKA 2PCUA 2Q4ZA 2ZOFA 3N5FA 4O23A 1CBXA 4LQGA 2IMOA 2ZENA 3RBUA 3IC1A 4OC3A 2IJZA 4B6ZA 4X8IA 2JBJA 1XBUA 2PE3A 1VGYA 3K2KA 3S9LA 2EWBA 5K8PA 3NH5A 3IJ3A 2V8HA 2G9DA 1ZG9A 5LRJA 5K8OA 2V8VA 4A37A 4JYWA 5K8MA 4MRIA 1XMBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PJ5 A;  1CP6 A;  2VL1 A;  2ZEP A;  1CP7 A;  1FNO A;  3PEI A;  3PB7 X;  1F57 A;  4MCS A;  2AFZ A;  1DTD A;  4EFD A;  2WZN A;  2XEF A;  3KR4 A;  2AFM A;  1ELL P;  3GLJ A;  3DLJ A;  3MRU A;  4PXD A;  4GM5 A;  3DGV A;  3H8F A;  3CPA A;  4UEZ A;  3D7F A;  1ZLI A;  5LYL A;  1ZG8 A;  3BXM A;  1LFW A;  3L2N A;  4MCP A;  3D7G A;  4FUU A;  1PYT B;  4ZX8 A;  3SJG A;  1M4L A;  3NA6 A;  1OBR A;  4MXU A;  3PBB A;  4P4F A;  3PB9 X;  1ZLH A;  3PB6 X;  2OR4 A;  3FH4 A;  4OP4 A;  4P6Y A;  2O4H A;  2EK8 A;  4EWT A;  2PJ4 A;  4W9Y A;  4OC0 A;  1LCP A;  3D7H A;  1Y7E A;  4R6T A;  4PPZ A;  3FF3 A;  2V8D A;  1HEE A;  5LRG A;  3PFO A;  1VIX A;  2PVV A;  4JZ0 A;  1YME A;  4KSI A;  4UEF A;  4ZX9 A;  3BI0 A;  3D68 A;  2CTB A;  4YWY A;  3WC7 A;  2O53 A;  1Y0R A;  2C6C A;  3SJF A;  4ZY0 A;  1R43 A;  3I1U A;  4R76 A;  5K8N A;  1VHO A;  4A38 A;  1KWM A;  4H2K A;  3D4U A;  5HXD A;  3FVL A;  2AFU A;  4P44 A;  3IO1 A;  1ARM A;  1CX8 A;  2AFW A;  5IB9 A;  1LOK A;  4IHM A;  3KI9 A;  1AMP A;  1F2O A;  2DEA A;  2PJB A;  3B3T A;  1TKF A;  2ZEL A;  4NGR A;  3BI1 A;  4NGN A;  1LAP A;  4NFR A;  3FX6 A;  1YW4 A;  3KQX A;  5LYD A;  1Z2L A;  4A39 A;  3FEC A;  3RAM A;  3HUV A;  2PIY A;  2PIZ A;  4OID A;  2ABZ A;  4RUH A;  1YSJ A;  3NH4 A;  3FMC A;  1VHE A;  4AXV A;  2HB6 A;  2F8H A;  2C6G A;  2PJC A;  2PJA A;  1AYE A;  3ISX A;  5JH9 A;  3LWU A;  2PJ6 A;  2BOA A;  3GB0 A;  4OC1 A;  2ZEH A;  3GUX A;  4OKO A;  3SI0 A;  1IY7 A;  3PB8 X;  5F09 A;  8CPA A;  3QNV A;  1ARL A;  1TXR A;  3SJX A;  2GU2 A;  3SJE A;  2PJ8 A;  3H8G A;  2F7V A;  2WYR A;  3RZA A;  1HDU A;  4CPA A;  4ZI6 A;  2PJ3 A;  3B3S A;  3B3V A;  3NFZ A;  3MN8 A;  2AFX A;  4UF4 A;  1QQ9 A;  5LYF A;  2BO9 A;  2PJ2 A;  1NSA A;  2ANP A;  2I3C A;  2PVW A;  3IEH A;  3D66 A;  3H8E A;  2NSM A;  5HVH A;  2PJ9 A;  3BHX A;  4ZYQ A;  5D8N A;  4A94 A;  4Z65 A;  7CPA A;  3D7D A;  4UEE A;  4DUK A;  1YLO A;  3IWW A;  4WWV A;  3V38 A;  1ELM P;  5I4M A;  2CTC A;  4ZY2 A;  5CPA A;  3JRU A;  1Y0Y A;  2RFH A;  3ISZ A;  3PFE A;  4PXE A;  2Q51 A;  4FWU A;  3TC8 A;  4MCR A;  3B3C A;  3IIB A;  4P4J A;  5D29 A;  3IFE A;  4IAV A;  4OIW A;  3WT4 A;  2AFO A;  3D67 A;  4R8F A;  4IK2 A;  2RB7 A;  5CBM A;  3B35 A;  3T8W A;  1BAV A;  1DE4 C;  4MMO A;  2QYV A;  2ZED A;  3FEE A;  1R3N A;  3K9T A;  2PJ0 A;  1HDQ A;  3KR5 A;  2PRQ A;  3SI1 A;  4NGS A;  1BLL E;  4NJR A;  3VAR A;  5JM6 A;  2XEI A;  1QMU A;  4BD9 A;  3B7I A;  2ZOG A;  3WC5 A;  1PCA A;  1TKH A;  2JBK A;  4TNU A;  2ZEE A;  3KAS A;  2GLF A;  3KZW A;  4OC5 A;  4P4I A;  2IQ6 A;  1TF9 A;  1ZG7 A;  1JQG A;  3NH8 A;  4F8Z A;  4K3N A;  2CF4 A;  2QJ8 A;  5ELY A;  4YU9 A;  4UIB A;  5HVF A;  6CPA A;  2V8G A;  1RTQ A;  3FED A;  1UWY A;  4DYO A;  5LYI A;  2GRE A;  4MHP A;  3VAT A;  3TX8 A;  4MCQ A;  1H8L A;  2PJ7 A;  4ZY1 A;  2C1C A;  4X3R A;  1Z8L A;  3PRT A;  4G1P A;  4OC4 A;  4ONW A;  2J9A A;  4R7M A;  3S9M A;  3B2Y A;  2XEG A;  4OME A;  4MHY A;  4WJB A;  3VH9 