2PE6B

Non-covalent complex between human sumo-1 and human ubc9
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
74
structure length
74
Chain Sequence
YIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Analysis of a Complex between SUMO and Ubc9 Illustrates Features of a Conserved E2-Ubl Interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding, ligase
molecule keywords SUMO-conjugating enzyme UBC9
total genus 15
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2007-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2pe6B00
5AEKB 5DPWA 3L13A 3UIPB 1V2YA 4YL8A 3NY5A 2GBJA 4HCNB 4W9GA 1WIAA 2FCQA 3H7PA 3L17A 1J0GA 4I6LB 2KTRB 2PJHA 1KM7A 3EFUA 3TCAA 1H8CA 1S3SG 2EKEC 1EF1A 2G45B 3X0WA 2LD9A 3EC8A 3QC8B 4MEMA 3TL5A 4A20A 3V6EB 1NBFC 3L54A 1R4NI 4K7WA 2DYBA 4DDID 1Q5WB 2ZPNA 2C7HA 1UELA 2IO1B 3QIJA 1WH3A 2NR2A 2ZNVC 4WJQA 2DZIA 4FJVB 1XQQA 4TQ1A 4W9JA 5DPTA 1LM8B 2DAJA 3U8ZA 4ASWC 2D07B 1UBIA 5D94A 4IWQA 2NPTB 2IY1B 2N7DA 2R2QA 2K39A 2KJHB 5G2NA 3ZVVA 2KDFB 1VCBA 3JVZX 2MP2B 3AU4A 1IPGA 1YX5B 2RR9A 2VRRB 1V9JA 2XK5B 3PHWB 4FJZA 4MDKE 1WX8A 2MQJA 3ZNZB 1C1YB 3ZTCA 3VTUA 4EFOA 3A4SC 3AXCA 2FIDA 4TKNA 4ANXA 2KZRA 4EUTA 1T0YA 4F7ZA 3KUDB 4W9FA 2ZJDA 4PYUA 3PHXB 4DHZE 4EKUA 4LDTB 4NNJB 1E90A 2KFKB 4URKA 1F9JA 2KOXA 4KV2A 2KXJA 1V5TA 2CHWA 4JL9A 1IYFA 1OTRB 2KN5A 3IFWB 2BWES 5D2MB 4BBNC 4ANVA 2BYEA 4W9IA 4XX5A 3O65B 4CO7A 4K1RB 4IC7B 2NS5A 2J7QB 3AI5A 4PS3A 1LFDA 2MW5A 3UF8A 4FHKA 1WF9A 2MP2A 2V3SA 3DCGA 1E5WA 2IO0B 2D2QA 2KNBA 3RULA 2D10A 2KTRA 2I1KA 3ZW3A 4ANUA 2PE6B 3CMMB 3QCAA 4DHJD 1V6EA 1GC6A 1WJUA 2DYMA 5C1ZA 5JZEB 3DBHI 1XD3B 3EHVA 3QARA 3R7RA 4E3CA 1GJZA 2MBOA 3VQIA 4NQKE 2KC1A 3WAMA 2KFKA 3ENEA 2JUOA 4NQLB 5IA7A 4BKSA 1C3TA 4EZKA 2K6QA 1WY8A 2J0KA 3W1SC 1WXVA 4I6PA 2MBQA 3ZRFA 4AP4C 3VFKA 1WXAA 2I1JA 1WZ3A 2LJ5A 3VDZA 4XZ4A 4HLEA 3WALA 4RM8A 4CYEA 4DBGA 4AWJA 3U30A 1P3QU 2W9NA 3NHEB 4BKTA 2MBEA 1WM3A 3QAQA 2NVUI 2KMAA 2KX0A 3PV1A 2AYOB 4ANWA 3T8MA 1Z5SB 3NS8A 1MG8A 2K8CA 2ZCCA 3GZNI 1EO6A 2KJ6A 2KLCA 4MJSB 2N9XA 2C7NB 3ZUNA 3K9PB 2G4DB 4B95A 3DQVA 5AZHA 1OGWA 1P98A 4NAWA 3RT3B 4MGKE 3PGEA 3V6CB 2L8JA 3B08A 5DPRA 4J6IA 2JZ3B 4MSQB 2JVCA 4BBNF 3A1QA 3I3TB 3P2BA 1YJ1A 4B6WA 4ICVA 4HDOA 1WGRA 2IYDB 4G11A 4JLCA 1WX9A 3ML9A 5DPSA 3JYUA 3D32A 3UGBB 1QZEA 2KDIA 2M0XA 3DVGX 1ZGUB 2V1YA 4AJYB 4IM3A 1E8ZA 3QWZB 1WM2A 4DXAB 2N1VA 4JGHB 4AJWA 5G55A 1Y8RC 1WI0A 2QHOA 3LJ3A 2LGDA 3VUXA 2Z0EB 2HTHA 1V81A 3DVNV 3PSEB 4HJKA 4EEWA 1P0RA 2ZEQA 2N9EB 3A1QB 2K8HA 3L16A 2BKFA 2HE7A 5E6PA 4GSWA 1R4MI 4DWFA 2CHZA 3L10B 3TMPB 4PYZA 4KVGB 2R2OA 4KIKA 2FCMA 3PRMB 2C7MB 2DENB 2C5LC 2KHWB 1SE9A 2BPSA 4FJYA 3QA8A 3W1SA 2L3ZA 1EUVB 3Q3FA 2LGXA 5JHBA 2DZKA 2KLGA 4W9HA 1VD2A 2ZZPB 2CS4A 4MM3A 3CSFA 3DOWA 2KDBA 1LQBA 2NCNA 5TR5A 3VUYA 2GMIC 2DZJA 2BYVE 5E6OA 1U4AA 3ZNHB 2MSED 4GU2A 3PT2B 4WJNA 3RD2A 4KZ0A 3WAOA 4HCPB 3ZNID 3VH4B 1YX6B 1Z2MA 3VUWA 3ONSA 2Y5BB 4GDLB 2MBHA 4BVUC 2DAFA 5L95C 2BWFA 1L2NA 2KWVB 5BO4B 1V49A 2KDEB 2N9PC 4NAWB 2HD5B 2K8BA 3IBEA 4TV3A 1ZW7A 2J0MA 2LRWA 3B0AA 3M95A 4HPLB 3U7DA 3V62A 1UBQA 2XEWA 1WGHA 1E8XA 2GOWA 4W9KA 3DPDA 2C9WB 3BINA 2LI5A 3CSTA 4HWIB 4IWPA 5CHWA 4PS8A 2XK5A 3A33B 2IO2B 4OVVA 3UINB 2HJ8A 2L05A 4HXDA 4LDTD 4CHKA 3C0RB 4EOYA 3QQ8B 2CHXA 3Q3JA 4F1SA 2JPHA 2ASQA 2FCNA 4G3XB 3RUIB 3ZTDA 1JRUA 2KVRA 3PPAA 3KW5B 1E8WA 1SIFA 4LJPB 1OEYJ 3VAWA 1I35A 4JIOU 3JSVA 2AL3A 3ECIA 3SD5A 3B1LX 4ZYNA 2C60A 3ML8A 4IM2A 1GG3A 2M1MA 5GMVA 4ZRKA 2L00B 4A3OA 3N32A 1RAXA 3R3MA 3WANA 5HKHA 2YVCA 3N3KB 2JY6A 2LXCA 2WX1A 3ALBA 4WAAA 2LVOA 2N1WA 4IG7B 1WJNA 3H6NA 3DBSA 4E74A 4BKSD 4P7IA 4NPNA 3NZSA 4GB9A 1G6JA 3MTNB 3PRZA 1KLVA 2RD0A 5CHFA 2NBUA 5KHQA 3JW0X 3PVLA 4GDLA 3T9LA 4RM9A 3M63B 3VTVA 1GC7A 2IY0B 2YLMA 4FBJB 4HPMB 1WXMA 2LXAA 2M4NA 3AU5A 1PQSA 3PLUA 4JQWC 3JSVB 1LXDA 1UH6A 3PLVA 4BOZB 2UWQA 2KKCA 3QHTA 3IVFA 1YQBA 2JWZA 5LXHA 4GOCA 2EMTA 2A5UA 3ZKJC 3LDZE 4WWPA 4DK5A 2JRHA 4W9DA 1Q1OA 1RFAA 3ZIMA 4NJ7A 4TUUA 3VVWB 2K25A 2DHZA 2LVQA 5AZGA 4KZCA 4K7SA 4I6NB 4GDKB 3QX1A 4FA6A 3UIOB 5KHOA 3EECA 4MJSA 1FXTB 3M62B 4IM0A 3APDA 2IZVB 2BYFA 2KC2A 3K9OB 5AZFA 4B9KA 2REXA 2CKHB 3M3JA 2FAZA 4FADA 3A9KB 1OQYA 5D6JB 2KX3A 2MA9B 2LWPA 3NZUA 2LZ6A 3PREA 4N9F4 5E6NA 3HM6X 1NI2A 4WWOA 1SGHA 4NJ6A 5J2RA 3MHSD 1OEYA 4HK2A 1I42A 1V86A 4GXBA 2MLBA 2MX2A 3OAWA 2J0JA 1WMHB 3UQAA 4X57B 1D3ZA 2G3QB 2O6VD 4FULA 2N4FA 1EF5A 4KDIC 2JT4B 4GDKA 1J8CA 3PZDA 2RSUA 2Z59B 1ISNA 2O6VB 2NBWB 2WWZA 4E71A 1WZ0A 4II2B 4OVUA 2JXXA 3A9KA 3V61A 1TZ1A 1YD8U 2V4LA 2LASA 2KWUB 2XBBC 2KMCA 5IAAC 1M94A 1X1MA 2RGFA 2PE9A 2ZVOA 4DDGD 1E7VA 3PRPB 