2PE3A

Crystal structure of frv operon protein frvx (ph1821)from pyrococcus horikoshii ot3
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
344
structure length
330
Chain Sequence
DWKLMQEIIEAPGVSGYEHLGIRDIVVDVLKEVADEVKVDKLGNVIAHFKGSSPRIMVAAHMDKIGVMVNHIDKDGYLHIVPIGGVLPETLVAQRIRFFTEKGERYGVVGVLPDWDQIVVDVGASSKEEAEEMGFRVGTVGEFAPNFTRLNEHRFATPYLDDRICLYAMIEAARQLGDHEADIYIVGSVQEEVGLRGARVASYAINPEVGIAMDVTFAKQPHDKGKIVPELGKGPVMDVGPNINPKLRAFADEVAKKYEIPLQVEPSPRPTGTDANVMQINREGVATAVLSIPIRYMHSQVELADARDVDNTIKLAKALLEELKPMDFTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of frv operon protein frvx (ph1821)from pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
molecule keywords 354aa long hypothetical operon protein Frv
total genus 97
structure length 330
sequence length 344
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05343 Peptidase_M42 M42 glutamyl aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.40 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Peptidase M42, domain 2 2pe3A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2pe3A01
4P4BA 1DE4C 1ARLA 2ZEHA 3D66A 4OC1A 2QYVA 3FH4A 1LAPA 2ZEPA 3CPAA 4KSIA 4H2KA 2OR4A 2PJ3A 2PJCA 1PYTB 2Q43A 3RBUA 3SI1A 4K3NA 4JZ0A 4ZI6A 1ZG7A 5K8MA 3ISZA 1LOKA 2OOTA 1LAMA 3BXMA 3PFOA 3KGQA 1XBUA 3PRTA 3ISXA 4WWVA 2PJ1A 1Y0RA 2V8GA 3VATA 4UF4A 3L2NA 4OC5A 5D8NA 4NJRA 1ARMA 4DYOA 4JYWA 6CPAA 1ZLIA 2F7VA 1TF8A 4A38A 2C6PA 2HB6A 3KHZA 1R43A 7CPAA 5K8OA 3KI9A 5CPAA 3PB8X 2CF4A 3D4UA 5JGFA 5LRGA 3B3VA 2WZNA 3IJ3A 1HDUA 3MN8A 4R7MA 3NA6A 3B3TA 2ZEFA 3KQZA 4P44A 2PRQA 4F9UA 3NFZA 2V8DA 3D67A 5HXDA 1Q7LA 4IHMA 5D29A 2AFZA 1IGBA 2PJ9A 3D68A 1FT7A 4B6ZA 1AYEA 3PEIA 2EK8A 4PXCA 2J9AA 4UIAA 4NGTA 2PJ2A 1QMUA 1ELMP 4MCQA 4W9YA 3PBEA 3WC5A 2PE3A 1JQGA 2XEIA 4BD9A 3DGVA 3D7DA 3V38A 1F57A 2FVGA 1CPSA 1Z5RA 3FJUA 2V77A 2GREA 1CX8A 3WC6A 4CPAA 1ZG8A 5ELYA 3LMSA 1FNOA 3BI0A 4P6YA 1RTQA 3JRUA 2CTBA 3FX6A 3T8WA 1ZG9A 4NGQA 1VIXA 4DJLA 4UIBA 4Z65A 1XRYA 2I3CA 4OC4A 4MXUA 3WC7A 2VL1A 2PCUA 5LYIA 4MHZA 4MHPA 2XEJA 4NJQA 4RUHA 3H8FA 1VHEA 1XMBA 2JEWA 4UEZA 2PJAA 3S9LA 3SJXA 2XEFA 2AFOA 1ZLHA 2PJ0A 2POKA 2ZEGA 5K8NA 3WABA 5HVGA 2C6CA 3IEHA 1Z2LA 4DUKA 4NGPA 2XEGA 4R6TA 2PJ4A 4ZX9A 1IY7A 1QQ9A 2AFMA 2V8VA 3KQXA 1TKJA 4X2TA 3I1UA 3IC1A 3K9TA 4F8ZA 3D7HA 4IAVA 1HDQA 3SJEA 3RZAA 2ZOFA 3GUXA 2JBKA 4MRIA 3PB4X 2Q4ZA 1YW6A 4NGSA 3IFEA 4ONWA 5IB9A 2PIZA 1TF9A 2ZEMA 3BHXA 1CBXA 4MCSA 3D7FA 3HLPA 2NSMA 1CP7A 3KL9A 2HC9A 3NH5A 4ZY2A 3SJGA 3D7GA 2ZEEA 4OP4A 4OC2A 1YSJA 3TX8A 1XJOA 4WJBA 1UWYA 4F9VA 1CPXA 3LWUA 4ZY0A 5J1QA 1M4LA 1HEEA 5THWA 5DS0A 4FWUA 4NGNA 3K2KA 1BPNA 4YU9A 2C1CA 1NSAA 1XFOA 4EFDA 3N5FA 1H8LA 3CT9A 4NFRA 4R76A 4P4FA 1Z8LA 3FMCA 2ABZA 3B2YA 4FUUA 4PPZA 4OMEA 1LANA 2O4HA 5JM6A 2PVWA 4A39A 1BPMA 2QVPA 2GLFA 2AFWA 4NGRA 3B7IA 3KASA 4P45A 1BLLE 3S9NA 3B3WA 3PB9X 4EWTA 8CPAA 2ZEDA 3WT4A 4GM5A 1DTDA 2IJZA 2PIYA 3IWWA 3PBBA 2ZEOA 3FEDA 2ZELA 2WYRA 4P4JA 2AFSA 3DLJA 4TWEA 3B3SA 5HVHA 2BO9A 2ZENA 4MCPA 4PXDA 1KWMA 2EK9A 2DEAA 4LQGA 1CG2A 4UEFA 3KR4A 3SJFA 2CTCA 2C6GA 5LYLA 5K8PA 5F09A 1OBRA 3IIBA 1AMPA 3B3CA 4A37A 2PJ8A 4IK2A 4ZY1A 4AXVA 3BI1A 4PQAA 4P10A 5LRKA 4TNUA 2GLJA 3MRUA 2ZOGA 3SI0A 5LYFA 5JH9A 4UEEA 2IMOA 2O53A 1VHOA 4ZX8A 1VGYA 3PB7X 1Y0YA 1ELLP 2JBJA 4R8FA 2CIJA 3NH8A 1F2OA 4FBEA 1TXRA 4A94A 1LFWA 1EE3P 2IQ6A 3S9MA 4NGMA 1F2PA 1TKFA 4MMOA 3KZWA 3FECA 5LYDA 4PXEA 4X8IA 4FAIA 2EWBA 1YMEA 4OC0A 4MHYA 2GU2A 3PB6X 3CDXA 1Y7EA 2RB7A 4MHNA 5CBMA 4P4DA 3IO1A 3GB0A 2F8HA 4EMEA 2PJBA 3H8GA 1YW4A 4PXBA 3V7ZA 1YLOA 2G9DA 3RAMA 1PCAA 3PFEA 4Q7AA 4ZYQA 3VH9A 1LCPA 2BCOA 3H8EA 1R3NA 3FF3A 4OIWA 3CPXA 4MCRA 3FVLA 3TC8A 3NH4A 4OIDA 2NYQA 4OC3A 2QJ8A 5HVFA 1TKHA 2ANPA 3GLJA 3FEEA 3KHXA 4P4EA 3B35A 2PJ7A 4P4IA 2PJ5A 1CP6A 3KR5A 3HUVA 3SI2A 5I4MA 1GYTA 4X3RA 5LRJA 2PVVA 2AFUA 2V8HA 2RFHA 2AFXA 1BAVA 2BOAA 4G1PA 3VARA 3QNVA 2Q51A 4YWYA 2PJ6A 4O23A 4OKOA
chains in the Genus database with same CATH superfamily
4P4BA 1VQ9B 1DE4C 1N07A 3HAGA 2B58A 2Z3NA 3VWDA 1LAPA 2V31A 3W6XA 3R9EA 4KSIA 4H2KA 3U6BA 2JN9A 3SXOA 1IJEA 2VNJA 4K30A 4RDJA 4C2XA 4JZ0A 1I12A 2Q7SA 4DQLA 1E79A 1R5BA 3ISZA 4MJ8A 1A8PA 1KUVA 5F4MA 2Q04A 3R9GA 3PFOA 4FD6A 4Q36A 3FJOA 2B4DA 3BCDA 3CMMA 2ODFA 2PQ8A 3LO8A 4L8AA 2V7UA 2PJ1A 1Y0RA 3T90A 3W91A 2X0KA 5IV0A 4LUAA 4DYOA 3B8GA 6CPAA 1ZLIA 4A38A 1TTTA 4M6GA 5EBVA 2Q6OA 1R43A 3G6EB 3PB8X 2CF4A 3D4UA 3B3VA 2WZNA 1IJFA 2BF4A 2EUIA 2YNEA 4UZEA 3NA6A 1Q2CA 2VNIA 2ZBVA 4UCPA 4UZUA 2VBTA 5HKKA 4F9UA 3CMAB 2X6XA 1QGZA 2R6HA 4RD0A 1M4GA 4Z4TA 4ACAA 2WSAA 2NV4A 1EFRA 1AYEA 2B7BA 4CAWA 3CXQA 2QE7A 3CRZA 4PXCA 1QMUA 1ELMP 4X7CA 4ZCLA 2R7HA 3WC5A 4UWJA 2BEIA 3DGVA 1Y7RA 5KW9A 3E1YE 2ZTNA 2V77A 1WPCA 4XORA 3QFTA 2OZGA 3WC6A 4XPKA 5ELYA 4XLCA 1PU9A 2CNTA 3LMSA 4B44A 4P6YA 3WR7A 4J3GA 1Q86D 4CGLA 2BGIA 4U9UA 3T8WA 3FPPA 5L46A 4UZFA 4MXUA 2VL1A 2CNDA 5LYIA 3JU4A 3R6JA 4M6IA 3ZZUA 2WSSA 4OPOA 1VHEA 1Z9UA 2JLMA 4YAUA 2W6JA 1MK4A 4CRZB 3CMEB 4A31A 2Z10A 1QH0A 1FNMA 1WWZA 4Y49B 1PKVA 1ZLHA 2POKA 4CYQA 1RXTA 4UFWA 4RCZA 2Z0ZA 4F6AA 5HVGA 2ZZQA 1Z2LA 4DK0A 2XNDA 1OGIA 4JD6A 2ZZGA 1KC8D 4HNWB 2VZLA 3KQXA 2PDOA 3IC1A 3CW2A 1HDQA 4RD2A 3RZAA 4CAVA 3GSIA 2J8MA 4F7DA 1K4JA 3TO9A 3PB4X 2Q4ZA 2YNCA 4NEXA 3RYOA 2BSWA 4ONWA 1K73D 4KOTA 1WORA 2ZEMA 1XEBA 1GO2A 3KL9A 1WOSA 1GAQA 4XKWA 1FNBA 3OZVA 4TT3A 1OZPA 1W0JA 3ZZTA 3GVKA 4XLFA 4ZY2A 3SJGA 4KZTA 5AN9A 1XJOA 4B11A 3GYAA 4ZY0A 2GFQA 1P4NA 4R87A 3AVYA 4FWUA 5F46A 2B5OA 4AVZA 1A2ZA 4CGPA 2C1CA 4QFMA 1NSAA 3LQ6A 4MYTA 1YX2A 4KVOE 