A;  2JEW A;  4PXB A;  3PBE A;  3SI2 A;  3CPX A;  4Q7A A;  3KL9 A;  3V7Z A;  5J1Q A;  3LMS A;  1XFO A;  1Z5R A;  1FT7 A;  1BPM A;  4F9V A;  2AFS A;  2ZEG A;  2CIJ A;  2C6P A;  2GLJ A;  3KGQ A;  4P4B A;  4P4D A;  2EK9 A;  4P45 A;  2Q43 A;  3KHX A;  1CG2 A;  4P10 A;  3FJU A;  3WAB A;  4MHZ A;  4FBE A;  4PXC A;  5JGF A;  5THW A;  4TWE A;  4DJL A;  1CPS A;  1LAM A;  3PB4 X;  3KHZ A;  3WC6 A;  1CPX A;  1EE3 P;  4NGM A;  1LAN A;  4NGP A;  4UIA A;  2QVP A;  2PJ1 A;  2HC9 A;  1TF8 A;  2ZEM A;  1IGB A;  2XEJ A;  2FVG A;  5DS0 A;  4X2T A;  2BCO A;  4NGQ A;  4MHN A;  4PQA A;  2ZEF A;  1XRY A;  4NGT A;  1TKJ A;  1YW6 A;  1GYT A;  4OC2 A;  3CDX A;  4EME A;  4P4E A;  3S9N A;  4NJQ A;  3HLP A;  2V77 A;  3KQZ A;  5HVG A;  1BPN A;  1XJO A;  5LRK A;  4FAI A;  3B3W A;  4F9U A;  2OOT A;  2ZEO A;  2NYQ A;  3CT9 A;  1F2P A;  1Q7L A;  2POK A;  2PCU A;  2Q4Z A;  2ZOF A;  3N5F A;  4O23 A;  1CBX A;  4LQG A;  2IMO A;  2ZEN A;  3RBU A;  3IC1 A;  4OC3 A;  2IJZ A;  4B6Z A;  4X8I A;  2JBJ A;  1XBU A;  2PE3 A;  1VGY A;  3K2K A;  3S9L A;  2EWB A;  5K8P A;  3NH5 A;  3IJ3 A;  2V8H A;  2G9D A;  1ZG9 A;  5LRJ A;  5K8O A;  2V8V A;  4A37 A;  4JYW A;  5K8M A;  4MRI A;  1XMB A; 
#chains in the Genus database with same CATH topology
 1IYK A;  4RD2 A;  4L8J A;  2PIA A;  2PC1 A;  2GQF A;  1CP7 A;  1FNO A;  4UFX A;  4DNT B;  1DTD A;  4EFD A;  2WZN A;  2EFG A;  4UCM A;  4QVA A;  1QX4 A;  5HXB A;  2P3M A;  3VMF A;  1YRE A;  1PJ6 A;  1WSV A;  3DGV A;  1VQK B;  3BCF A;  4WZE A;  2Z3O A;  3WYA A;  3BXM A;  4MCP A;  1PYT B;  4ZX8 A;  5AG4 A;  3PGP A;  3Q39 A;  4RS2 A;  2AE6 A;  2ZTN A;  4YGO A;  2WZP P;  2CNS A;  3K9U A;  4X05 A;  2OK8 A;  2QGG A;  4P6Y A;  4P22 A;  4EWT A;  3CCV B;  3QFT A;  4B5P B;  4AG9 A;  4R6T A;  4PPZ A;  1IOI A;  4XN3 A;  2YWG A;  3Q6Q A;  2V8D A;  1HEE A;  4YRH A;  4Z1M A;  5FNZ A;  3GVJ A;  4TMX A;  4XQF A;  1YME A;  2I79 A;  4UEF A;  2X85 A;  5F4J A;  4ZX9 A;  3W6S A;  1N08 A;  3W2I A;  3I56 B;  2C6C A;  2BM1 A;  1R43 A;  4R76 A;  1G7S A;  2BSA A;  1VHO A;  4A38 A;  1N0V C;  1BPL A;  1W34 A;  4E8O A;  4PK2 A;  5HXD A;  3B8H A;  3IO1 A;  1Z9U A;  1LOK A;  1OHH A;  4YFJ A;  3S6F A;  4HE6 A;  4OPV A;  4IHM A;  1R5B A;  1AMP A;  4Y49 C;  1NBM A;  3A8J A;  2OBS A;  3CXP A;  2D3N A;  1KJZ A;  2D4P A;  1DAR A;  4XOR A;  4GQN A;  1QSR A;  1VHS A;  1LAP A;  4R87 A;  2Q44 A;  5LYD A;  1AUG A;  1TIQ A;  1UD2 A;  3CZX A;  5FA6 A;  1Z2L A;  2OU2 A;  2KCW A;  2O28 A;  3HUV A;  5C88 A;  2XNJ A;  1TLL A;  4OID A;  1VQ7 B;  1H8E A;  2ABZ A;  3D8P A;  3FPK A;  1QFJ A;  3FMC A;  2BF4 A;  4UCP A;  3AGQ A;  2BL1 A;  2VQY A;  4Z4W A;  4FD7 A;  4AXV A;  4NNJ A;  3G4S B;  3ISX A;  4X0C A;  2PJ6 A;  4BMH A;  3C26 A;  2QMU A;  2ZEH A;  4GS4 A;  2ZZF A;  3IGR A;  4OKO A;  2GK7 A;  2I00 A;  3F0A A;  2ZZG A;  1QUE A;  4G1V A;  3PB8 X;  5F09 A;  1YJW B;  2EBJ A;  4YAW A;  5H59 A;  1T5E A;  1HDU A;  1WU8 A;  2VNH A;  2JDD A;  1IB1 E;  1B6B A;  3ZBU A;  1M44 A;  1WOO A;  3EXN A;  4RDL A;  2AFX A;  1E79 A;  4M1K A;  1QQ9 A;  2Q4V A;  2BO9 A;  5H5J A;  4U9Z A;  3PUN A;  2ZW6 A;  4YAF A;  2GPJ A;  2OYN A;  2I3C A;  2WJY A;  4CGN A;  4Z4Y A;  1J9Z A;  4QV2 A;  3BHX A;  3W91 A;  4JD6 A;  4RD4 A;  3WBJ A;  3EO4 