2KFJA 4HVBA 4BFRA 3GOEA 3ZDMC 2PPHA 3H7SA 4ZRIA 2DZMA 2GBNA 2MWSB 4PS7A 3HIZA 5CX3A 3R7QA 4KIKB 1GNUA 2KJRA 1P1AA 2ZPYA 3QK0A 1WFYA 4A3PA 4F8CB 1A5RA 2D11A 3X23A 4MGZE 2FUHB 4ZRJA 2K6DB 1WJ6A 2FNJB 1WRDB 3HM3A 2DX5B 2ZVNA 4KSLC 3NOBA 4ZDVA 2JZZA 2OJRA 4G50A 1TGZB 3S2AA 4WWNA 2LVPA 4W9LA 3SU8X 1K8RB 2O2VB 1UGMA 2GBMA 3RZFA 1WX7A 2AEHA 2MCNB 1WMHA 2BF8B 2UYZB 3OLMD 4LJOB 3TIXA 2FCSA 3IG3A 2B3AA 1UZXB 3DBLI 3CF6E 3ZNGC 4KDLB 4FN2A 2L0TA 4XC2A 1WXSA 2KD0A 2L0FA 1WR6E 2WDTB 1WR1A 2CR5A 1AARA 1V80A 2WYQA 3DVGY 3KUZA 2G4SA 5L83A 4MGYE 4WJOA 3ZDTA 5EDSA 3H9DA 4II3B 4GGQA 3WAPA 3APFA 2O2VA 4RMAA 3ZRCA 1NDDA 3HHMA 1P9DU 1KOTA 3VHTC 5JHAA 2L7RA 5LXIB 3L08A 3SHQA 4K7UA 4IW0A 2EMSA 2KQSA 3OJ3A 1WJ4A 4EZJA 3UQBA 3H7PB 4GMVA 1WE7A 4MELA 3KYDD 2WX0A 1RRBA 2O6VA 2KK8A 1CMXB 3WA0A 3PS6A 2GBKA 5CHVC 2RPQA 2IO3B 3KYCD 3APCA 2KTFA 1S1QB 5LLIA 4GIVA 4MSMB 3RYTA 3A4RA 4M0WB 5FR6A 3IHPC 3VH3B 1HE8A 3RCZA 4TQ0A 3A9JA 4W9EA 5DCNA 2D3GA 3KVFB 4DHZB 2GBRA 2JF5A 5D7GA 3SDLC 1J19A 1V5OA 2LUEA 4FHJA 3ZLZA 2NBVB 4W9CA 3VTWA 4HDQA 5JH5C 4DHJB 3HK0A 4WQOB 4AOFA 4G0NB 1IP9A 5C23A 3N30A 2FIFA 1Q0WB 3DBRI 3QJZA 3V60A 2ZCBA 1TBEA 3TJPA 4EZLA 3PTFC 3TBLD 2MRPA 1UD7A 2M17A 4FLHA 4MH0E 4AUQC 1BT0A 1RLFA 2Z0DB 1L7YA 2K1FA 5J18A 2IBIB 1ZKHA 3L0WB 2AWTA 4GN1A 4WJPA 5CTRC 2KO3A 1GUAB 1E8YA 4BOSC 2N7EA 2BGFA 2KQ7A 4MGIE 1TTNA 2PEAA 3A9JB 3H1UA 2LGYA 3OJ4B 3R66C 2BKRB 2OOBB 1YIWA 3W1YA 3VXWA 3AULA 1WGYA 1XT9B 2M8SA 4IUMB 2L76A 1WGDA 2ZNVB 3WIMA 4BKGA 3KUCB 3MJWA 4NY0A 4K81A 1WGGA 3DDCB 5J17A 2KWCA 4ICUA 2JRIB 2CU1A 4M8NA 3RZWC 3ZO5B 1E7UA 1KJTA 1WYWB 4IWOA 3KH0A 4M8MA 2LRUA 1WE6A 2MBBB 3BY4B 2DYOA 1H4RA 2NPTA 2AL6A 3DVNU 4LCDE 2A4ZA 2KANA 4KSKC
chains in the Genus database with same CATH superfamily
4OZAA 2Q5WD 4HCNB 2FCQA 3H7PA 4I6LB 1T0QC 1K51A 2WXOA 3TL5A 3AN1A 3V6EB 1NBFC 3AE7B 4WJQA 1QOFA 2M0AA 4HKZE 4W9JA 1XQQA 3BVZA 3U8ZA 2H89B 1C4PA 3ZVVA 2R2QA 2KJHB 1XF5L 1VCBA 3AU4A 1DYQA 4MDKE 4WH4A 1WX8A 1C1YB 3ZTCA 2WU5B 3ZJVA 2KZRA 4F7ZA 3KUDB 4PYUA 2W54A 1E90A 2KFKB 1V1PA 2KOXA 4KV2A 1V5TA 5D2MB 2ZW0A 4RGTA 2MW5A 3MJ5A 4FHKA 4LNOA 3VR8B 2KTRA 3ZW3A 1FCLA 3H8HA 2FBWB 3HVDA 4XGAB 1V6EA 5EE1A 2LGSA 3R7RA 4NQKE 3ENEA 4NQLB 4BKSA 5EE9A 1ZUD2 2KWDA 4AP4C 2IGHA 3RPFC 1K50A 1E7PB 3HRDD 5T8IA 1FNWA 3NHEB 3PV1A 2KN4A 1EU4A 1IGDA 4JX1C 1MG8A 3AE8B 2KLCA 1SXTA 2N9XA 1T3QA 1CZPA 4NAWA 4MGKE 1I4GA 2MHJA 3B08A 4J6IA 4MSQB 4KGRA 2AQ1B 3I3TB 1F2RI 4HRSA 4ICVA 1WGRA 2IYDB 4G11A 5E6JA 5DPSA 3FAHA 3JYUA 4AJYB 3QWZB 3N20C 4AJWA 1WI0A 4ITKA 2LGDA 2Z0EB 1V81A 3RNEC 1BUIC 4HJKA 1P0RA 4P1CC 2K8HA 3AE3B 3AE2B 3TMPB 1YQ4B 4KIKA 5H8YE 1JROA 4KGTA 2CJNA 4FJYA 5MPOA 1PUTA 4OVZA 2J4XA 2KDBA 2NCNA 4US8A 5TR5A 2DZJA 5E6OA 1HEZE 4OZBA 2MJEA 2L52A 3VH4B 1YX6B 2RDBC 1OQQA 4JWUC 5L95C 3FILB 3VR9B 3BWUD 1T0SC 2PLPA 4KX6B 1L0YB 1UUPA 1ZPSA 3V62A 2XEWA 3NRZA 4ARCA 4W9KA 3DPDA 2C9WB 3BINA 2BQQA 2KT7A 4XWTA 5CHWA 4UDUC 2KAJA 2IO2B 1F1HA 3UINB 2L05A 2LMCA 4L2YA 4CHKA 4EOYA 1TKYA 2CHXA 3Q3JA 2JPHA 4G3XB 3ZTDA 3PPAA 1I35A 4JIOU 3BVGA 3CWIA 1FXIA 4ZYNA 2ON8A 3I5JC 2M1MA 4A3OA 3TEZA 3N32A 3R3MA 2YVCA 3AE1B 4WAAA 2LVOA 2N1WA 1WJNA 2IDYA 3H6NA 4BKSD 4P7IA 4AS1A 1G6JA 1FMAD 1KLVA 2PIAA 5CHFA 3JW0X 3PVLA 3O13A 3T9LA 4KGSA 4RM9A 1NENB 3VTVA 4HPMB 2QC8A 3AU5A 3PLUA 4JQWC 3MP9A 3PLVA 4RGOS 2J42A 3IVFA 1QILA 1WRIA 2A5UA 4WWPA 4DK5A 4QAYA 3VVWB 4ZRPA 2K25A 2LVQA 2BVCA 5HI1A 4K7SA 3UIOB 1I4RA 3EECA 5KHOA 4IM0A 1V97A 3APDA 2AQ2B 2IZVB 1YN5A 4B9KA 2CKHB 2FAZA 1OQYA 2JX5A 4PK1A 2MA9B 2WXGA 3MC9A 2N0SB 1PDXA 2XNAC 3MHSD 2MX2A 4MT5A 4X57B 4FULA 4WURA 4LK0M 3DWMA 1AW7A 1IGCA 2Z59B 3Q8CA 2O6VB 2NBWB 4B0MA 2JXXA 4HPPA 3P63A 2LASA 2KMCA 5IAAC 4M01A 1X1MA 2PE9A 1MI0A 3R2IA 1VZ7A 2KFJA 1KTKA 4BFRA 4HVBA 4US9A 2VZKB 3HIZA 4KIKB 1KLUD 1GNUA 2ZPYA 4A3PA 1A5RA 4MGZE 4ZRJA 1WJ6A 2FNJB 1WRDB 3HM3A 2DX5B 2LUMA 1I4HA 4ZDVA 2SAKA 3BYYB 4G50A 2LVPA 3BYTB 2NTSA 2O2VB 1UGMA 3RZFA 2TSSA 1WXQA 2AEHA 3NG0A 3J9CA 3OLMD 3TIXA 3IG3A 1UZXB 3CF6E 2WXRA 4KDLB 4HJGE 2LGIA 4FN2A 4XC2A 5BYSA 1WXSA 1ZDXA 3CIRB 4IKGA 3AM9A 1K53A 2WS3B 3GS2A 1GB4A 1AARA 1ZE3D 3GB1A 2G4SA 1UWMA 3ZDTA 1XLOA 1FFVA 1CQVA 4DXGA 4YWGG 2JSVX 1ZOYB 1SF0A 2MJ3A 3OJ3A 5G5HA 1I4PA 4MELA 1A70A 3IT4B 2KK8A 2GRIA 3PS6A 5CHVC 1R4NB 2DLBA 2KTFA 4K3BA 1C76A 5LLIA 3RYTA 2Z8LA 3E9SA 1NVID 3Q3NC 2INCC 3DHIC 1GOZA 4TQ0A 1SIJA 4DHZB 3KVFB 2GBRA 5I4DA 4OW0A 4WQOB 3ZXRA 1PGAA 2FIFA 3N30A 3QJZA 3SR6A 2ZCBA 1TBEA 1NEKB 2NTTA 3PTFC 4XYCA 2KQ4X 3BVMA 4MH0E 1RLFA 2Z0DB 1ZKHA 4GN1A 4LNFA 4WJPA 2KO3A 3KWVA 1GUAB 4BOSC 2KQ7A 1YNTE 3VXWA 1WGDA 2NMQA 2ZNVB 2ICIA 4TMAB 4NY0A 3Q8FA 4ZRQA 5J17A 2KWCA 