2PE6B

Non-covalent complex between human sumo-1 and human ubc9
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
74
structure length
74
Chain Sequence
YIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUMO-conjugating enzyme UBC9
publication title Structure and Analysis of a Complex between SUMO and Ubc9 Illustrates Features of a Conserved E2-Ubl Interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding, ligase
total genus 15
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2007-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2pe6B00
1WR6E 2JWZA 4PS8A 4IM2A 2KNBA 1EO6A 1WGDA 2JPHA 2DENB 3ZW3A 4LDTB 3Q3FA 4MJSB 4WJQA 4FULA 3WIMA 1WJUA 4G3XB 3U8ZA 4HCPB 3VTVA 3PGEA 4J6IA 1V9JA 2KHWB 2NVUI 3BY4B 4TQ0A 2IY0B 2MW5A 3ZTCA 2FUHB 1E8YA 5J17A 2XK5B 1QZEA 2Z59B 4EOYA 3OAWA 2L7RA 3WAPA 2C9WB 2J0JA 3MJWA 1WM3A 2KK8A 2XEWA 3N3KB 3RULA 2KJ6A 3WAOA 3ZLZA 1YX6B 3QCAA 2N7EA 3RT3B 5HKHA 3L13A 3VTUA 4IW0A 2MRPA 3L54A 4BKSA 2UYZB 2MQJA 1BT0A 3DBLI 4G0NB 4WWPA 1GC7A 2C5LC 2LGYA 3JSVA 5D94A 4MGZE 3ZNGC 2N9XA 1SIFA 2O6VD 3OJ3A 3K9PB 1YIWA 3A4SC 4FJVB 4MGYE 4OVUA 1EF5A 2MBQA 1UBIA 3PHXB 2K1FA 1NDDA 1WFYA 4EEWA 1P98A 2V3SA 1SGHA 1Y8RC 2CU1A 1WMHA 4LJPB 4AWJA 4F8CB 4IC7B 2AWTA 2DHZA 3A9KA 3PREA 1LM8B 3NOBA 3ZIMA 1EUVB 4GSWA 4MSMB 2IO0B 2MA9B 4KSLC 3RD2A 3HHMA 2PEAA 2KANA 2WX1A 5D2MB 2DZKA 2KLGA 4P7IA 3VH3B 2DYOA 3VDZA 2N4FA 2KFJA 3JW0X 3LDZE 2MCNB 4NNJB 3ZVVA 1E5WA 3KVFB 1UELA 4WAAA 5JH5C 4TQ1A 4DDGD 3DOWA 2GBRA 2KTFA 3C0RB 4HDQA 4FJZA 2GMIC 4DK5A 3R3MA 4B9KA 2JRIB 4IWQA 3K9OB 2FCMA 4E3CA 4KIKA 2KXJA 1E7UA 3VUXA 2Y5BB 3RUIB 2ZJDA 4WQOB 1OTRB 2ZNVC 2OOBB 3KH0A 4MELA 1V2YA 4F7ZA 4ANUA 3ZO5B 3T9LA 4XZ4A 5E6PA 1A5RA 1CMXB 4MSQB 4LJOB 4W9IA 2BF8B 1RAXA 4NQLB 1UGMA 2WYQA 4W9HA 4PYZA 1H4RA 2LWPA 2C7NB 3DVNU 4MGIE 4DHZB 3DVGX 5JHAA 2D3GA 2JXXA 4GGQA 4GOCA 4FN2A 3U30A 2EKEC 3T8MA 4KDLB 4EZKA 2EMSA 4EKUA 4KIKB 4LDTD 2LD9A 4BOZB 4WWNA 3UIPB 5LLIA 3W1SC 5C1ZA 4HCNB 1OEYA 2KFKA 2JZ3B 2BWES 2KC1A 5BO4B 2O2VA 1WGYA 5E6OA 4AUQC 2BYVE 3RZFA 1EF1A 2AYOB 2MP2A 4WJPA 1C1YB 3UGBB 2L3ZA 4ICUA 1YJ1A 4EZLA 1LFDA 1IP9A 2LVOA 3QARA 3ONSA 5G55A 1PQSA 4FADA 4MJSA 3APCA 2KKCA 4DDID 1XQQA 2KDIA 2KOXA 3OJ4B 1KM7A 2AEHA 2DZMA 3IBEA 3CMMB 4RM8A 3TMPB 4X57B 2KFKB 4BOSC 2ZCCA 3M95A 3V62A 5J18A 1WX7A 2DAJA 4PS3A 4W9LA 2R2OA 4KSKC 4W9GA 2DZJA 4AP4C 2BYFA 3A1QB 2XK5A 1UH6A 4FJYA 5CHWA 2IO3B 2MP2B 2FIDA 2KMAA 5IA7A 4M8MA 2JUOA 2N9EB 3NHEB 1V6EA 3H9DA 1Q5WB 2KMCA 3CSFA 3PVLA 3QHTA 3KW5B 1WGRA 2HTHA 4JGHB 1AARA 5LXHA 4NY0A 4NPNA 2LJ5A 3QAQA 1E8WA 5DPRA 4BKSD 3VAWA 3MHSD 2FIFA 3TIXA 2CKHB 5AEKB 5J2RA 1H8CA 1E8XA 1WI0A 4GN1A 4FHKA 3L16A 2KWVB 4MH0E 5DPSA 1MG8A 3V6CB 3W1YA 3NS8A 4MM3A 3VH4B 3VQIA 3A9JB 1E7VA 3AU5A 4HPLB 2M17A 4E71A 3VFKA 2I1JA 2JRHA 2KJRA 4G50A 2W9NA 3R7RA 5DPWA 1UD7A 2PE6B 2NS5A 3B08A 2C7HA 4PS7A 4DHZE 2NR2A 1L7YA 2DZIA 2REXA 3PLUA 3P2BA 2KC2A 2ZVNA 1V5TA 4MGKE 1UZXB 5G2NA 1WIAA 2KVRA 3UIOB 4A20A 3PS6A 2BGFA 2LRWA 3A4RA 3AXCA 4IWPA 1KLVA 3M62B 2RSUA 3QQ8B 1J8CA 3HM6X 3VTWA 2IO1B 4LCDE 3GOEA 5D7GA 2L8JA 2LASA 4K7WA 4BKGA 3RCZA 1OEYJ 2KWUB 3AU4A 1FXTB 3HK0A 3PRMB 1R4NI 3PSEB 3U7DA 3V6EB 4EFOA 5JZEB 1WH3A 3QC8B 1TBEA 3SHQA 2EMTA 3B0AA 3VUWA 4CYEA 1WM2A 1XD3B 4HPMB 2OJRA 2DX5B 3AI5A 3QK0A 2NCNA 1OGWA 4XX5A 3HM3A 4ANVA 2VRRB 2L0FA 5AZHA 2RD0A 3WANA 2ZEQA 4TKNA 3NZUA 3L08A 1ZW7A 3JYUA 3ZTDA 2NBVB 3WA0A 2ZZPB 4A3PA 3DQVA 2IZVB 4WJNA 2M0XA 2MX2A 2CHXA 2M1MA 1WF9A 3ML8A 4W9CA 1VD2A 3PHWB 2PJHA 4WJOA 2K8CA 3A33B 2IO2B 3SDLC 5GMVA 4IWOA 2CR5A 2KTRA 1GUAB 2ASQA 2M8SA 3QWZB 2JVCA 2AL6A 1GG3A 1P9DU 5IAAC 5CHVC 2WX0A 4HDOA 4PYUA 4KZCA 4GU2A 2BPSA 4TV3A 4W9FA 3VUYA 3RYTA 1WGGA 3O65B 1WZ0A 4FHJA 4ANWA 2KQSA 2FAZA 3WAMA 2AL3A 2KN5A 4NAWB 2RGFA 1WR1A 2LUEA 4ANXA 1ISNA 1C3TA 4JLCA 4ICVA 3ZUNA 5L83A 1Q1OA 3DDCB 3N30A 3PRZA 4K7UA 2KTRB 1TZ1A 3ZDTA 2WWZA 4K7SA 1P0RA 4XC2A 4I6NB 2FCNA 4GB9A 2HJ8A 1OQYA 2UWQA 3A1QA 2M4NA 1V81A 2L00B 4GDKA 3L17A 2D2QA 2LXCA 3ML9A 2KJHB 2J7QB 3ALBA 4ASWC 3PRPB 4GMVA 3D32A 3S2AA 1ZKHA 4EZJA 1Z5SB 4NQKE 1XT9B 3QJZA 1D3ZA 1X1MA 2IBIB 2K6DB 1V80A 4ZRIA 3TJPA 3V61A 3ZNZB 2I1KA 3DVNV 4IUMB 1WX8A 1Q0WB 2IY1B 2JY6A 1TGZB 2NPTB 3MTNB 4JQWC 2KO3A 3H6NA 1WX9A 3GZNI 2KDEB 4IG7B 3R7QA 2LZ6A 2LVPA 4AJWA 2MLBA 3M63B 2ZNVB 2BKRB 2BKFA 4GDKB 3A9JA 1YD8U 2J0MA 1WXMA 2MSED 2KD0A 4MEMA 3R66C 2L0TA 3H7PA 2ZVOA 1I42A 4DHJB 2D11A 3DBRI 2B3AA 1KOTA 4F1SA 2QHOA 2IYDB 2N1WA 2N7DA 4BFRA 1E8ZA 1WY8A 4BVUC 2LVQA 5LXIB 4JIOU 1WE7A 3JVZX 4DWFA 1E90A 1V5OA 2G4DB 3DVGY 4URKA 1GNUA 3ZDMC 3APFA 4A3OA 3KUZA 4GDLA 2CHZA 4K1RB 4M0WB 2L05A 4W9JA 3H7PB 3UQAA 1NI2A 4MDKE 3PTFC 3KUDB 2LGDA 1VCBA 2GBKA 2GBJA 3KYCD 3EECA 2K25A 1GJZA 4NJ7A 2Z0DB 4EUTA 3IVFA 3UINB 3DPDA 1YQBA 2FNJB 4HXDA 1UBQA 3QA8A 2CS4A 2HD5B 2V4LA 3VXWA 1WE6A 2GOWA 2C60A 2LRUA 5JHBA 2MBEA 2FCQA 2NBWB 2G45B 2G4SA 1T0YA 3KUCB 4GDLB 4RM9A 1SE9A 2BYEA 3DBSA 2K8HA 3ZNID 4BBNF 4HLEA 3VVWB 2JT4B 3QX1A 5DPTA 3I3TB 2C7MB 4HWIB 4BKTA 4I6PA 2L76A 1WJ4A 2JF5A 3HIZA 4KVGB 3SU8X 5D6JB 1S1QB 2KZRA 2KX0A 2KQ7A 4KZ0A 4W9KA 2WDTB 4AJYB 2PE9A 4JL9A 1WXVA 1L2NA 4WWOA 5L95C 4DBGA 4KDIC 3ZNHB 2FCSA 1WXAA 2MWSB 1ZGUB 3APDA 3ZRFA 4ZYNA 1RLFA 4CO7A 3TL5A 2K39A 3CSTA 4ZRKA 4FA6A 4NAWA 3AULA 3L10B 3EFUA 3ENEA 1V49A 2DYMA 3CF6E 4K81A 1M94A 4OVVA 2A4ZA 2CHWA 2HE7A 2A5UA 2KX3A 4IM3A 3PT2B 4FLHA 2LGXA 3H7SA 4W9EA 3BINA 2KDBA 3M3JA 3ZKJC 3PLVA 5AZGA 2J0KA 5CTRC 5TR5A 3JSVB 2BWFA 3PPAA 1WJ6A 4YL8A 2O6VA 2R2QA 3Q3JA 2D07B 2MBBB 1GC6A 2LXAA 2KDFB 1TTNA 4II2B 1WRDB 2KLCA 4IM0A 5E6NA 5DCNA 4BBNC 2K8BA 1WMHB 3IHPC 4KV2A 1U4AA 1WJNA 3A9KB 4HJKA 1LQBA 5KHQA 3UF8A 4DHJD 4HVBA 2N9PC 1WYWB 1LXDA 4HK2A 2RPQA 2NPTA 4GXBA 3KYDD 1V86A 1S3SG 3NZSA 4W9DA 5AZFA 2ZPYA 3LJ3A 4I6LB 2O6VB 3RZWC 4GIVA 4M8NA 3UQBA 3H1UA 1F9JA 2G3QB 2ZPNA 1P3QU 3ECIA 4E74A 2RR9A 4DXAB 5KHOA 3IFWB 4II3B 1IYFA 1I35A 1WXSA 3ZRCA 1IPGA 2JZZA 4ZDVA 1RFAA 4NJ6A 1J19A 2GBMA 4B6WA 4CHKA 2K6QA 1JRUA 3PV1A 1K8RB 2Z0EB 1WZ3A 3TBLD 3EC8A 3PZDA 5FR6A 3W1SA 3B1LX 2LI5A 4ZRJA 2PPHA 2KWCA 4G11A 4TUUA 3V60A 2NBUA 1NBFC 3IG3A 3N32A 1P1AA 2YLMA 1R4MI 2GBNA 3QIJA 4B95A 1G6JA 3SD5A 1J0GA 3DCGA 3L0WB 5C23A 3WALA 3X23A 2MBHA 4FBJB 3X0WA 5CX3A 1RRBA 2XBBC 4N9F4 4RMAA 3DBHI 3OLMD 2ZCBA 1Z2MA 4AOFA 1KJTA 1HE8A 3EHVA 3VHTC 2YVCA 1WGHA 2O2VB 1YX5B 2D10A 2MBOA 2N1VA 3TCAA 3NY5A 2DAFA 2DYBA 2V1YA 5CHFA 5EDSA
chains in the Genus database with same CATH superfamily