A;  5D8N A;  4KOU A;  5E6T A;  4B3G A;  3D7D A;  2G3A A;  3CD6 B;  2ZL6 A;  1Z4E A;  3V38 A;  5CPA A;  3JRU A;  2RFH A;  2EUI A;  4QUZ A;  1SKQ A;  3LO8 A;  4ZGN B;  4KVO E;  1X12 A;  1Q2C A;  3TC8 A;  4MCR A;  2JEV A;  3B3C A;  1UD8 A;  3BY2 A;  4NF1 A;  4M6H A;  1V0F A;  5LMZ A;  4MI4 A;  4IK2 A;  2RB7 A;  1FNB A;  3W5H A;  3B35 A;  4MFK A;  3CCJ B;  4XKV A;  4X06 A;  2G0B A;  3LQE A;  4AG7 A;  2PJ0 A;  3GIR A;  1HDQ A;  2P0W A;  4PC6 A;  2B7B A;  1E1R A;  1F20 A;  4PC2 A;  4U9U A;  2Q7S A;  4MFQ A;  3VAR A;  3R6J A;  5JM6 A;  5DN6 A;  4UA3 A;  2Q0Y A;  3B7I A;  2ZOG A;  1ON0 A;  3WY9 A;  4DNC A;  3QFS A;  4NCN A;  4M3S A;  5H86 A;  2WSS A;  4B5O A;  4TMW A;  3KZW A;  4KOS A;  4OC5 A;  4OOX A;  3CCM B;  3TTH A;  2B4D A;  2C27 A;  2DOG A;  3KEW A;  1GJR A;  2XZP A;  2PRB A;  2RC6 A;  1VQP B;  1QSM A;  5J8F A;  1EFR A;  6CPA A;  3FED A;  2BPO A;  2J8M A;  2YWE A;  1UWY A;  4PSW A;  1Q2D A;  2Z10 A;  3H9N A;  4X07 A;  5G22 A;  4MHP A;  4M6I A;  4QUS A;  3TX8 A;  4EVY A;  4RDJ A;  5F47 A;  3TO9 A;  4ZY1 A;  3W2H A;  4CRZ B;  2Q6L A;  3PRT A;  4G1P A;  4OC4 A;  3T53 B;  4ONW A;  1Q2Y A;  2J9A A;  1DDI A;  3PA1 A;  4B4D A;  3LOD A;  1R5O A;  4R9M A;  2BEI A;  1P4M A;  4WJB A;  2FCK A;  3SI2 A;  4P25 A;  5A27 A;  4Q7A A;  4KKS A;  2V4D A;  4B11 A;  3LMS A;  2QEX B;  4XPK A;  1FT7 A;  1BPM A;  1W35 A;  5F46 A;  3QFR A;  1BQE A;  2CIJ A;  1YIJ B;  4WQM A;  3EC4 A;  4P4D A;  1UMK A;  2BV3 A;  4XLA A;  4J3G A;  1ZM3 A;  3FJU A;  3VO1 A;  5JGF A;  4KOW A;  1S3Z A;  4XPL A;  1WPC A;  3D2M A;  4CAE A;  3BJ8 A;  3WC6 A;  1CPX A;  4NGM A;  2DXQ A;  4X7F A;  3CTA A;  3RO0 A;  2R9V A;  1TF8 A;  4X2T A;  3OW2 B;  2BCO A;  1HA3 A;  2QDX A;  4MHN A;  2X7B A;  2ZEF A;  1XRY A;  4R57 A;  1JB9 A;  4OOV A;  4NCZ A;  4MFZ A;  1S0U A;  4OC2 A;  1NE9 A;  3CDX A;  4HNX B;  5EC4 A;  3ASR A;  2VJI A;  4CYO A;  1OGJ A;  3HLP A;  5EMI A;  5L46 A;  1BPN A;  4TKO B;  3B3W A;  2HCJ B;  4OP7 A;  3DR6 A;  3W6X A;  2ZBV A;  2NYQ A;  4XMY A;  1F2P A;  3N5F A;  3JU4 A;  1TVC A;  1MK4 A;  2B4B A;  5IB0 A;  4IF5 A;  5BSY A;  4LQG A;  2IMO A;  3IC1 A;  2CY2 A;  2IJZ A;  1WOP A;  4B6Z A;  4X8I A;  2YWF A;  3V8I A;  1EP1 B;  3G8W A;  1KUV A;  3SKB A;  3GKR A;  1MJ9 A;  5HMN A;  4UZF A;  5K8P A;  3TO7 A;  3NH5 A;  3PZJ A;  1KK3 A;  1B87 A;  2EIX A;  5LRJ A;  2V8V A;  3CP8 A;  4A37 A;  1QVG B;  4AVB A;  2NMT A;  2OB0 A;  1Z8W A;  2VBQ A;  3ZZI A;  2ZPA A;  2ZEP A;  4B14 A;  4YAU A;  4KZT A;  2H5M A;  1E3X A;  2IL4 A;  2B5G B;  1F57 A;  4MCS A;  2PSW A;  4ORF A;  1YK3 A;  2FXF A;  1BOB A;  2F43 A;  1Y9K A;  4LBZ A;  2OBT A;  2C4U A;  4PXD A;  3W2G A;  1M4D A;  4KOX A;  4GM5 A;  3FPP A;  1PKV A;  1VQN B;  2BN4 A;  3CPA A;  4UEZ A;  3TOB A;  1ZLI A;  5J8C A;  4FD4 A;  4FUU A;  3TE4 A;  4JWP A;  3VWD A;  2RC5 A;  5EBV A;  1D8T A;  3SJZ A;  5G21 A;  4B5P A;  3PBB A;  4P4F A;  4C2Y A;  3BY1 A;  3PB9 X;  3PB6 X;  2OR4 A;  3FH4 A;  4RCY A;  2FL4 A;  3VNV A;  1E1Q A;  3R9E A;  4OPS A;  4TSF A;  2PJ4 A;  3WNB A;  1KC8 D;  4OC0 A;  2QTL A;  1OB2 A;  1Y7E A;  1TTT A;  1FRN A;  4R71 A;  4FWT A;  4QVJ A;  4WZL A;  3F5B A;  5FL7 A;  4KUA A;  3BH4 A;  3AST A;  4FD5 A;  2Z0Z A;  2X6W A;  1BLI A;  4RN7 A;  1Q82 