1TS4A 2CU1A 3RZWC 4IWOA 3RNGC 4ZHPA 1C4AA 2DYOA 4OZCA 3T3NA 2KANA 5AEKB 1AN8A 3L13A 5BMHA 4XDDA 3NY5A 3DBRB 3P4RB 3NVWA 3VRAB 3EFUA 2G45B 2WU2B 3P1MA 1ZXIA 3EC8A 3QC8B 4MEMA 4A20A 4S17A 2PMVA 3L54A 1R4NI 4K7WA 1Q5WB 2C7HA 1UELA 5DPTA 3ZXVA 4M0WA 1UBIA 5D94A 4IWQA 2NPTB 2K39A 1YN3A 1TY2A 2RR9A 1V9JA 2XK5B 4FJZA 3FC4A 3AXCA 2FIDA 4TKNA 2WXIA 4URKA 3N1XC 1OQRA 1QLBB 2CHWA 1HTQA 3IFWB 2Y3AA 1QKZA 4ANVA 2BYEA 1AYFA 4XX5A 4K1RB 2NS5A 2BB6A 1LFDA 4XE0A 1TS3A 3DCGA 1E5WA 2KNBA 5FR3A 2D10A 1N6ZA 5AUKA 3QCAA 4LTUA 1GJZA 4ACFA 2MBOA 3VQIA 2QMTA 4AQ7A 1WY8A 2J0KA 3W1SC 1WXVA 4MM3B 2MBQA 1WXAA 2LJ5A 1T6BX 3WALA 2EKIA 3U30A 1E0ZA 1P3QU 2MBEA 1TS2A 1IUEA 1Z5SB 1TT5B 2ZCCA 3GZNI 2WXQA 2BS4B 3ZUNA 4FXCA 2G4DB 4B95A 1P98A 4N6EB 2J53A 2L8JA 5DPRA 2JVCA 4BBNF 3A1QA 4GLSC 4B6WA 1KH0A 5BYRA 1UNSA 3ML9A 2GLSA 3D32A 2M0XA 3DVGX 3LB8C 1ZGUB 2V1YA 1E8ZA 4DXAB 4JGHB 1XEEA 3BK2A 3T3OA 1K52A 3AEFB 4HEA1 2JQRB 1BMLC 3RN9C 3AECB 3L16A 4GSWA 4DWFA 3C19A 3TEWA 2ZW1A 2DENB 2WXKA 1XCTL 1RM6C 3QA8A 2L3ZA 1EUVB 5JHBA 1VD2A 2ZZPB 2CS4A 1J7BA 3VUYA 3AE6B 2BYVE 1U4AA 5AUIA 4KZ0A 2E3TA 1L4ZB 3MFGA 1Z2MA 3VUWA 1J7CA 1VZ6A 2MBHA 1JWUD 2DAFA 2PTLA 2Y5CA 4NAWB 1FRDA 2J0MA 2LRWA 1AWDA 1WGHA 2GOWA 4IWPA 3TUOA 3RI7C 4LLGM 2XK5A 5TSSA 1PYWD 2HJ8A 3C0RB 3QQ8B 4F1SA 4L1BA 1JRUA 4RF0A 2IGDA 4PT5A 1E8WA 1C4CA 1OEYJ 3Q3OC 5IKCM 3ECIA 3SD5A 1GB1A 1ROEA 2L00B 1CJEA 1XO3A 4JWSC 1B9RA 2WXLA 1J7AA 3DHHC 2JY6A 3ALBA 2BB5A 1R7SA 1UGJA 1SE4A 4IG7B 3NUHB 3Q3MC 2WGSA 3RNBC 3PRZA 2LJIA 2RD0A 3LYYA 3NZ3A 4IOIE 4TSSA 1D5MC 2YLMA 4FBJB 1WXMA 2LXAA 3JSVB 1LXDA 1UH6A 1SJHD 2L32A 4BOZB 2UWQA 2KKCA 2JWZA 3ZKJC 1Q1OA 3ZIMA 5AZGA 5EE0A 4GDKB 1WSPA 4MJSA 3M62B 3OG5A 3N9YC 3ETRA 2KYWA 2KC2A 3K9OB 2REXA 1JCKB 5D6JB 1VR9A 3RNFC 2LWPA 4WAFA 1N5WA 5J2RA 4HK2A 1OEYA 2MLBA 1TS5A 1EF5A 3IT6B 5FK9C 2JT4B 3IAS1 3PZDA 2RSUA 1WZ0A 2D5GA 3A9KA 3GE3C 3V61A 1TZ1A 1YD8U 2V4LA 1M94A 1ACCA 1E7VA 1B1ZA 2V3PA 5HHDG 3GOEA 3DBLB 1C78A 2PPHA 4ZRIA 2BT6A 2GBNA 1D5XC 4RH6A 3P4PB 1PFDA 2KJRA 4KSLC 1I4QA 4YSXB 2OJRA 1FNVA 1TGZB 2V9HA 1NI3A 3SU8X 1FIQA 2SEBD 2GBMA 1WX7A 1WWTA 2MCNB 5BYQA 2UYZB 4YTPB 3E56A 4JPSA 2B3AA 3DBLI 3ZNGC 4CQNA 2WXNA 3Q8BA 3RFZB 2UU7A 2FE8A 1V80A 3KUZA 3H9DA 4II3B 4GGQA 3WAPA 2N9KA 1D4BA 1KOTA 1NDDA 2QIEB 4REZA 2L7RA 3U52E 4YTMB 4K7UA 2WXJA 3GE8C 3H7PB 4GMVA 3KYDD 3I9V1 1RRBA 2O6VA 1CMXB 2V3NA 2GBKA 2IO3B 3AEAB 2E6XA 2L83A 3A4RA 4A6QA 4C4VA 1F52A 3PZ8A 2INDC 1P7FA 5FR6A 3VH3B 3ZJUA 3RCZA 4DXFA 3A9JA 5DCNA 2D3GA 5D7GA 1V5OA 3AEEB 4FHJA 3ZLZA 2NBVB 3NJTA 1IP9A 1DOYA 3TJPA 1L0VB 3TBLD 4ZYSA 1UD7A 4FLHA 3DBHB 1OFFA 2IBIB 2RDHA 3L0WB 3WCQA 5CTRC 1EM7A 1ZDVA 2BGFA 2PEAA 5IN7A 1DOIA 2M8SA 4IUMB 2L76A 1C79A 3MJWA 1WGGA 4M8NA 4M8MA 4J3OD 1WE6A 1N63A 1H4RA 1C9FA 4YL8A 4W9GA 1WIAA 1J0GA 2PJHA 1KM7A 1VJKA 2KMMA 1H8CA 2EKEC 1EF1A 3X0WA 2MJDA 2WXPA 2GI9A 2JYTA 2DYBA 4DDID 1QF6A 2ZPNA 4C56C 2IO1B 1WH3A 5J18A 2DZIA 2D07B 2IY1B 5G2NA 3NVZA 4LNNA 2MP2B 4YSZB 1YX5B 5IOIA 3VTUA 4EFOA 3A4SC 2GB1A 2K5PA 4R3DA 1T0YA 2ZJDA 3PHXB 4DHZE 4EKUA 4NNJB 2KXJA 1HQRD 1FO4A 4JL9A 2KN5A 2J7QB 3AI5A 3UF8A 2MEKA 2V3SA 2D2QA 3Q69A 2PE6B 2JYEA 3CMMB 3N1ZC 4DHJD 3EUB2 1WJUA 5C1ZA 1XD3B 2KC1A 2KFKA 1QQRA 2BW2A 1C3TA 2K6QA 2RMMA 2KVZA 3VFKA 2WDRB 1WZ3A 3VDZA 4HLEA 3ZGZA 4RM8A 4CYEA 4AWJA 4BAXA 1MVKA 2J52A 2JU6X 2NVUI 2KMAA 2KX0A 2AYOB 4ANWA 3T8MA 3N1YC 4MJSB 1SSNA 3DQVA 1TIFA 1OGWA 1JRPA 3RT3B 3PGEA 3R8BA 2OEDA 4H2AA 2JZ3B 3ABVB 1N61A 2EELA 1F2RC 3NVVA 1YJ1A 2PVOD 4XDCA 3BIID 3P4SB 5D3IB 1XXGA 2QDFA 4WQMA 3MC8A 1QZEA 4IM3A 1VZ8A 3W5UB 3URYA 2PW9A 4RFBA 1Y8RC 4A55A 1ET9A 1YOVB 4C7ZA 3LJ3A 3UI3A 2HTHA 3NS1A 4IDIA 3DVNV 3PSEB 4Q2JA 3AE9B 1L0XB 2N9EB 3A1QB 5E6PA 4C80A 2BKFA 1D6EC 2CHZA 3L10B 4PYZA 3SFEB 3EA6A 3RNCC 4YT0B 3SEBA 2C5LC 2HJ1A 2YEPB 3B2GA 1CK1A 1SE9A 2BPSA 3Q3FA 2LGXA 2DZKA 2KLGA 4W9HA 2WNMA 4MM3A 3CSFA 1VLBA 1LQBA 1E10A 2GMIC 4GU2A 3PT2B 4WJNA 1KF6B 4HCPB 3ONSA 2Y5BB 4GDLB 4BVUC 4MH8A 2VH2A 1Y56A 5BO4B 1R4MB 2KDEB 2K8BA 4HPLB 1E8XA 2LI5A 3CSTA 1T0RC 2D3AA 4OVVA 1N60A 3EGRA 4HXDA 1XCQL 2ASQA 3RUIB 2KVRA 4LJPB 1SIFA 3VAWA 2FUG1 1XLQA 2AL3A 1HXYD 3FILA 3ML8A 4ZRKA 1FXAA 2WXHA 2QCZA 2LXCA 2QEJC 2WX1A 4ARIA 1IBXB 3DBSA 5BMGA 4E74A 4NPNA 3NZSA 4GB9A 3MTNB 3EFCA 5KHQA 5HG2A 3AV8A 1GC7A 2IY0B 3IAM1 3TSSA 1YQBA 1YMHE 4GOCA 2RDGA 1SEBD 1SBBB 4W9DA 2WLBA 1FFUA 4TUUA 4EE2A 2DHZA 2BYTA 4BZAA 3QX1A 2MH7A 1HZ6A 1FXTB 4FADA 3Q2AC 2KX3A 3NZUA 4N9F4 3OWEB 5E6NA 3VRBB 3HM6X 4WWOA 1SGHA 1N62A 1RWSA 1HTOA 4GXBA 3UQAA 2J0JA 1WMHB 1D3ZA 2O6VD 1ET6A 2N4FA 2WHIA 4GDKA 5LNK1 3U7ZA 3PZ7A 1J8CA 1JMLA 1ISNA 2WWZA 2BBCA 1WGKA 3MC0B 2KWUB 2XBBC 