2JWZA 2X8XX 3EA6A 4ZYSA 3U4EG 3WIMA 3U8ZA 2W54A 5I4DA 2HTME 1NVID 2D3BA 1N63A 1WRIA 1E8YA 4YTPB 4R3DA 1QZEA 2PW9A 1FXIA 4LK0M 3P42A 3MJWA 2LHEA 1IUEA 3URYA 1N5XA 5HKHA 3VTUA 4IW0A 4BKSA 1BT0A 4WWPA 2LGYA 2O6VD 3OJ3A 3K9PB 4OVUA 3PHXB 1NDDA 1T0SC 2V3SA 4LJPB 3A9KA 2VH2A 1EUVB 3KWLA 4GSWA 4MSMB 4KSLC 2PEAA 2WDVB 2DLBA 1F2RC 3U2SC 4WWMA 5JH5C 4TQ1A 4PT5A 1V1PA 1YN3A 4DK5A 2WNMA 4IWQA 2HDEA 2ZJDA 1E7PB 1OTRB 2ZNVC 3LB8C 3W5UB 5E6PA 4XYCA 1A5RA 4MSQB 2KMMA 4ZRQA 1RAXA 1ZDXA 2WHIA 2WYQA 2D3GA 4KDLB 2EMSA 1MFWA 3BVMA 2JQRB 2WLBA 1V1OA 1SJHD 3W1SC 1T3QA 1OEYA 4BAXA 3RPFC 2GI9A 4AUQC 1FPYA 4H2AA 4MH8A 3BYTB 3W9CB 2L3ZA 1IP9A 5G55A 3LYYA 4S0RA 1YMHE 1XQQA 2AEHA 2DZMA 1PGBA 1FCLA 4BOSC 4X57B 2DAJA 4RFBA 4KSKC 1BXTA 2BYFA 5C2TB 2MP2B 2IGGA 2WXFA 2N9EB 4DXGA 5MPOA 4JGHB 1WWTA 1ROEA 2OJWA 2LJ5A 2V9HA 5DPRA 2MJ3A 2G9HD 3VAWA 4HROA 3HUIA 2CKHB 2I38A 5AEKB 1H8CA 1ET6A 2WS3B 1WI0A 1VZ8A 1HEZE 2BS2B 1VDVA 1UGJA 1C4PA 4JE3B 3VH4B 3AU5A 2M17A 1JW9D 2JRHA 5DPWA 3U52E 2PE6B 4K3CA 2C7HA 4OZCA 2NR2A 1L7YA 2DZIA 2REXA 3P4SB 1NI3A 2KC2A 2ZVNA 4MGKE 2CJOA 1UZXB 2XNAC 1I4PA 1WIAA 2KVRA 3UIOB 1RYJA 2LRWA 4DQOC 3M62B 2RSUA 4A90A 3QQ8B 4LCDE 2K3UA 5D7GA 2L8JA 3N9YC 2LASA 2NMQA 1JWSD 4MM3B 2KWUB 1FXTB 3V3XA 4J3OD 1I7HA 1R4MB 3SHQA 3Q8BA 1NENB 1QOBA 2CJNA 3NUHB 3AI5A 2NCNA 4XX5A 4HJGE 1F1HA 1ZW7A 3WA0A 1IGDA 3DQVA 2BQQA 3ML8A 3TEXA 1WYGA 2IO2B 3SDLC 4IWOA 2ASQA 3SEBA 5IAAC 3L4PA 4PYUA 4KZCA 1XLPA 3ETRA 3PZ7A 2FAZA 3WAMA 1N61A 3OWEB 1L6UA 1YJJA 3PRZA 2D5GA 4ARCA 2WWZA 1P0RA 2V3NA 3SFEB 2FCNA 1UWMA 3TSSA 3DHIC 3ML9A 2J7QB 3PRPB 4GMVA 2LFIA 1D3ZA 3QJZA 3ZNZB 1WX8A 1C76A 3AE5B 5AUKA 3MTNB 3RNAC 2KDEB 1N60A 2LVPA 2MLBA 1J7CA 2ZNVB 2BKRB 3AN1A 4OW0A 3ZXVA 2PMVA 2PIAA 4M0WA 2M19A 2N9LA 4MEMA 1EM7A 2CU3A 3R66C 2L0TA 3H7PA 2ZVOA 2D11A 1CZPA 3DBRI 2WXNA 3MC9A 1AYFA 3I63C 1WE7A 3JVZX 4DWFA 4RCOA 1GNUA 3CWIA 3KUZA 1CQVA 1V8CA 2HJ1A 3N20C 2WXGA 2LGDA 4YSXB 3LXFA 2JU6X 4NJ7A 1CJEA 4RH6A 1QOFA 1YQBA 2FNJB 2V4LA 2GOWA 4AQ7A 4Q2JA 5JHBA 4O1NA 2K22A 2G45B 3KUCB 2NTTA 2K8HA 1KTKA 3I3TB 3BVZA 1FCCC 4I6PA 3SU8X 2JXTA 4YT0B 2JZPA 2KX0A 2KQ7A 4KZ0A 2INDC 2E6XA 2RPVA 2Y5PA 2H89B 3IT6B 3I9V1 4KDIC 2FCSA 1E9MA 1HZ5A 1ZGUB 3APDA 1LGRA 1XEEA 1RLFA 4CO7A 2AX5A 3TL5A 3CSTA 1XCTL 5BYSA 5T8IA 2FBWB 2DYMA 4C7YA 3FILA 2CHWA 4IM3A 2KX3A 3PT2B 4FXCA 3RFZB 2LGXA 3BINA 3M3JA 3ZGZA 3ZKJC 3PLVA 5AZGA 1WJ6A 3Q3JA 2ACZB 3KLSX 2KDFB 4II2B 1WRDB 2KLCA 2N0SB 3P63A 2K8BA 1WMHB 1WJNA 1LQBA 3B2GA 2RPQA 3NZSA 1NYQA 2ZPYA 3LJ3A 4C56C 1VR9A 3NS1A 1TS3A 2WXOA 3ECIA 4E74A 2RR9A 5IKCM 3IFWB 1L4ZB 1WXSA 4A9AA 5EE9A 2QMTA 4NJ6A 2GBMA 1K8RB 3NVZA 1STEA 2L83A 3W1SA 4TUUA 2NBUA 3N32A 1P1AA 2WDRB 1R4MI 4JX1C 4B95A 3AE1B 1J0GA 3DCGA 2N9KA 3TEZA 2K5PA 4FBJB 2BVCA 4N9F4 1D4BA 4RMAA 3AECB 3AEFB 2ZCBA 1KJTA 1A70A 2YVCA 1WGHA 2D10A 1PGAA 2MBOA 5CHFA 5FKAC 1WR6E 4PS8A 2DENB 3ZW3A 3MHZA 4LDTB 4MJSB 1QF6A 4FULA 1WJUA 5HG2A 3PGEA 2V0GA 4J6IA 2KT7A 3BY4B 1JCKB 2MW5A 3ZTCA 1FRDA 2XK5B 3WAPA 1WM3A 3AMZA 5IP4D 2KJ6A 1B1ZA 3L13A 1K52A 2WXMA 2C5LC 5IN7A 1JROA 1SIFA 1YIWA 3A4SC 4FJVB 1XO3A 2K1FA 1P98A 2WU5B 1Y8RC 4AWJA 1WMHA 5TSSA 2IO0B 4B0EA 2WX1A 2DZKA 2KLGA 1SXTA 1XLQA 3ZVVA 4DDGD 3DOWA 2GBRA 4B9KA 2JRIB 3K9OB 1E7UA 3VUXA 2H88B 4K3BA 2OOBB 3KH0A 4MELA 4F7ZA 4ANUA 3T9LA 1LO5D 3P4RB 4LJOB 1ZXIA 1V1PB 2MJEA 4PYZA 3ZXRA 2C7NB 4DXFA 2JXXA 4GGQA 4GOCA 2KN4A 4LDTD 2LD9A 3W2DA 5LLIA 4HCNB 2JZ3B 3Q69A 1FFUA 1KRHA 2BWES 3IAS1 3RZFA 1PDXA 1ZXHA 4WJPA 3R2IA 4P16A 4HKZE 1C9FA 4EZLA 2W55A 3ONSA 4MJSA 3APCA 1ACCA 4WAFA 2KOXA 3CMMB 2ZCCA 5J18A 3V62A 5GXGB 1GOZA 4AP4C 3A1QB 2XK5A 2LHDA 4FJYA 1J7AA 1KH0A 2IJ0A 2KMAA 5IA7A 3NHEB 4C00A 1V6EA 4RGMA 1Q5WB 3TUOA 1FNUA 1WGRA 5LXHA 3VRBB 4BKSD 2FIFA 5H92C 2JYEA 1PFDA 3P1MA 4P1BC 3ZJUA 4FHKA 2WXKA 1V97A 1UNSA 1XLNA 3RI7C 4HPLB 1E7VA 4WQMA 3Q3MC 3VFKA 2I1JA 1XXGA 1UD7A 1FNVA 3P2BA 3PLUA 1KF6B 4A20A 2BT6A 3Q8AA 3AXCA 1KLVA 4LNIA 1J8CA 3HM6X 3GOEA 4BKGA 3AE4B 1OEYJ 1WH3A 1QOGA 3VUWA 4CYEA 4LNFA 4HPMB 2OJRA 2DX5B 3QK0A 4ANVA 1FXAA 3ZTDA 1ESFA 2IZVB 2CHXA 2M1MA 5FR3A 3PHWB 4WJOA 2K8CA 4MACA 3KWVA 4OHJA 3NVWA 1GUAB 5D3DA 2AL6A 2WX0A 2BPSA 4TV3A 4EE2A 4LNOA 3VUYA 1MJDA 2KQSA 1JALA 2KN5A 1IGCA 2RGFA 2KAJA 1WR1A 3VRAB 1ISNA 4ICVA 3ZUNA 1JWMD 3DDCB 3N30A 5H8YE 2WXPA 3BZDB 4K7SA 4XC2A 3DBLB 1OQYA 1SF0A 3A1QA 2M4NA 2KJHB 4REZA 3D32A 3S2AA 1ZKHA 4NQKE 1X1MA 2IBIB 1FD6A 1V80A 4ZRIA 2WXQA 1N5WA 1ZPSA 1TGZB 3H6NA 1WX9A 1HZ6A 1C4CA 4MT5A 4HEA1 2BKFA 3GB1A 2KD0A 1SE3A 4M00A 1IBXA 2B3AA 1FMAD 3H8HA 4BFRA 2LVQA 5LXIB 3NRZA 4HPPA 3ZDMC 3APFA 4GDLA 4M0WB 2INCC 4W9JA 3H7PB 1I4QA 4MDKE 3KUDB 3IT4B 2J53A 3EECA 3O13A 2Z0DB 4EUTA 4IKGA 3DPDA 1T0QC 3P4QB 3GE3C 2MBEA 2FCQA 2NBWB 2G4SA 1T0YA 1SE9A 2LJIA 2BYEA 3DBSA 3VVWB 3QX1A 5DPTA 3AEDB 2C7MB 2L76A 1WJ4A 3HIZA 4KVGB 2BB5A 2KZRA 3VR9B 2WDTB 4JL9A 1TKGA 4DBGA 3ZNHB 4L2YA 2KVZA 3ZRFA 4ZRKA 3V05A 3L10B 3EFUA 1CK1A 2A4ZA 2HE7A 2WU2B 3BWUD 1QILA 1T6BX 1GPXA 2J0KA 3JSVB 2BS3B 2D07B 2W3RA 1B9RA 1TTNA 4IM0A 4KGSA 3Q2AC 3Q14C 5HFYA 2LEKA 4ARIA 5E6NA 5DCNA 4XGAB 1XLOA 3AH7A 3IHPC 1U4AA 4HJKA 2RDGA 3FILB 5G5HA 5C3JB 1MHXA 2KWDA 4GXBA 1S3SG 1YQ3B 2KQ4X 4W9DA 4I6LB 1QLBB 1YOVB 3UQBA 1F9JA 2G3QB 2ZPNA 5EE1A 2MJDA 4II3B 1IYFA 1XCQL 4YWGG 4ZDVA 2M0AA 1RFAA 1JRUA 2AQ3B 3OG5A 2Z0EB 3TBLD 4N6EB 3PZDA 3B1LX 1R7SA 4ZRJA 4JPSA 4G11A 1NBFC 1WGKA 4C80A 2V3PA 2YLMA 2GBNA 1D5MC 5C23A 3WALA 3X23A 2MBHA 1UWXA 5CX3A 1RRBA 2EKIA 2JWUA 4NAMA 4L23A 4AOFA 2MEKA 3EHVA 2O2VB 1YX5B 1FNWA 3TCAA 3NY5A 3Q8EA 2PVGC 2DYBA 1T5XD 4IM2A 2KNBA 1WGDA 2JPHA 2YEPF 3GE8C 3Q3FA 3Q3NC 1P7EA 4G3XB 1OFFA 2ZW0A 4HCPB 3Q8FA 1V9JA 2KHWB 4TQ0A 2FUHB 5J17A 2B76B 3UI3A 3OAWA 3E9SA 2L7RA 2C9WB 2QSDA 5BMIA 2KK8A 2XEWA 3RULA 3ZLZA 4YXDB 1YX6B 3QCAA 2INNE 3RT3B 2IPKD 2ONQA 3B2FA 3L54A 2UYZB 5D94A 3DBLI 4G0NB 3ZNGC 3JSVA 1F77A 4MGZE 4C4VA 1MHHE 4MGYE 4WH4A 2BB6A 4PK1A 3TEWA 1UBIA 3C19A 4EEWA 2INPE 1SGHA 2CU1A 4F8CB 3PREA 1LM8B 2Z8LA 1TS2A 3RD2A 2KANA 5D2MB 3VH3B 4P7IA 3TEYA 4CQNA 2DYOA 2N4FA 2L52A 3JW0X 3LDZE 4NNJB 1E5WA 4WAAA 4UDUC 1E0ZA 4HDQA 3PZ8A 3R3MA 4E3CA 4KIKA 2KXJA 1SEBD 2Y5BB 3RUIB 4AS1A 4JWUC 4WQOB 2K9XA 2DNFA 1V2YA 2WGSA 2WXLA 4IOIE 4XZ4A 2WXJA 2PVOD 4W9IA 2BF8B 1UGMA 3Q6BA 4BZAA 3Q8CA 2LWPA 3DVNU 4MGIE 3DVGX 4FN2A 4EZKA 1SSNA 3KQ4A 1D5XC 4WWNA 5C1ZA 4WURA 2KFKA 5HHDG 5BO4B 2O2VA 1WGYA 2BYVE 1EF1A 2AYOB 2QC8A 1KLGD 1JWBD 1LFDA 2GLSA 1PQSA 4FADA 4DDID 3N1YC 3OJ4B 1KM7A 3IBEA 3TMPB 4PS3A 2R2OA 4W9GA 1YQ4B 2DZJA 2WDQB 2IO3B 1Y56A 3H9DA 3PVLA 2HTHA 1AARA 1N6ZA 4NPNA 1E8WA 1MVKA 2WP9B 3MHSD 1KLUD 5J2RA 2IGDA 2NTSA 1PYWD 2KWVB 4MH0E 2K0PA 5DPSA 1MG8A 2Y5CA 3C8YA 4E71A 4D2KA 2KJRA 3E56A 2W9NA 3B08A 4PS7A 4DHZE 4ACFA 2QDFA 1MG4A 1YJIA 5G2NA 1FFVA 2QIEB 3PS6A 2BGFA 3A4RA 1DGJA 4IWPA 4JWSC 3R8BA 2IO1B 3AE9B 4K7WA 1F2RI 3RCZA 3U7DA 3VTWA 3HK0A 3PSEB 4EFOA 3QC8B 2V4IB 3B0AA 3B9JA 1GB1A 1EU3A 1ET9A 4B0MA 1K50A 1E6EB 2RDHA 4XWTA 2I2YA 2ICIA 1Q10A 2VRRB 2L0FA 1AW7A 3T3NA 3WANA 2J52A 2J42A 2NBVB 2ZZPB 2MX2A 3NVYA 1WF9A 4W9CA 4US8A 2PJHA 3A33B 1QOAA 2CR5A 2KTRA 3ZJVA 4ITKA 1WXQA 2M8SA 3QWZB 1GG3A 1P9DU 2QILA 1K51A 4HDOA 2BTEA 4GU2A 4ZOHC 3RYTA 2TSSA 1WGGA 4FHJA 4ANWA 4NJCA 2AL3A 1J7BA 4NAWB 1XF5L 2PLPA 4JLCA 5L83A 1Q1OA 2Q5WD 2YEPB 2BW2A 4I6NB 1C78A 3NG0A 1NYRA 4GB9A 2UWQA 3R2TA 4OVZA 3HRDD 1YNTE 1V81A 3MC0B 4GDKA 3L17A 2D2QA 2LXCA 3HVDA 3ALBA 4ASWC 4IDIA 4LNNA 4EZJA 3J9CA 1Z5SB 1XT9B 1FIQA 2K6DB 2ON8A 3DVNV 1Q0WB 2IY1B 2XN9C 2ZW1A 5JXVA 4JQWC 2WQYB 4IG7B 3R7QA 1TKEA 1YD8U 3HVZA 2J0MA 1WXMA 3MJ5A 2PKOA 2RDBC 1I42A 2R61A 2KDMA 4F1SA 4S17A 2W82A 2QHOA 2IYDB 2N1WA 1E8ZA 1TS5A 3AV8A 4JIOU 1TT5B 1E90A 1V5OA 1DYQA 2G4DB 4URKA 3ZJTA 3FAHA 4HRSA 5E6JA 4A3OA 2CHZA 4YSZB 2W3SA 2L05A 2JSVX 3UQAA 1AN8A 1NI2A 1IBXB 2BYTA 3PTFC 2GBJA 2K25A 1GJZA 2IGHA 3AE3B 1WSPA 3AB5A 3IVFA 3UINB 4HXDA 1UBQA 2LUMA 3QA8A 2CS4A 2VH1A 3VXWA 2LRUA 3AE2B 4XDDA 1I4HA 4GDLB 4M01A 1I4RA 1PUTA 4HWIB 4WIPA 2JF5A 4TMAB 2PE9A 1TY2A 1WXVA 4XWWA 1FRRA 4WWOA 1WXAA 1QKZA 