3N5FA 2QECA 3G8WA 1H8LA 4XOPA 2I1LA 4EVYA 4P1VA 4ONUA 2DXQA 1Z8LA 3B2YA 2H5MA 3Q6RA 1E1QA 3P2HA 4OMEA 1JB9A 2Q6KA 1LANA 3JQRA 1D2EA 2YNCC 5JM6A 3VWEA 4A39A 2GLFA 2AFWA 4NGRA 3OKXA 3OEHA 1BLLE 2M5SA 3A8IA 3VR6A 1PJ7A 2WZPP 2FS5A 1MJ9A 1QX4A 4B47A 8CPAA 1NBMA 2QMLA 2ZEDA 4F0XA 3WT4A 3CESA 1DTDA 2IJZA 3TTHA 1I7PA 3OZWA 4E0FA 3FEDA 3S6KA 4R71A 2F5IA 1PJ5A 4RI1A 4QBJA 4ASUA 3PZJA 3B3SA 2KCWA 1CNEA 4M0LA 1YVKA 2G3AA 2B4BA 4A2ZA 4NBSA 1S7KA 2BMWA 3KR4A 2Q6LA 3SJFA 3BY2A 2CTCA 4QUSA 3ONYA 4YRHA 4RCYA 1VQMB 5F09A 2Z3LA 1EFTA 1XF8A 4CGMA 3OWCA 4IK2A 3BI1A 3Q39A 4Y9RA 4PQAA 4TNUA 3ASSA 4KLWA 2B5GA 2G0BA 4RS2A 2IMOA 4XLEA 5G22A 1VQNB 2O53A 4NCZA 1VHOA 1Y0YA 1VGYA 3FPKA 3V7AA 2K5TA 1J9ZA 4R57A 1F2OA 2AJ6A 1TXRA 1Y9WA 1LFWA 4A94A 1ELOA 2DPSA 4G1BA 5JQ4A 4MI4A 1W0KA 2EVNA 1HZEA 1T5EA 4Z4SA 1QSMA 2OZUA 4LBYA 2GQFA 3KZWA 1AMOA 3P26A 4X8IA 3BQJA 2JDDA 1XE1A 4MHYA 3FB3A 1OHHA 3IGRA 5CBMA 4RDKA 3CC7B 1DDGA 2QTLA 4UAJA 2R8VA 4X05A 4PXBA 1EFUA 2RC5A 4Z1MA 3EO4A 1PCAA 3PFEA 1CNFA 4B3GA 1UD4A 1FX0A 1LCPA 1N06A 1ZM4A 4OIWA 2D74A 3CPXA 2P6GA 4N3GA 1AUGA 4OIDA 3QB8A 2BM1A 3ZUGA 1TKHA 4AG9A 3GLJA 3LD2A 3FEEA 4YHBA 2BGJA 2ZXIA 2XNJA 1Q9SA 1CP6A 1FRQA 3HUVA 2HDNB 1N0VC 5I4MA 1QSRA 4X3RA 2AFUA 3T9YA 2RFHA 2Z3MA 2GJKA 3QNVA 5IYWA 2PJ6A 3OJWA 1K9MD 3A3BA 3TT2A 4L89A 1ARLA 2ZEHA 3D66A 4ZCIA 2OU2A 3QFRA 2ZEPA 3JTKA 3R6KA 4TN1A 3A9LA 2VBSA 2PJ3A 3GVLA 1PYTB 3RBUA 3I1FA 1JWQA 4ZI6A 1KUYA 5A89A 3TOBA 5BWAB 3GY9A 5TV2A 3CD6B 1ZG7A 4YFJA 5K8MA 4PV6A 2C4TA 4MFQA 2XZLA 3DR6A 4MHDA 2DIEA 4P3IA 2JIZA 4KORA 3T53B 3W5HA 1EP1B 1PJ6A 2DYIA 1XBUA 4B12A 4GXHA 3ISXA 1U6MA 4WWVA 3WBKA 4QVTA 2V8GA 3CPWB 4UF4A 4NJRA 1IU8A 2R9VA 4YEJA 4NF1A 2J7KA 2C6PA 2HB6A 7CPAA 3KI9A 1G7TA 1DDIA 1CQXA 4R7MA 1KMHA 3MN8A 4BBHA 2ZEFA 2WPDA 4UFVA 5IX3A 1Q7LA 5HXBA 4IHMA 1I21A 1QSNA 2Z6BD 1VLYA 1IGBA 4Z4WA 5FO1A 3R1KA 2AHOA 2EK8A 5BSXA 2J9AA 4X5KA 4RD3A 2PJ2A 4XPDB 2WJVA 4MCQA 2ZXHA 1JQGA 3B78A 2GIVA 4BD9A 1UFHA 4AVBA 3D7DA 2FVGA 3FJUA 2GREA 1CX8A 2I00A 1VQ5B 5TR9A 4C43A 3FYNA 4B5PB 5BSYA 3W2IA 1ZG8A 1FNOA 1IB1E 2YWHA 1RTQA 4NSQA 3Q3AA 4A30A 3W5VA 1ZG9A 3LACA 3V8IA 4Z65A 1XRYA 4X7FA 3JVNA 3ES9A 4MHZA 2XEJA 4NJQA 2FCKA 3H8FA 4KOSA 4LQ6A 3S9LA 3DSBA 3ONUA 4U9ZA 2ZW5A 3SJZA 1QUFA 3SJXA 1T6ZA 2CW5A 1Z4RA 2PJ0A 1W87A 4FD4A 1YVOA 3SXNA 1QGYA 1RQRA 2ZEGA 1Q81D 4A32A 3WABA 1G7SA 5F48A 3IEHA 4NXYA 1YLEA 4DUKA 2NMTA 2PJ4A 5KTCA 1IY7A 2AFMA 1KRHA 2WUUA 3R95A 1E3XA 1TKJA 2REEA 3DNSA 3I1UA 4X2TA 4M85A 3AGQA 4B5PA 1WOPA 2HLDA 4C0SA 3SJEA 4QHYA 4NGSA 2DOGA 4TMXA 4XPDC 5HZBA 3Q38A 5IB9A 3BHXA 1CJWA 3RO0A 4UCNA 4XN0A 2CNSA 2V7TA 2C4UA 3OFNA 1BOBA 3NH5A 1COWA 2V7WA 3D7GA 2ZEEA 2YWFA 4XLAA 1YI2B 4WJBA 1CPXA 4PC7A 4U9YA 4LBZA 1HEEA 4KUAA 3R96A 4E2AA 3NE7A 1WSRA 4NGNA 4M4SA 2ZL5A 1S0UA 4NCNA 5AGEA 4QUZA 2PC1A 3W2FA 4RD6A 3V76A 2YGWA 5GV8A 4P4FA 1V0CA 1KK1A 2ABZA 1KK0A 2YWEA 4FUUA 4PPZA 2FT0A 2OB0A 2FIWA 3ASPA 2V4DA 2Z3OA 3B7IA 1UD3A 4KSFA 4R3KA 2YWGA 4XNFA 3B3WA 3PB9X 4Z4UA 1OB0A 4G6IA 1M44A 1BMFA 2PIYA 3IWWA 4ZCMA 2ZEOA 1Y9KA 4FWTA 2ZELA 1UD6A 3G05A 4P4JA 1YX0A 3CCRB 2AFSA 2ZW6A 3AVWA 4MY3A 5HVHA 4C2YA 1M4DA 4MCPA 4Z4YA 1WDTA 1N05A 4MBUA 1VQ8B 3CB4A 3JQQA 1IYLA 1YITB 3CC4B 2VYQA 5LYLA 2QGGA 1YQEA 1TUIA 4PC2A 3F5BA 1BQEA 3LVBA 5FA6A 5LRKA 3W2GA 2GLJA 1K28D 2ZOGA 2QDXA 4LBWA 5LYFA 5ISVA 2P6EA 3GVJA 4JWPA 4G7XA 1WSVA 3LODA 5E96A 3PB7X 1ELLP 2ZL6A 3T51B 4H89A 4CAXA 4XN3A 3NH8A 3EC4A 5TRDA 4X06A 4RN7A 4RDLA 4G1VA 1EE3P 4F0YA 4P6VF 1IICA 4NGMA 2D3LA 1N8RD 4Z4RA 2ZW4A 1TKFA 2VNKA 3OAAA 1VQOB 4PXEA 2R1IA 3CCVB 3B8HA 4FAIA 1YMEA 2ZTGA 3PB6X 2GK6A 3RY8A 1Y7EA 4MHNA 3F8KA 1E1RA 2O28A 5J8CA 5GV7A 3B82A 1OB5A 5DWNA 2X3UA 3BY1A 2F8HA 3TFYA 2REFA 2PJBA 2WPXA 1YW4A 3EFAA 4PC6A 1CM0A 4K1XA 5HZAA 4OADA 4J0QA 2OBRA 1NJID 4YAOA 4H6UA 5JBQA 2BCOA 1S5KA 5IYQA 1NRKA 3I3GA 4MCRA 1N71A 5EMIA 2X6YA 5FVJA 2QJ8A 5HVFA 4P25A 1TVCA 3KHXA 4P4EA 3CTAA 4PABA 4P4IA 3QE2A 5EMNA 4KKTA 5J35A 3FNCA 3BJ7A 2XNCA 1WOOA 5KSWB 2PIAA 4WZTA 4C7HA 3P27A 1Z8XA 4E8OA 3Q6QA 3FBUA 4ZGYB 1BX1A 1WP6A 4OLLA 3H9NA 5TY0A 4OP7A 4IW3B 1YHQB 4MFLA 1ZM9A 5KTAA 3QFCA 2Q0YA 4OC1A 5IYNA 3FH4A 4CRYB 3CPAA 3F0AA 3CP2A 1FDRA 2PJCA 3W2HA 4MFZA 3SI1A 2P0WA 4N3NA 1TIQA 1LOKA 2OOTA 2BM0A 4ZGNB 4IF5A 1LAMA 4Y49C 4XPLA 4KUBA 2ZXVA 3BXMA 3KGQA 1KQSB 2OK7A 3IU1A 1QFZA 4LX9A 3VMFA 4XL9A 2GJRA 4KKUA 3I55B 2DETA 1E63A 3OZUA 3S6FA 4XLHA 2E1BA 5D8NA 2OTLB 1ARMA 3W2EA 1NB9A 2F7VA 3U6KA 4XR6A 4ACBA 4P2NA 1QFYA 1B23P 3KHZA 1IHMA 4B13A 3BJ8A 5DSZA 5CPAA 4JJXA 2DEUA 1ON0A 4C2ZA 5AG7A 5LRGA 3IJ3A 4HNXB 1HDUA 3B3TA 2CXAA 1M90D 4P44A 2C78A 2PRQA 3R9FA 5HXDA 3CP8A 4KKSA 4G7WA 1M1DA 2AFZA 3CZXA 1Q7YD 1FT7A 4XNHC 4RD1A 4B6ZA 4MFJA 4PC1A 2VJJA 5A28A 3PENA 2X7BA 4AF6A 4NGTA 3GQBA 4TKOB 2CC2A 1ZM3A 1VLOA 3OE7A 2XEIA 4B5OA 5F47A 2BN4A 3V38A 3A3GA 1QG0A 4CPAA 5A27A 4AB7A 4DK1A 3CXCB 5G1ZA 3VNUA 3ASQA 3FX6A 4DJLA 3JQPA 4NGQA 1VIXA 2I3CA 2XOKA 4L8JA 4UCMA 2PCUA 4R9MA 3SLNA 1V5VA 3TO7A 5I0CA 1XMBA 5IYPA 1SKQA 3CCJB 5FIUA 3OW2B 4ZV4A 5H86A 1X10A 2FIAA 4WZLA 3G4SB 4II2A 2HV2A 4OOXA 4P12A 1NDHA 2AFOA 4DNCA 5J3OA 5LMZA 3J81k 4MFPA 1KJZA 4AC9A 4II9A 1S4MA 3PA1A 5K8NA 2I79A 1Q82D 3FKSA 1QVGB 3MMPA 1VKCA 1QQ9A 4MFKA 2V8VA 2OH1A 1F60A 3D7HA 4IAVA 1DG1G 2CK3A 5H84A 4PSWA 2ZOFA 2JBKA 4MRIA 4FD7A 3A8JA 4UBRA 4CAEA 4CYOA 5FL7A 4CYNA 3D26A 1AIPA 3W5UA 4M3SA 2PIZA 1CBXA 1S7LA 4MCSA 3D7FA 2P6FA 1RQPA 1R57A 2HC9A 2VNHA 4B14A 2X53S 5B6IA 1UD2A 2C5BA 3D8PA 3TOAA 5A88A 4CGNA 3IWGA 4OP4A 4OC2A 1BJKA 4X07A 2FX3A 1UWYA 4B3FX 1H42A 5J1QA 1M4LA 3MCAA 4KOXA 4RPDA 4HNYB 2DCUA 