4DDGD 3PRPB 3B2FA 1MG4A 3AMZA 3ZDMC 1SJED 3H7SA 1TYGB 2MWSB 2QILA 3R7QA 1MHXA 4HKQA 3W5VB 2LEKA 2INNE 4F8CB 1P1AA 3QK0A 2D11A 3X23A 1HZ5A 2K6DB 2ZVNA 3NOBA 2PVGC 2JZZA 3S2AA 2WP9B 1LGRA 2BS3B 4YTNB 3Q8EA 1MFWA 5IP4D 2LHEA 2AX5A 2KD0A 1TKGA 2CJOA 1TZOA 1WR6E 1WR1A 2Y5PA 2INPE 2CR5A 4JE3B 4WJOA 5EDSA 3R2TA 3APFA 2O2VA 3ZRCA 3HHMA 1P9DU 3VHTC 2XN9C 5LXIB 3SHQA 4IW0A 2M56B 2EMSA 1WJ4A 4EZJA 2X38A 3DWGC 1TKEA 3KWLA 1FNUA 3WA0A 2V4IB 3KYCD 3Q8AA 3APCA 2G9HD 1S1QB 4D2KA 1XLPA 4MSMB 4L23A 2D3CA 2QJLA 4M02A 1HE8A 3ZQ4A 4W9EA 2JF5A 3SDLC 1J19A 2YEPF 2LUEA 4W9CA 3VTWA 2W55A 4DHJB 3HK0A 1GAQB 2LFIA 4G0NB 5C23A 3IXSA 3DBRI 1ZP0B 1BXTA 1KRHA 4K3CA 2MRPA 2M17A 2I2YA 1L7YA 2K1FA 1E8YA 2BS2B 1M4VA 2N7EA 1SE3A 4MGIE 2W3RA 3OJ4B 2LGYA 3NVYA 1ZXHA 1YIWA 2H88B 1SE2A 3W1YA 1WGYA 1NYRA 1XT9B 4NJCA 3KUCB 5IO9A 3DDCB 2WDVB 4ICUA 3ZO5B 5EE3A 1E7UA 1KJTA 1WYWB 2DNFA 2MBBB 3BY4B 4C00A 2NPTA 2B76B 1V8CA 5DPWA 4A9AA 3UIPB 1V2YA 3Q14C 2K22A 2GBJA 4ZHOA 3L17A 2KTRB 4N59A 3TCAA 1S3SG 3ZYYX 2LD9A 1JALA 3QIJA 2NR2A 2ZNVC 4FJVB 4TQ1A 1E9MA 1LM8B 2DAJA 3AB5A 4ASWC 1L5PA 4RCOA 2D3BA 4YXDB 2N7DA 4XWWA 2KDFB 3JVZX 1IPGA 4OHJA 1JWAD 2VRRB 3PHWB 3ZNZB 2MQJA 1FEHA 1DGJA 4ANXA 4EUTA 4W9FA 4LDTB 1F9JA 1IYFA 1OTRB 2BWES 5FKAC 4BBNC 4W9IA 3O65B 4CO7A 4IC7B 3BK1A 4O1NA 4PS3A 2WXMA 1WF9A 2MP2A 2IO0B 1GPXA 3RULA 2I1KA 1NYQA 4ANUA 1UWXA 1GC6A 3V05A 2DYMA 3V3XA 5JZEB 3DBHI 3EHVA 3QARA 4E3CA 2K3UA 3WAMA 1STEA 2JUOA 5IA7A 1QOAA 4EZKA 2OHFA 4NZLB 4I6PA 3ZRFA 2I1JA 3GP7A 1MPEA 4XZ4A 1JW9D 4DBGA 2W9NA 4BKTA 1WM3A 3QAQA 3KLSX 2PKOA 2K0PA 3NS8A 1FPYA 2K8CA 1EO6A 2KJ6A 2C7NB 3K9PB 5HFYA 3TEYA 2X8XX 5AZHA 2DWQA 1RFKA 2W82A 3V6CB 1QT9A 3P2BA 3AE4B 4HDOA 4WWMA 1VRAB 4JLCA 4C7YA 1WX9A 5GXGB 3UGBB 2KDIA 4RNAA 3BZDB 1WM2A 1FRRA 2N1VA 5G55A 2QHOA 3VUXA 5C3JB 1N5XA 4EEWA 2ZEQA 2HE7A 1R4MI 4HROA 3SFDB 4KVGB 2R2OA 2FCMA 3PRMB 3ZJTA 2C7MB 1TY0A 4LNIA 2KHWB 2R61A 3W1SA 2VZKD 1FCCC 3I63C 3DOWA 1FM0D 1DOXA 2KACA 3ZNHB 2AQ3B 2G1EA 2MSED 1KFYB 3RD2A 3WAOA 3ZNID 2IGGA 1JQ4A 4NAMA 4P6VF 2BWFA 1L2NA 2KWVB 4A8XC 3P42A 1V49A 2N9PC 2HD5B 3IBEA 4TV3A 1ZW7A 3B0AA 3M95A 3U7DA 3HUIA 1UBQA 4HWIB 1Q10A 3A33B 4PS8A 1XLNA 4LDTD 1ENFA 5JXVA 1P7EA 2FCNA 2WXFA 3AEBB 3KW5B 2WDQB 2M19A 1V1PB 3JSVA 3B1LX 2C60A 4IM2A 1GG3A 5GMVA 2V0GA 4DQOC 4KKIA 1RAXA 3WANA 5HKHA 3N3KB 3I57A 3P4QB 4RGNA 1F77A 3AEGB 4YSYB 5C2TB 1D5ZC 4A90A 1PGXA 1ESFA 2NBUA 4GDLA 2LHDA 1VDVA 3M63B 1SB3C 1C77A 2M4NA 1PQSA 1LO5D 2RPVA 3QHTA 1UF0A 1YJJA 3MHZA 1YJIA 1EWCA 5LXHA 2EMTA 1QOGA 4ZOHC 3LDZE 1KLGD 2JRHA 1E6EB 3AE5B 3W2DA 1RFAA 4NJ7A 4KZCA 1F0ZA 3U4EG 4KKJA 4I6NB 4FA6A 1V1OA 2CU3A 2DBYA 4WIPA 1HA5A 2BYFA 5AZFA 3M3JA 3A9KB 1I4XA 1MJDA 2LZ6A 3PREA 1NI2A 3LXFA 4NJ6A 2ACZB 3HVZA 1I42A 1V86A 3W9CB 3OAWA 5D3DA 2JWUA 2G3QB 4KDIC 1FD6A 2WQYB 4M00A 4E71A 4II2B 4OVUA 5H92C 3RMKC 3AEDB 5BMIA 2ZVOA 2RGFA 1IBXA 4N58A 2DZMA 4PS7A 5CX3A 3U2SC 3B9JA 1WFYA 2FUHB 2KDMA 1JWMD 4WWNA 4W9LA 1K8RB 4MACA 3L4PA 2IJ0A 4P1BC 1WMHA 2BF8B 2K9XA 4LJOB 4USAA 1EWYC 1L4DB 2FCSA 2N9LA 3FKYA 2IPKD 2L0TA 1L6UA 2L0FA 2WDTB 2VH1A 2WYQA 3DVGY 5L83A 4MGYE 1YN4A 4C4VB 1WYGA 4RMAA 4RF1A 5JHAA 2JXTA 2HTME 3L08A 1RYJA 1QOBA 4S0RA 2KQSA 3UQBA 2W3SA 1TJEA 3TEXA 2QSDA 1WE7A 3Q6BA 4P16A 2WX0A 1I7HA 2HDEA 2RPQA 2L1AA 3AH7A 4B0EA 4GIVA 2BTEA 4M0WB 3IHPC 2I38A 2OJWA 2JZPA 4RGMA 1JWSD 5JH5C 1MHHE 4HDQA 4AOFA 1Q0WB 3V60A 1L6VA 4EZLA 2ONQA 4AUQC 1BT0A 3GZNB 2AWTA 3DHGC 3PO0A 1EU3A 1TTNA 3A9JB 3H1UA 3C8YA 3R66C 2BKRB 2OOBB 3RNAC 4LNKA 3AULA 3WIMA 3KQ4A 1PGBA 4BKGA 4K81A 2JRIB 3KH0A 1T5XD 2LRUA 2N7JA 1JWBD 1YQ3B 5G5GA 2AL6A 3DVNU 4LCDE 2A4ZA 4KSKC
chains in the Genus database with same CATH topology
5AEKB 5DPWA 3L13A 3UIPB 1V2YA 4YL8A 3NY5A 2GBJA 4HCNB 4W9GA 1WIAA 2FCQA 3H7PA 3L17A 1J0GA 4I6LB 2KTRB 2PJHA 1KM7A 3EFUA 3TCAA 1H8CA 1S3SG 2EKEC 1EF1A 2G45B 3X0WA 2LD9A 3EC8A 3QC8B 4MEMA 3TL5A 4A20A 3V6EB 1NBFC 3L54A 1R4NI 4K7WA 2DYBA 4DDID 1Q5WB 2ZPNA 2C7HA 1UELA 2IO1B 3QIJA 1WH3A 2NR2A 2ZNVC 4WJQA 2DZIA 4FJVB 1XQQA 4TQ1A 4W9JA 5DPTA 1LM8B 2DAJA 3U8ZA 4ASWC 2D07B 1UBIA 5D94A 4IWQA 2NPTB 2IY1B 2N7DA 2R2QA 2K39A 2KJHB 5G2NA 3ZVVA 2KDFB 1VCBA 3JVZX 2MP2B 3AU4A 1IPGA 1YX5B 2RR9A 2VRRB 1V9JA 2XK5B 3PHWB 4FJZA 4MDKE 1WX8A 2MQJA 3ZNZB 1C1YB 3ZTCA 3VTUA 4EFOA 3A4SC 3AXCA 2FIDA 4TKNA 4ANXA 2KZRA 4EUTA 1T0YA 4F7ZA 3KUDB 4W9FA 2ZJDA 4PYUA 3PHXB 4DHZE 4EKUA 4LDTB 4NNJB 1E90A 2KFKB 4URKA 1F9JA 2KOXA 4KV2A 2KXJA 1V5TA 2CHWA 4JL9A 1IYFA 1OTRB 2KN5A 3IFWB 2BWES 5D2MB 4BBNC 4ANVA 2BYEA 4W9IA 4XX5A 3O65B 4CO7A 4K1RB 4IC7B 2NS5A 2J7QB 3AI5A 4PS3A 1LFDA 2MW5A 3UF8A 4FHKA 1WF9A 2MP2A 2V3SA 3DCGA 1E5WA 2IO0B 