4ZYNA 2K39A 4FA6A 2D3CA 4NAWA 3AULA 4K81A 2A5UA 3SR6A 3DBRB 4FLHA 3H7SA 2QJLA 5TR5A 2BWFA 2O6VA 3MFGA 2OHFA 1I4XA 1L0YB 3DWGC 1RFKA 4KV2A 4N59A 5KHQA 4HVBA 2N9PC 1WYWB 1LXDA 4HK2A 5BYRA 3KYDD 1V86A 5AZFA 3RZWC 4GIVA 3RNBC 3RMKC 1JMLA 1FM0D 5IO9A 3MC8A 2X38A 3AEGB 4DXAB 5KHOA 1R4NB 2J4XA 3ZRCA 2JZZA 1ENFA 2VZKB 2AQ2B 1J19A 1EWYC 2BS4B 4CHKA 3PV1A 4A6QA 1BUIC 1F52A 2LI5A 1TY0A 2PPHA 2KWCA 5BMHA 1UUPA 4A8XC 4RF0A 3SD5A 1OQRA 3L0WB 2XBBC 3I5JC 1Z2MA 4YTMB 3WCQA 3VHTC 4QAYA 2N1VA 2DAFA 3KW5B 2V1YA 5EDSA 4US9A 1OQQA 2BBCA 2LMCA 1EO6A 1SE2A 1TS4A 4WJQA 3DHGC 4TSSA 3VTVA 4HKQA 2NVUI 3Q3OC 5BMGA 1TJEA 2IY0B 3GP7A 4RNAA 1YN5A 2Z59B 4EOYA 1ZDVA 2IDYA 2J0JA 3WAOA 3N3KB 3BYYB 2N7EA 1RM6C 1P7FA 3DHHC 3ZQ4A 3NZ3A 3EUB2 2MRPA 1VRAB 2MQJA 1GC7A 4OZAA 3GZNB 2N9XA 1EF5A 2MBQA 3U7ZA 1WFYA 2JYTA 3W5VB 4IC7B 2AWTA 2DHZA 3NOBA 3ZIMA 4USAA 2MA9B 2VZKD 4LLGM 3HHMA 2JX5A 5EE3A 3VDZA 4C4VB 2DBYA 2KFJA 2Y3AA 2MCNB 4L1BA 3KVFB 1UELA 3N1XC 2KTFA 3C0RB 3FKYA 4FJZA 2GMIC 2FCMA 1FO4A 1HTQA 3DWMA 3ZO5B 1SB3C 1MPEA 1TZOA 2EELA 1HA5A 1CMXB 4NQLB 5LNK1 4W9HA 1H4RA 4DHZB 5JHAA 3U30A 2EKEC 3T8MA 4EKUA 4KIKB 4BOZB 3AEBB 3UIPB 4LTUA 2KC1A 1ZOYB 3RNFC 2WXIA 1HXYD 5E6OA 4C7ZA 2MP2A 1D5ZC 1C1YB 3UGBB 4LNKA 4KGRA 4ICUA 1YJ1A 4N58A 2LVOA 3QARA 2KKCA 4P1CC 2KDIA 4RM8A 4KGTA 1K53A 2KFKB 3AE7B 1TIFA 3M95A 1WX7A 4W9LA 4XDCA 2LGIA 2D3AA 1UH6A 5CHWA 2FE8A 2AQ1B 5G5GA 2FIDA 4M8MA 2JUOA 2KMCA 3CSFA 1SIJA 3QHTA 1JQ4A 4NY0A 3EFCA 2SAKA 3QAQA 2OEDA 1L5PA 2E3TA 3TIXA 3RNGC 1E8XA 4GN1A 3P4PB 1VZ7A 3L16A 1MI0A 3V6CB 3W1YA 3NS8A 4MM3A 3VQIA 3A9JB 4RF1A 4G50A 1L6VA 3R7RA 2NS5A 1VZ6A 4KKJA 3N1ZC 3ZYYX 4RGTA 1V5TA 1I4GA 2UU7A 1EU4A 2L32A 1VLBA 1L4DB 5AUIA 1QQRA 3AU4A 3PRMB 1R4NI 3V6EB 1FEHA 5JZEB 1TBEA 2EMTA 4ZHOA 1SE4A 1WM2A 1XD3B 1D6EC 3T3OA 1ZE3D 3DBHB 1OGWA 3HM3A 4A55A 5AZHA 2RD0A 2ZEQA 4TKNA 3NZUA 3L08A 3JYUA 2WXHA 4A3PA 1DOYA 4WJNA 2M0XA 1VD2A 3PO0A 5GMVA 1DOIA 2JVCA 5CHVC 2PTLA 1L0VB 4W9FA 3O65B 1WZ0A 2MH7A 1JWAD 4RGNA 2LUEA 4ANXA 4ZHPA 1C3TA 1ZP0B 2FUG1 4K7UA 1GAQB 2KTRB 1TZ1A 3ZDTA 2M56B 2HJ8A 1JWUD 2L00B 3AEEB 1N62A 1M4VA 3ABVB 1BMLC 3TJPA 3V61A 2I1KA 4IUMB 2JY6A 5IOIA 2NPTB 1ZUD2 2KO3A 3GZNI 2RMMA 2LZ6A 4AJWA 3M63B 4GDKB 3A9JA 4RGOS 2MSED 1KFYB 2LGSA 4DHJB 1SJED 4P6VF 1KOTA 3AE8B 1RWSA 2N7DA 1WY8A 5FK9C 4BVUC 3RNEC 3GS2A 3DVGY 5BYQA 1SBBB 3FC4A 1HQRD 4K1RB 1TYGB 3AE6B 1L0XB 1VCBA 2GBKA 3KYCD 1HTOA 5HI1A 1T0RC 2HD5B 4YTNB 1WE6A 3I57A 1JRPA 2C60A 3RN9C 4RM9A 3ZNID 4BBNF 2G1EA 4HLEA 2JT4B 3BIID 4BKTA 5D6JB 1TKYA 3RNCC 1S1QB 4W9KA 4AJYB 1AWDA 1L2NA 3AEAB 5L95C 2MWSB 1NEKB 1UF0A 1C77A 3ENEA 1V49A 3CF6E 1VJKA 4OVVA 1M94A 5EE0A 5D3IB 4M02A 2QEJC 4W9EA 2KDBA 5CTRC 3PPAA 4YL8A 1C79A 2R2QA 2MBBB 1GC6A 2MHJA 2LXAA 3BK1A 3IAM1 3NJTA 2GRIA 3NVVA 4BBNC 3A9KB 1E10A 2N7JA 3CIRB 3UF8A 4DHJD 4YSYB 3BK2A 1DOXA 2NPTA 3MP9A 3EGRA 2O6VB 3BVGA 4NZLB 4M8NA 3H1UA 1P3QU 4XE0A 1QT9A 3VR8B 1I35A 2KACA 1IPGA 2GB1A 4GLSC 4B6WA 2K6QA 4KKIA 1WZ3A 1F0ZA 2L1AA 3EC8A 5FR6A 1GB4A 2SEBD 1YN4A 3V60A 3IG3A 3QIJA 1G6JA 4ZRPA 4OZBA 3SFDB 3X0WA 2DWQA 1EWCA 2QCZA 3DBHI 3OLMD 4KX6B 1C4AA 1HE8A 2KYWA 3IXSA 2WXRA 3AM9A 1PGXA
chains in the Genus database with same CATH topology
1WR6E 2JWZA 4PS8A 4IM2A 2KNBA 1EO6A 1WGDA 2JPHA 2DENB 3ZW3A 4LDTB 3Q3FA 4MJSB 4WJQA 4FULA 3WIMA 1WJUA 4G3XB 3U8ZA 4HCPB 3VTVA 3PGEA 4J6IA 1V9JA 2KHWB 2NVUI 3BY4B 4TQ0A 2IY0B 2MW5A 3ZTCA 2FUHB 1E8YA 5J17A 2XK5B 1QZEA 2Z59B 4EOYA 3OAWA 2L7RA 3WAPA 2C9WB 2J0JA 3MJWA 1WM3A 2KK8A 2XEWA 3N3KB 3RULA 2KJ6A 3WAOA 3ZLZA 1YX6B 3QCAA 2N7EA 3RT3B 5HKHA 3L13A 3VTUA 4IW0A 2MRPA 3L54A 4BKSA 2UYZB 2MQJA 1BT0A 3DBLI 4G0NB 4WWPA 1GC7A 2C5LC 2LGYA 3JSVA 5D94A 4MGZE 3ZNGC 2N9XA 1SIFA 2O6VD 3OJ3A 3K9PB 1YIWA 3A4SC 4FJVB 4MGYE 4OVUA 1EF5A 2MBQA 1UBIA 3PHXB 2K1FA 1NDDA 1WFYA 4EEWA 1P98A 2V3SA 1SGHA 1Y8RC 2CU1A 1WMHA 4LJPB 4AWJA 4F8CB 4IC7B 2AWTA 2DHZA 3A9KA 3PREA 1LM8B 3NOBA 3ZIMA 1EUVB 4GSWA 4MSMB 2IO0B 2MA9B 4KSLC 3RD2A 3HHMA 2PEAA 2KANA 2WX1A 5D2MB 2DZKA 2KLGA 4P7IA 3VH3B 2DYOA 3VDZA 2N4FA 2KFJA 3JW0X 3LDZE 2MCNB 4NNJB 3ZVVA 1E5WA 3KVFB 1UELA 4WAAA 5JH5C 4TQ1A 4DDGD 3DOWA 2GBRA 2KTFA 3C0RB 4HDQA 4FJZA 2GMIC 4DK5A 3R3MA 4B9KA 2JRIB 4IWQA 3K9OB 2FCMA 4E3CA 4KIKA 2KXJA 1E7UA 3VUXA 2Y5BB 3RUIB 2ZJDA 4WQOB 1OTRB 2ZNVC 2OOBB 3KH0A 4MELA 1V2YA 4F7ZA 4ANUA 3ZO5B 3T9LA 4XZ4A 5E6PA 1A5RA 1CMXB 4MSQB 4LJOB 4W9IA 2BF8B 1RAXA 4NQLB 1UGMA 2WYQA 4W9HA 4PYZA 1H4RA 2LWPA 2C7NB 3DVNU 4MGIE 4DHZB 3DVGX 5JHAA 2D3GA 2JXXA 4GGQA 4GOCA 4FN2A 3U30A 2EKEC 3T8MA 4KDLB 4EZKA 2EMSA 4EKUA 4KIKB 4LDTD 2LD9A 4BOZB 4WWNA 3UIPB 5LLIA 3W1SC 5C1ZA 4HCNB 1OEYA 2KFKA 2JZ3B 2BWES 2KC1A 5BO4B 2O2VA 1WGYA 5E6OA 4AUQC 2BYVE 3RZFA 1EF1A 2AYOB 2MP2A 4WJPA 1C1YB 3UGBB 2L3ZA 4ICUA 1YJ1A 4EZLA 1LFDA 1IP9A 2LVOA 3QARA 3ONSA 5G55A 1PQSA 4FADA 4MJSA 3APCA 2KKCA 4DDID 1XQQA 2KDIA 2KOXA 3OJ4B 1KM7A 2AEHA 2DZMA 3IBEA 3CMMB 4RM8A 3TMPB 4X57B 2KFKB 4BOSC 2ZCCA 3M95A 3V62A 5J18A 1WX7A 2DAJA 4PS3A 4W9LA 2R2OA 4KSKC 4W9GA 2DZJA 4AP4C 2BYFA 3A1QB 2XK5A 1UH6A 4FJYA 5CHWA 2IO3B 2MP2B 2FIDA 2KMAA 5IA7A 4M8MA 2JUOA 2N9EB 3NHEB 1V6EA 3H9DA 1Q5WB 2KMCA 3CSFA 3PVLA 3QHTA 3KW5B 1WGRA 2HTHA 4JGHB 1AARA 5LXHA 4NY0A 4NPNA 2LJ5A 3QAQA 1E8WA 5DPRA 4BKSD 3VAWA 3MHSD 2FIFA 3TIXA 2CKHB 5AEKB 5J2RA 1H8CA 1E8XA 1WI0A 4GN1A 4FHKA 3L16A 2KWVB 4MH0E 5DPSA 1MG8A 3V6CB 3W1YA 3NS8A 4MM3A 3VH4B 3VQIA 3A9JB 1E7VA 3AU5A 4HPLB 2M17A 4E71A 3VFKA 2I1JA 2JRHA 2KJRA 4G50A 2W9NA 3R7RA 5DPWA 1UD7A 2PE6B 2NS5A 3B08A 2C7HA 4PS7A 4DHZE 2NR2A 1L7YA 2DZIA 2REXA 3PLUA 3P2BA 2KC2A 2ZVNA 1V5TA 4MGKE 1UZXB 5G2NA 1WIAA 2KVRA 3UIOB 4A20A 3PS6A 2BGFA 2LRWA 3A4RA 3AXCA 4IWPA 1KLVA 3M62B 2RSUA 3QQ8B 1J8CA 3HM6X 3VTWA 2IO1B 4LCDE 3GOEA 5D7GA 2L8JA 2LASA 4K7WA 4BKGA 3RCZA 1OEYJ 2KWUB 3AU4A 1FXTB 3HK0A 3PRMB 1R4NI 3PSEB 3U7DA 3V6EB 4EFOA 5JZEB 1WH3A 3QC8B 1TBEA 3SHQA 2EMTA 3B0AA 3VUWA 4CYEA 1WM2A 1XD3B 4HPMB 2OJRA 2DX5B 3AI5A 3QK0A 2NCNA 1OGWA 4XX5A 3HM3A 4ANVA 2VRRB 2L0FA 5AZHA 2RD0A 3WANA 2ZEQA 4TKNA 3NZUA 3L08A 1ZW7A 3JYUA 3ZTDA 2NBVB 3WA0A 2ZZPB 4A3PA 3DQVA 2IZVB 4WJNA 2M0XA 2MX2A 2CHXA 2M1MA 1WF9A 3ML8A 4W9CA 1VD2A 3PHWB 2PJHA 4WJOA 2K8CA 3A33B 2IO2B 3SDLC 5GMVA 4IWOA 2CR5A 2KTRA 1GUAB 2ASQA 2M8SA 3QWZB 2JVCA 2AL6A 1GG3A 1P9DU 5IAAC 5CHVC 2WX0A 4HDOA 4PYUA 4KZCA 4GU2A 2BPSA 4TV3A 4W9FA 3VUYA 3RYTA 1WGGA 3O65B 1WZ0A 4FHJA 4ANWA 2KQSA 2FAZA 3WAMA 2AL3A 2KN5A 4NAWB 2RGFA 1WR1A 2LUEA 4ANXA 1ISNA 1C3TA 4JLCA 4ICVA 3ZUNA 5L83A 1Q1OA 3DDCB 3N30A 3PRZA 4K7UA 2KTRB 1TZ1A 3ZDTA 2WWZA 4K7SA 1P0RA 4XC2A 4I6NB 2FCNA 4GB9A 2HJ8A 1OQYA 2UWQA 3A1QA 2M4NA 1V81A 2L00B 4GDKA 3L17A 2D2QA 2LXCA 3ML9A 2KJHB 2J7QB 3ALBA 4ASWC 3PRPB 4GMVA 3D32A 3S2AA 1ZKHA 4EZJA 1Z5SB 4NQKE 1XT9B 3QJZA 1D3ZA 1X1MA 2IBIB 2K6DB 1V80A 4ZRIA 3TJPA 3V61A 3ZNZB 2I1KA 3DVNV 4IUMB 1WX8A 1Q0WB 2IY1B 2JY6A 1TGZB 2NPTB 3MTNB 4JQWC 2KO3A 3H6NA 1WX9A 3GZNI 2KDEB 4IG7B 3R7QA 2LZ6A 2LVPA 4AJWA 2MLBA 3M63B 2ZNVB 2BKRB 2BKFA 4GDKB 3A9JA 1YD8U 2J0MA 1WXMA 2MSED 2KD0A 4MEMA 3R66C 2L0TA 3H7PA 2ZVOA 1I42A 4DHJB 2D11A 3DBRI 2B3AA 1KOTA 4F1SA 2QHOA 2IYDB 2N1WA 2N7DA 4BFRA 1E8ZA 1WY8A 4BVUC 2LVQA 5LXIB 4JIOU 1WE7A 3JVZX 4DWFA 1E90A 1V5OA 2G4DB 3DVGY 4URKA 1GNUA 3ZDMC 3APFA 4A3OA 3KUZA 4GDLA 2CHZA 