D;  5KTC A;  4MBU A;  4KLV A;  2FIA A;  4KSI A;  4J0Q A;  2NV4 A;  3OE7 A;  3BI0 A;  3D68 A;  3DDY A;  4Z4T A;  2CTB A;  5DWN A;  4YWY A;  2J8R A;  4JXR A;  1Y0R A;  2X6Y A;  3WBK A;  1Y9W A;  4DK0 A;  1XE4 A;  3DDD A;  4DQK A;  4EH1 A;  5IB9 A;  4ZCM A;  2C78 A;  5J3O A;  1VLO A;  1W9X A;  4DNR B;  2QEC A;  1QG0 A;  4M53 A;  1XE1 A;  1V0C A;  1F2O A;  2DEA A;  1Q9S A;  2ZXH A;  4MFJ A;  2CNT A;  4CRY B;  4XLF A;  1CQX A;  2ZW4 A;  2VNJ A;  4NFR A;  1G7T A;  3SLN A;  1KD1 D;  4B3F X;  3FX6 A;  3WR7 A;  2F4N A;  2ATR A;  1R5N A;  3KQX A;  2YNE A;  3GSI A;  3FEC A;  3RAM A;  3ONY A;  1IIC A;  2PIZ A;  4F0X A;  1XEB A;  2ZIT A;  1I7P A;  4CGO A;  4RUH A;  1YSJ A;  2PR1 A;  3NH4 A;  3N7Z A;  3OWC A;  1NDH A;  4Y7C A;  3SXO A;  3TT2 A;  2BOA A;  3GB0 A;  5IV0 A;  1Y7R A;  2JIZ A;  4OC1 A;  4XNF A;  1XQB A;  2DER A;  4MYT A;  1N71 A;  8CPA A;  3QNV A;  3FXT A;  1MAB A;  1TXR A;  2REE A;  2PJ8 A;  2WYR A;  3RZA A;  2JJ1 A;  4KVM E;  1W0J A;  3D3S A;  3R96 A;  4K30 A;  4ZI6 A;  1YJN B;  2VBS A;  2Z3M A;  3B3V A;  3CCU B;  3E1Y E;  2BUE A;  2X0K A;  3NFZ A;  3MN8 A;  4UF4 A;  5LYF A;  3JQR A;  1U6M A;  2ANP A;  4UZE A;  3HAG A;  3CCE B;  3IEH A;  3CMA B;  3W5V A;  1FDR A;  4YHB A;  4Z4U A;  5F48 A;  4RJL A;  4ZYQ A;  4A94 A;  2R98 A;  1QH0 A;  2D3L A;  4M4S A;  4UEE A;  4YXW A;  1QSN A;  4ZGY B;  1EFU A;  2OTL B;  5TV2 A;  1EWY A;  2CRV A;  4MYU A;  3IWE A;  4RD1 A;  2AJ6 A;  1IJE A;  5HH1 A;  3T56 B;  1GHE A;  3T9Y A;  4H6U A;  1YQE A;  5THX A;  4M2L A;  2XND A;  3ZPN A;  2D4O A;  3VR6 A;  5I0C A;  3J81 k;  3IIB A;  5BSX A;  5D29 A;  1NJI D;  2VBU A;  3V76 A;  3WT4 A;  2AFO A;  4R8F A;  5KNL A;  3TFY A;  4H6Z A;  3JQP A;  1KUY A;  5A28 A;  3MCA A;  5IYN A;  2B3V A;  3R9F A;  3T8W A;  3U2Q A;  1BAV A;  4ACA A;  4MMO A;  2QYV A;  2VNK A;  2ZED A;  3FEE A;  3A1P A;  1KRH A;  2CC2 A;  1AIP A;  3OKX A;  1J4J A;  4XN0 A;  2PRQ A;  4FXU A;  3SI1 A;  4PC1 A;  4AVZ A;  1BLL E;  4X7C A;  4UWI A;  4NJR A;  3A3G A;  1FNM A;  4B10 A;  1OB5 A;  4KSA A;  1N0U A;  2XEI A;  1QMU A;  1S7F A;  2BMW A;  4YAO A;  3CB4 A;  3AVY A;  1PCA A;  3CXS A;  1KUX A;  2ZEE A;  3KAS A;  4QFM A;  3SEJ A;  2GLF A;  4P4I A;  2IQ6 A;  1ZG7 A;  2A4N A;  1JQG A;  3Q3A A;  1KQS B;  4WZT A;  4F8Z A;  2CF4 A;  2NPF A;  2QJ8 A;  4KLW A;  3PVD A;  2OBR A;  1RTQ A;  3AVT A;  5FIU A;  2V7W A;  5LYI A;  2ZTG A;  5JBQ A;  2GRE A;  4PC3 A;  1GAW A;  5AG7 A;  2Z11 A;  2JJ2 A;  4E2A A;  3Q38 A;  1S5K A;  5TRD A;  4PGO A;  2PJ7 A;  4Z4R A;  3CES A;  4X3R A;  4DK1 A;  5C82 A;  3P26 A;  1VQ6 B;  4ACB A;  4CYP A;  3B2Y A;  2R7H A;  1SKY B;  1M90 D;  3WND A;  4RPB A;  3VH9 A;  2C5H A;  3H94 A;  1LRZ A;  1IU8 A;  5J1Q A;  1Z5R A;  2AFS A;  1UD6 A;  4L89 A;  2V7V A;  1UFH A;  4KS9 A;  2YND A;  4R3K A;  2Q43 A;  1CG2 A;  2X53 S;  3ZBT A;  4MHZ A;  1FNC A;  5JPH A;  4FBE A;  4PXC A;  1XF8 A;  4OAE A;  4QB9 A;  1CPS A;  1LAM A;  2X3U A;  3GQB A;  1EE3 P;  4C43 A;  4NXY A;  1KTV A;  1LAN A;  4NGP A;  2Q4Y A;  2PJ1 A;  2Z3K A;  4XM3 A;  3FYN A;  4Z4S A;  1IGB A;  5DS0 A;  4RD6 A;  1T6X A;  3ZC3 A;  4PQA A;  2PMD A;  1BO4 A;  1TKJ A;  3AVU A;  3RNZ A;  1ZM9 A;  1UD4 A;  4KSF A;  1XMT A;  1Z8X A;  5LRK A;  1H8H A;  4F9U A;  