2D2QA 2KNBA 3RULA 2D10A 2KTRA 2I1KA 3ZW3A 4ANUA 2PE6B 3CMMB 3QCAA 4DHJD 1V6EA 1GC6A 1WJUA 2DYMA 5C1ZA 5JZEB 3DBHI 1XD3B 3EHVA 3QARA 3R7RA 4E3CA 1GJZA 2MBOA 3VQIA 4NQKE 2KC1A 3WAMA 2KFKA 3ENEA 2JUOA 4NQLB 5IA7A 4BKSA 1C3TA 4EZKA 2K6QA 1WY8A 2J0KA 3W1SC 1WXVA 4I6PA 2MBQA 3ZRFA 4AP4C 3VFKA 1WXAA 2I1JA 1WZ3A 2LJ5A 3VDZA 4XZ4A 4HLEA 3WALA 4RM8A 4CYEA 4DBGA 4AWJA 3U30A 1P3QU 2W9NA 3NHEB 4BKTA 2MBEA 1WM3A 3QAQA 2NVUI 2KMAA 2KX0A 3PV1A 2AYOB 4ANWA 3T8MA 1Z5SB 3NS8A 1MG8A 2K8CA 2ZCCA 3GZNI 1EO6A 2KJ6A 2KLCA 4MJSB 2N9XA 2C7NB 3ZUNA 3K9PB 2G4DB 4B95A 3DQVA 5AZHA 1OGWA 1P98A 4NAWA 3RT3B 4MGKE 3PGEA 3V6CB 2L8JA 3B08A 5DPRA 4J6IA 2JZ3B 4MSQB 2JVCA 4BBNF 3A1QA 3I3TB 3P2BA 1YJ1A 4B6WA 4ICVA 4HDOA 1WGRA 2IYDB 4G11A 4JLCA 1WX9A 3ML9A 5DPSA 3JYUA 3D32A 3UGBB 1QZEA 2KDIA 2M0XA 3DVGX 1ZGUB 2V1YA 4AJYB 4IM3A 1E8ZA 3QWZB 1WM2A 4DXAB 2N1VA 4JGHB 4AJWA 5G55A 1Y8RC 1WI0A 2QHOA 3LJ3A 2LGDA 3VUXA 2Z0EB 2HTHA 1V81A 3DVNV 3PSEB 4HJKA 4EEWA 1P0RA 2ZEQA 2N9EB 3A1QB 2K8HA 3L16A 2BKFA 2HE7A 5E6PA 4GSWA 1R4MI 4DWFA 2CHZA 3L10B 3TMPB 4PYZA 4KVGB 2R2OA 4KIKA 2FCMA 3PRMB 2C7MB 2DENB 2C5LC 2KHWB 1SE9A 2BPSA 4FJYA 3QA8A 3W1SA 2L3ZA 1EUVB 3Q3FA 2LGXA 5JHBA 2DZKA 2KLGA 4W9HA 1VD2A 2ZZPB 2CS4A 4MM3A 3CSFA 3DOWA 2KDBA 1LQBA 2NCNA 5TR5A 3VUYA 2GMIC 2DZJA 2BYVE 5E6OA 1U4AA 3ZNHB 2MSED 4GU2A 3PT2B 4WJNA 3RD2A 4KZ0A 3WAOA 4HCPB 3ZNID 3VH4B 1YX6B 1Z2MA 3VUWA 3ONSA 2Y5BB 4GDLB 2MBHA 4BVUC 2DAFA 5L95C 2BWFA 1L2NA 2KWVB 5BO4B 1V49A 2KDEB 2N9PC 4NAWB 2HD5B 2K8BA 3IBEA 4TV3A 1ZW7A 2J0MA 2LRWA 3B0AA 3M95A 4HPLB 3U7DA 3V62A 1UBQA 2XEWA 1WGHA 1E8XA 2GOWA 4W9KA 3DPDA 2C9WB 3BINA 2LI5A 3CSTA 4HWIB 4IWPA 5CHWA 4PS8A 2XK5A 3A33B 2IO2B 4OVVA 3UINB 2HJ8A 2L05A 4HXDA 4LDTD 4CHKA 3C0RB 4EOYA 3QQ8B 2CHXA 3Q3JA 4F1SA 2JPHA 2ASQA 2FCNA 4G3XB 3RUIB 3ZTDA 1JRUA 2KVRA 3PPAA 3KW5B 1E8WA 1SIFA 4LJPB 1OEYJ 3VAWA 1I35A 4JIOU 3JSVA 2AL3A 3ECIA 3SD5A 3B1LX 4ZYNA 2C60A 3ML8A 4IM2A 1GG3A 2M1MA 5GMVA 4ZRKA 2L00B 4A3OA 3N32A 1RAXA 3R3MA 3WANA 5HKHA 2YVCA 3N3KB 2JY6A 2LXCA 2WX1A 3ALBA 4WAAA 2LVOA 2N1WA 4IG7B 1WJNA 3H6NA 3DBSA 4E74A 4BKSD 4P7IA 4NPNA 3NZSA 4GB9A 1G6JA 3MTNB 3PRZA 1KLVA 2RD0A 5CHFA 2NBUA 5KHQA 3JW0X 3PVLA 4GDLA 3T9LA 4RM9A 3M63B 3VTVA 1GC7A 2IY0B 2YLMA 4FBJB 4HPMB 1WXMA 2LXAA 2M4NA 3AU5A 1PQSA 3PLUA 4JQWC 3JSVB 1LXDA 1UH6A 3PLVA 4BOZB 2UWQA 2KKCA 3QHTA 3IVFA 1YQBA 2JWZA 5LXHA 4GOCA 2EMTA 2A5UA 3ZKJC 3LDZE 4WWPA 4DK5A 2JRHA 4W9DA 1Q1OA 1RFAA 3ZIMA 4NJ7A 4TUUA 3VVWB 2K25A 2DHZA 2LVQA 5AZGA 4KZCA 4K7SA 4I6NB 4GDKB 3QX1A 4FA6A 3UIOB 5KHOA 3EECA 4MJSA 1FXTB 3M62B 4IM0A 3APDA 2IZVB 2BYFA 2KC2A 3K9OB 5AZFA 4B9KA 2REXA 2CKHB 3M3JA 2FAZA 4FADA 3A9KB 1OQYA 5D6JB 2KX3A 2MA9B 2LWPA 3NZUA 2LZ6A 3PREA 4N9F4 5E6NA 3HM6X 1NI2A 4WWOA 1SGHA 4NJ6A 5J2RA 3MHSD 1OEYA 4HK2A 1I42A 1V86A 4GXBA 2MLBA 2MX2A 3OAWA 2J0JA 1WMHB 3UQAA 4X57B 1D3ZA 2G3QB 2O6VD 4FULA 2N4FA 1EF5A 4KDIC 2JT4B 4GDKA 1J8CA 3PZDA 2RSUA 2Z59B 1ISNA 2O6VB 2NBWB 2WWZA 4E71A 1WZ0A 4II2B 4OVUA 2JXXA 3A9KA 3V61A 1TZ1A 1YD8U 2V4LA 2LASA 2KWUB 2XBBC 2KMCA 5IAAC 1M94A 1X1MA 2RGFA 2PE9A 2ZVOA 4DDGD 1E7VA 3PRPB 2KFJA 4HVBA 4BFRA 3GOEA 3ZDMC 2PPHA 3H7SA 4ZRIA 2DZMA 2GBNA 2MWSB 4PS7A 3HIZA 5CX3A 3R7QA 4KIKB 1GNUA 2KJRA 1P1AA 2ZPYA 3QK0A 1WFYA 4A3PA 4F8CB 1A5RA 2D11A 3X23A 4MGZE 2FUHB 4ZRJA 2K6DB 1WJ6A 2FNJB 1WRDB 3HM3A 2DX5B 2ZVNA 4KSLC 3NOBA 4ZDVA 2JZZA 2OJRA 4G50A 1TGZB 3S2AA 4WWNA 2LVPA 4W9LA 3SU8X 1K8RB 2O2VB 1UGMA 2GBMA 3RZFA 1WX7A 2AEHA 2MCNB 1WMHA 2BF8B 2UYZB 3OLMD 4LJOB 3TIXA 2FCSA 3IG3A 2B3AA 1UZXB 3DBLI 3CF6E 3ZNGC 4KDLB 4FN2A 2L0TA 4XC2A 1WXSA 2KD0A 2L0FA 1WR6E 2WDTB 1WR1A 2CR5A 1AARA 1V80A 2WYQA 3DVGY 3KUZA 2G4SA 5L83A 4MGYE 4WJOA 3ZDTA 5EDSA 3H9DA 4II3B 4GGQA 3WAPA 3APFA 2O2VA 4RMAA 3ZRCA 1NDDA 3HHMA 1P9DU 1KOTA 3VHTC 5JHAA 2L7RA 5LXIB 3L08A 3SHQA 4K7UA 4IW0A 2EMSA 2KQSA 3OJ3A 1WJ4A 4EZJA 3UQBA 3H7PB 4GMVA 1WE7A 4MELA 3KYDD 2WX0A 1RRBA 2O6VA 2KK8A 1CMXB 3WA0A 3PS6A 2GBKA 5CHVC 2RPQA 2IO3B 3KYCD 3APCA 2KTFA 1S1QB 5LLIA 4GIVA 4MSMB 3RYTA 3A4RA 4M0WB 5FR6A 3IHPC 3VH3B 1HE8A 3RCZA 4TQ0A 3A9JA 4W9EA 5DCNA 2D3GA 3KVFB 4DHZB 2GBRA 2JF5A 5D7GA 3SDLC 1J19A 1V5OA 2LUEA 4FHJA 3ZLZA 2NBVB 4W9CA 3VTWA 4HDQA 5JH5C 4DHJB 3HK0A 4WQOB 4AOFA 4G0NB 1IP9A 5C23A 3N30A 2FIFA 1Q0WB 3DBRI 3QJZA 3V60A 2ZCBA 1TBEA 3TJPA 4EZLA 3PTFC 3TBLD 2MRPA 1UD7A 2M17A 4FLHA 4MH0E 4AUQC 1BT0A 1RLFA 2Z0DB 1L7YA 2K1FA 5J18A 2IBIB 1ZKHA 3L0WB 2AWTA 4GN1A 4WJPA 5CTRC 2KO3A 1GUAB 1E8YA 4BOSC 2N7EA 2BGFA 2KQ7A 4MGIE 1TTNA 2PEAA 3A9JB 3H1UA 2LGYA 3OJ4B 3R66C 2BKRB 2OOBB 1YIWA 3W1YA 3VXWA 3AULA 1WGYA 1XT9B 2M8SA 4IUMB 2L76A 1WGDA 2ZNVB 3WIMA 4BKGA 3KUCB 3MJWA 4NY0A 4K81A 