4K1RB 4M0WB 2L05A 4W9JA 3H7PB 3UQAA 1NI2A 4MDKE 3PTFC 3KUDB 2LGDA 1VCBA 2GBKA 2GBJA 3KYCD 3EECA 2K25A 1GJZA 4NJ7A 2Z0DB 4EUTA 3IVFA 3UINB 3DPDA 1YQBA 2FNJB 4HXDA 1UBQA 3QA8A 2CS4A 2HD5B 2V4LA 3VXWA 1WE6A 2GOWA 2C60A 2LRUA 5JHBA 2MBEA 2FCQA 2NBWB 2G45B 2G4SA 1T0YA 3KUCB 4GDLB 4RM9A 1SE9A 2BYEA 3DBSA 2K8HA 3ZNID 4BBNF 4HLEA 3VVWB 2JT4B 3QX1A 5DPTA 3I3TB 2C7MB 4HWIB 4BKTA 4I6PA 2L76A 1WJ4A 2JF5A 3HIZA 4KVGB 3SU8X 5D6JB 1S1QB 2KZRA 2KX0A 2KQ7A 4KZ0A 4W9KA 2WDTB 4AJYB 2PE9A 4JL9A 1WXVA 1L2NA 4WWOA 5L95C 4DBGA 4KDIC 3ZNHB 2FCSA 1WXAA 2MWSB 1ZGUB 3APDA 3ZRFA 4ZYNA 1RLFA 4CO7A 3TL5A 2K39A 3CSTA 4ZRKA 4FA6A 4NAWA 3AULA 3L10B 3EFUA 3ENEA 1V49A 2DYMA 3CF6E 4K81A 1M94A 4OVVA 2A4ZA 2CHWA 2HE7A 2A5UA 2KX3A 4IM3A 3PT2B 4FLHA 2LGXA 3H7SA 4W9EA 3BINA 2KDBA 3M3JA 3ZKJC 3PLVA 5AZGA 2J0KA 5CTRC 5TR5A 3JSVB 2BWFA 3PPAA 1WJ6A 4YL8A 2O6VA 2R2QA 3Q3JA 2D07B 2MBBB 1GC6A 2LXAA 2KDFB 1TTNA 4II2B 1WRDB 2KLCA 4IM0A 5E6NA 5DCNA 4BBNC 2K8BA 1WMHB 3IHPC 4KV2A 1U4AA 1WJNA 3A9KB 4HJKA 1LQBA 5KHQA 3UF8A 4DHJD 4HVBA 2N9PC 1WYWB 1LXDA 4HK2A 2RPQA 2NPTA 4GXBA 3KYDD 1V86A 1S3SG 3NZSA 4W9DA 5AZFA 2ZPYA 3LJ3A 4I6LB 2O6VB 3RZWC 4GIVA 4M8NA 3UQBA 3H1UA 1F9JA 2G3QB 2ZPNA 1P3QU 3ECIA 4E74A 2RR9A 4DXAB 5KHOA 3IFWB 4II3B 1IYFA 1I35A 1WXSA 3ZRCA 1IPGA 2JZZA 4ZDVA 1RFAA 4NJ6A 1J19A 2GBMA 4B6WA 4CHKA 2K6QA 1JRUA 3PV1A 1K8RB 2Z0EB 1WZ3A 3TBLD 3EC8A 3PZDA 5FR6A 3W1SA 3B1LX 2LI5A 4ZRJA 2PPHA 2KWCA 4G11A 4TUUA 3V60A 2NBUA 1NBFC 3IG3A 3N32A 1P1AA 2YLMA 1R4MI 2GBNA 3QIJA 4B95A 1G6JA 3SD5A 1J0GA 3DCGA 3L0WB 5C23A 3WALA 3X23A 2MBHA 4FBJB 3X0WA 5CX3A 1RRBA 2XBBC 4N9F4 4RMAA 3DBHI 3OLMD 2ZCBA 1Z2MA 4AOFA 1KJTA 1HE8A 3EHVA 3VHTC 2YVCA 1WGHA 2O2VB 1YX5B 2D10A 2MBOA 2N1VA 3TCAA 3NY5A 2DAFA 2DYBA 2V1YA 5CHFA 5EDSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WR6 E;  2JWZ A;  4PS8 A;  4IM2 A;  2KNB A;  1EO6 A;  1WGD A;  2JPH A;  2DEN B;  3ZW3 A;  4LDT B;  3Q3F A;  4MJS B;  4WJQ A;  4FUL A;  3WIM A;  1WJU A;  4G3X B;  3U8Z A;  4HCP B;  3VTV A;  3PGE A;  4J6I A;  1V9J A;  2KHW B;  2NVU I;  3BY4 B;  4TQ0 A;  2IY0 B;  2MW5 A;  3ZTC A;  2FUH B;  1E8Y A;  5J17 A;  2XK5 B;  1QZE A;  2Z59 B;  4EOY A;  3OAW A;  2L7R A;  3WAP A;  2C9W B;  2J0J A;  3MJW A;  1WM3 A;  2KK8 A;  2XEW A;  3N3K B;  3RUL A;  2KJ6 A;  3WAO A;  3ZLZ A;  1YX6 B;  3QCA A;  2N7E A;  3RT3 B;  5HKH A;  3L13 A;  3VTU A;  4IW0 A;  2MRP A;  3L54 A;  4BKS A;  2UYZ B;  2MQJ A;  1BT0 A;  3DBL I;  4G0N B;  4WWP A;  1GC7 A;  2C5L C;  2LGY A;  3JSV A;  5D94 A;  4MGZ E;  3ZNG C;  2N9X A;  1SIF A;  2O6V D;  3OJ3 A;  3K9P B;  1YIW A;  3A4S C;  4FJV B;  4MGY E;  4OVU A;  1EF5 A;  2MBQ A;  1UBI A;  3PHX B;  2K1F A;  1NDD A;  1WFY A;  4EEW A;  1P98 A;  2V3S A;  1SGH A;  1Y8R C;  2CU1 A;  1WMH A;  4LJP B;  4AWJ A;  4F8C B;  4IC7 B;  2AWT A;  2DHZ A;  3A9K A;  3PRE A;  1LM8 B;  3NOB A;  3ZIM A;  1EUV B;  4GSW A;  4MSM B;  2IO0 B;  2MA9 B;  4KSL C;  3RD2 A;  3HHM A;  2PEA A;  2KAN A;  2WX1 A;  5D2M B;  2DZK A;  2KLG A;  4P7I A;  3VH3 B;  2DYO A;  3VDZ A;  2N4F A;  2KFJ A;  3JW0 X;  3LDZ E;  2MCN B;  4NNJ B;  3ZVV A;  1E5W A;  3KVF B;  1UEL A;  4WAA A;  5JH5 C;  4TQ1 A;  4DDG D;  3DOW A;  2GBR A;  2KTF A;  3C0R B;  4HDQ A;  4FJZ A;  2GMI C;  4DK5 A;  3R3M A;  4B9K A;  2JRI B;  4IWQ A;  3K9O B;  2FCM A;  4E3C A;  4KIK A;  2KXJ A;  1E7U A;  3VUX A;  2Y5B B;  3RUI B;  2ZJD A;  4WQO B;  1OTR B;  2ZNV C;  2OOB B;  3KH0 A;  4MEL A;  1V2Y A;  4F7Z A;  4ANU A;  3ZO5 B;  3T9L A;  4XZ4 A;  5E6P A;  1A5R A;  1CMX B;  4MSQ B;  4LJO B;  4W9I A;  2BF8 B;  1RAX A;  4NQL B;  1UGM A;  2WYQ A;  4W9H A;  4PYZ A;  1H4R A;  2LWP A;  2C7N B;  3DVN U;  4MGI E;  4DHZ B;  3DVG X;  5JHA A;  2D3G A;  2JXX A;  4GGQ A;  4GOC A;  4FN2 A;  3U30 A;  2EKE C;  3T8M A;  4KDL B;  4EZK A;  2EMS A;  4EKU A;  4KIK B;  4LDT D;  2LD9 A;  4BOZ B;  4WWN A;  3UIP B;  5LLI A;  3W1S C;  5C1Z A;  4HCN B;  1OEY A;  2KFK A;  2JZ3 B;  2BWE S;  2KC1 A;  5BO4 B;  2O2V A;  1WGY A;  5E6O A;  4AUQ C;  2BYV E;  3RZF A;  1EF1 A;  2AYO B;  2MP2 A;  4WJP A;  1C1Y B;  3UGB B;  2L3Z A;  4ICU A;  1YJ1 A;  4EZL A;  1LFD A;  1IP9 A;  2LVO A;  3QAR A;  3ONS A;  5G55 A;  1PQS A;  4FAD A;  4MJS A;  3APC A;  2KKC A;  4DDI D;  1XQQ A;  2KDI A;  2KOX A;  3OJ4 B;  1KM7 A;  2AEH A;  2DZM A;  3IBE A;  3CMM B;  4RM8 A;  3TMP B;  4X57 B;  2KFK B;  4BOS C;  2ZCC A;  3M95 A;  3V62 A;  5J18 A;  1WX7 A;  2DAJ A;  4PS3 A;  4W9L A;  2R2O A;  4KSK C;  4W9G A;  2DZJ A;  4AP4 C;  2BYF A;  3A1Q B;  2XK5 A;  1UH6 A;  4FJY A;  5CHW A;  2IO3 B;  2MP2 B;  2FID A;  2KMA A;  5IA7 A;  4M8M A;  2JUO A;  2N9E B;  3NHE B;  1V6E A;  3H9D A;  1Q5W B;  2KMC A;  3CSF A;  3PVL A;  3QHT A;  3KW5 B;  1WGR A;  2HTH A;  4JGH B;  1AAR A;  5LXH A;  4NY0 A;  4NPN A;  2LJ5 A;  3QAQ A;  1E8W A;  5DPR A;  4BKS D;  3VAW A;  3MHS D;  2FIF A;  3TIX A;  2CKH B;  5AEK B;  5J2R A;  1H8C A;  1E8X A;  1WI0 A;  4GN1 A;  4FHK A;  3L16 A;  2KWV B;  4MH0 E;  5DPS A;  1MG8 A;  3V6C B;  3W1Y A;  3NS8 A;  4MM3 A;  3VH4 B;  3VQI A;  3A9J B;  1E7V A;  3AU5 A;  4HPL B;  2M17 A;  4E71 A;  3VFK A;  2I1J A;  2JRH A;  2KJR A;  4G50 A;  2W9N A;  3R7R A;  5DPW A;  1UD7 A;  2PE6 B;  2NS5 A;  3B08 A;  2C7H A;  4PS7 A;  4DHZ E;  2NR2 A;  1L7Y A;  2DZI A;  2REX A;  3PLU A;  3P2B A;  2KC2 A;  2ZVN A;  1V5T A;  4MGK E;  1UZX B;  5G2N A;  1WIA A;  2KVR A;  3UIO B;  4A20 A;  3PS6 A;  2BGF A;  2LRW A;  3A4R A;  3AXC A;  4IWP A;  1KLV A;  3M62 B;  2RSU A;  3QQ8 B;  1J8C A;  3HM6 X;  3VTW A;  2IO1 B;  4LCD E;  3GOE A;  5D7G A;  2L8J A;  2LAS A;  4K7W A;  4BKG A;  3RCZ A;  1OEY J;  2KWU B;  3AU4 A;  1FXT B;  3HK0 A;  3PRM B;  1R4N I;  3PSE B;  3U7D A;  3V6E B;  4EFO A;  5JZE B;  1WH3 A;  3QC8 B;  1TBE A;  3SHQ A;  2EMT A;  3B0A A;  3VUW A;  4CYE A;  1WM2 A;  1XD3 B;  4HPM B;  2OJR A;  2DX5 B;  3AI5 A;  3QK0 A;  2NCN A;  1OGW A;  4XX5 A;  3HM3 A;  4ANV A;  2VRR B;  2L0F A;  5AZH A;  2RD0 A;  3WAN A;  2ZEQ A;  4TKN A;  3NZU A;  3L08 A;  1ZW7 A;  3JYU A;  3ZTD A;  2NBV B;  3WA0 A;  2ZZP B;  4A3P A;  3DQV A;  2IZV B;  4WJN A;  2M0X A;  2MX2 A;  2CHX A;  2M1M A;  1WF9 A;  3ML8 A;  4W9C A;  1VD2 A;  3PHW B;  2PJH A;  4WJO A;  2K8C A;  3A33 B;  2IO2 B;  3SDL C;  5GMV A;  4IWO A;  2CR5 A;  2KTR A;  1GUA B;  2ASQ A;  2M8S A;  3QWZ B;  2JVC A;  2AL6 A;  1GG3 A;  1P9D U;  5IAA C;  5CHV C;  2WX0 A;  4HDO A;  4PYU A;  4KZC A;  4GU2 A;  2BPS A;  4TV3 A;  4W9F A;  3VUY A;  3RYT A;  1WGG A;  3O65 B;  1WZ0 A;  4FHJ A;  4ANW A;  2KQS A;  2FAZ A;  3WAM A;  2AL3 A;  2KN5 A;  4NAW B;  2RGF A;  1WR1 A;  2LUE A;  4ANX A;  1ISN A;  1C3T A;  4JLC A;  4ICV A;  3ZUN A;  5L83 A;  1Q1O A;  3DDC B;  3N30 A;  3PRZ A;  4K7U A;  2KTR B;  1TZ1 A;  3ZDT A;  2WWZ A;  4K7S A;  1P0R A;  4XC2 A;  4I6N B;  2FCN A;  4GB9 A;  2HJ8 A;  1OQY A;  2UWQ A;  3A1Q A;  2M4N A;  1V81 A;  2L00 B;  4GDK A;  3L17 A;  2D2Q A;  2LXC A;  3ML9 A;  2KJH B;  2J7Q B;  3ALB A;  4ASW C;  3PRP B;  4GMV A;  3D32 A;  3S2A A;  1ZKH A;  4EZJ A;  1Z5S B;  4NQK E;  1XT9 B;  3QJZ A;  1D3Z A;  1X1M A;  2IBI B;  2K6D B;  1V80 A;  4ZRI A;  3TJP A;  3V61 A;  3ZNZ B;  2I1K A;  3DVN V;  4IUM B;  1WX8 A;  1Q0W B;  2IY1 