1E64 A;  4CYN A;  1YJ9 B;  3CT9 A;  1Q7L A;  1COW A;  4O23 A;  4UAJ A;  1QUF A;  1CBX A;  1PJ7 A;  4TT3 A;  3SLD A;  1ZUN B;  3RBU A;  1S72 B;  4HKF A;  4OC3 A;  3ZJ0 A;  4ZCI A;  2JBJ A;  1P0H A;  3B78 A;  1QVF B;  2PE3 A;  4KUB A;  2QML A;  1WDT A;  1VGY A;  3S9L A;  2YNC C;  1N06 A;  5G20 A;  2P6G A;  2EWB A;  4WZK A;  2V7U A;  1DDG A;  2VI7 A;  4KVX A;  3SHP A;  3QSY A;  3AVW A;  3IJ3 A;  4C0S A;  2B5G A;  3OJX A;  3W2F A;  2VEZ A;  4BPR A;  4KOT A;  3LD2 A;  1QSO A;  4TWE A;  3S6K A;  4RI1 A;  3ES9 A;  3CC2 B;  3PEI A;  3PB7 X;  3WQZ A;  1IOF A;  3ZZU A;  3OEH A;  4PV6 A;  2W6I A;  2F1L A;  3R9G A;  1ELL P;  4LQ6 A;  3DLJ A;  1I12 A;  3MRU A;  1XOV A;  4ASU A;  2ZZQ A;  4KOR A;  4NBS A;  2XZO A;  4I49 A;  3D7F A;  5LYL A;  1ZG8 A;  3A35 A;  3L2N A;  3JTK A;  5FO1 A;  3SJG A;  1WWZ A;  1OGI A;  1M4L A;  3H5Z A;  1OBR A;  3FB3 A;  4Q7J B;  3ASP A;  2ZL7 A;  1RO5 A;  1ZLH A;  1IB0 A;  4RM0 A;  1YIT B;  1EFT A;  2O4H A;  2EK8 A;  3U6K A;  2CND A;  4MY3 A;  2CXA A;  1P4N A;  5H84 A;  1FX0 A;  4C7H A;  3D7H A;  3EY5 A;  4G1B A;  3GIU A;  4PC7 A;  5IYQ A;  3WNC A;  2R1I A;  3FF3 A;  1WTH D;  4QHY A;  3CC4 B;  5FVJ A;  1RQR A;  1PJ5 A;  3OOC A;  1VIX A;  2PVV A;  4A31 A;  4JZ0 A;  1S7N A;  2DPS A;  4FN5 A;  3ONU A;  2V7T A;  1VKC A;  4XPD B;  3CPW B;  2DCU A;  1JNY A;  4ZGQ B;  2O53 A;  3SJF A;  3GVK A;  1VJS A;  3I1U A;  5K8N A;  2FIW A;  2QN6 A;  4M6G A;  3IU1 A;  4H2K A;  3D4U A;  2B3U A;  1A8P A;  3VNU A;  2AFU A;  4P44 A;  5J35 A;  1VQL B;  2XGJ A;  4UBR A;  3KI9 A;  2PJB A;  4MJ8 A;  1VQ5 B;  3QB8 A;  4NEX A;  2Z3P A;  5KW9 A;  4NGR A;  3BI1 A;  1EFC A;  3SXN A;  4XOT A;  1MRZ A;  2FSR A;  4II2 A;  3TO6 A;  3PUM A;  4A39 A;  2PIY A;  4N3N A;  4G5G A;  4XLC A;  4CS0 B;  2XEX A;  4CAW A;  1VHE A;  1GR1 A;  4H89 A;  2F8H A;  2C6G A;  3SJP A;  2GAN A;  2PJC A;  2YNC A;  1W87 A;  3LWU A;  2VYQ A;  1V5V A;  3JVN A;  2VZZ A;  4A30 A;  3GUX A;  3OEE A;  2GE3 A;  2D9R A;  4IW3 B;  3SJE A;  3FBU A;  3H8G A;  4ONU A;  3R6K A;  3OZV A;  3CXQ A;  4CGP A;  2FE7 A;  2Z3L A;  4P9S A;  3S6G A;  2Q6K A;  2Z3N A;  1ZM4 A;  2W6J A;  1A2Z A;  3CW2 A;  2PJ3 A;  4B44 A;  1X10 A;  1NMT A;  2PJ2 A;  4CYQ A;  1YLE A;  4A2Z A;  1QFZ A;  2C4T A;  1CNF A;  4HE5 A;  2PVW A;  2OTJ B;  3H8E A;  4FD6 A;  5HVH A;  1TUI A;  2G3T A;  4M85 A;  4U5Y A;  3H4Q A;  4XD7 A;  7CPA A;  4G7X A;  2VNI A;  4X5K A;  1D2E A;  4P1V A;  1YLO A;  2VJJ A;  3P2F A;  4E0A A;  3IWW A;  1YX0 A;  4TN1 A;  1ELM P;  2CTC A;  1KZF A;  4ZY2 A;  2J7K A;  1Y0Y A;  3CME B;  3DR8 A;  3PP9 A;  3TCV A;  3PFE A;  4PXE A;  5KTA A;  2Q51 A;  3OJW A;  1WP6 A;  4A95 A;  1VQM B;  5AGE A;  2B5O A;  4P4J A;  4IAV A;  4OIW A;  5CBM A;  4YAL A;  3JQQ A;  2Q6O A;  1DE4 C;  4X7D A;  3FJO A;  3EFA A;  3NE8 A;  2DF5 A;  3MGD A;  4C2Z A;  1T6Z A;  1R3N A;  2Z6B D;  5IYP A;  2EVN A;  4LBW A;  4RD3 A;  1VQ4 B;  1KZL A;  5G1Z A;  1ZM2 A;  1Q7Y D;  2BVN A;  5DSZ A;  3W2E A;  4BD9 A;  4Y9R A;  4B43 A;  3JUW A;  3CP2 A;  2XOK A;  3WC5 A;  1JWQ A;  1IYL A;  4ZBG A;  3OFN A;  2JBK A;  4TNU A;  4YEJ A;  4RDK A;  2FT0 A;  3UY5 A;  4OOS A;  5FO0 A;  4LBV A;  1TF9 A;  3I9S A;  1R57 A;  4G7W A;  3NH8 A;  4UCN A;  4K3N A;  3MHP A;  1NSL A;  