1WGGA 3DDCB 5J17A 2KWCA 4ICUA 2JRIB 2CU1A 4M8NA 3RZWC 3ZO5B 1E7UA 1KJTA 1WYWB 4IWOA 3KH0A 4M8MA 2LRUA 1WE6A 2MBBB 3BY4B 2DYOA 1H4RA 2NPTA 2AL6A 3DVNU 4LCDE 2A4ZA 2KANA 4KSKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AEK B;  5DPW A;  3L13 A;  3UIP B;  1V2Y A;  4YL8 A;  3NY5 A;  2GBJ A;  4HCN B;  4W9G A;  1WIA A;  2FCQ A;  3H7P A;  3L17 A;  1J0G A;  4I6L B;  2KTR B;  2PJH A;  1KM7 A;  3EFU A;  3TCA A;  1H8C A;  1S3S G;  2EKE C;  1EF1 A;  2G45 B;  3X0W A;  2LD9 A;  3EC8 A;  3QC8 B;  4MEM A;  3TL5 A;  4A20 A;  3V6E B;  1NBF C;  3L54 A;  1R4N I;  4K7W A;  2DYB A;  4DDI D;  1Q5W B;  2ZPN A;  2C7H A;  1UEL A;  2IO1 B;  3QIJ A;  1WH3 A;  2NR2 A;  2ZNV C;  4WJQ A;  2DZI A;  4FJV B;  1XQQ A;  4TQ1 A;  4W9J A;  5DPT A;  1LM8 B;  2DAJ A;  3U8Z A;  4ASW C;  2D07 B;  1UBI A;  5D94 A;  4IWQ A;  2NPT B;  2IY1 B;  2N7D A;  2R2Q A;  2K39 A;  2KJH B;  5G2N A;  3ZVV A;  2KDF B;  1VCB A;  3JVZ X;  2MP2 B;  3AU4 A;  1IPG A;  1YX5 B;  2RR9 A;  2VRR B;  1V9J A;  2XK5 B;  3PHW B;  4FJZ A;  4MDK E;  1WX8 A;  2MQJ A;  3ZNZ B;  1C1Y B;  3ZTC A;  3VTU A;  4EFO A;  3A4S C;  3AXC A;  2FID A;  4TKN A;  4ANX A;  2KZR A;  4EUT A;  1T0Y A;  4F7Z A;  3KUD B;  4W9F A;  2ZJD A;  4PYU A;  3PHX B;  4DHZ E;  4EKU A;  4LDT B;  4NNJ B;  1E90 A;  2KFK B;  4URK A;  1F9J A;  2KOX A;  4KV2 A;  2KXJ A;  1V5T A;  2CHW A;  4JL9 A;  1IYF A;  1OTR B;  2KN5 A;  3IFW B;  2BWE S;  5D2M B;  4BBN C;  4ANV A;  2BYE A;  4W9I A;  4XX5 A;  3O65 B;  4CO7 A;  4K1R B;  4IC7 B;  2NS5 A;  2J7Q B;  3AI5 A;  4PS3 A;  1LFD A;  2MW5 A;  3UF8 A;  4FHK A;  1WF9 A;  2MP2 A;  2V3S A;  3DCG A;  1E5W A;  2IO0 B;  2D2Q A;  2KNB A;  3RUL A;  2D10 A;  2KTR A;  2I1K A;  3ZW3 A;  4ANU A;  2PE6 B;  3CMM B;  3QCA A;  4DHJ D;  1V6E A;  1GC6 A;  1WJU A;  2DYM A;  5C1Z A;  5JZE B;  3DBH I;  1XD3 B;  3EHV A;  3QAR A;  3R7R A;  4E3C A;  1GJZ A;  2MBO A;  3VQI A;  4NQK E;  2KC1 A;  3WAM A;  2KFK A;  3ENE A;  2JUO A;  4NQL B;  5IA7 A;  4BKS A;  1C3T A;  4EZK A;  2K6Q A;  1WY8 A;  2J0K A;  3W1S C;  1WXV A;  4I6P A;  2MBQ A;  3ZRF A;  4AP4 C;  3VFK A;  1WXA A;  2I1J A;  1WZ3 A;  2LJ5 A;  3VDZ A;  4XZ4 A;  4HLE A;  3WAL A;  4RM8 A;  4CYE A;  4DBG A;  4AWJ A;  3U30 A;  1P3Q U;  2W9N A;  3NHE B;  4BKT A;  2MBE A;  1WM3 A;  3QAQ A;  2NVU I;  2KMA A;  2KX0 A;  3PV1 A;  2AYO B;  4ANW A;  3T8M A;  1Z5S B;  3NS8 A;  1MG8 A;  2K8C A;  2ZCC A;  3GZN I;  1EO6 A;  2KJ6 A;  2KLC A;  4MJS B;  2N9X A;  2C7N B;  3ZUN A;  3K9P B;  2G4D B;  4B95 A;  3DQV A;  5AZH A;  1OGW A;  1P98 A;  4NAW A;  3RT3 B;  4MGK E;  3PGE A;  3V6C B;  2L8J A;  3B08 A;  5DPR A;  4J6I A;  2JZ3 B;  4MSQ B;  2JVC A;  4BBN F;  3A1Q A;  3I3T B;  3P2B A;  1YJ1 A;  4B6W A;  4ICV A;  4HDO A;  1WGR A;  2IYD B;  4G11 A;  4JLC A;  1WX9 A;  3ML9 A;  5DPS A;  3JYU A;  3D32 A;  3UGB B;  1QZE A;  2KDI A;  2M0X A;  3DVG X;  1ZGU B;  2V1Y A;  4AJY B;  4IM3 A;  1E8Z A;  3QWZ B;  1WM2 A;  4DXA B;  2N1V A;  4JGH B;  4AJW A;  5G55 A;  1Y8R C;  1WI0 A;  2QHO A;  3LJ3 A;  2LGD A;  3VUX A;  2Z0E B;  2HTH A;  1V81 A;  3DVN V;  3PSE B;  4HJK A;  4EEW A;  1P0R A;  2ZEQ A;  2N9E B;  3A1Q B;  2K8H A;  3L16 A;  2BKF A;  2HE7 A;  5E6P A;  4GSW A;  1R4M I;  4DWF A;  2CHZ A;  3L10 B;  3TMP B;  4PYZ A;  4KVG B;  2R2O A;  4KIK A;  2FCM A;  3PRM B;  2C7M B;  2DEN B;  2C5L C;  2KHW B;  1SE9 A;  2BPS A;  4FJY A;  3QA8 A;  3W1S A;  2L3Z A;  1EUV B;  3Q3F A;  2LGX A;  5JHB A;  2DZK A;  2KLG A;  4W9H A;  1VD2 A;  2ZZP B;  2CS4 A;  4MM3 A;  3CSF A;  3DOW A;  2KDB A;  1LQB A;  2NCN A;  5TR5 A;  3VUY A;  2GMI C;  2DZJ A;  2BYV E;  5E6O A;  1U4A A;  3ZNH B;  2MSE D;  4GU2 A;  3PT2 B;  4WJN A;  3RD2 A;  4KZ0 A;  3WAO A;  4HCP B;  3ZNI D;  3VH4 B;  1YX6 B;  1Z2M A;  3VUW A;  3ONS A;  2Y5B B;  4GDL B;  2MBH A;  4BVU C;  2DAF A;  5L95 C;  2BWF A;  1L2N A;  2KWV B;  5BO4 B;  1V49 A;  2KDE B;  2N9P C;  4NAW B;  2HD5 B;  2K8B A;  3IBE A;  4TV3 A;  1ZW7 A;  2J0M A;  2LRW A;  3B0A A;  3M95 A;  4HPL B;  3U7D A;  3V62 A;  1UBQ A;  2XEW A;  1WGH A;  1E8X A;  2GOW A;  4W9K A;  3DPD A;  2C9W B;  3BIN A;  2LI5 A;  3CST A;  4HWI B;  4IWP A;  5CHW A;  4PS8 A;  2XK5 A;  3A33 B;  2IO2 B;  4OVV A;  3UIN B;  2HJ8 A;  2L05 A;  4HXD A;  4LDT D;  4CHK A;  3C0R B;  4EOY A;  3QQ8 B;  2CHX A;  3Q3J A;  4F1S A;  2JPH A;  2ASQ A;  2FCN A;  4G3X B;  3RUI B;  3ZTD A;  1JRU A;  2KVR A;  3PPA A;  3KW5 B;  1E8W A;  1SIF A;  4LJP B;  1OEY J;  3VAW A;  1I35 A;  4JIO U;  3JSV A;  2AL3 A;  3ECI A;  3SD5 A;  3B1L X;  4ZYN A;  2C60 A;  3ML8 A;  4IM2 A;  1GG3 A;  2M1M A;  5GMV A;  4ZRK A;  2L00 B;  4A3O A;  3N32 