B;  2JY6 A;  1TGZ B;  2NPT B;  3MTN B;  4JQW C;  2KO3 A;  3H6N A;  1WX9 A;  3GZN I;  2KDE B;  4IG7 B;  3R7Q A;  2LZ6 A;  2LVP A;  4AJW A;  2MLB A;  3M63 B;  2ZNV B;  2BKR B;  2BKF A;  4GDK B;  3A9J A;  1YD8 U;  2J0M A;  1WXM A;  2MSE D;  2KD0 A;  4MEM A;  3R66 C;  2L0T A;  3H7P A;  2ZVO A;  1I42 A;  4DHJ B;  2D11 A;  3DBR I;  2B3A A;  1KOT A;  4F1S A;  2QHO A;  2IYD B;  2N1W A;  2N7D A;  4BFR A;  1E8Z A;  1WY8 A;  4BVU C;  2LVQ A;  5LXI B;  4JIO U;  1WE7 A;  3JVZ X;  4DWF A;  1E90 A;  1V5O A;  2G4D B;  3DVG Y;  4URK A;  1GNU A;  3ZDM C;  3APF A;  4A3O A;  3KUZ A;  4GDL A;  2CHZ A;  4K1R B;  4M0W B;  2L05 A;  4W9J A;  3H7P B;  3UQA A;  1NI2 A;  4MDK E;  3PTF C;  3KUD B;  2LGD A;  1VCB A;  2GBK A;  2GBJ A;  3KYC D;  3EEC A;  2K25 A;  1GJZ A;  4NJ7 A;  2Z0D B;  4EUT A;  3IVF A;  3UIN B;  3DPD A;  1YQB A;  2FNJ B;  4HXD A;  1UBQ A;  3QA8 A;  2CS4 A;  2HD5 B;  2V4L A;  3VXW A;  1WE6 A;  2GOW A;  2C60 A;  2LRU A;  5JHB A;  2MBE A;  2FCQ A;  2NBW B;  2G45 B;  2G4S A;  1T0Y A;  3KUC B;  4GDL B;  4RM9 A;  1SE9 A;  2BYE A;  3DBS A;  2K8H A;  3ZNI D;  4BBN F;  4HLE A;  3VVW B;  2JT4 B;  3QX1 A;  5DPT A;  3I3T B;  2C7M B;  4HWI B;  4BKT A;  4I6P A;  2L76 A;  1WJ4 A;  2JF5 A;  3HIZ A;  4KVG B;  3SU8 X;  5D6J B;  1S1Q B;  2KZR A;  2KX0 A;  2KQ7 A;  4KZ0 A;  4W9K A;  2WDT B;  4AJY B;  2PE9 A;  4JL9 A;  1WXV A;  1L2N A;  4WWO A;  5L95 C;  4DBG A;  4KDI C;  3ZNH B;  2FCS A;  1WXA A;  2MWS B;  1ZGU B;  3APD A;  3ZRF A;  4ZYN A;  1RLF A;  4CO7 A;  3TL5 A;  2K39 A;  3CST A;  4ZRK A;  4FA6 A;  4NAW A;  3AUL A;  3L10 B;  3EFU A;  3ENE A;  1V49 A;  2DYM A;  3CF6 E;  4K81 A;  1M94 A;  4OVV A;  2A4Z A;  2CHW A;  2HE7 A;  2A5U A;  2KX3 A;  4IM3 A;  3PT2 B;  4FLH A;  2LGX A;  3H7S A;  4W9E A;  3BIN A;  2KDB A;  3M3J A;  3ZKJ C;  3PLV A;  5AZG A;  2J0K A;  5CTR C;  5TR5 A;  3JSV B;  2BWF A;  3PPA A;  1WJ6 A;  4YL8 A;  2O6V A;  2R2Q A;  3Q3J A;  2D07 B;  2MBB B;  1GC6 A;  2LXA A;  2KDF B;  1TTN A;  4II2 B;  1WRD B;  2KLC A;  4IM0 A;  5E6N A;  5DCN A;  4BBN C;  2K8B A;  1WMH B;  3IHP C;  4KV2 A;  1U4A A;  1WJN A;  3A9K B;  4HJK A;  1LQB A;  5KHQ A;  3UF8 A;  4DHJ D;  4HVB A;  2N9P C;  1WYW B;  1LXD A;  4HK2 A;  2RPQ A;  2NPT A;  4GXB A;  3KYD D;  1V86 A;  1S3S G;  3NZS A;  4W9D A;  5AZF A;  2ZPY A;  3LJ3 A;  4I6L B;  2O6V B;  3RZW C;  4GIV A;  4M8N A;  3UQB A;  3H1U A;  1F9J A;  2G3Q B;  2ZPN A;  1P3Q U;  3ECI A;  4E74 A;  2RR9 A;  4DXA B;  5KHO A;  3IFW B;  4II3 B;  1IYF A;  1I35 A;  1WXS A;  3ZRC A;  1IPG A;  2JZZ A;  4ZDV A;  1RFA A;  4NJ6 A;  1J19 A;  2GBM A;  4B6W A;  4CHK A;  2K6Q A;  1JRU A;  3PV1 A;  1K8R B;  2Z0E B;  1WZ3 A;  3TBL D;  3EC8 A;  3PZD A;  5FR6 A;  3W1S A;  3B1L X;  2LI5 A;  4ZRJ A;  2PPH A;  2KWC A;  4G11 A;  4TUU A;  3V60 A;  2NBU A;  1NBF C;  3IG3 A;  3N32 A;  1P1A A;  2YLM A;  1R4M I;  2GBN A;  3QIJ A;  4B95 A;  1G6J A;  3SD5 A;  1J0G A;  3DCG A;  3L0W B;  5C23 A;  3WAL A;  3X23 A;  2MBH A;  4FBJ B;  3X0W A;  5CX3 A;  1RRB A;  2XBB C;  4N9F 4;  4RMA A;  3DBH I;  3OLM D;  2ZCB A;  1Z2M A;  4AOF A;  1KJT A;  1HE8 A;  3EHV A;  3VHT C;  2YVC A;  1WGH A;  2O2V B;  1YX5 B;  2D10 A;  2MBO A;  2N1V A;  3TCA A;  3NY5 A;  2DAF A;  2DYB A;  2V1Y A;  5CHF A;  5EDS A; 
#chains in the Genus database with same CATH topology
 2JWZ A;  2X8X X;  3EA6 A;  4ZYS A;  3U4E G;  3WIM A;  3U8Z A;  2W54 A;  5I4D A;  2HTM E;  1NVI D;  2D3B A;  1N63 A;  1WRI A;  1E8Y A;  4YTP B;  4R3D A;  1QZE A;  2PW9 A;  1FXI A;  4LK0 M;  3P42 A;  3MJW A;  2LHE A;  1IUE A;  3URY A;  1N5X A;  5HKH A;  3VTU A;  4IW0 A;  4BKS A;  1BT0 A;  4WWP A;  2LGY A;  2O6V D;  3OJ3 A;  3K9P B;  4OVU A;  3PHX B;  1NDD A;  1T0S C;  2V3S A;  4LJP B;  3A9K A;  2VH2 A;  1EUV B;  3KWL A;  4GSW A;  4MSM B;  4KSL C;  2PEA A;  2WDV B;  2DLB A;  1F2R C;  3U2S C;  4WWM A;  5JH5 C;  4TQ1 A;  4PT5 A;  1V1P A;  1YN3 A;  4DK5 A;  2WNM A;  4IWQ A;  2HDE A;  2ZJD A;  1E7P B;  1OTR B;  2ZNV C;  3LB8 C;  3W5U B;  5E6P A;  4XYC A;  1A5R A;  4MSQ B;  2KMM A;  4ZRQ A;  1RAX A;  1ZDX A;  2WHI A;  2WYQ A;  2D3G A;  4KDL B;  2EMS A;  1MFW A;  3BVM A;  2JQR B;  2WLB A;  1V1O A;  1SJH D;  3W1S C;  1T3Q A;  1OEY A;  4BAX A;  3RPF C;  2GI9 A;  4AUQ C;  1FPY A;  4H2A A;  4MH8 A;  3BYT B;  3W9C B;  2L3Z A;  1IP9 A;  5G55 A;  3LYY A;  4S0R A;  1YMH E;  1XQQ A;  2AEH A;  2DZM A;  1PGB A;  1FCL A;  4BOS C;  4X57 B;  2DAJ A;  4RFB A;  4KSK C;  1BXT A;  2BYF A;  5C2T B;  2MP2 B;  2IGG A;  2WXF A;  2N9E B;  4DXG A;  5MPO A;  4JGH B;  1WWT A;  1ROE A;  2OJW A;  2LJ5 A;  2V9H A;  5DPR A;  2MJ3 A;  2G9H D;  3VAW A;  4HRO A;  3HUI A;  2CKH B;  2I38 A;  5AEK B;  1H8C A;  1ET6 A;  2WS3 B;  1WI0 A;  1VZ8 A;  1HEZ E;  2BS2 B;  1VDV A;  1UGJ A;  1C4P A;  4JE3 B;  3VH4 B;  3AU5 A;  2M17 A;  1JW9 D;  2JRH A;  5DPW A;  3U52 E;  2PE6 B;  4K3C A;  2C7H A;  4OZC A;  2NR2 A;  1L7Y A;  2DZI A;  2REX A;  3P4S B;  1NI3 A;  2KC2 A;  2ZVN A;  4MGK E;  2CJO A;  1UZX B;  2XNA C;  1I4P A;  1WIA A;  2KVR A;  3UIO B;  1RYJ A;  2LRW A;  4DQO C;  3M62 B;  2RSU A;  4A90 A;  3QQ8 B;  4LCD E;  2K3U A;  5D7G A;  2L8J A;  3N9Y C;  2LAS A;  2NMQ A;  1JWS D;  4MM3 B;  2KWU B;  1FXT B;  3V3X A;  4J3O D;  1I7H A;  1R4M B;  3SHQ A;  3Q8B A;  1NEN B;  1QOB A;  2CJN A;  3NUH B;  3AI5 A;  2NCN A;  4XX5 A;  4HJG E;  1F1H A;  1ZW7 A;  3WA0 A;  1IGD A;  3DQV A;  2BQQ A;  3ML8 A;  3TEX A;  1WYG A;  2IO2 B;  3SDL C;  4IWO A;  2ASQ A;  3SEB A;  5IAA C;  3L4P A;  4PYU A;  4KZC A;  1XLP A;  3ETR A;  3PZ7 A;  2FAZ A;  3WAM A;  1N61 A;  3OWE B;  1L6U A;  1YJJ A;  3PRZ A;  2D5G A;  4ARC A;  2WWZ A;  1P0R A;  2V3N A;  3SFE B;  2FCN A;  1UWM A;  3TSS A;  3DHI C;  3ML9 A;  2J7Q B;  3PRP B;  4GMV A;  2LFI A;  1D3Z A;  3QJZ A;  3ZNZ B;  1WX8 A;  1C76 A;  3AE5 B;  5AUK A;  3MTN B;  3RNA C;  2KDE B;  1N60 A;  2LVP A;  2MLB A;  1J7C A;  2ZNV B;  2BKR B;  3AN1 A;  4OW0 A;  3ZXV A;  2PMV A;  2PIA A;  4M0W A;  2M19 A;  2N9L A;  4MEM A;  1EM7 A;  2CU3 A;  3R66 C;  2L0T A;  3H7P A;  2ZVO A;  2D11 A;  1CZP A;  3DBR I;  2WXN A;  3MC9 A;  1AYF A;  3I63 C;  1WE7 A;  3JVZ X;  4DWF A;  4RCO A;  1GNU A;  3CWI A;  3KUZ A;  1CQV A;  1V8C A;  2HJ1 A;  3N20 C;  2WXG A;  2LGD A;  4YSX B;  3LXF A;  2JU6 X;  4NJ7 A;  1CJE A;  4RH6 A;  1QOF A;  1YQB A;  2FNJ B;  2V4L A;  2GOW A;  4AQ7 A;  4Q2J A;  5JHB A;  4O1N A;  2K22 A;  2G45 B;  3KUC B;  2NTT A;  2K8H A;  1KTK A;  3I3T B;  3BVZ A;  1FCC C;  4I6P A;  3SU8 X;  2JXT A;  4YT0 B;  2JZP A;  2KX0 A;  2KQ7 A;  4KZ0 A;  2IND C;  2E6X A;  2RPV A;  2Y5P A;  2H89 B;  3IT6 B;  3I9V 1;  4KDI C;  2FCS A;  1E9M A;  1HZ5 A;  1ZGU B;  3APD A;  1LGR A;  1XEE A;  1RLF A;  4CO7 A;  2AX5 A;  3TL5 A;  3CST A;  1XCT L;  5BYS A;  5T8I A;  2FBW B;  2DYM A;  4C7Y A;  3FIL A;  2CHW A;  4IM3 A;  2KX3 A;  3PT2 B;  4FXC A;  3RFZ B;  2LGX A;  3BIN A;  3M3J A;  3ZGZ A;  3ZKJ C;  3PLV A;  5AZG A;  1WJ6 A;  3Q3J A;  2ACZ B;  3KLS X;  2KDF B;  4II2 B;  1WRD B;  2KLC A;  2N0S B;  3P63 A;  2K8B A;  1WMH B;  1WJN A;  1LQB A;  3B2G A;  2RPQ A;  3NZS A;  1NYQ A;  2ZPY A;  3LJ3 A;  4C56 C;  1VR9 A;  3NS1 A;  1TS3 A;  2WXO A;  3ECI A;  4E74 A;  