3AVUA 5DS0A 3K2KA 4CAFA 1MRZA 1BPNA 2BV3A 4QC6A 1XFOA 4EFDA 4X7EA 2VQYA 2W6IA 1GVHA 4KOWA 1TLLA 1R5NA 2OZHA 1YJNB 4M53A 4JLYA 3VO1A 2V7QA 2PR8A 3FMCA 4P3YA 2B4DB 4H9GA 2QA4B 2ZITA 2O4HA 4PSXA 1VQ7B 1BPMA 2QVPA 1HVXA 1KK2A 2VBQA 4AVAA 3KASA 2PLFA 1B87A 2LZJA 4PK3A 4EWTA 3ZPNA 3TCVA 1W35A 1P0HA 1V0EA 4GM5A 1YR0A 3QFSA 3PBBA 1GJRA 1VQ4B 1KZFA 2QIRA 2WYRA 2GPJA 1EXMA 5DN6A 4TWEA 3QAYA 4UA3A 2BO9A 1P4MA 4KS9A 4PXDA 5THXA 1KWMA 3MGDA 1WU8A 2EK9A 4LQGA 2AE6A 1YREA 1IOIA 2A4NA 1CG2A 4UEFA 2G3TA 2OK8A 2B3VA 3KKWA 4UWIA 3ASTA 2PMDA 1OBRA 3IIBA 1EP3B 2FSRA 5FO0A 4BINA 2XZOA 1DARA 1GR1A 1OB2A 4KVME 4ZY1A 2VI7A 4YGOA 1GAWA 4P10A 4BMHA 5IYRA 3SI0A 4RM0A 2Q44A 2XEXA 1ZUNB 1RO5A 4PK2A 2Y0MA 2XGJA 4R8FA 5HMNA 2CIJA 2X85A 5FNZA 2B3UA 4CGOA 4PC3A 2VZZA 5C88A 3AVTA 2V7XA 4KOVA 4A33A 3G3SA 4FBEA 3SKBA 1X12A 2IQ6A 3S9MA 3EXNA 4LC0A 3FXTA 1F2PA 3WNDA 5C82A 2ZPAA 4MMOA 2E1RA 5LYDA 3T56B 4P9SA 1KUXA 4OC0A 4KSAA 3PVDA 1UD5A 5AG6A 3GB0A 3KEWA 2DERA 4EMEA 1XB2A 1KD1D 2JEVA 3TO6A 4XMYA 3MHPA 3DDDA 4Q7AA 1QFJA 4HKFA 3VH9A 2DY1A 2OBTA 5AG4A 1R3NA 1I8DA 1VF7A 4WZKA 4HE6A 2BPOA 1NB0A 1E64A 2ANPA 1BPLA 3QAHA 1QSTA 3IWEA 1Z4EA 2PJ7A 3ZBTA 2PSWA 3EY5A 4ZBGA 2PJ5A 1FY7A 1SQHA 3D2PA 3PUMA 3OJXA 5IK2A 4OAEA 3SI2A 1NE9A 1GYTA 2JDCA 4PGOA 2V8HA 3CXSA 1UMKA 2AFXA 1BAVA 2XZPA 2BOAA 3CCSB 1KZLA 4G1PA 3A8KA 3VARA 1VQLB 2Q51A 4YWYA 4FXUA 3BNWA 1G7RA 4Q38A 3SLDA 4CQJA 3NE8A 4OKOA 4M1KA 3PUNA 4ZGQB 5KTDA 2QYVA 2QTZA 3FIXA 4Y9UA 1YJWB 2WPWA 1S7FA 1WTHD 5HH1A 4P26A 3A1PA 4AF7A 2OR4A 4QVJA 4DNTB 3H4QA 2Q43A 1K8AD 1GHEA 4K3NA 2B5GB 4XKVA 1VHSA 1G7CA 3WYAA 4G5GA 3ZJ0A 3FRMA 1VJSA 1J4JA 2OTJB 1H8HA 1Q2DA 4CS0B 4LBVA 2ZW7A 2D4OA 4C68A 3PRTA 5IB0A 2GK7A 4XONA 4RPBA 3TE4A 4WZEA 2QEXB 4AG7A 3U2QA 3VATA 4TMWA 2IL4A 3L2NA 4OC5A 3CCMB 1W2BB 1IYKA 3W6SA 1I1DA 4B48A 1V0FA 2HQYA 2NPFA 2PRBA 4JYWA 3VNVA 4YALA 1TF8A 3GIRA 4X0CA 4KOYA 1XE4A 4MYUA 3PA2A 4GS4A 5K8OA 1B6BA 3OPOA 3WXMA 4XQFA 3I9SA 5JGFA 2VZYA 2QN6A 1UD8A 1FNDA 3KQZA 2BVNA 3NFZA 2V8DA 3D67A 3UY5A 2Q7BA 5D29A 5EC4A 1MABA 1H8EA 5F4JA 4B4DA 1LRZA 1QSOA 4BPRA 3D68A 2PJ9A 3K9UA 2Q4YA 4FK8A 4P22A 3PEIA 2GANA 4JXRA 5GCNA 2C77A 4RLZA 3H5ZA 4UIAA 4W9YA 3PBEA 2CNMA 2ZZFA 2PE3A 4XOTA 4OOVA 1YIJB 4Z4VA 1F57A 1CPSA 1JJ2B 1Z5RA 2D9RA 3DDYA 3AVVA 3N7ZA 5KNLA 5A8AA 2BSAA 3OW7A 3AVXA 1H85A 1SM4A 3BI0A 2B7CA 5G20A 3JRUA 2CTBA 3BC9A 4JMQA 4KOUA 4UIBA 4OC4A 1FRNA 3WC7A 2Z3PA 4MHPA 1E3ZA 2QMUA 4RUHA 4YELA 2JEWA 3E20A 3ZZIA 4UEZA 3OEEA 2PJAA 2EO8A 1YK3A 1Z8WA 1JA0A 2WR8A 1KTVA 3QSYA 2D3NA 3VO2A 1KK3A 2XEFA 3AGPA 2C5HA 3BCFA 1VQPB 3BH4A 1VQ6B 1JA1A 2C6CA 1JNYA 4FD5A 4TMVA 4NGPA 2XEGA 4R6TA 2KVOA 4WQMA 5AG5A 2Z11A 4ZX9A 1VQKB 2VBVA 1BO4A 3S6GA 4M2LA 5F49A 3K9TA 3IU2A 3OP1A 4F8ZA 1Z8TA 2C27A 2HUZA 1XQBA 1NSLA 3GUXA 1S72B 2R98A 1YW6A 2FXFA 1XOVA 3WNCA 4Q7JB 2J8NA 2Q4VA 2F1LA 1D1NA 3IFEA 3RNZA 3CCQB 1TF9A 3G71B 2ATRA 3HLPA 2NSMA 1CP7A 5G21A 1ZM2A 3CCLB 2RC6A 1YSJA 3TX8A 2CBXA 3C26A 5CNPA 4F9VA 1NMTA 4YXWA 3LWUA 4XNHB 1N0UA 3SHPA 3ASRA 1YGHA 5H59A 5THWA 2HMAA 4AVCA 2RC4A 2VEZA 5JPHA 2JDIA 1XMTA 4OOSA 3CCUB 4YU9A 2VJIA 3CXPA 3WBJA 2OBSA 3H94A 4YAFA 4QVAA 4QB9A 1W9XA 3D3SA 4DQKA 3CT9A 4NFRA 4TMTA 4R76A 2JJ2A 1WK4A 2CY2A 3WNBA 2X8KA 1XIXA 4TSFA 4QV2A 1M1KD 1ZO0A 4RD4A 2PVWA 4DNRB 4JXQA 1EWYA 2VBUA 1Q2YA 1PUAA 3NE5B 3PGPA 1S3ZA 4P45A 3S9NA 1D8TA 4PAAA 2X6WA 3SEJA 1YJ9B 1IOFA 2HCJB 1MJAA 3GKRA 2YNDA 3WQZA 3ZC3A 2C2WA 3CCEB 4GQNA 4B3XA 1I18A 1S60A 5DWMA 3DLJA 2CRVA 2ARHA 2ZENA 1U2RA 1S7NA 1BLIA 2DEAA 5CDFA 2J8RA 2FE7A 2BUEA 3SJPA 2F43A 3S6HA 2C6GA 2JJ1A 5K8PA 4XM3A 2F1MA 1AMPA 3B3CA 1QVFB 4A37A 2GE3A 4I49A 2PJ8A 1HA3A 1OGJA 3GIUA 4EH1A 2EBJA 3LNNA 3I56B 4AXVA 3LQEA 2D4PA 3MRUA 5JH9A 1IB0A 5H5JA 2P3MA 4UEEA 2Q6IA 4ZX8A 4X7DA 2JBJA 2WJYA 4Z4ZA 4XD7A 2GJPA 3ZIAA 4Y7CA 1QGAA 3OOCA 4NNJA 1N08A 2VXKA 1T6XA 3FECA 1BX0A 2DF5A 4R3LA 4HPSA 5J8FA 2F4NA 2EWBA 2ZBUA 2GU2A 1B2RA 3CDXA 2RB7A 3BLNA 4YAWA 1SKYB 4P4DA 3IO1A 4M6HA 2V7VA 1E43A 4C7IA 4TMZA 3H8GA 4IUSA 4H6ZA 4OPSA 1F20A 3ZBUA 3P2FA 3V7ZA 1YLOA 2G9DA 3RAMA 1FNCA 4ZYQA 4CYPA 2DPTA 3H8EA 3CC2B 3D2MA 3FF3A 4U5YA 4FN5A 4B43A 3FVLA 2EFGA 3TC8A 3NH4A 1L0CA 4HIZA 2ZL7A 4B10A 2NYQA 4KLVA 4OC3A 4A95A 2ZZEA 2BL1A 3B35A 4ORFA 3ZZ0A 2FL4A 3DR8A 1R5OA 1MJBA 4RJLA 1IIDA 4MY0A 1M4IA 3E0KA 4OPVA 2PR1A 3KR5A 1W34A 3PP9A 1E62A 1QUEA 5LRJA 4E0AA 2PVVA 3WY9A 1T6YA 1EP2B 4HE5A 5E6TA 3A35A 4II3A 3JUWA 1EFCA 4UFXA 4KVXA 4ROXA 2OYNA 2Z3KA 4O23A 5F4OA 2EIXA
chains in the Genus database with same CATH topology
4P4BA 1DE4C 1ARLA 2ZEHA 3D66A 4OC1A 2QYVA 3FH4A 1LAPA 2ZEPA 3CPAA 4KSIA 4H2KA 2OR4A 2PJ3A 2PJCA 1PYTB 2Q43A 3RBUA 3SI1A 4K3NA 4JZ0A 4ZI6A 1ZG7A 5K8MA 3ISZA 1LOKA 2OOTA 1LAMA 3BXMA 3PFOA 3KGQA 1XBUA 3PRTA 3ISXA 4WWVA 2PJ1A 1Y0RA 2V8GA 3VATA 4UF4A 3L2NA 4OC5A 5D8NA 4NJRA 1ARMA 4DYOA 4JYWA 6CPAA 1ZLIA 2F7VA 1TF8A 4A38A 2C6PA 2HB6A 3KHZA 1R43A 7CPAA 5K8OA 3KI9A 5CPAA 3PB8X 2CF4A 3D4UA 5JGFA 5LRGA 3B3VA 2WZNA 3IJ3A 1HDUA 3MN8A 4R7MA 3NA6A 3B3TA 2ZEFA 3KQZA 4P44A 2PRQA 4F9UA 3NFZA 2V8DA 3D67A 5HXDA 1Q7LA 4IHMA 5D29A 2AFZA 1IGBA 2PJ9A 3D68A 1FT7A 4B6ZA 1AYEA 3PEIA 2EK8A 4PXCA 2J9AA 4UIAA 4NGTA 2PJ2A 1QMUA 1ELMP 4MCQA 4W9YA 3PBEA 3WC5A 2PE3A 1JQGA 2XEIA 4BD9A 3DGVA 3D7DA 3V38A 1F57A 2FVGA 1CPSA 1Z5RA 3FJUA 2V77A 2GREA 1CX8A 3WC6A 4CPAA 1ZG8A 5ELYA 3LMSA 1FNOA 3BI0A 4P6YA 1RTQA 3JRUA 2CTBA 3FX6A 3T8WA 1ZG9A 4NGQA 1VIXA 4DJLA 4UIBA 4Z65A 1XRYA 2I3CA 4OC4A 4MXUA 3WC7A 2VL1A 2PCUA 5LYIA 4MHZA 4MHPA 2XEJA 4NJQA 4RUHA 3H8FA 1VHEA 1XMBA 2JEWA 4UEZA 2PJAA 3S9LA 3SJXA 2XEFA 2AFOA 1ZLHA 2PJ0A 