A;  1RAX A;  3R3M A;  3WAN A;  5HKH A;  2YVC A;  3N3K B;  2JY6 A;  2LXC A;  2WX1 A;  3ALB A;  4WAA A;  2LVO A;  2N1W A;  4IG7 B;  1WJN A;  3H6N A;  3DBS A;  4E74 A;  4BKS D;  4P7I A;  4NPN A;  3NZS A;  4GB9 A;  1G6J A;  3MTN B;  3PRZ A;  1KLV A;  2RD0 A;  5CHF A;  2NBU A;  5KHQ A;  3JW0 X;  3PVL A;  4GDL A;  3T9L A;  4RM9 A;  3M63 B;  3VTV A;  1GC7 A;  2IY0 B;  2YLM A;  4FBJ B;  4HPM B;  1WXM A;  2LXA A;  2M4N A;  3AU5 A;  1PQS A;  3PLU A;  4JQW C;  3JSV B;  1LXD A;  1UH6 A;  3PLV A;  4BOZ B;  2UWQ A;  2KKC A;  3QHT A;  3IVF A;  1YQB A;  2JWZ A;  5LXH A;  4GOC A;  2EMT A;  2A5U A;  3ZKJ C;  3LDZ E;  4WWP A;  4DK5 A;  2JRH A;  4W9D A;  1Q1O A;  1RFA A;  3ZIM A;  4NJ7 A;  4TUU A;  3VVW B;  2K25 A;  2DHZ A;  2LVQ A;  5AZG A;  4KZC A;  4K7S A;  4I6N B;  4GDK B;  3QX1 A;  4FA6 A;  3UIO B;  5KHO A;  3EEC A;  4MJS A;  1FXT B;  3M62 B;  4IM0 A;  3APD A;  2IZV B;  2BYF A;  2KC2 A;  3K9O B;  5AZF A;  4B9K A;  2REX A;  2CKH B;  3M3J A;  2FAZ A;  4FAD A;  3A9K B;  1OQY A;  5D6J B;  2KX3 A;  2MA9 B;  2LWP A;  3NZU A;  2LZ6 A;  3PRE A;  4N9F 4;  5E6N A;  3HM6 X;  1NI2 A;  4WWO A;  1SGH A;  4NJ6 A;  5J2R A;  3MHS D;  1OEY A;  4HK2 A;  1I42 A;  1V86 A;  4GXB A;  2MLB A;  2MX2 A;  3OAW A;  2J0J A;  1WMH B;  3UQA A;  4X57 B;  1D3Z A;  2G3Q B;  2O6V D;  4FUL A;  2N4F A;  1EF5 A;  4KDI C;  2JT4 B;  4GDK A;  1J8C A;  3PZD A;  2RSU A;  2Z59 B;  1ISN A;  2O6V B;  2NBW B;  2WWZ A;  4E71 A;  1WZ0 A;  4II2 B;  4OVU A;  2JXX A;  3A9K A;  3V61 A;  1TZ1 A;  1YD8 U;  2V4L A;  2LAS A;  2KWU B;  2XBB C;  2KMC A;  5IAA C;  1M94 A;  1X1M A;  2RGF A;  2PE9 A;  2ZVO A;  4DDG D;  1E7V A;  3PRP B;  2KFJ A;  4HVB A;  4BFR A;  3GOE A;  3ZDM C;  2PPH A;  3H7S A;  4ZRI A;  2DZM A;  2GBN A;  2MWS B;  4PS7 A;  3HIZ A;  5CX3 A;  3R7Q A;  4KIK B;  1GNU A;  2KJR A;  1P1A A;  2ZPY A;  3QK0 A;  1WFY A;  4A3P A;  4F8C B;  1A5R A;  2D11 A;  3X23 A;  4MGZ E;  2FUH B;  4ZRJ A;  2K6D B;  1WJ6 A;  2FNJ B;  1WRD B;  3HM3 A;  2DX5 B;  2ZVN A;  4KSL C;  3NOB A;  4ZDV A;  2JZZ A;  2OJR A;  4G50 A;  1TGZ B;  3S2A A;  4WWN A;  2LVP A;  4W9L A;  3SU8 X;  1K8R B;  2O2V B;  1UGM A;  2GBM A;  3RZF A;  1WX7 A;  2AEH A;  2MCN B;  1WMH A;  2BF8 B;  2UYZ B;  3OLM D;  4LJO B;  3TIX A;  2FCS A;  3IG3 A;  2B3A A;  1UZX B;  3DBL I;  3CF6 E;  3ZNG C;  4KDL B;  4FN2 A;  2L0T A;  4XC2 A;  1WXS A;  2KD0 A;  2L0F A;  1WR6 E;  2WDT B;  1WR1 A;  2CR5 A;  1AAR A;  1V80 A;  2WYQ A;  3DVG Y;  3KUZ A;  2G4S A;  5L83 A;  4MGY E;  4WJO A;  3ZDT A;  5EDS A;  3H9D A;  4II3 B;  4GGQ A;  3WAP A;  3APF A;  2O2V A;  4RMA A;  3ZRC A;  1NDD A;  3HHM A;  1P9D U;  1KOT A;  3VHT C;  5JHA A;  2L7R A;  5LXI B;  3L08 A;  3SHQ A;  4K7U A;  4IW0 A;  2EMS A;  2KQS A;  3OJ3 A;  1WJ4 A;  4EZJ A;  3UQB A;  3H7P B;  4GMV A;  1WE7 A;  4MEL A;  3KYD D;  2WX0 A;  1RRB A;  2O6V A;  2KK8 A;  1CMX B;  3WA0 A;  3PS6 A;  2GBK A;  5CHV C;  2RPQ A;  2IO3 B;  3KYC D;  3APC A;  2KTF A;  1S1Q B;  5LLI A;  4GIV A;  4MSM B;  3RYT A;  3A4R A;  4M0W B;  5FR6 A;  3IHP C;  3VH3 B;  1HE8 A;  3RCZ A;  4TQ0 A;  3A9J A;  4W9E A;  5DCN A;  2D3G A;  3KVF B;  4DHZ B;  2GBR A;  2JF5 A;  5D7G A;  3SDL C;  1J19 A;  1V5O A;  2LUE A;  4FHJ A;  3ZLZ A;  2NBV B;  4W9C A;  3VTW A;  4HDQ A;  5JH5 C;  4DHJ B;  3HK0 A;  4WQO B;  4AOF A;  4G0N B;  1IP9 A;  5C23 A;  3N30 A;  2FIF A;  1Q0W B;  3DBR I;  3QJZ A;  3V60 A;  2ZCB A;  1TBE A;  3TJP A;  4EZL A;  3PTF C;  3TBL D;  2MRP A;  1UD7 A;  2M17 A;  4FLH A;  4MH0 E;  4AUQ C;  1BT0 A;  1RLF A;  2Z0D B;  1L7Y A;  2K1F A;  5J18 A;  2IBI B;  1ZKH A;  3L0W B;  2AWT A;  4GN1 A;  4WJP A;  5CTR C;  2KO3 A;  1GUA B;  1E8Y A;  4BOS C;  2N7E A;  2BGF A;  2KQ7 A;  4MGI E;  1TTN A;  2PEA A;  3A9J B;  3H1U A;  2LGY A;  3OJ4 B;  3R66 C;  2BKR B;  2OOB B;  1YIW A;  3W1Y A;  3VXW A;  3AUL A;  1WGY A;  1XT9 B;  2M8S A;  4IUM B;  2L76 A;  1WGD A;  2ZNV B;  3WIM A;  4BKG A;  3KUC B;  3MJW A;  4NY0 A;  4K81 A;  1WGG A;  3DDC B;  5J17 A;  2KWC A;  4ICU A;  2JRI B;  2CU1 A;  4M8N A;  3RZW C;  3ZO5 B;  1E7U A;  1KJT A;  1WYW B;  4IWO A;  3KH0 A;  4M8M A;  2LRU A;  1WE6 A;  2MBB B;  3BY4 B;  2DYO A;  1H4R A;  2NPT A;  2AL6 A;  3DVN U;  4LCD E;  2A4Z A;  2KAN A;  4KSK C; 
#chains in the Genus database with same CATH topology