2RR9 A;  5IKC M;  3IFW B;  1L4Z B;  1WXS A;  4A9A A;  5EE9 A;  2QMT A;  4NJ6 A;  2GBM A;  1K8R B;  3NVZ A;  1STE A;  2L83 A;  3W1S A;  4TUU A;  2NBU A;  3N32 A;  1P1A A;  2WDR B;  1R4M I;  4JX1 C;  4B95 A;  3AE1 B;  1J0G A;  3DCG A;  2N9K A;  3TEZ A;  2K5P A;  4FBJ B;  2BVC A;  4N9F 4;  1D4B A;  4RMA A;  3AEC B;  3AEF B;  2ZCB A;  1KJT A;  1A70 A;  2YVC A;  1WGH A;  2D10 A;  1PGA A;  2MBO A;  5CHF A;  5FKA C;  1WR6 E;  4PS8 A;  2DEN B;  3ZW3 A;  3MHZ A;  4LDT B;  4MJS B;  1QF6 A;  4FUL A;  1WJU A;  5HG2 A;  3PGE A;  2V0G A;  4J6I A;  2KT7 A;  3BY4 B;  1JCK B;  2MW5 A;  3ZTC A;  1FRD A;  2XK5 B;  3WAP A;  1WM3 A;  3AMZ A;  5IP4 D;  2KJ6 A;  1B1Z A;  3L13 A;  1K52 A;  2WXM A;  2C5L C;  5IN7 A;  1JRO A;  1SIF A;  1YIW A;  3A4S C;  4FJV B;  1XO3 A;  2K1F A;  1P98 A;  2WU5 B;  1Y8R C;  4AWJ A;  1WMH A;  5TSS A;  2IO0 B;  4B0E A;  2WX1 A;  2DZK A;  2KLG A;  1SXT A;  1XLQ A;  3ZVV A;  4DDG D;  3DOW A;  2GBR A;  4B9K A;  2JRI B;  3K9O B;  1E7U A;  3VUX A;  2H88 B;  4K3B A;  2OOB B;  3KH0 A;  4MEL A;  4F7Z A;  4ANU A;  3T9L A;  1LO5 D;  3P4R B;  4LJO B;  1ZXI A;  1V1P B;  2MJE A;  4PYZ A;  3ZXR A;  2C7N B;  4DXF A;  2JXX A;  4GGQ A;  4GOC A;  2KN4 A;  4LDT D;  2LD9 A;  3W2D A;  5LLI A;  4HCN B;  2JZ3 B;  3Q69 A;  1FFU A;  1KRH A;  2BWE S;  3IAS 1;  3RZF A;  1PDX A;  1ZXH A;  4WJP A;  3R2I A;  4P16 A;  4HKZ E;  1C9F A;  4EZL A;  2W55 A;  3ONS A;  4MJS A;  3APC A;  1ACC A;  4WAF A;  2KOX A;  3CMM B;  2ZCC A;  5J18 A;  3V62 A;  5GXG B;  1GOZ A;  4AP4 C;  3A1Q B;  2XK5 A;  2LHD A;  4FJY A;  1J7A A;  1KH0 A;  2IJ0 A;  2KMA A;  5IA7 A;  3NHE B;  4C00 A;  1V6E A;  4RGM A;  1Q5W B;  3TUO A;  1FNU A;  1WGR A;  5LXH A;  3VRB B;  4BKS D;  2FIF A;  5H92 C;  2JYE A;  1PFD A;  3P1M A;  4P1B C;  3ZJU A;  4FHK A;  2WXK A;  1V97 A;  1UNS A;  1XLN A;  3RI7 C;  4HPL B;  1E7V A;  4WQM A;  3Q3M C;  3VFK A;  2I1J A;  1XXG A;  1UD7 A;  1FNV A;  3P2B A;  3PLU A;  1KF6 B;  4A20 A;  2BT6 A;  3Q8A A;  3AXC A;  1KLV A;  4LNI A;  1J8C A;  3HM6 X;  3GOE A;  4BKG A;  3AE4 B;  1OEY J;  1WH3 A;  1QOG A;  3VUW A;  4CYE A;  4LNF A;  4HPM B;  2OJR A;  2DX5 B;  3QK0 A;  4ANV A;  1FXA A;  3ZTD A;  1ESF A;  2IZV B;  2CHX A;  2M1M A;  5FR3 A;  3PHW B;  4WJO A;  2K8C A;  4MAC A;  3KWV A;  4OHJ A;  3NVW A;  1GUA B;  5D3D A;  2AL6 A;  2WX0 A;  2BPS A;  4TV3 A;  4EE2 A;  4LNO A;  3VUY A;  1MJD A;  2KQS A;  1JAL A;  2KN5 A;  1IGC A;  2RGF A;  2KAJ A;  1WR1 A;  3VRA B;  1ISN A;  4ICV A;  3ZUN A;  1JWM D;  3DDC B;  3N30 A;  5H8Y E;  2WXP A;  3BZD B;  4K7S A;  4XC2 A;  3DBL B;  1OQY A;  1SF0 A;  3A1Q A;  2M4N A;  2KJH B;  4REZ A;  3D32 A;  3S2A A;  1ZKH A;  4NQK E;  1X1M A;  2IBI B;  1FD6 A;  1V80 A;  4ZRI A;  2WXQ A;  1N5W A;  1ZPS A;  1TGZ B;  3H6N A;  1WX9 A;  1HZ6 A;  1C4C A;  4MT5 A;  4HEA 1;  2BKF A;  3GB1 A;  2KD0 A;  1SE3 A;  4M00 A;  1IBX A;  2B3A A;  1FMA D;  3H8H A;  4BFR A;  2LVQ A;  5LXI B;  3NRZ A;  4HPP A;  3ZDM C;  3APF A;  4GDL A;  4M0W B;  2INC C;  4W9J A;  3H7P B;  1I4Q A;  4MDK E;  3KUD B;  3IT4 B;  2J53 A;  3EEC A;  3O13 A;  2Z0D B;  4EUT A;  4IKG A;  3DPD A;  1T0Q C;  3P4Q B;  3GE3 C;  2MBE A;  2FCQ A;  2NBW B;  2G4S A;  1T0Y A;  1SE9 A;  2LJI A;  2BYE A;  3DBS A;  3VVW B;  3QX1 A;  5DPT A;  3AED B;  2C7M B;  2L76 A;  1WJ4 A;  3HIZ A;  4KVG B;  2BB5 A;  2KZR A;  3VR9 B;  2WDT B;  4JL9 A;  1TKG A;  4DBG A;  3ZNH B;  4L2Y A;  2KVZ A;  3ZRF A;  4ZRK A;  3V05 A;  3L10 B;  3EFU A;  1CK1 A;  2A4Z A;  2HE7 A;  2WU2 B;  3BWU D;  1QIL A;  1T6B X;  1GPX A;  2J0K A;  3JSV B;  2BS3 B;  2D07 B;  2W3R A;  1B9R A;  1TTN A;  4IM0 A;  4KGS A;  3Q2A C;  3Q14 C;  5HFY A;  2LEK A;  4ARI A;  5E6N A;  5DCN A;  4XGA B;  1XLO A;  3AH7 A;  3IHP C;  1U4A A;  4HJK A;  2RDG A;  3FIL B;  5G5H A;  5C3J B;  1MHX A;  2KWD A;  4GXB A;  1S3S G;  1YQ3 B;  2KQ4 X;  4W9D A;  4I6L B;  1QLB B;  1YOV B;  3UQB A;  1F9J A;  2G3Q B;  2ZPN A;  5EE1 A;  2MJD A;  4II3 B;  1IYF A;  1XCQ L;  4YWG G;  4ZDV A;  2M0A A;  1RFA A;  1JRU A;  2AQ3 B;  3OG5 A;  2Z0E B;  3TBL D;  4N6E B;  3PZD A;  3B1L X;  1R7S A;  4ZRJ A;  4JPS A;  4G11 A;  1NBF C;  1WGK A;  4C80 A;  2V3P A;  2YLM A;  2GBN A;  1D5M C;  5C23 A;  3WAL A;  3X23 A;  2MBH A;  1UWX A;  5CX3 A;  1RRB A;  2EKI A;  2JWU A;  4NAM A;  4L23 A;  4AOF A;  2MEK A;  3EHV A;  2O2V B;  1YX5 B;  1FNW A;  3TCA A;  3NY5 A;  3Q8E A;  2PVG C;  2DYB A;  1T5X D;  4IM2 A;  2KNB A;  1WGD A;  2JPH A;  2YEP F;  3GE8 C;  3Q3F A;  3Q3N C;  1P7E A;  4G3X B;  1OFF A;  2ZW0 A;  4HCP B;  3Q8F A;  1V9J A;  2KHW B;  4TQ0 A;  2FUH B;  5J17 A;  2B76 B;  3UI3 A;  3OAW A;  3E9S A;  2L7R A;  2C9W B;  2QSD A;  5BMI A;  2KK8 A;  2XEW A;  3RUL A;  3ZLZ A;  4YXD B;  1YX6 B;  3QCA A;  2INN E;  3RT3 B;  2IPK D;  2ONQ A;  3B2F A;  3L54 A;  2UYZ B;  5D94 A;  3DBL I;  4G0N B;  3ZNG C;  3JSV A;  1F77 A;  4MGZ E;  4C4V A;  1MHH E;  4MGY E;  4WH4 A;  2BB6 A;  4PK1 A;  3TEW A;  1UBI A;  3C19 A;  4EEW A;  2INP E;  1SGH A;  2CU1 A;  4F8C B;  3PRE A;  1LM8 B;  2Z8L A;  1TS2 A;  3RD2 A;  2KAN A;  5D2M B;  3VH3 B;  4P7I A;  3TEY A;  4CQN A;  2DYO A;  2N4F A;  2L52 A;  3JW0 X;  3LDZ E;  4NNJ B;  1E5W A;  4WAA A;  4UDU C;  1E0Z A;  4HDQ A;  3PZ8 A;  3R3M A;  4E3C A;  4KIK A;  2KXJ A;  1SEB D;  2Y5B B;  3RUI B;  4AS1 A;  4JWU C;  4WQO B;  2K9X A;  2DNF A;  1V2Y A;  2WGS A;  2WXL A;  4IOI E;  4XZ4 A;  2WXJ A;  2PVO D;  4W9I A;  2BF8 B;  1UGM A;  3Q6B A;  4BZA A;  3Q8C A;  2LWP A;  3DVN U;  4MGI E;  3DVG X;  4FN2 A;  4EZK A;  1SSN A;  3KQ4 A;  1D5X C;  4WWN A;  5C1Z A;  4WUR A;  2KFK A;  5HHD G;  5BO4 B;  2O2V A;  1WGY A;  2BYV E;  1EF1 A;  2AYO B;  2QC8 A;  1KLG D;  1JWB D;  1LFD A;  2GLS A;  1PQS A;  4FAD A;  4DDI D;  3N1Y C;  3OJ4 B;  1KM7 A;  3IBE A;  3TMP B;  4PS3 A;  2R2O A;  4W9G A;  1YQ4 B;  2DZJ A;  2WDQ B;  2IO3 B;  1Y56 A;  3H9D A;  3PVL A;  2HTH A;  1AAR A;  1N6Z A;  4NPN A;  1E8W A;  1MVK A;  2WP9 B;  3MHS D;  1KLU D;  5J2R A;  2IGD A;  2NTS A;  1PYW D;  2KWV B;  4MH0 E;  2K0P A;  5DPS A;  1MG8 A;  2Y5C A;  3C8Y A;  4E71 A;  4D2K A;  2KJR A;  3E56 A;  2W9N A;  3B08 A;  4PS7 A;  4DHZ E;  4ACF A;  2QDF A;  1MG4 A;  1YJI A;  5G2N A;  1FFV A;  2QIE B;  3PS6 A;  2BGF A;  3A4R A;  1DGJ A;  4IWP A;  4JWS C;  3R8B A;  2IO1 B;  3AE9 B;  4K7W A;  1F2R I;  3RCZ A;  3U7D A;  3VTW A;  3HK0 A;  3PSE B;  4EFO A;  3QC8 B;  2V4I B;  3B0A A;  3B9J A;  1GB1 A;  1EU3 A;  1ET9 A;  4B0M A;  1K50 A;  1E6E B;  2RDH A;  4XWT A;  2I2Y A;  2ICI A;  1Q10 A;  2VRR B;  2L0F A;  1AW7 A;  3T3N A;  3WAN A;  2J52 A;  2J42 A;  2NBV B;  2ZZP B;  2MX2 A;  3NVY A;  1WF9 A;  4W9C A;  4US8 A;  2PJH A;  3A33 B;  1QOA A;  2CR5 A;  2KTR A;  3ZJV A;  4ITK A;  1WXQ A;  2M8S A;  3QWZ B;  1GG3 A;  1P9D U;  2QIL A;  1K51 A;  4HDO A;  2BTE A;  4GU2 A;  4ZOH C;  3RYT A;  2TSS A;  1WGG A;  4FHJ A;  4ANW A;  4NJC A;  2AL3 A;  1J7B A;  4NAW B;  1XF5 L;  2PLP A;  4JLC A;  5L83 A;  1Q1O A;  2Q5W D;  2YEP B;  2BW2 A;  4I6N B;  1C78 A;  3NG0 A;  1NYR A;  4GB9 A;  2UWQ A;  3R2T A;  4OVZ A;  3HRD D;  1YNT E;  1V81 A;  3MC0 B;  4GDK A;  3L17 A;  2D2Q A;  2LXC A;  3HVD A;  3ALB A;  4ASW C;  4IDI A;  4LNN A;  4EZJ A;  