2POKA 2ZEGA 5K8NA 3WABA 5HVGA 2C6CA 3IEHA 1Z2LA 4DUKA 4NGPA 2XEGA 4R6TA 2PJ4A 4ZX9A 1IY7A 1QQ9A 2AFMA 2V8VA 3KQXA 1TKJA 4X2TA 3I1UA 3IC1A 3K9TA 4F8ZA 3D7HA 4IAVA 1HDQA 3SJEA 3RZAA 2ZOFA 3GUXA 2JBKA 4MRIA 3PB4X 2Q4ZA 1YW6A 4NGSA 3IFEA 4ONWA 5IB9A 2PIZA 1TF9A 2ZEMA 3BHXA 1CBXA 4MCSA 3D7FA 3HLPA 2NSMA 1CP7A 3KL9A 2HC9A 3NH5A 4ZY2A 3SJGA 3D7GA 2ZEEA 4OP4A 4OC2A 1YSJA 3TX8A 1XJOA 4WJBA 1UWYA 4F9VA 1CPXA 3LWUA 4ZY0A 5J1QA 1M4LA 1HEEA 5THWA 5DS0A 4FWUA 4NGNA 3K2KA 1BPNA 4YU9A 2C1CA 1NSAA 1XFOA 4EFDA 3N5FA 1H8LA 3CT9A 4NFRA 4R76A 4P4FA 1Z8LA 3FMCA 2ABZA 3B2YA 4FUUA 4PPZA 4OMEA 1LANA 2O4HA 5JM6A 2PVWA 4A39A 1BPMA 2QVPA 2GLFA 2AFWA 4NGRA 3B7IA 3KASA 4P45A 1BLLE 3S9NA 3B3WA 3PB9X 4EWTA 8CPAA 2ZEDA 3WT4A 4GM5A 1DTDA 2IJZA 2PIYA 3IWWA 3PBBA 2ZEOA 3FEDA 2ZELA 2WYRA 4P4JA 2AFSA 3DLJA 4TWEA 3B3SA 5HVHA 2BO9A 2ZENA 4MCPA 4PXDA 1KWMA 2EK9A 2DEAA 4LQGA 1CG2A 4UEFA 3KR4A 3SJFA 2CTCA 2C6GA 5LYLA 5K8PA 5F09A 1OBRA 3IIBA 1AMPA 3B3CA 4A37A 2PJ8A 4IK2A 4ZY1A 4AXVA 3BI1A 4PQAA 4P10A 5LRKA 4TNUA 2GLJA 3MRUA 2ZOGA 3SI0A 5LYFA 5JH9A 4UEEA 2IMOA 2O53A 1VHOA 4ZX8A 1VGYA 3PB7X 1Y0YA 1ELLP 2JBJA 4R8FA 2CIJA 3NH8A 1F2OA 4FBEA 1TXRA 4A94A 1LFWA 1EE3P 2IQ6A 3S9MA 4NGMA 1F2PA 1TKFA 4MMOA 3KZWA 3FECA 5LYDA 4PXEA 4X8IA 4FAIA 2EWBA 1YMEA 4OC0A 4MHYA 2GU2A 3PB6X 3CDXA 1Y7EA 2RB7A 4MHNA 5CBMA 4P4DA 3IO1A 3GB0A 2F8HA 4EMEA 2PJBA 3H8GA 1YW4A 4PXBA 3V7ZA 1YLOA 2G9DA 3RAMA 1PCAA 3PFEA 4Q7AA 4ZYQA 3VH9A 1LCPA 2BCOA 3H8EA 1R3NA 3FF3A 4OIWA 3CPXA 4MCRA 3FVLA 3TC8A 3NH4A 4OIDA 2NYQA 4OC3A 2QJ8A 5HVFA 1TKHA 2ANPA 3GLJA 3FEEA 3KHXA 4P4EA 3B35A 2PJ7A 4P4IA 2PJ5A 1CP6A 3KR5A 3HUVA 3SI2A 5I4MA 1GYTA 4X3RA 5LRJA 2PVVA 2AFUA 2V8HA 2RFHA 2AFXA 1BAVA 2BOAA 4G1PA 3VARA 3QNVA 2Q51A 4YWYA 2PJ6A 4O23A 4OKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P4B A;  1DE4 C;  1ARL A;  2ZEH A;  3D66 A;  4OC1 A;  2QYV A;  3FH4 A;  1LAP A;  2ZEP A;  3CPA A;  4KSI A;  4H2K A;  2OR4 A;  2PJ3 A;  2PJC A;  1PYT B;  2Q43 A;  3RBU A;  3SI1 A;  4K3N A;  4JZ0 A;  4ZI6 A;  1ZG7 A;  5K8M A;  3ISZ A;  1LOK A;  2OOT A;  1LAM A;  3BXM A;  3PFO A;  3KGQ A;  1XBU A;  3PRT A;  3ISX A;  4WWV A;  2PJ1 A;  1Y0R A;  2V8G A;  3VAT A;  4UF4 A;  3L2N A;  4OC5 A;  5D8N A;  4NJR A;  1ARM A;  4DYO A;  4JYW A;  6CPA A;  1ZLI A;  2F7V A;  1TF8 A;  4A38 A;  2C6P A;  2HB6 A;  3KHZ A;  1R43 A;  7CPA A;  5K8O A;  3KI9 A;  5CPA A;  3PB8 X;  2CF4 A;  3D4U A;  5JGF A;  5LRG A;  3B3V A;  2WZN A;  3IJ3 A;  1HDU A;  3MN8 A;  4R7M A;  3NA6 A;  3B3T A;  2ZEF A;  3KQZ A;  4P44 A;  2PRQ A;  4F9U A;  3NFZ A;  2V8D A;  3D67 A;  5HXD A;  1Q7L A;  4IHM A;  5D29 A;  2AFZ A;  1IGB A;  2PJ9 A;  3D68 A;  1FT7 A;  4B6Z A;  1AYE A;  3PEI A;  2EK8 A;  4PXC A;  2J9A A;  4UIA A;  4NGT A;  2PJ2 A;  1QMU A;  1ELM P;  4MCQ A;  4W9Y A;  3PBE A;  3WC5 A;  2PE3 A;  1JQG A;  2XEI A;  4BD9 A;  3DGV A;  3D7D A;  3V38 A;  1F57 A;  2FVG A;  1CPS A;  1Z5R A;  3FJU A;  2V77 A;  2GRE A;  1CX8 A;  3WC6 A;  4CPA A;  1ZG8 A;  5ELY A;  3LMS A;  1FNO A;  3BI0 A;  4P6Y A;  1RTQ A;  3JRU A;  2CTB A;  3FX6 A;  3T8W A;  1ZG9 A;  4NGQ A;  1VIX A;  4DJL A;  4UIB A;  4Z65 A;  1XRY A;  2I3C A;  4OC4 A;  4MXU A;  3WC7 A;  2VL1 A;  2PCU A;  5LYI A;  4MHZ A;  4MHP A;  2XEJ A;  4NJQ A;  4RUH A;  3H8F A;  1VHE A;  1XMB A;  2JEW A;  4UEZ A;  2PJA A;  3S9L A;  3SJX A;  2XEF A;  2AFO A;  1ZLH A;  2PJ0 A;  2POK A;  2ZEG A;  5K8N A;  3WAB A;  5HVG A;  2C6C A;  3IEH A;  1Z2L A;  4DUK A;  4NGP A;  2XEG A;  4R6T A;  2PJ4 A;  4ZX9 A;  1IY7 A;  1QQ9 A;  2AFM A;  2V8V A;  3KQX A;  1TKJ A;  4X2T A;  3I1U A;  3IC1 A;  3K9T A;  4F8Z A;  3D7H A;  4IAV A;  1HDQ A;  3SJE A;  3RZA A;  2ZOF A;  3GUX A;  2JBK A;  4MRI A;  3PB4 X;  2Q4Z A;  1YW6 A;  4NGS A;  3IFE A;  4ONW A;  5IB9 A;  2PIZ A;  1TF9 A;  2ZEM A;  3BHX A;  1CBX A;  4MCS A;  3D7F A;  3HLP A;  2NSM A;  1CP7 A;  3KL9 A;  2HC9 A;  3NH5 A;  4ZY2 A;  3SJG A;  3D7G A;  2ZEE A;  4OP4 A;  4OC2 A;  1YSJ A;  3TX8 A;  1XJO A;  4WJB A;  1UWY A;  4F9V A;  1CPX A;  3LWU A;  4ZY0 A;  5J1Q A;  1M4L A;  1HEE A;  5THW A;  5DS0 A;  4FWU A;  4NGN A;  3K2K A;  1BPN A;  4YU9 A;  2C1C A;  1NSA A;  1XFO A;  4EFD A;  3N5F A;  1H8L A;  3CT9 A;  4NFR A;  4R76 A;  4P4F A;  1Z8L A;  3FMC A;  2ABZ A;  3B2Y A;  4FUU A;  4PPZ A;  4OME A;  1LAN A;  2O4H A;  5JM6 A;  2PVW A;  4A39 A;  1BPM A;  2QVP A;  2GLF A;  2AFW A;  4NGR A;  3B7I A;  3KAS A;  4P45 A;  1BLL E;  3S9N A;  3B3W A;  3PB9 X;  4EWT A;  8CPA A;  2ZED A;  3WT4 A;  4GM5 A;  1DTD A;  2IJZ A;  2PIY A;  3IWW A;  3PBB A;  2ZEO A;  3FED A;  2ZEL A;  2WYR A;  4P4J A;  2AFS A;  3DLJ A;  4TWE A;  3B3S A;  5HVH A;  2BO9 A;  2ZEN A;  4MCP A;  4PXD A;  1KWM A;  2EK9 A;  2DEA A;  4LQG A;  1CG2 A;  4UEF A;  3KR4 A;  3SJF A;  2CTC A;  2C6G A;  5LYL A;  5K8P A;  5F09 A;  1OBR A;  3IIB A;  1AMP A;  3B3C A;  4A37 A;  2PJ8 A;  4IK2 A;  4ZY1 A;  4AXV A;  3BI1 A;  4PQA A;  4P10 A;  5LRK A;  4TNU A;  2GLJ A;  3MRU A;  2ZOG A;  3SI0 A;  5LYF A;  5JH9 A;  4UEE A;  2IMO A;  2O53 A;  1VHO A;  4ZX8 A;  1VGY A;  3PB7 X;  1Y0Y A;  1ELL P;  2JBJ A;  4R8F A;  2CIJ A;  3NH8 A;  1F2O A;  4FBE A;  1TXR A;  4A94 A;  1LFW A;  1EE3 P;  2IQ6 A;  3S9M A;  4NGM A;  1F2P A;  1TKF A;  4MMO A;  3KZW A;  3FEC A;  5LYD A;  4PXE A;  4X8I A;  4FAI A;  2EWB A;  1YME A;  4OC0 A;  4MHY A;  2GU2 A;  3PB6 X;  3CDX A;  1Y7E A;  2RB7 A;  4MHN A;  5CBM A;  4P4D A;  3IO1 A;  3GB0 A;  2F8H A;  4EME A;  2PJB A;  3H8G A;  1YW4 A;  4PXB A;  3V7Z A;  1YLO A;  2G9D A;  3RAM A;  1PCA A;  3PFE A;  4Q7A A;  4ZYQ A;  3VH9 A;  1LCP A;  2BCO A;  3H8E A;  1R3N A;  3FF3 A;  4OIW A;  3CPX A;  4MCR A;  3FVL A;  3TC8 A;  3NH4 A;  4OID A;  2NYQ A;  4OC3 A;  2QJ8 A;  5HVF A;  1TKH A;  2ANP A;  3GLJ A;  3FEE A;  3KHX A;  4P4E A;  3B35 A;  2PJ7 A;  4P4I A;  2PJ5 A;  1CP6 A;  3KR5 A;  3HUV A;  3SI2 A;  5I4M A;  1GYT A;  4X3R A;  5LRJ A;  2PVV A;  2AFU A;  2V8H A;  2RFH A;  2AFX A;  1BAV A;  2BOA A;  4G1P A;  3VAR A;  3QNV A;  2Q51 A;  4YWY A;  2PJ6 A;  4O23 A;  4OKO A; 