1I18 A;  3IU2 A;  1N07 A;  4TMZ A;  3LQ6 A;  2V8G A;  2VZY A;  3RY8 A;  4QBJ A;  1VLY A;  3BCD A;  4DQL A;  4TMT A;  3AVX A;  4MCQ A;  1H8L A;  3CCQ B;  2C1C A;  1Z8L A;  4PAB A;  1QGZ A;  1HVX A;  3S9M A;  3FRM A;  1VQO B;  4CAF A;  5IYW A;  1BJK A;  1YHQ B;  4AVA A;  4MHY A;  2GIV A;  1EXM A;  2R6H A;  2JEW A;  1WK4 A;  3CPX A;  2P6F A;  1Q81 D;  4B3X A;  4XPD C;  1S4M A;  4N3G A;  1YR0 A;  3V7Z A;  3LVB A;  4B47 A;  2WSA A;  1S7L A;  2ZEG A;  1I8D A;  1K8A D;  1NB0 A;  2E1R A;  2JDI A;  2X8K A;  2EK9 A;  1M4G A;  4P26 A;  4P45 A;  3KHX A;  3WAB A;  4ROX A;  3BJ7 A;  3OZU A;  3CCR B;  4DJL A;  3PB4 X;  4JJX A;  2CBX A;  2ZXI A;  5F4O A;  4XLE A;  4RD0 A;  2PLF A;  3ZUG A;  3GVL A;  4AF7 A;  4UIA A;  3U6B A;  2QVP A;  4XOP A;  4QC6 A;  5F4M A;  2HC9 A;  2ZEM A;  5CDF A;  4NGQ A;  2JLM A;  4CGM A;  4NSQ A;  2OZU A;  3ZIA A;  1H42 A;  3CMM A;  2DY1 A;  4F7D A;  4KKU A;  1Z8T A;  2ODF A;  2V77 A;  5HVG A;  1EP3 B;  2C2W A;  1SQH A;  4UZU A;  4FAI A;  1NRK A;  2OOT A;  2OZH A;  4CGL A;  2ZOF A;  2K5T A;  1FY7 A;  2PQ8 A;  4M0L A;  4B13 A;  4U9Y A;  4G6I A;  5IK2 A;  1K9M D;  3G71 B;  5A8A A;  4P2N A;  4C68 A;  2YGW A;  1H85 A;  1E3Z A;  2DEU A;  1XBU A;  1JA1 A;  3MMP A;  3A3B A;  1V0E A;  3S6H A;  1T6Y A;  3OPO A;  4LC0 A;  1DG1 G;  3QFC A;  3CRZ A;  5JQ4 A;  1ZG9 A;  3GYA A;  5K8O A;  3AGP A;  4F6A A;  5K8M A;  2XNC A;  2PJ5 A;  4QVT A;  1WOR A;  1CP6 A;  2BSW A;  4YEL A;  2VL1 A;  2ZW7 A;  4CAV A;  3ASQ A;  1S7K A;  2AFZ A;  2XEF A;  3KR4 A;  2E1B A;  2AFM A;  3GLJ A;  1M1K D;  4H9G A;  5B6I A;  3DSB A;  3LAC A;  3T51 B;  3H8F A;  5HZB A;  4MFL A;  1KK2 A;  1LFW A;  2WPD A;  1QGY A;  3D7G A;  1BX0 A;  1UD5 A;  2QA4 B;  2FX3 A;  4ZCL A;  4ZV4 A;  1BX1 A;  3NA6 A;  4MXU A;  1F60 A;  3WXM A;  1L0C A;  1E43 A;  3P27 A;  2YWH A;  3KKW A;  1JA0 A;  4XKW A;  2WUU A;  4OP4 A;  4C7I A;  1I1D A;  1PU9 A;  2QTZ A;  2V7Q A;  4W9Y A;  5IX3 A;  2ZL5 A;  1LCP A;  1JJ2 B;  5KTD A;  2P6E A;  5TR9 A;  4UFW A;  4KOY A;  2BGI A;  4XON A;  4Q38 A;  5LRG A;  3PFO A;  4HNY B;  4B48 A;  1VQ9 B;  3G6E B;  3AVV A;  3Q6R A;  1XB2 A;  3WC7 A;  4ZY0 A;  4HPS A;  2F5I A;  1XIX A;  4K1X A;  1KWM A;  4B12 A;  3E20 A;  2X6X A;  1I21 A;  3FVL A;  3IWG A;  2Q6I A;  2DPT A;  2I1L A;  1YGH A;  1ARM A;  1CX8 A;  4AVC A;  2AFW A;  2WJV A;  3B8G A;  4KOV A;  3ZZT A;  4Y9U A;  2DIE A;  3B3T A;  3OAA A;  1KK0 A;  1BMF A;  3OP1 A;  4FK8 A;  1TKF A;  2ZEL A;  2GJP A;  3R95 A;  4MHD A;  4NGN A;  5EMN A;  2XZL A;  1CM0 A;  4AB7 A;  1RXT A;  2JN9 A;  1YW4 A;  3G3S A;  2ARH A;  2OZG A;  2V31 A;  1QST A;  4L8A A;  1K28 D;  3PA2 A;  2HQY A;  3BQJ A;  3QAY A;  2FS5 A;  1CJW A;  4Z4V A;  3D2P A;  5KSW B;  3FIX A;  2C77 A;  1G7C A;  5IYR A;  2R8V A;  1GO2 A;  1PUA A;  2HB6 A;  2PJA A;  1AYE A;  5JH9 A;  3G05 A;  1IID A;  4GXH A;  3SI0 A;  1IY7 A;  2Y0M A;  1Z4R A;  2QIR A;  4BBH A;  3CXC B;  1ARL A;  3SJX A;  2GU2 A;  4XNH B;  5DWM A;  3V7A A;  3GY9 A;  2F7V A;  2HDN B;  1IJF A;  4CPA A;  4MY0 A;  4A33 A;  3FKS A;  3I1F A;  3B3S A;  1E62 A;  1ELO A;  3CCS B;  5AG5 A;  2OK7 A;  3BC9 A;  4RCZ A;  1NSA A;  4RLZ A;  1S60 A;  1HZE A;  3D66 A;  2NSM A;  4R3L A;  2PJ9 A;  3VO2 A;  4JMQ A;  4AC9 A;  2DYI A;  4Z65 