3J9C A;  1Z5S B;  1XT9 B;  1FIQ A;  2K6D B;  2ON8 A;  3DVN V;  1Q0W B;  2IY1 B;  2XN9 C;  2ZW1 A;  5JXV A;  4JQW C;  2WQY B;  4IG7 B;  3R7Q A;  1TKE A;  1YD8 U;  3HVZ A;  2J0M A;  1WXM A;  3MJ5 A;  2PKO A;  2RDB C;  1I42 A;  2R61 A;  2KDM A;  4F1S A;  4S17 A;  2W82 A;  2QHO A;  2IYD B;  2N1W A;  1E8Z A;  1TS5 A;  3AV8 A;  4JIO U;  1TT5 B;  1E90 A;  1V5O A;  1DYQ A;  2G4D B;  4URK A;  3ZJT A;  3FAH A;  4HRS A;  5E6J A;  4A3O A;  2CHZ A;  4YSZ B;  2W3S A;  2L05 A;  2JSV X;  3UQA A;  1AN8 A;  1NI2 A;  1IBX B;  2BYT A;  3PTF C;  2GBJ A;  2K25 A;  1GJZ A;  2IGH A;  3AE3 B;  1WSP A;  3AB5 A;  3IVF A;  3UIN B;  4HXD A;  1UBQ A;  2LUM A;  3QA8 A;  2CS4 A;  2VH1 A;  3VXW A;  2LRU A;  3AE2 B;  4XDD A;  1I4H A;  4GDL B;  4M01 A;  1I4R A;  1PUT A;  4HWI B;  4WIP A;  2JF5 A;  4TMA B;  2PE9 A;  1TY2 A;  1WXV A;  4XWW A;  1FRR A;  4WWO A;  1WXA A;  1QKZ A;  4ZYN A;  2K39 A;  4FA6 A;  2D3C A;  4NAW A;  3AUL A;  4K81 A;  2A5U A;  3SR6 A;  3DBR B;  4FLH A;  3H7S A;  2QJL A;  5TR5 A;  2BWF A;  2O6V A;  3MFG A;  2OHF A;  1I4X A;  1L0Y B;  3DWG C;  1RFK A;  4KV2 A;  4N59 A;  5KHQ A;  4HVB A;  2N9P C;  1WYW B;  1LXD A;  4HK2 A;  5BYR A;  3KYD D;  1V86 A;  5AZF A;  3RZW C;  4GIV A;  3RNB C;  3RMK C;  1JML A;  1FM0 D;  5IO9 A;  3MC8 A;  2X38 A;  3AEG B;  4DXA B;  5KHO A;  1R4N B;  2J4X A;  3ZRC A;  2JZZ A;  1ENF A;  2VZK B;  2AQ2 B;  1J19 A;  1EWY C;  2BS4 B;  4CHK A;  3PV1 A;  4A6Q A;  1BUI C;  1F52 A;  2LI5 A;  1TY0 A;  2PPH A;  2KWC A;  5BMH A;  1UUP A;  4A8X C;  4RF0 A;  3SD5 A;  1OQR A;  3L0W B;  2XBB C;  3I5J C;  1Z2M A;  4YTM B;  3WCQ A;  3VHT C;  4QAY A;  2N1V A;  2DAF A;  3KW5 B;  2V1Y A;  5EDS A;  4US9 A;  1OQQ A;  2BBC A;  2LMC A;  1EO6 A;  1SE2 A;  1TS4 A;  4WJQ A;  3DHG C;  4TSS A;  3VTV A;  4HKQ A;  2NVU I;  3Q3O C;  5BMG A;  1TJE A;  2IY0 B;  3GP7 A;  4RNA A;  1YN5 A;  2Z59 B;  4EOY A;  1ZDV A;  2IDY A;  2J0J A;  3WAO A;  3N3K B;  3BYY B;  2N7E A;  1RM6 C;  1P7F A;  3DHH C;  3ZQ4 A;  3NZ3 A;  3EUB 2;  2MRP A;  1VRA B;  2MQJ A;  1GC7 A;  4OZA A;  3GZN B;  2N9X A;  1EF5 A;  2MBQ A;  3U7Z A;  1WFY A;  2JYT A;  3W5V B;  4IC7 B;  2AWT A;  2DHZ A;  3NOB A;  3ZIM A;  4USA A;  2MA9 B;  2VZK D;  4LLG M;  3HHM A;  2JX5 A;  5EE3 A;  3VDZ A;  4C4V B;  2DBY A;  2KFJ A;  2Y3A A;  2MCN B;  4L1B A;  3KVF B;  1UEL A;  3N1X C;  2KTF A;  3C0R B;  3FKY A;  4FJZ A;  2GMI C;  2FCM A;  1FO4 A;  1HTQ A;  3DWM A;  3ZO5 B;  1SB3 C;  1MPE A;  1TZO A;  2EEL A;  1HA5 A;  1CMX B;  4NQL B;  5LNK 1;  4W9H A;  1H4R A;  4DHZ B;  5JHA A;  3U30 A;  2EKE C;  3T8M A;  4EKU A;  4KIK B;  4BOZ B;  3AEB B;  3UIP B;  4LTU A;  2KC1 A;  1ZOY B;  3RNF C;  2WXI A;  1HXY D;  5E6O A;  4C7Z A;  2MP2 A;  1D5Z C;  1C1Y B;  3UGB B;  4LNK A;  4KGR A;  4ICU A;  1YJ1 A;  4N58 A;  2LVO A;  3QAR A;  2KKC A;  4P1C C;  2KDI A;  4RM8 A;  4KGT A;  1K53 A;  2KFK B;  3AE7 B;  1TIF A;  3M95 A;  1WX7 A;  4W9L A;  4XDC A;  2LGI A;  2D3A A;  1UH6 A;  5CHW A;  2FE8 A;  2AQ1 B;  5G5G A;  2FID A;  4M8M A;  2JUO A;  2KMC A;  3CSF A;  1SIJ A;  3QHT A;  1JQ4 A;  4NY0 A;  3EFC A;  2SAK A;  3QAQ A;  2OED A;  1L5P A;  2E3T A;  3TIX A;  3RNG C;  1E8X A;  4GN1 A;  3P4P B;  1VZ7 A;  3L16 A;  1MI0 A;  3V6C B;  3W1Y A;  3NS8 A;  4MM3 A;  3VQI A;  3A9J B;  4RF1 A;  4G50 A;  1L6V A;  3R7R A;  2NS5 A;  1VZ6 A;  4KKJ A;  3N1Z C;  3ZYY X;  4RGT A;  1V5T A;  1I4G A;  2UU7 A;  1EU4 A;  2L32 A;  1VLB A;  1L4D B;  5AUI A;  1QQR A;  3AU4 A;  3PRM B;  1R4N I;  3V6E B;  1FEH A;  5JZE B;  1TBE A;  2EMT A;  4ZHO A;  1SE4 A;  1WM2 A;  1XD3 B;  1D6E C;  3T3O A;  1ZE3 D;  3DBH B;  1OGW A;  3HM3 A;  4A55 A;  5AZH A;  2RD0 A;  2ZEQ A;  4TKN A;  3NZU A;  3L08 A;  3JYU A;  2WXH A;  4A3P A;  1DOY A;  4WJN A;  2M0X A;  1VD2 A;  3PO0 A;  5GMV A;  1DOI A;  2JVC A;  5CHV C;  2PTL A;  1L0V B;  4W9F A;  3O65 B;  1WZ0 A;  2MH7 A;  1JWA D;  4RGN A;  2LUE A;  4ANX A;  4ZHP A;  1C3T A;  1ZP0 B;  2FUG 1;  4K7U A;  1GAQ B;  2KTR B;  1TZ1 A;  3ZDT A;  2M56 B;  2HJ8 A;  1JWU D;  2L00 B;  3AEE B;  1N62 A;  1M4V A;  3ABV B;  1BML C;  3TJP A;  3V61 A;  2I1K A;  4IUM B;  2JY6 A;  5IOI A;  2NPT B;  1ZUD 2;  2KO3 A;  3GZN I;  2RMM A;  2LZ6 A;  4AJW A;  3M63 B;  4GDK B;  3A9J A;  4RGO S;  2MSE D;  1KFY B;  2LGS A;  4DHJ B;  1SJE D;  4P6V F;  1KOT A;  3AE8 B;  1RWS A;  2N7D A;  1WY8 A;  5FK9 C;  4BVU C;  3RNE C;  3GS2 A;  3DVG Y;  5BYQ A;  1SBB B;  3FC4 A;  1HQR D;  4K1R B;  1TYG B;  3AE6 B;  1L0X B;  1VCB A;  2GBK A;  3KYC D;  1HTO A;  5HI1 A;  1T0R C;  2HD5 B;  4YTN B;  1WE6 A;  3I57 A;  1JRP A;  2C60 A;  3RN9 C;  4RM9 A;  3ZNI D;  4BBN F;  2G1E A;  4HLE A;  2JT4 B;  3BII D;  4BKT A;  5D6J B;  1TKY A;  3RNC C;  1S1Q B;  4W9K A;  4AJY B;  1AWD A;  1L2N A;  3AEA B;  5L95 C;  2MWS B;  1NEK B;  1UF0 A;  1C77 A;  3ENE A;  1V49 A;  3CF6 E;  1VJK A;  4OVV A;  1M94 A;  5EE0 A;  5D3I B;  4M02 A;  2QEJ C;  4W9E A;  2KDB A;  5CTR C;  3PPA A;  4YL8 A;  1C79 A;  2R2Q A;  2MBB B;  1GC6 A;  2MHJ A;  2LXA A;  3BK1 A;  3IAM 1;  3NJT A;  2GRI A;  3NVV A;  4BBN C;  3A9K B;  1E10 A;  2N7J A;  3CIR B;  3UF8 A;  4DHJ D;  4YSY B;  3BK2 A;  1DOX A;  2NPT A;  3MP9 A;  3EGR A;  2O6V B;  3BVG A;  4NZL B;  4M8N A;  3H1U A;  1P3Q U;  4XE0 A;  1QT9 A;  3VR8 B;  1I35 A;  2KAC A;  1IPG A;  2GB1 A;  4GLS C;  4B6W A;  2K6Q A;  4KKI A;  1WZ3 A;  1F0Z A;  2L1A A;  3EC8 A;  5FR6 A;  1GB4 A;  2SEB D;  1YN4 A;  3V60 A;  3IG3 A;  3QIJ A;  1G6J A;  4ZRP A;  4OZB A;  3SFD B;  3X0W A;  2DWQ A;  1EWC A;  2QCZ A;  3DBH I;  3OLM D;  4KX6 B;  1C4A A;  1HE8 A;  2KYW A;  3IXS A;  2WXR A;  3AM9 A;  1PGX A; 
#chains in the Genus database with same CATH homology
 1WR6 E;  2JWZ A;  4PS8 A;  4IM2 A;  2KNB A;  1EO6 A;  1WGD A;  2JPH A;  2DEN B;  3ZW3 A;  4LDT B;  3Q3F A;  4MJS B;  4WJQ A;  4FUL A;  3WIM A;  1WJU A;  4G3X B;  3U8Z A;  4HCP B;  3VTV A;  3PGE A;  4J6I A;  1V9J A;  2KHW B;  2NVU I;  3BY4 B;  4TQ0 A;  2IY0 B;  2MW5 A;  3ZTC A;  2FUH B;  1E8Y A;  5J17 A;  2XK5 B;  1QZE A;  2Z59 B;  4EOY A;  3OAW A;  2L7R A;  3WAP A;  2C9W B;  2J0J A;  3MJW A;  1WM3 A;  2KK8 A;  2XEW A;  3N3K B;  3RUL A;  2KJ6 A;  3WAO A;  3ZLZ A;  1YX6 B;  3QCA A;  2N7E A;  3RT3 B;  5HKH A;  3L13 A;  3VTU A;  4IW0 A;  2MRP A;  3L54 A;  4BKS A;  2UYZ B;  2MQJ A;  1BT0 A;  3DBL I;  4G0N B;  4WWP A;  1GC7 A;  2C5L C;  2LGY A;  3JSV A;  5D94 A;  4MGZ E;  3ZNG C;  2N9X A;  1SIF A;  2O6V D;  3OJ3 A;  3K9P B;  1YIW A;  3A4S C;  4FJV B;  4MGY E;  4OVU A;  1EF5 A;  2MBQ A;  1UBI A;  3PHX B;  2K1F A;  1NDD A;  1WFY A;  4EEW A;  1P98 A;  2V3S A;  1SGH A;  1Y8R C;  2CU1 A;  1WMH A;  4LJP B;  4AWJ A;  4F8C B;  4IC7 B;  2AWT A;  2DHZ A;  3A9K A;  3PRE A;  1LM8 B;  3NOB A;  3ZIM A;  1EUV B;  4GSW A;  4MSM B;  2IO0 B;  2MA9 B;  4KSL C;  3RD2 A;  3HHM A;  2PEA A;  2KAN A;  2WX1 A;  5D2M B;  2DZK A;  2KLG A;  4P7I A;  3VH3 B;  2DYO A;  3VDZ A;  2N4F A;  2KFJ A;  3JW0 X;  3LDZ E;  2MCN B;  4NNJ B;  3ZVV A;  1E5W A;  3KVF B;  1UEL A;  4WAA A;  5JH5 C;  4TQ1 A;  4DDG D;  3DOW A;  2GBR A;  2KTF A;  3C0R B;  4HDQ A;  4FJZ A;  2GMI C;  4DK5 A;  3R3M A;  4B9K A;  2JRI B;  4IWQ A;  3K9O B;  2FCM A;  4E3C A;  4KIK A;  