#chains in the Genus database with same CATH topology
 4P4B A;  1VQ9 B;  1DE4 C;  1N07 A;  3HAG A;  2B58 A;  2Z3N A;  3VWD A;  1LAP A;  2V31 A;  3W6X A;  3R9E A;  4KSI A;  4H2K A;  3U6B A;  2JN9 A;  3SXO A;  1IJE A;  2VNJ A;  4K30 A;  4RDJ A;  4C2X A;  4JZ0 A;  1I12 A;  2Q7S A;  4DQL A;  1E79 A;  1R5B A;  3ISZ A;  4MJ8 A;  1A8P A;  1KUV A;  5F4M A;  2Q04 A;  3R9G A;  3PFO A;  4FD6 A;  4Q36 A;  3FJO A;  2B4D A;  3BCD A;  3CMM A;  2ODF A;  2PQ8 A;  3LO8 A;  4L8A A;  2V7U A;  2PJ1 A;  1Y0R A;  3T90 A;  3W91 A;  2X0K A;  5IV0 A;  4LUA A;  4DYO A;  3B8G A;  6CPA A;  1ZLI A;  4A38 A;  1TTT A;  4M6G A;  5EBV A;  2Q6O A;  1R43 A;  3G6E B;  3PB8 X;  2CF4 A;  3D4U A;  3B3V A;  2WZN A;  1IJF A;  2BF4 A;  2EUI A;  2YNE A;  4UZE A;  3NA6 A;  1Q2C A;  2VNI A;  2ZBV A;  4UCP A;  4UZU A;  2VBT A;  5HKK A;  4F9U A;  3CMA B;  2X6X A;  1QGZ A;  2R6H A;  4RD0 A;  1M4G A;  4Z4T A;  4ACA A;  2WSA A;  2NV4 A;  1EFR A;  1AYE A;  2B7B A;  4CAW A;  3CXQ A;  2QE7 A;  3CRZ A;  4PXC A;  1QMU A;  1ELM P;  4X7C A;  4ZCL A;  2R7H A;  3WC5 A;  4UWJ A;  2BEI A;  3DGV A;  1Y7R A;  5KW9 A;  3E1Y E;  2ZTN A;  2V77 A;  1WPC A;  4XOR A;  3QFT A;  2OZG A;  3WC6 A;  4XPK A;  5ELY A;  4XLC A;  1PU9 A;  2CNT A;  3LMS A;  4B44 A;  4P6Y A;  3WR7 A;  4J3G A;  1Q86 D;  4CGL A;  2BGI A;  4U9U A;  3T8W A;  3FPP A;  5L46 A;  4UZF A;  4MXU A;  2VL1 A;  2CND A;  5LYI A;  3JU4 A;  3R6J A;  4M6I A;  3ZZU A;  2WSS A;  4OPO A;  1VHE A;  1Z9U A;  2JLM A;  4YAU A;  2W6J A;  1MK4 A;  4CRZ B;  3CME B;  4A31 A;  2Z10 A;  1QH0 A;  1FNM A;  1WWZ A;  4Y49 B;  1PKV A;  1ZLH A;  2POK A;  4CYQ A;  1RXT A;  4UFW A;  4RCZ A;  2Z0Z A;  4F6A A;  5HVG A;  2ZZQ A;  1Z2L A;  4DK0 A;  2XND A;  1OGI A;  4JD6 A;  2ZZG A;  1KC8 D;  4HNW B;  2VZL A;  3KQX A;  2PDO A;  3IC1 A;  3CW2 A;  1HDQ A;  4RD2 A;  3RZA A;  4CAV A;  3GSI A;  2J8M A;  4F7D A;  1K4J A;  3TO9 A;  3PB4 X;  2Q4Z A;  2YNC A;  4NEX A;  3RYO A;  2BSW A;  4ONW A;  1K73 D;  4KOT A;  1WOR A;  2ZEM A;  1XEB A;  1GO2 A;  3KL9 A;  1WOS A;  1GAQ A;  4XKW A;  1FNB A;  3OZV A;  4TT3 A;  1OZP A;  1W0J A;  3ZZT A;  3GVK A;  4XLF A;  4ZY2 A;  3SJG A;  4KZT A;  5AN9 A;  1XJO A;  4B11 A;  3GYA A;  4ZY0 A;  2GFQ A;  1P4N A;  4R87 A;  3AVY A;  4FWU A;  5F46 A;  2B5O A;  4AVZ A;  1A2Z A;  4CGP A;  2C1C A;  4QFM A;  1NSA A;  3LQ6 A;  4MYT A;  1YX2 A;  4KVO E;  3N5F A;  2QEC A;  3G8W A;  1H8L A;  4XOP A;  2I1L A;  4EVY A;  4P1V A;  4ONU A;  2DXQ A;  1Z8L A;  3B2Y A;  2H5M A;  3Q6R A;  1E1Q A;  3P2H A;  4OME A;  1JB9 A;  2Q6K A;  1LAN A;  3JQR A;  1D2E A;  2YNC C;  5JM6 A;  3VWE A;  4A39 A;  2GLF A;  2AFW A;  4NGR A;  3OKX A;  3OEH A;  1BLL E;  2M5S A;  3A8I A;  3VR6 A;  1PJ7 A;  2WZP P;  2FS5 A;  1MJ9 A;  1QX4 A;  4B47 A;  8CPA A;  1NBM A;  2QML A;  2ZED A;  4F0X A;  3WT4 A;  3CES A;  1DTD A;  2IJZ A;  3TTH A;  1I7P A;  3OZW A;  4E0F A;  3FED A;  3S6K A;  4R71 A;  2F5I A;  1PJ5 A;  4RI1 A;  4QBJ A;  4ASU A;  3PZJ A;  3B3S A;  2KCW A;  1CNE A;  4M0L A;  1YVK A;  2G3A A;  2B4B A;  4A2Z A;  4NBS A;  1S7K A;  2BMW A;  3KR4 A;  2Q6L A;  3SJF A;  3BY2 A;  2CTC A;  4QUS A;  3ONY A;  4YRH A;  4RCY A;  1VQM B;  5F09 A;  2Z3L A;  1EFT A;  1XF8 A;  4CGM A;  3OWC A;  4IK2 A;  3BI1 A;  3Q39 A;  4Y9R A;  4PQA A;  4TNU A;  3ASS A;  4KLW A;  2B5G A;  2G0B A;  4RS2 A;  2IMO A;  4XLE A;  5G22 A;  1VQN B;  2O53 A;  4NCZ A;  1VHO A;  1Y0Y A;  1VGY A;  3FPK A;  3V7A A;  2K5T A;  1J9Z A;  4R57 A;  1F2O A;  2AJ6 A;  1TXR A;  1Y9W A;  1LFW A;  4A94 A;  1ELO A;  2DPS A;  4G1B A;  5JQ4 A;  4MI4 A;  1W0K A;  2EVN A;  1HZE A;  1T5E A;  4Z4S A;  1QSM A;  2OZU A;  4LBY A;  2GQF A;  3KZW A;  1AMO A;  3P26 A;  4X8I A;  3BQJ A;  2JDD A;  1XE1 A;  4MHY A;  3FB3 A;  1OHH A;  3IGR A;  5CBM A;  4RDK A;  3CC7 B;  1DDG A;  2QTL A;  4UAJ A;  2R8V A;  4X05 A;  4PXB A;  1EFU A;  2RC5 A;  4Z1M A;  3EO4 A;  1PCA A;  3PFE A;  1CNF A;  4B3G A;  1UD4 A;  1FX0 A;  1LCP A;  1N06 A;  1ZM4 A;  4OIW A;  2D74 A;  3CPX A;  2P6G A;  4N3G A;  1AUG A;  4OID A;  3QB8 A;  2BM1 A;  3ZUG A;  1TKH A;  4AG9 A;  3GLJ A;  3LD2 A;  3FEE A;  4YHB A;  2BGJ A;  2ZXI A;  2XNJ A;  1Q9S A;  1CP6 A;  1FRQ A;  3HUV A;  2HDN B;  1N0V C;  5I4M A;  1QSR A;  4X3R A;  2AFU A;  3T9Y A;  2RFH A;  2Z3M A;  2GJK A;  3QNV A;  5IYW A;  2PJ6 A;  3OJW A;  1K9M D;  3A3B A;  3TT2 A;  4L89 A;  1ARL A;  2ZEH A;  3D66 A;  4ZCI A;  2OU2 A;  3QFR A;  2ZEP A;  3JTK A;  3R6K A;  4TN1 A;  3A9L A;  2VBS A;  2PJ3 A;  3GVL A;  1PYT B;  3RBU A;  3I1F A;  1JWQ A;  4ZI6 A;  1KUY A;  5A89 A;  3TOB A;  5BWA B;  3GY9 A;  5TV2 A;  3CD6 B;  1ZG7 A;  4YFJ A;  5K8M A;  4PV6 A;  2C4T A;  4MFQ A;  2XZL A;  3DR6 A;  4MHD A;  2DIE A;  4P3I A;  2JIZ A;  4KOR A;  3T53 B;  3W5H A;  1EP1 B;  1PJ6 A;  2DYI A;  1XBU A;  4B12 A;  4GXH A;  3ISX A;  1U6M A;  4WWV A;  3WBK A;  4QVT A;  2V8G A;  3CPW B;  4UF4 A;  4NJR A;  1IU8 A;  2R9V A;  4YEJ A;  4NF1 A;  2J7K A;  2C6P A;  2HB6 A;  7CPA A;  3KI9 A;  1G7T A;  1DDI A;  1CQX A;  4R7M A;  1KMH A;  3MN8 A;  4BBH A;  2ZEF