A;  2LZJ A;  5TY0 A;  5AG6 A;  2Q04 A;  4DUK A;  1ZO0 A;  4UWJ A;  2JDC A;  4JLY A;  2GK6 A;  3A8K A;  4WWV A;  1FRQ A;  5I4M A;  3A8I A;  3QAH A;  3ISZ A;  1W0K A;  2GFQ A;  4F0Y A;  5BWA B;  1YX2 A;  1D1N A;  4FWU A;  5A88 A;  2B7C A;  3LNN A;  3W5U A;  2ZW5 A;  4RPD A;  3B82 A;  4AF6 A;  2CK3 A;  4PSX A;  1N8R D;  5E96 A;  2WPX A;  4A32 A;  4JXQ A;  1RQP A;  4LBY A;  1U2R A;  3P2H A;  3IFE A;  4P6V F;  3F8K A;  5HKK A;  3D67 A;  2RC4 A;  1B23 P;  2ZBU A;  3ZZ0 A;  1YVO A;  3NE5 B;  2CW5 A;  1E63 A;  3NE7 A;  2PDO A;  2WR8 A;  4PAA A;  1VF7 A;  3K9T A;  3KR5 A;  4NGS A;  2BM0 A;  4HIZ A;  2B58 A;  2HV2 A;  3VWE A;  3D26 A;  2GJK A;  5GCN A;  3BNW A;  2REF A;  1EP2 B;  3FNC A;  2VBV A;  1SM4 A;  2WPW A;  5A89 A;  1TKH A;  5AN9 A;  3E0K A;  3RYO A;  1UD3 A;  2OH1 A;  2ZZE A;  1AMO A;  4IUS A;  1K73 D;  2C5B A;  5F49 A;  3I55 B;  5ELY A;  4YU9 A;  3T90 A;  1MJB A;  4UIB A;  5HVF A;  4II9 A;  3CCL B;  1QFY A;  3BLN A;  4DYO A;  1K4J A;  2B4D B;  1FND A;  3VAT A;  2BGJ A;  4CAX A;  4Z4Z A;  4E0F A;  1YI2 B;  4Y49 B;  2M5S A;  1KK1 A;  1KMH A;  4R7M A;  3DNS A;  3ASS A;  2XEG A;  4OME A;  5GV8 A;  2F1M A;  4UFV A;  4TMV A;  4PXB A;  3PBE A;  3A9L A;  1Q86 D;  3KL9 A;  4OLL A;  1XFO A;  3R1K A;  4XL9 A;  1MJA A;  1N05 A;  4F9V A;  2C6P A;  2GLJ A;  2VXK A;  3KGQ A;  2QE7 A;  4P4B A;  3OZW A;  4P12 A;  4P10 A;  1M4I A;  4BIN A;  5THW A;  4MFP A;  2CNM A;  1VQ8 B;  4P3Y A;  2D74 A;  3KHZ A;  3QE2 A;  2PR8 A;  4II3 A;  3CC7 B;  5HZA A;  2VBT A;  4OAD A;  1NB9 A;  1B2R A;  4PK3 A;  2XEJ A;  2FVG A;  2VZL A;  2HLD A;  2HUZ A;  3TOA A;  4C2X A;  4NGT A;  1QGA A;  2ZXV A;  1YW6 A;  2DET A;  1GYT A;  1IHM A;  1WSR A;  5CNP A;  3I3G A;  4P4E A;  4EME A;  1GVH A;  4NJQ A;  3S9N A;  3KQZ A;  3PEN A;  1CNE A;  4P3I A;  5GV7 A;  1XJO A;  4LX9 A;  2Q7B A;  4HNW B;  4LUA A;  2ZEO A;  1OB0 A;  1GAQ A;  2POK A;  2PCU A;  2Q4Z A;  5ISV A;  1OZP A;  1G7R A;  2HMA A;  1W2B B;  2ZEN A;  2KVO A;  4OPO A;  1M1D A;  2J8N A;  1WOS A;  3OW7 A;  4XLH A;  4KKT A;  2GJR A;  3K2K A;  4XNH C;  2EO8 A;  4Q36 A;  4XR6 A;  4X7E A;  2V8H A;  2G9D A;  2AHO A;  2V7X A;  1YVK A;  4CQJ A;  4JYW A;  4MRI A;  1XMB A; 
#chains in the Genus database with same CATH homology
 2PJ5 A;  1CP6 A;  2VL1 A;  2ZEP A;  1CP7 A;  1FNO A;  3PEI A;  3PB7 X;  1F57 A;  4MCS A;  2AFZ A;  1DTD A;  4EFD A;  2WZN A;  2XEF A;  3KR4 A;  2AFM A;  1ELL P;  3GLJ A;  3DLJ A;  3MRU A;  4PXD A;  4GM5 A;  3DGV A;  3H8F A;  3CPA A;  4UEZ A;  3D7F A;  1ZLI A;  5LYL A;  1ZG8 A;  3BXM A;  1LFW A;  3L2N A;  4MCP A;  3D7G A;  4FUU A;  1PYT B;  4ZX8 A;  3SJG A;  1M4L A;  3NA6 A;  1OBR A;  4MXU A;  3PBB A;  4P4F A;  3PB9 X;  1ZLH A;  3PB6 X;  2OR4 A;  3FH4 A;  4OP4 A;  4P6Y A;  2O4H A;  2EK8 A;  4EWT A;  2PJ4 A;  4W9Y A;  4OC0 A;  1LCP A;  3D7H A;  1Y7E A;  4R6T A;  4PPZ A;  3FF3 A;  2V8D A;  1HEE A;  5LRG A;  3PFO A;  1VIX A;  2PVV A;  4JZ0 A;  1YME A;  4KSI A;  4UEF A;  4ZX9 A;  3BI0 A;  3D68 A;  2CTB A;  4YWY A;  3WC7 A;  2O53 A;  1Y0R A;  2C6C A;  3SJF A;  4ZY0 A;  1R43 A;  3I1U A;  4R76 A;  5K8N A;  1VHO A;  4A38 A;  1KWM A;  4H2K A;  3D4U A;  5HXD A;  3FVL A;  2AFU A;  4P44 A;  3IO1 A;  1ARM A;  1CX8 A;  2AFW A;  5IB9 A;  1LOK