2KXJ A;  1E7U A;  3VUX A;  2Y5B B;  3RUI B;  2ZJD A;  4WQO B;  1OTR B;  2ZNV C;  2OOB B;  3KH0 A;  4MEL A;  1V2Y A;  4F7Z A;  4ANU A;  3ZO5 B;  3T9L A;  4XZ4 A;  5E6P A;  1A5R A;  1CMX B;  4MSQ B;  4LJO B;  4W9I A;  2BF8 B;  1RAX A;  4NQL B;  1UGM A;  2WYQ A;  4W9H A;  4PYZ A;  1H4R A;  2LWP A;  2C7N B;  3DVN U;  4MGI E;  4DHZ B;  3DVG X;  5JHA A;  2D3G A;  2JXX A;  4GGQ A;  4GOC A;  4FN2 A;  3U30 A;  2EKE C;  3T8M A;  4KDL B;  4EZK A;  2EMS A;  4EKU A;  4KIK B;  4LDT D;  2LD9 A;  4BOZ B;  4WWN A;  3UIP B;  5LLI A;  3W1S C;  5C1Z A;  4HCN B;  1OEY A;  2KFK A;  2JZ3 B;  2BWE S;  2KC1 A;  5BO4 B;  2O2V A;  1WGY A;  5E6O A;  4AUQ C;  2BYV E;  3RZF A;  1EF1 A;  2AYO B;  2MP2 A;  4WJP A;  1C1Y B;  3UGB B;  2L3Z A;  4ICU A;  1YJ1 A;  4EZL A;  1LFD A;  1IP9 A;  2LVO A;  3QAR A;  3ONS A;  5G55 A;  1PQS A;  4FAD A;  4MJS A;  3APC A;  2KKC A;  4DDI D;  1XQQ A;  2KDI A;  2KOX A;  3OJ4 B;  1KM7 A;  2AEH A;  2DZM A;  3IBE A;  3CMM B;  4RM8 A;  3TMP B;  4X57 B;  2KFK B;  4BOS C;  2ZCC A;  3M95 A;  3V62 A;  5J18 A;  1WX7 A;  2DAJ A;  4PS3 A;  4W9L A;  2R2O A;  4KSK C;  4W9G A;  2DZJ A;  4AP4 C;  2BYF A;  3A1Q B;  2XK5 A;  1UH6 A;  4FJY A;  5CHW A;  2IO3 B;  2MP2 B;  2FID A;  2KMA A;  5IA7 A;  4M8M A;  2JUO A;  2N9E B;  3NHE B;  1V6E A;  3H9D A;  1Q5W B;  2KMC A;  3CSF A;  3PVL A;  3QHT A;  3KW5 B;  1WGR A;  2HTH A;  4JGH B;  1AAR A;  5LXH A;  4NY0 A;  4NPN A;  2LJ5 A;  3QAQ A;  1E8W A;  5DPR A;  4BKS D;  3VAW A;  3MHS D;  2FIF A;  3TIX A;  2CKH B;  5AEK B;  5J2R A;  1H8C A;  1E8X A;  1WI0 A;  4GN1 A;  4FHK A;  3L16 A;  2KWV B;  4MH0 E;  5DPS A;  1MG8 A;  3V6C B;  3W1Y A;  3NS8 A;  4MM3 A;  3VH4 B;  3VQI A;  3A9J B;  1E7V A;  3AU5 A;  4HPL B;  2M17 A;  4E71 A;  3VFK A;  2I1J A;  2JRH A;  2KJR A;  4G50 A;  2W9N A;  3R7R A;  5DPW A;  1UD7 A;  2PE6 B;  2NS5 A;  3B08 A;  2C7H A;  4PS7 A;  4DHZ E;  2NR2 A;  1L7Y A;  2DZI A;  2REX A;  3PLU A;  3P2B A;  2KC2 A;  2ZVN A;  1V5T A;  4MGK E;  1UZX B;  5G2N A;  1WIA A;  2KVR A;  3UIO B;  4A20 A;  3PS6 A;  2BGF A;  2LRW A;  3A4R A;  3AXC A;  4IWP A;  1KLV A;  3M62 B;  2RSU A;  3QQ8 B;  1J8C A;  3HM6 X;  3VTW A;  2IO1 B;  4LCD E;  3GOE A;  5D7G A;  2L8J A;  2LAS A;  4K7W A;  4BKG A;  3RCZ A;  1OEY J;  2KWU B;  3AU4 A;  1FXT B;  3HK0 A;  3PRM B;  1R4N I;  3PSE B;  3U7D A;  3V6E B;  4EFO A;  5JZE B;  1WH3 A;  3QC8 B;  1TBE A;  3SHQ A;  2EMT A;  3B0A A;  3VUW A;  4CYE A;  1WM2 A;  1XD3 B;  4HPM B;  2OJR A;  2DX5 B;  3AI5 A;  3QK0 A;  2NCN A;  1OGW A;  4XX5 A;  3HM3 A;  4ANV A;  2VRR B;  2L0F A;  5AZH A;  2RD0 A;  3WAN A;  2ZEQ A;  4TKN A;  3NZU A;  3L08 A;  1ZW7 A;  3JYU A;  3ZTD A;  2NBV B;  3WA0 A;  2ZZP B;  4A3P A;  3DQV A;  2IZV B;  4WJN A;  2M0X A;  2MX2 A;  2CHX A;  2M1M A;  1WF9 A;  3ML8 A;  4W9C A;  1VD2 A;  3PHW B;  2PJH A;  4WJO A;  2K8C A;  3A33 B;  2IO2 B;  3SDL C;  5GMV A;  4IWO A;  2CR5 A;  2KTR A;  1GUA B;  2ASQ A;  2M8S A;  3QWZ B;  2JVC A;  2AL6 A;  1GG3 A;  1P9D U;  5IAA C;  5CHV C;  2WX0 A;  4HDO A;  4PYU A;  4KZC A;  4GU2 A;  2BPS A;  4TV3 A;  4W9F A;  3VUY A;  3RYT A;  1WGG A;  3O65 B;  1WZ0 A;  4FHJ A;  4ANW A;  2KQS A;  2FAZ A;  3WAM A;  2AL3 A;  2KN5 A;  4NAW B;  2RGF A;  1WR1 A;  2LUE A;  4ANX A;  1ISN A;  1C3T A;  4JLC A;  4ICV A;  3ZUN A;  5L83 A;  1Q1O A;  3DDC B;  3N30 A;  3PRZ A;  4K7U A;  2KTR B;  1TZ1 A;  3ZDT A;  2WWZ A;  4K7S A;  1P0R A;  4XC2 A;  4I6N B;  2FCN A;  4GB9 A;  2HJ8 A;  1OQY A;  2UWQ A;  3A1Q A;  2M4N A;  1V81 A;  2L00 B;  4GDK A;  3L17 A;  2D2Q A;  2LXC A;  3ML9 A;  2KJH B;  2J7Q B;  3ALB A;  4ASW C;  3PRP B;  4GMV A;  3D32 A;  3S2A A;  1ZKH A;  4EZJ A;  1Z5S B;  4NQK E;  1XT9 B;  3QJZ A;  1D3Z A;  1X1M A;  2IBI B;  2K6D B;  1V80 A;  4ZRI A;  3TJP A;  3V61 A;  3ZNZ B;  2I1K A;  3DVN V;  4IUM B;  1WX8 A;  1Q0W B;  2IY1 B;  2JY6 A;  1TGZ B;  2NPT B;  3MTN B;  4JQW C;  2KO3 A;  3H6N A;  1WX9 A;  3GZN I;  2KDE B;  4IG7 B;  3R7Q A;  2LZ6 A;  2LVP A;  4AJW A;  2MLB A;  3M63 B;  2ZNV B;  2BKR B;  2BKF A;  4GDK B;  3A9J A;  1YD8 U;  2J0M A;  1WXM A;  2MSE D;  2KD0 A;  4MEM A;  3R66 C;  2L0T A;  3H7P A;  2ZVO A;  1I42 A;  4DHJ B;  2D11 A;  3DBR I;  2B3A A;  1KOT A;  4F1S A;  2QHO A;  2IYD B;  2N1W A;  2N7D A;  4BFR A;  1E8Z A;  1WY8 A;  4BVU C;  2LVQ A;  5LXI B;  4JIO U;  1WE7 A;  3JVZ X;  4DWF A;  1E90 A;  1V5O A;  2G4D B;  3DVG Y;  4URK A;  1GNU A;  3ZDM C;  3APF A;  4A3O A;  3KUZ A;  4GDL A;  2CHZ A;  4K1R B;  4M0W B;  2L05 A;  4W9J A;  3H7P B;  3UQA A;  1NI2 A;  4MDK E;  3PTF C;  3KUD B;  2LGD A;  1VCB A;  2GBK A;  2GBJ A;  3KYC D;  3EEC A;  2K25 A;  1GJZ A;  4NJ7 A;  2Z0D B;  4EUT A;  3IVF A;  3UIN B;  3DPD A;  1YQB A;  2FNJ B;  4HXD A;  1UBQ A;  3QA8 A;  2CS4 A;  2HD5 B;  2V4L A;  3VXW A;  1WE6 A;  2GOW A;  2C60 A;  2LRU A;  5JHB A;  2MBE A;  2FCQ A;  2NBW B;  2G45 B;  2G4S A;  1T0Y A;  3KUC B;  4GDL B;  4RM9 A;  1SE9 A;  2BYE A;  3DBS A;  2K8H A;  3ZNI D;  4BBN F;  4HLE A;  3VVW B;  2JT4 B;  3QX1 A;  5DPT A;  3I3T B;  2C7M B;  4HWI B;  4BKT A;  4I6P A;  2L76 A;  1WJ4 A;  2JF5 A;  3HIZ A;  4KVG B;  3SU8 X;  5D6J B;  1S1Q B;  2KZR A;  2KX0 A;  2KQ7 A;  4KZ0 A;  4W9K A;  2WDT B;  4AJY B;  2PE9 A;  4JL9 A;  1WXV A;  1L2N A;  4WWO A;  5L95 C;  4DBG A;  4KDI C;  3ZNH B;  2FCS A;  1WXA A;  2MWS B;  1ZGU B;  3APD A;  3ZRF A;  4ZYN A;  1RLF A;  4CO7 A;  3TL5 A;  2K39 A;  3CST A;  4ZRK A;  4FA6 A;  4NAW A;  3AUL A;  3L10 B;  3EFU A;  3ENE A;  1V49 A;  2DYM A;  3CF6 E;  4K81 A;  1M94 A;  4OVV A;  2A4Z A;  2CHW A;  2HE7 A;  2A5U A;  2KX3 A;  4IM3 A;  3PT2 B;  4FLH A;  2LGX A;  3H7S A;  4W9E A;  3BIN A;  2KDB A;  3M3J A;  3ZKJ C;  3PLV A;  5AZG A;  2J0K A;  5CTR C;  5TR5 A;  3JSV B;  2BWF A;  3PPA A;  1WJ6 A;  4YL8 A;  2O6V A;  2R2Q A;  3Q3J A;  2D07 B;  2MBB B;  1GC6 A;  2LXA A;  2KDF B;  1TTN A;  4II2 B;  1WRD B;  2KLC A;  4IM0 A;  5E6N A;  5DCN A;  4BBN C;  2K8B A;  1WMH B;  3IHP C;  4KV2 A;  1U4A A;  1WJN A;  3A9K B;  4HJK A;  1LQB A;  5KHQ A;  3UF8 A;  4DHJ D;  4HVB A;  2N9P C;  1WYW B;  1LXD A;  4HK2 A;  2RPQ A;  2NPT A;  4GXB A;  3KYD D;  1V86 A;  1S3S G;  3NZS A;  4W9D A;  5AZF A;  2ZPY A;  3LJ3 A;  4I6L B;  2O6V B;  3RZW C;  4GIV A;  4M8N A;  3UQB A;  3H1U A;  1F9J A;  2G3Q B;  2ZPN A;  1P3Q U;  3ECI A;  4E74 A;  2RR9 A;  4DXA B;  5KHO A;  3IFW B;  4II3 B;  1IYF A;  1I35 A;  1WXS A;  3ZRC A;  1IPG A;  2JZZ A;  4ZDV A;  1RFA A;  4NJ6 A;  1J19 A;  2GBM A;  4B6W A;  4CHK A;  2K6Q A;  1JRU A;  3PV1 A;  1K8R B;  2Z0E B;  1WZ3 A;  3TBL D;  3EC8 A;  3PZD A;  5FR6 A;  3W1S A;  3B1L X;  2LI5 A;  4ZRJ A;  2PPH A;  2KWC A;  4G11 A;  4TUU A;  3V60 A;  2NBU A;  1NBF C;  3IG3 A;  3N32 A;  1P1A A;  2YLM A;  1R4M I;  2GBN A;  3QIJ A;  4B95 A;  1G6J A;  3SD5 A;  1J0G A;  3DCG A;  3L0W B;  5C23 A;  3WAL A;  3X23 A;  2MBH A;  4FBJ B;  3X0W A;  5CX3 A;  1RRB A;  2XBB C;  4N9F 4;  4RMA A;  3DBH I;  3OLM D;  2ZCB A;  1Z2M A;  4AOF A;  1KJT A;  1HE8 A;  3EHV A;  3VHT C;  2YVC A;  1WGH A;  2O2V B;  1YX5 B;  2D10 A;  2MBO A;  2N1V A;  3TCA A;  3NY5 A;  2DAF A;  2DYB A;  2V1Y A;  5CHF A;  5EDS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...