A;  2WPD A;  4UFV A;  5IX3 A;  1Q7L A;  5HXB A;  4IHM A;  1I21 A;  1QSN A;  2Z6B D;  1VLY A;  1IGB A;  4Z4W A;  5FO1 A;  3R1K A;  2AHO A;  2EK8 A;  5BSX A;  2J9A A;  4X5K A;  4RD3 A;  2PJ2 A;  4XPD B;  2WJV A;  4MCQ A;  2ZXH A;  1JQG A;  3B78 A;  2GIV A;  4BD9 A;  1UFH A;  4AVB A;  3D7D A;  2FVG A;  3FJU A;  2GRE A;  1CX8 A;  2I00 A;  1VQ5 B;  5TR9 A;  4C43 A;  3FYN A;  4B5P B;  5BSY A;  3W2I A;  1ZG8 A;  1FNO A;  1IB1 E;  2YWH A;  1RTQ A;  4NSQ A;  3Q3A A;  4A30 A;  3W5V A;  1ZG9 A;  3LAC A;  3V8I A;  4Z65 A;  1XRY A;  4X7F A;  3JVN A;  3ES9 A;  4MHZ A;  2XEJ A;  4NJQ A;  2FCK A;  3H8F A;  4KOS A;  4LQ6 A;  3S9L A;  3DSB A;  3ONU A;  4U9Z A;  2ZW5 A;  3SJZ A;  1QUF A;  3SJX A;  1T6Z A;  2CW5 A;  1Z4R A;  2PJ0 A;  1W87 A;  4FD4 A;  1YVO A;  3SXN A;  1QGY A;  1RQR A;  2ZEG A;  1Q81 D;  4A32 A;  3WAB A;  1G7S A;  5F48 A;  3IEH A;  4NXY A;  1YLE A;  4DUK A;  2NMT A;  2PJ4 A;  5KTC A;  1IY7 A;  2AFM A;  1KRH A;  2WUU A;  3R95 A;  1E3X A;  1TKJ A;  2REE A;  3DNS A;  3I1U A;  4X2T A;  4M85 A;  3AGQ A;  4B5P A;  1WOP A;  2HLD A;  4C0S A;  3SJE A;  4QHY A;  4NGS A;  2DOG A;  4TMX A;  4XPD C;  5HZB A;  3Q38 A;  5IB9 A;  3BHX A;  1CJW A;  3RO0 A;  4UCN A;  4XN0 A;  2CNS A;  2V7T A;  2C4U A;  3OFN A;  1BOB A;  3NH5 A;  1COW A;  2V7W A;  3D7G A;  2ZEE A;  2YWF A;  4XLA A;  1YI2 B;  4WJB A;  1CPX A;  4PC7 A;  4U9Y A;  4LBZ A;  1HEE A;  4KUA A;  3R96 A;  4E2A A;  3NE7 A;  1WSR A;  4NGN A;  4M4S A;  2ZL5 A;  1S0U A;  4NCN A;  5AGE A;  4QUZ A;  2PC1 A;  3W2F A;  4RD6 A;  3V76 A;  2YGW A;  5GV8 A;  4P4F A;  1V0C A;  1KK1 A;  2ABZ A;  1KK0 A;  2YWE A;  4FUU A;  4PPZ A;  2FT0 A;  2OB0 A;  2FIW A;  3ASP A;  2V4D A;  2Z3O A;  3B7I A;  1UD3 A;  4KSF A;  4R3K A;  2YWG A;  4XNF A;  3B3W A;  3PB9 X;  4Z4U A;  1OB0 A;  4G6I A;  1M44 A;  1BMF A;  2PIY A;  3IWW A;  4ZCM A;  2ZEO A;  1Y9K A;  4FWT A;  2ZEL A;  1UD6 A;  3G05 A;  4P4J A;  1YX0 A;  3CCR B;  2AFS A;  2ZW6 A;  3AVW A;  4MY3 A;  5HVH A;  4C2Y A;  1M4D A;  4MCP A;  4Z4Y A;  1WDT A;  1N05 A;  4MBU A;  1VQ8 B;  3CB4 A;  3JQQ A;  1IYL A;  1YIT B;  3CC4 B;  2VYQ A;  5LYL A;  2QGG A;  1YQE A;  1TUI A;  4PC2 A;  3F5B A;  1BQE A;  3LVB A;  5FA6 A;  5LRK A;  3W2G A;  2GLJ A;  1K28 D;  2ZOG A;  2QDX A;  4LBW A;  5LYF A;  5ISV A;  2P6E A;  3GVJ A;  4JWP A;  4G7X A;  1WSV A;  3LOD A;  5E96 A;  3PB7 X;  1ELL P;  2ZL6 A;  3T51 B;  4H89 A;  4CAX A;  4XN3 A;  3NH8 A;  3EC4 A;  5TRD A;  4X06 A;  4RN7 A;  4RDL A;  4G1V A;  1EE3 P;  4F0Y A;  4P6V F;  1IIC A;  4NGM A;  2D3L A;  1N8R D;  4Z4R A;  2ZW4 A;  1TKF A;  2VNK A;  3OAA A;  1VQO B;  4PXE A;  2R1I A;  3CCV B;  3B8H A;  4FAI A;  1YME A;  2ZTG A;  3PB6 X;  2GK6 A;  3RY8 A;  1Y7E A;  4MHN A;  3F8K A;  1E1R A;  2O28 A;  5J8C A;  5GV7 A;  3B82 A;  1OB5 A;  5DWN A;  2X3U A;  3BY1 A;  2F8H A;  3TFY A;  2REF A;  2PJB A;  2WPX A;  1YW4 A;  3EFA A;  4PC6 A;  1CM0 A;  4K1X A;  5HZA A;  4OAD A;  4J0Q A;  2OBR A;  1NJI D;  4YAO A;  4H6U A;  5JBQ A;  2BCO A;  1S5K A;  5IYQ A;  1NRK A;  3I3G A;  4MCR A;  1N71 A;  5EMI A;  2X6Y A;  5FVJ A;  2QJ8 A;  5HVF A;  4P25 A;  1TVC A;  3KHX A;  4P4E A;  3CTA A;  4PAB A;  4P4I A;  3QE2 A;  5EMN A;  4KKT A;  5J35 A;  3FNC A;  3BJ7 A;  2XNC A;  1WOO A;  5KSW B;  2PIA A;  4WZT A;  4C7H A;  3P27 A;  1Z8X A;  4E8O A;  3Q6Q A;  3FBU A;  4ZGY B;  1BX1 A;  1WP6 A;  4OLL A;  3H9N A;  5TY0 A;  4OP7 A;  4IW3 B;  1YHQ B;  4MFL A;  1ZM9 A;  5KTA A;  3QFC A;  2Q0Y A;  4OC1 A;  5IYN A;  3FH4 A;  4CRY B;  3CPA A;  3F0A A;  3CP2 A;  1FDR A;  2PJC A;  3W2H A;  4MFZ A;  3SI1 A;  2P0W A;  4N3N A;  1TIQ A;  1LOK A;  2OOT A;  2BM0 A;  4ZGN B;  4IF5 A;  1LAM A;  4Y49 C;  4XPL A;  4KUB A;  2ZXV A;  3BXM A;  3KGQ A;  1KQS B;  2OK7 A;  3IU1 A;  1QFZ A;  4LX9 A;  3VMF A;  4XL9 A;  2GJR A;  4KKU A;  3I55 B;  2DET A;  1E63 A;  3OZU A;  3S6F A;  4XLH A;  2E1B A;  5D8N A;  2OTL B;  1ARM A;  3W2E A;  1NB9 A;  2F7V A;  3U6K A;  4XR6 A;  4ACB A;  4P2N A;  1QFY A;  1B23 P;  3KHZ A;  1IHM A;  4B13 A;  3BJ8 A;  5DSZ A;  5CPA A;  4JJX A;  2DEU A;  1ON0 A;  4C2Z A;  5AG7 A;  5LRG A;  3IJ3 A;  4HNX B;  1HDU A;  3B3T A;  2CXA A;  1M90 D;  4P44 A;  2C78 A;  2PRQ A;  3R9F A;  5HXD A;  3CP8 A;  4KKS A;  4G7W A;  1M1D A;  2AFZ A;  3CZX A;  1Q7Y D;  1FT7 A;  4XNH C;  4RD1 A;  4B6Z A;  4MFJ A;  4PC1 A;  2VJJ A;  5A28 A;  3PEN A;  2X7B A;  4AF6 A;  4NGT A;  3GQB A;  4TKO B;  2CC2 A;  1ZM3 A;  1VLO A;  3OE7 A;  2XEI A;  4B5O A;  5F47 A;  2BN4 A;  3V38 A;  3A3G A;  1QG0 A;  4CPA A;  5A27 A;  4AB7 A;  4DK1 A;  3CXC B;  5G1Z A;  3VNU A;  3ASQ A;  3FX6 A;  4DJL A;  3JQP A;  4NGQ A;  1VIX A;  2I3C A;  2XOK A;  4L8J A;  4UCM A;  2PCU A;  4R9M A;  3SLN A;  1V5V A;  3TO7 A;  5I0C A;  1XMB A;  5IYP A;  1SKQ A;  3CCJ B;  5FIU A;  3OW2 B;  4ZV4 A;  5H86 A;  1X10 A;  2FIA A;  4WZL A;  3G4S B;  4II2 A;  2HV2 A;  4OOX A;  4P12 A;  1NDH A;  2AFO A;  4DNC A;  5J3O A;  5LMZ A;  3J81 k;  4MFP A;  1KJZ A;  4AC9 A;  4II9 A;  1S4M A;  3PA1 A;  5K8N A;  2I79 A;  1Q82 D;  3FKS A;  1QVG B;  3MMP A;  1VKC A;  1QQ9 A;  4MFK A;  2V8V A;  2OH1 A;  1F60 A;  3D7H A;  4IAV A;  1DG1 G;  2CK3 A;  5H84 A;  4PSW A;  2ZOF A;  2JBK A;  4MRI A;  4FD7 A;  3A8J A;  4UBR A;  4CAE A;  4CYO A;  5FL7 A;  4CYN A;  3D26 A;  1AIP A;  3W5U A;  4M3S A;  2PIZ A;  1CBX A;  1S7L A;  4MCS A;  3D7F A;  2P6F A;  1RQP A;  1R57 A;  2HC9 A;  2VNH A;  4B14 A;  2X53 S;  5B6I A;  1UD2 A;  2C5B A;  3D8P A;  3TOA A;  5A88 A;  4CGN A;  3IWG A;  4OP4 A;  4OC2 A;  1BJK A;  4X07 A;  2FX3 