A;  4IHM A;  3KI9 A;  1AMP A;  1F2O A;  2DEA A;  2PJB A;  3B3T A;  1TKF A;  2ZEL A;  4NGR A;  3BI1 A;  4NGN A;  1LAP A;  4NFR A;  3FX6 A;  1YW4 A;  3KQX A;  5LYD A;  1Z2L A;  4A39 A;  3FEC A;  3RAM A;  3HUV A;  2PIY A;  2PIZ A;  4OID A;  2ABZ A;  4RUH A;  1YSJ A;  3NH4 A;  3FMC A;  1VHE A;  4AXV A;  2HB6 A;  2F8H A;  2C6G A;  2PJC A;  2PJA A;  1AYE A;  3ISX A;  5JH9 A;  3LWU A;  2PJ6 A;  2BOA A;  3GB0 A;  4OC1 A;  2ZEH A;  3GUX A;  4OKO A;  3SI0 A;  1IY7 A;  3PB8 X;  5F09 A;  8CPA A;  3QNV A;  1ARL A;  1TXR A;  3SJX A;  2GU2 A;  3SJE A;  2PJ8 A;  3H8G A;  2F7V A;  2WYR A;  3RZA A;  1HDU A;  4CPA A;  4ZI6 A;  2PJ3 A;  3B3S A;  3B3V A;  3NFZ A;  3MN8 A;  2AFX A;  4UF4 A;  1QQ9 A;  5LYF A;  2BO9 A;  2PJ2 A;  1NSA A;  2ANP A;  2I3C A;  2PVW A;  3IEH A;  3D66 A;  3H8E A;  2NSM A;  5HVH A;  2PJ9 A;  3BHX A;  4ZYQ A;  5D8N A;  4A94 A;  4Z65 A;  7CPA A;  3D7D A;  4UEE A;  4DUK A;  1YLO A;  3IWW A;  4WWV A;  3V38 A;  1ELM P;  5I4M A;  2CTC A;  4ZY2 A;  5CPA A;  3JRU A;  1Y0Y A;  2RFH A;  3ISZ A;  3PFE A;  4PXE A;  2Q51 A;  4FWU A;  3TC8 A;  4MCR A;  3B3C A;  3IIB A;  4P4J A;  5D29 A;  3IFE A;  4IAV A;  4OIW A;  3WT4 A;  2AFO A;  3D67 A;  4R8F A;  4IK2 A;  2RB7 A;  5CBM A;  3B35 A;  3T8W A;  1BAV A;  1DE4 C;  4MMO A;  2QYV A;  2ZED A;  3FEE A;  1R3N A;  3K9T A;  2PJ0 A;  1HDQ A;  3KR5 A;  2PRQ A;  3SI1 A;  4NGS A;  1BLL E;  4NJR A;  3VAR A;  5JM6 A;  2XEI A;  1QMU A;  4BD9 A;  3B7I A;  2ZOG A;  3WC5 A;  1PCA A;  1TKH A;  2JBK A;  4TNU A;  2ZEE A;  3KAS A;  2GLF A;  3KZW A;  4OC5 A;  4P4I A;  2IQ6 A;  1TF9 A;  1ZG7 A;  1JQG A;  3NH8 A;  4F8Z A;  4K3N A;  2CF4 A;  2QJ8 A;  5ELY A;  4YU9 A;  4UIB A;  5HVF A;  6CPA A;  2V8G A;  1RTQ A;  3FED A;  1UWY A;  4DYO A;  5LYI A;  2GRE A;  4MHP A;  3VAT A;  3TX8 A;  4MCQ A;  1H8L A;  2PJ7 A;  4ZY1 A;  2C1C A;  4X3R A;  1Z8L A;  3PRT A;  4G1P A;  4OC4 A;  4ONW A;  2J9A A;  4R7M A;  3S9M A;  3B2Y A;  2XEG A;  4OME A;  4MHY A;  4WJB A;  3VH9 A;  2JEW A;  4PXB A;  3PBE A;  3SI2 A;  3CPX A;  4Q7A A;  3KL9 A;  3V7Z A;  5J1Q A;  3LMS A;  1XFO A;  1Z5R A;  1FT7 A;  1BPM A;  4F9V A;  2AFS A;  2ZEG A;  2CIJ A;  2C6P A;  2GLJ A;  3KGQ A;  4P4B A;  4P4D A;  2EK9 A;  4P45 A;  2Q43 A;  3KHX A;  1CG2 A;  4P10 A;  3FJU A;  3WAB A;  4MHZ A;  4FBE A;  4PXC A;  5JGF A;  5THW A;  4TWE A;  4DJL A;  1CPS A;  1LAM A;  3PB4 X;  3KHZ A;  3WC6 A;  1CPX A;  1EE3 P;  4NGM A;  1LAN A;  4NGP A;  4UIA A;  2QVP A;  2PJ1 A;  2HC9 A;  1TF8 A;  2ZEM A;  1IGB A;  2XEJ A;  2FVG A;  5DS0 A;  4X2T A;  2BCO A;  4NGQ A;  4MHN A;  4PQA A;  2ZEF A;  1XRY A;  4NGT A;  1TKJ A;  1YW6 A;  1GYT A;  4OC2 A;  3CDX A;  4EME A;  4P4E A;  3S9N A;  4NJQ A;  3HLP A;  2V77 A;  3KQZ A;  5HVG A;  1BPN A;  1XJO A;  5LRK A;  4FAI A;  3B3W A;  4F9U A;  2OOT A;  2ZEO A;  2NYQ A;  3CT9 A;  1F2P A;  1Q7L A;  2POK A;  2PCU A;  2Q4Z A;  2ZOF A;  3N5F A;  4O23 A;  1CBX A;  4LQG A;  2IMO A;  2ZEN A;  3RBU A;  3IC1 A;  4OC3 A;  2IJZ A;  4B6Z A;  4X8I A;  2JBJ A;  1XBU A;  2PE3 A;  1VGY A;  3K2K A;  3S9L A;  2EWB A;  5K8P A;  3NH5 A;  3IJ3 A;  2V8H A;  2G9D A;  1ZG9 A;  5LRJ A;  5K8O A;  2V8V A;  4A37 A;  4JYW A;  5K8M A;  4MRI A;  1XMB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...