A;  1UWY A;  4B3F X;  1H42 A;  5J1Q A;  1M4L A;  3MCA A;  4KOX A;  4RPD A;  4HNY B;  2DCU A;  3AVU A;  5DS0 A;  3K2K A;  4CAF A;  1MRZ A;  1BPN A;  2BV3 A;  4QC6 A;  1XFO A;  4EFD A;  4X7E A;  2VQY A;  2W6I A;  1GVH A;  4KOW A;  1TLL A;  1R5N A;  2OZH A;  1YJN B;  4M53 A;  4JLY A;  3VO1 A;  2V7Q A;  2PR8 A;  3FMC A;  4P3Y A;  2B4D B;  4H9G A;  2QA4 B;  2ZIT A;  2O4H A;  4PSX A;  1VQ7 B;  1BPM A;  2QVP A;  1HVX A;  1KK2 A;  2VBQ A;  4AVA A;  3KAS A;  2PLF A;  1B87 A;  2LZJ A;  4PK3 A;  4EWT A;  3ZPN A;  3TCV A;  1W35 A;  1P0H A;  1V0E A;  4GM5 A;  1YR0 A;  3QFS A;  3PBB A;  1GJR A;  1VQ4 B;  1KZF A;  2QIR A;  2WYR A;  2GPJ A;  1EXM A;  5DN6 A;  4TWE A;  3QAY A;  4UA3 A;  2BO9 A;  1P4M A;  4KS9 A;  4PXD A;  5THX A;  1KWM A;  3MGD A;  1WU8 A;  2EK9 A;  4LQG A;  2AE6 A;  1YRE A;  1IOI A;  2A4N A;  1CG2 A;  4UEF A;  2G3T A;  2OK8 A;  2B3V A;  3KKW A;  4UWI A;  3AST A;  2PMD A;  1OBR A;  3IIB A;  1EP3 B;  2FSR A;  5FO0 A;  4BIN A;  2XZO A;  1DAR A;  1GR1 A;  1OB2 A;  4KVM E;  4ZY1 A;  2VI7 A;  4YGO A;  1GAW A;  4P10 A;  4BMH A;  5IYR A;  3SI0 A;  4RM0 A;  2Q44 A;  2XEX A;  1ZUN B;  1RO5 A;  4PK2 A;  2Y0M A;  2XGJ A;  4R8F A;  5HMN A;  2CIJ A;  2X85 A;  5FNZ A;  2B3U A;  4CGO A;  4PC3 A;  2VZZ A;  5C88 A;  3AVT A;  2V7X A;  4KOV A;  4A33 A;  3G3S A;  4FBE A;  3SKB A;  1X12 A;  2IQ6 A;  3S9M A;  3EXN A;  4LC0 A;  3FXT A;  1F2P A;  3WND A;  5C82 A;  2ZPA A;  4MMO A;  2E1R A;  5LYD A;  3T56 B;  4P9S A;  1KUX A;  4OC0 A;  4KSA A;  3PVD A;  1UD5 A;  5AG6 A;  3GB0 A;  3KEW A;  2DER A;  4EME A;  1XB2 A;  1KD1 D;  2JEV A;  3TO6 A;  4XMY A;  3MHP A;  3DDD A;  4Q7A A;  1QFJ A;  4HKF A;  3VH9 A;  2DY1 A;  2OBT A;  5AG4 A;  1R3N A;  1I8D A;  1VF7 A;  4WZK A;  4HE6 A;  2BPO A;  1NB0 A;  1E64 A;  2ANP A;  1BPL A;  3QAH A;  1QST A;  3IWE A;  1Z4E A;  2PJ7 A;  3ZBT A;  2PSW A;  3EY5 A;  4ZBG A;  2PJ5 A;  1FY7 A;  1SQH A;  3D2P A;  3PUM A;  3OJX A;  5IK2 A;  4OAE A;  3SI2 A;  1NE9 A;  1GYT A;  2JDC A;  4PGO A;  2V8H A;  3CXS A;  1UMK A;  2AFX A;  1BAV A;  2XZP A;  2BOA A;  3CCS B;  1KZL A;  4G1P A;  3A8K A;  3VAR A;  1VQL B;  2Q51 A;  4YWY A;  4FXU A;  3BNW A;  1G7R A;  4Q38 A;  3SLD A;  4CQJ A;  3NE8 A;  4OKO A;  4M1K A;  3PUN A;  4ZGQ B;  5KTD A;  2QYV A;  2QTZ A;  3FIX A;  4Y9U A;  1YJW B;  2WPW A;  1S7F A;  1WTH D;  5HH1 A;  4P26 A;  3A1P A;  4AF7 A;  2OR4 A;  4QVJ A;  4DNT B;  3H4Q A;  2Q43 A;  1K8A D;  1GHE A;  4K3N A;  2B5G B;  4XKV A;  1VHS A;  1G7C A;  3WYA A;  4G5G A;  3ZJ0 A;  3FRM A;  1VJS A;  1J4J A;  2OTJ B;  1H8H A;  1Q2D A;  4CS0 B;  4LBV A;  2ZW7 A;  2D4O A;  4C68 A;  3PRT A;  5IB0 A;  2GK7 A;  4XON A;  4RPB A;  3TE4 A;  4WZE A;  2QEX B;  4AG7 A;  3U2Q A;  3VAT A;  4TMW A;  2IL4 A;  3L2N A;  4OC5 A;  3CCM B;  1W2B B;  1IYK A;  3W6S A;  1I1D A;  4B48 A;  1V0F A;  2HQY A;  2NPF A;  2PRB A;  4JYW A;  3VNV A;  4YAL A;  1TF8 A;  3GIR A;  4X0C A;  4KOY A;  1XE4 A;  4MYU A;  3PA2 A;  4GS4 A;  5K8O A;  1B6B A;  3OPO A;  3WXM A;  4XQF A;  3I9S A;  5JGF A;  2VZY A;  2QN6 A;  1UD8 A;  1FND A;  3KQZ A;  2BVN A;  3NFZ A;  2V8D A;  3D67 A;  3UY5 A;  2Q7B A;  5D29 A;  5EC4 A;  1MAB A;  1H8E A;  5F4J A;  4B4D A;  1LRZ A;  1QSO A;  4BPR A;  3D68 A;  2PJ9 A;  3K9U A;  2Q4Y A;  4FK8 A;  4P22 A;  3PEI A;  2GAN A;  4JXR A;  5GCN A;  2C77 A;  4RLZ A;  3H5Z A;  4UIA A;  4W9Y A;  3PBE A;  2CNM A;  2ZZF A;  2PE3 A;  4XOT A;  4OOV A;  1YIJ B;  4Z4V A;  1F57 A;  1CPS A;  1JJ2 B;  1Z5R A;  2D9R A;  3DDY A;  3AVV A;  3N7Z A;  5KNL A;  5A8A A;  2BSA A;  3OW7 A;  3AVX A;  1H85 A;  1SM4 A;  3BI0 A;  2B7C A;  5G20 A;  3JRU A;  2CTB A;  3BC9 A;  4JMQ A;  4KOU A;  4UIB A;  4OC4 A;  1FRN A;  3WC7 A;  2Z3P A;  4MHP A;  1E3Z A;  2QMU A;  4RUH A;  4YEL A;  2JEW A;  3E20 A;  3ZZI A;  4UEZ A;  3OEE A;  2PJA A;  2EO8 A;  1YK3 A;  1Z8W A;  1JA0 A;  2WR8 A;  1KTV A;  3QSY A;  2D3N A;  3VO2 A;  1KK3 A;  2XEF A;  3AGP A;  2C5H A;  3BCF A;  1VQP B;  3BH4 A;  1VQ6 B;  1JA1 A;  2C6C A;  1JNY A;  4FD5 A;  4TMV A;  4NGP A;  2XEG A;  4R6T A;  2KVO A;  4WQM A;  5AG5 A;  2Z11 A;  4ZX9 A;  1VQK B;  2VBV A;  1BO4 A;  3S6G A;  4M2L A;  5F49 A;  3K9T A;  3IU2 A;  3OP1 A;  4F8Z A;  1Z8T A;  2C27 A;  2HUZ A;  1XQB A;  1NSL A;  3GUX A;  1S72 B;  2R98 A;  1YW6 A;  2FXF A;  1XOV A;  3WNC A;  4Q7J B;  2J8N A;  2Q4V A;  2F1L A;  1D1N A;  3IFE A;  3RNZ A;  3CCQ B;  1TF9 A;  3G71 B;  2ATR A;  3HLP A;  2NSM A;  1CP7 A;  5G21 A;  1ZM2 A;  3CCL B;  2RC6 A;  1YSJ A;  3TX8 A;  2CBX A;  3C26 A;  5CNP A;  4F9V A;  1NMT A;  4YXW A;  3LWU A;  4XNH B;  1N0U A;  3SHP A;  3ASR A;  1YGH A;  5H59 A;  5THW A;  2HMA A;  4AVC A;  2RC4 A;  2VEZ A;  5JPH A;  2JDI A;  1XMT A;  4OOS A;  3CCU B;  4YU9 A;  2VJI A;  3CXP A;  3WBJ A;  2OBS A;  3H94 A;  4YAF A;  4QVA A;  4QB9 A;  1W9X A;  3D3S A;  4DQK A;  3CT9 A;  4NFR A;  4TMT A;  4R76 A;  2JJ2 A;  1WK4 A;  2CY2 A;  3WNB A;  2X8K A;  1XIX A;  4TSF A;  4QV2 A;  1M1K D;  1ZO0 A;  4RD4 A;  2PVW A;  4DNR B;  4JXQ A;  1EWY A;  2VBU A;  1Q2Y A;  1PUA A;  3NE5 B;  3PGP A;  1S3Z A;  4P45 A;  3S9N A;  1D8T A;  4PAA A;  2X6W A;  3SEJ A;  1YJ9 B;  1IOF A;  2HCJ B;  1MJA A;  3GKR A;  2YND A;  3WQZ A;  3ZC3 A;  2C2W A;  3CCE B;  4GQN A;  4B3X A;  1I18 A;  1S60 A;  5DWM A;  3DLJ A;  2CRV A;  2ARH A;  2ZEN A;  1U2R A;  1S7N A;  1BLI A;  2DEA A;  5CDF A;  2J8R A;  2FE7 A;  2BUE A;  3SJP A;  2F43 A;  3S6H A;  2C6G A;  2JJ1 A;  5K8P A;  4XM3 A;  2F1M A;  1AMP A;  3B3C A;  1QVF B;  4A37 A;  2GE3 A;  4I49 A;  2PJ8 A;  1HA3 A;  1OGJ A;  3GIU A;  4EH1 A;  2EBJ A;  3LNN A;  3I56 B;  4AXV A;  3LQE A;  2D4P A;  3MRU A;  5JH9 A;  1IB0 A;  5H5J A;  2P3M A;  4UEE A;  2Q6I A;  4ZX8 A;  4X7D A;  2JBJ A;  2WJY A;  4Z4Z A;  4XD7 A;  2GJP A;  3ZIA A;  4Y7C A;  1QGA A;  3OOC A;  4NNJ A;  1N08 A;  2VXK A;  1T6X A;  3FEC A;  1BX0 A;  2DF5 A;  4R3L A;  4HPS A;  5J8F A;  2F4N A;  2EWB A;  2ZBU A;  2GU2 A;  1B2R A;  3CDX A;  2RB7 A;  3BLN A;  4YAW A;  1SKY B;  4P4D A;  3IO1 A;  4M6H A;  2V7V A;  1E43 A;  4C7I A;  4TMZ A;  3H8G A;  4IUS A;  4H6Z A;  4OPS A;  1F20 A;  3ZBU A;  3P2F A;  3V7Z A;  1YLO A;  2G9D A;  3RAM A;  1FNC A;  4ZYQ A;  4CYP A;  2DPT A;  3H8E A;  3CC2 B;  3D2M A;  3FF3 A;  4U5Y A;  4FN5 A;  4B43 A;  3FVL A;  2EFG A;  3TC8 A;  3NH4 A;  1L0C A;  4HIZ A;  2ZL7 A;  4B10 A;  2NYQ A;  4KLV A;  4OC3 A;  4A95 A;  2ZZE A;  2BL1 A;  3B35 A;  4ORF A;  3ZZ0 A;  2FL4 A;  3DR8 A;  1R5O A;  1MJB A;  4RJL A;  1IID A;  4MY0 A;  1M4I A;  3E0K A;  4OPV A;  2PR1 A;  3KR5 A;  1W34 A;  3PP9 A;  1E62 A;  1QUE A;  5LRJ A;  4E0A A;  2PVV A;  3WY9 A;  1T6Y A;  1EP2 B;  4HE5 A;  5E6T A;  3A35 A;  4II3 A;  3JUW A;  1EFC A;  4UFX A;  4KVX A;  4ROX A;  2OYN A;  2Z3K A;  4O23 A;  5F4O A;  2EIX A; 
#chains in the Genus database with same CATH homology
 4P4B A;  1DE4 C;  1ARL A;  2ZEH A;  3D66 A;  4OC1 A;  2QYV A;  3FH4 A;  1LAP A;  2ZEP A;  3CPA A;  4KSI A;  4H2K A;  2OR4 A;  2PJ3 A;  2PJC A;  1PYT B;  2Q43 A;  3RBU A;  3SI1 A;  4K3N A;  4JZ0 A;  4ZI6 A;  1ZG7 A;  5K8M A;  3ISZ A;  1LOK A;  2OOT A;  1LAM A;  3BXM A;  3PFO A;  3KGQ A;  1XBU A;  3PRT A;  3ISX A;  4WWV A;  2PJ1 A;  1Y0R A;  2V8G A;  3VAT A;  4UF4 A;  3L2N A;  4OC5 A;  5D8N A;  4NJR A;  1ARM A;  4DYO A;  4JYW A;  6CPA A;  1ZLI A;  2F7V A;  1TF8 A;  4A38 A;  2C6P A;  2HB6 A;  3KHZ A;  1R43 A;  7CPA A;  5K8O A;  3KI9 A;  5CPA A;  3PB8 X;  2CF4 A;  3D4U A;  5JGF A;  5LRG A;  3B3V A;  2WZN A;  3IJ3 A;  1HDU A;  3MN8 A;  4R7M A;  3NA6 A;  3B3T A;  2ZEF A;  3KQZ A;  4P44 A;  2PRQ A;  4F9U A;  3NFZ A;  2V8D A;  3D67 A;  5HXD A;  1Q7L A;  4IHM A;  5D29 A;  2AFZ A;  1IGB A;  2PJ9 A;  3D68 A;  1FT7 A;  4B6Z A;  1AYE A;  3PEI A;  2EK8 A;  4PXC A;  2J9A A;  4UIA A;  4NGT A;  2PJ2 A;  1QMU A;  1ELM P;  4MCQ A;  4W9Y A;  3PBE A;  3WC5 A;  2PE3 A;  1JQG A;  2XEI A;  4BD9 A;  3DGV A;  3D7D A;  3V38 A;  1F57 A;  2FVG A;  1CPS A;  1Z5R A;  3FJU A;  2V77 A;  2GRE A;  1CX8 A;  3WC6 A;  4CPA A;  1ZG8 A;  5ELY A;  3LMS A;  1FNO A;  3BI0 A;  4P6Y A;  1RTQ A;  3JRU A;  2CTB A;  3FX6 A;  3T8W A;  1ZG9 A;  4NGQ A;  1VIX A;  4DJL A;  4UIB A;  4Z65 A;  1XRY A;  2I3C A;  4OC4 A;  4MXU A;  3WC7 A;  2VL1 A;  2PCU A;  5LYI A;  4MHZ A;  4MHP A;  2XEJ A;  4NJQ A;  4RUH A;  3H8F A;  1VHE A;  1XMB A;  2JEW A;  4UEZ A;  2PJA A;  3S9L A;  3SJX A;  2XEF A;  2AFO A;  1ZLH A;  2PJ0 A;  2POK A;  2ZEG A;  5K8N A;  3WAB A;  5HVG A;  2C6C A;  3IEH A;  1Z2L A;  4DUK A;  4NGP A;  2XEG A;  4R6T A;  2PJ4 A;  4ZX9 A;  1IY7 A;  1QQ9 A;  2AFM A;  2V8V A;  3KQX A;  1TKJ A;  4X2T A;  3I1U A;  3IC1 A;  3K9T A;  4F8Z A;  3D7H A;  4IAV A;  1HDQ A;  3SJE A;  3RZA A;  2ZOF A;  3GUX A;  2JBK A;  4MRI A;  3PB4 X;  2Q4Z A;  1YW6 A;  4NGS A;  3IFE A;  4ONW A;  5IB9 A;  2PIZ A;  1TF9 A;  2ZEM A;  3BHX A;  1CBX A;  4MCS A;  3D7F A;  3HLP A;  2NSM A;  1CP7 A;  3KL9 A;  2HC9 A;  3NH5 A;  4ZY2 A;  3SJG A;  3D7G A;  2ZEE A;  4OP4 A;  4OC2 A;  1YSJ A;  3TX8 A;  1XJO A;  4WJB A;  1UWY A;  4F9V A;  1CPX A;  3LWU A;  4ZY0 A;  5J1Q A;  1M4L A;  1HEE A;  5THW A;  5DS0 A;  4FWU A;  4NGN A;  3K2K A;  1BPN A;  4YU9 A;  2C1C A;  1NSA A;  1XFO A;  4EFD A;  3N5F A;  1H8L A;  3CT9 A;  4NFR A;  4R76 A;  4P4F A;  1Z8L A;  3FMC A;  2ABZ A;  3B2Y A;  4FUU A;  4PPZ A;  4OME A;  1LAN A;  2O4H A;  5JM6 A;  2PVW A;  4A39 A;  1BPM A;  2QVP A;  2GLF A;  2AFW A;  4NGR A;  3B7I A;  3KAS A;  4P45 A;  1BLL E;  3S9N A;  3B3W A;  3PB9 X;  4EWT A;  8CPA A;  2ZED A;  3WT4 A;  4GM5 A;  1DTD A;  2IJZ A;  2PIY A;  3IWW A;  3PBB A;  2ZEO A;  3FED A;  2ZEL A;  2WYR A;  4P4J A;  2AFS A;  3DLJ A;  4TWE A;  3B3S A;  5HVH A;  2BO9 A;  2ZEN A;  4MCP A;  4PXD A;  1KWM A;  2EK9 A;  2DEA A;  4LQG A;  1CG2 A;  4UEF A;  3KR4 A;  3SJF A;  2CTC A;  2C6G A;  5LYL A;  5K8P A;  5F09 A;  1OBR A;  3IIB A;  1AMP A;  3B3C A;  4A37 A;  2PJ8 A;  4IK2 A;  4ZY1 A;  4AXV A;  3BI1 A;  4PQA A;  4P10 A;  5LRK A;  4TNU A;  2GLJ A;  3MRU A;  2ZOG A;  3SI0 A;  5LYF A;  5JH9 A;  4UEE A;  2IMO A;  2O53 A;  1VHO A;  4ZX8 A;  1VGY A;  3PB7 X;  1Y0Y A;  1ELL P;  2JBJ A;  4R8F A;  2CIJ A;  3NH8 A;  1F2O A;  4FBE A;  1TXR A;  4A94 A;  1LFW A;  1EE3 P;  2IQ6 A;  3S9M A;  4NGM A;  1F2P A;  1TKF A;  4MMO A;  3KZW A;  3FEC A;  5LYD A;  4PXE A;  4X8I A;  4FAI A;  2EWB A;  1YME A;  4OC0 A;  4MHY A;  2GU2 A;  3PB6 X;  3CDX A;  1Y7E A;  2RB7 A;  4MHN A;  5CBM A;  4P4D A;  3IO1 A;  3GB0 A;  2F8H A;  4EME A;  2PJB A;  3H8G A;  1YW4 A;  4PXB A;  3V7Z A;  1YLO A;  2G9D A;  3RAM A;  1PCA A;  3PFE A;  4Q7A A;  4ZYQ A;  3VH9 A;  1LCP A;  2BCO A;  3H8E A;  1R3N A;  3FF3 A;  4OIW A;  3CPX A;  4MCR A;  3FVL A;  3TC8 A;  3NH4 A;  4OID A;  2NYQ A;  4OC3 A;  2QJ8 A;  5HVF A;  1TKH A;  2ANP A;  3GLJ A;  3FEE A;  3KHX A;  4P4E A;  3B35 A;  2PJ7 A;  4P4I A;  2PJ5 A;  1CP6 A;  3KR5 A;  3HUV A;  3SI2 A;  5I4M A;  1GYT A;  4X3R A;  5LRJ A;  2PVV A;  2AFU A;  2V8H A;  2RFH A;  2AFX A;  1BAV A;  2BOA A;  4G1P A;  3VAR A;  3QNV A;  2Q51 A;  4YWY A;  2PJ6 A;  4O23 A;  4OKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...