 4OZA A;  2Q5W D;  4HCN B;  2FCQ A;  3H7P A;  4I6L B;  1T0Q C;  1K51 A;  2WXO A;  3TL5 A;  3AN1 A;  3V6E B;  1NBF C;  3AE7 B;  4WJQ A;  1QOF A;  2M0A A;  4HKZ E;  4W9J A;  1XQQ A;  3BVZ A;  3U8Z A;  2H89 B;  1C4P A;  3ZVV A;  2R2Q A;  2KJH B;  1XF5 L;  1VCB A;  3AU4 A;  1DYQ A;  4MDK E;  4WH4 A;  1WX8 A;  1C1Y B;  3ZTC A;  2WU5 B;  3ZJV A;  2KZR A;  4F7Z A;  3KUD B;  4PYU A;  2W54 A;  1E90 A;  2KFK B;  1V1P A;  2KOX A;  4KV2 A;  1V5T A;  5D2M B;  2ZW0 A;  4RGT A;  2MW5 A;  3MJ5 A;  4FHK A;  4LNO A;  3VR8 B;  2KTR A;  3ZW3 A;  1FCL A;  3H8H A;  2FBW B;  3HVD A;  4XGA B;  1V6E A;  5EE1 A;  2LGS A;  3R7R A;  4NQK E;  3ENE A;  4NQL B;  4BKS A;  5EE9 A;  1ZUD 2;  2KWD A;  4AP4 C;  2IGH A;  3RPF C;  1K50 A;  1E7P B;  3HRD D;  5T8I A;  1FNW A;  3NHE B;  3PV1 A;  2KN4 A;  1EU4 A;  1IGD A;  4JX1 C;  1MG8 A;  3AE8 B;  2KLC A;  1SXT A;  2N9X A;  1T3Q A;  1CZP A;  4NAW A;  4MGK E;  1I4G A;  2MHJ A;  3B08 A;  4J6I A;  4MSQ B;  4KGR A;  2AQ1 B;  3I3T B;  1F2R I;  4HRS A;  4ICV A;  1WGR A;  2IYD B;  4G11 A;  5E6J A;  5DPS A;  3FAH A;  3JYU A;  4AJY B;  3QWZ B;  3N20 C;  4AJW A;  1WI0 A;  4ITK A;  2LGD A;  2Z0E B;  1V81 A;  3RNE C;  1BUI C;  4HJK A;  1P0R A;  4P1C C;  2K8H A;  3AE3 B;  3AE2 B;  3TMP B;  1YQ4 B;  4KIK A;  5H8Y E;  1JRO A;  4KGT A;  2CJN A;  4FJY A;  5MPO A;  1PUT A;  4OVZ A;  2J4X A;  2KDB A;  2NCN A;  4US8 A;  5TR5 A;  2DZJ A;  5E6O A;  1HEZ E;  4OZB A;  2MJE A;  2L52 A;  3VH4 B;  1YX6 B;  2RDB C;  1OQQ A;  4JWU C;  5L95 C;  3FIL B;  3VR9 B;  3BWU D;  1T0S C;  2PLP A;  4KX6 B;  1L0Y B;  1UUP A;  1ZPS A;  3V62 A;  2XEW A;  3NRZ A;  4ARC A;  4W9K A;  3DPD A;  2C9W B;  3BIN A;  2BQQ A;  2KT7 A;  4XWT A;  5CHW A;  4UDU C;  2KAJ A;  2IO2 B;  1F1H A;  3UIN B;  2L05 A;  2LMC A;  4L2Y A;  4CHK A;  4EOY A;  1TKY A;  2CHX A;  3Q3J A;  2JPH A;  4G3X B;  3ZTD A;  3PPA A;  1I35 A;  4JIO U;  3BVG A;  3CWI A;  1FXI A;  4ZYN A;  2ON8 A;  3I5J C;  2M1M A;  4A3O A;  3TEZ A;  3N32 A;  3R3M A;  2YVC A;  3AE1 B;  4WAA A;  2LVO A;  2N1W A;  1WJN A;  2IDY A;  3H6N A;  4BKS D;  4P7I A;  4AS1 A;  1G6J A;  1FMA D;  1KLV A;  2PIA A;  5CHF A;  3JW0 X;  3PVL A;  3O13 A;  3T9L A;  4KGS A;  4RM9 A;  1NEN B;  3VTV A;  4HPM B;  2QC8 A;  3AU5 A;  3PLU A;  4JQW C;  3MP9 A;  3PLV A;  4RGO S;  2J42 A;  3IVF A;  1QIL A;  1WRI A;  2A5U A;  4WWP A;  4DK5 A;  4QAY A;  3VVW B;  4ZRP A;  2K25 A;  2LVQ A;  2BVC A;  5HI1 A;  4K7S A;  3UIO B;  1I4R A;  3EEC A;  5KHO A;  4IM0 A;  1V97 A;  3APD A;  2AQ2 B;  2IZV B;  1YN5 A;  4B9K A;  2CKH B;  2FAZ A;  1OQY A;  2JX5 A;  4PK1 A;  2MA9 B;  2WXG A;  3MC9 A;  2N0S B;  1PDX A;  2XNA C;  3MHS D;  2MX2 A;  4MT5 A;  4X57 B;  4FUL A;  4WUR A;  4LK0 M;  3DWM A;  1AW7 A;  1IGC A;  2Z59 B;  3Q8C A;  2O6V B;  2NBW B;  4B0M A;  2JXX A;  4HPP A;  3P63 A;  2LAS A;  2KMC A;  5IAA C;  4M01 A;  1X1M A;  2PE9 A;  1MI0 A;  3R2I A;  1VZ7 A;  2KFJ A;  1KTK A;  4BFR A;  4HVB A;  4US9 A;  2VZK B;  3HIZ A;  4KIK B;  1KLU D;  1GNU A;  2ZPY A;  4A3P A;  1A5R A;  4MGZ E;  4ZRJ A;  1WJ6 A;  2FNJ B;  1WRD B;  3HM3 A;  2DX5 B;  2LUM A;  1I4H A;  4ZDV A;  2SAK A;  3BYY B;  4G50 A;  2LVP A;  3BYT B;  2NTS A;  2O2V B;  1UGM A;  3RZF A;  2TSS A;  1WXQ A;  2AEH A;  3NG0 A;  3J9C A;  3OLM D;  3TIX A;  3IG3 A;  1UZX B;  3CF6 E;  2WXR A;  4KDL B;  4HJG E;  2LGI A;  4FN2 A;  4XC2 A;  5BYS A;  1WXS A;  1ZDX A;  3CIR B;  4IKG A;  3AM9 A;  1K53 A;  2WS3 B;  3GS2 A;  1GB4 A;  1AAR A;  1ZE3 D;  3GB1 A;  2G4S A;  1UWM A;  3ZDT A;  1XLO A;  1FFV A;  1CQV A;  4DXG A;  4YWG G;  2JSV X;  1ZOY B;  1SF0 A;  2MJ3 A;  3OJ3 A;  5G5H A;  1I4P A;  4MEL A;  1A70 A;  3IT4 B;  2KK8 A;  2GRI A;  3PS6 A;  5CHV C;  1R4N B;  2DLB A;  2KTF A;  4K3B A;  1C76 A;  5LLI A;  3RYT A;  2Z8L A;  3E9S A;  1NVI D;  3Q3N C;  2INC C;  3DHI C;  1GOZ A;  4TQ0 A;  1SIJ A;  4DHZ B;  3KVF B;  2GBR A;  5I4D A;  4OW0 A;  4WQO B;  3ZXR A;  1PGA A;  2FIF A;  3N30 A;  3QJZ A;  3SR6 A;  2ZCB A;  1TBE A;  1NEK B;  2NTT A;  3PTF C;  4XYC A;  2KQ4 X;  3BVM A;  4MH0 E;  1RLF A;  2Z0D B;  1ZKH A;  4GN1 A;  4LNF A;  4WJP A;  2KO3 A;  3KWV A;  1GUA B;  4BOS C;  2KQ7 A;  1YNT E;  3VXW A;  1WGD A;  2NMQ A;  2ZNV B;  2ICI A;  4TMA B;  4NY0 A;  3Q8F A;  4ZRQ A;  5J17 A;  2KWC A;  1TS4 A;  2CU1 A;  3RZW C;  4IWO A;  3RNG C;  4ZHP A;  1C4A A;  2DYO A;  4OZC A;  3T3N A;  2KAN A;  5AEK B;  1AN8 A;  3L13 A;  5BMH A;  4XDD A;  3NY5 A;  3DBR B;  3P4R B;  3NVW A;  3VRA B;  3EFU A;  2G45 B;  2WU2 B;  3P1M A;  1ZXI A;  3EC8 A;  3QC8 B;  4MEM A;  4A20 A;  4S17 A;  2PMV A;  3L54 A;  1R4N I;  4K7W A;  1Q5W B;  2C7H A;  1UEL A;  5DPT A;  3ZXV A;  4M0W A;  1UBI A;  5D94 A;  4IWQ A;  2NPT B;  2K39 A;  1YN3 A;  1TY2 A;  2RR9 A;  1V9J A;  2XK5 B;  4FJZ A;  3FC4 A;  3AXC A;  2FID A;  4TKN A;  2WXI A;  4URK A;  3N1X C;  1OQR A;  1QLB B;  2CHW A;  1HTQ A;  3IFW B;  2Y3A A;  1QKZ A;  4ANV A;  2BYE A;  1AYF A;  4XX5 A;  4K1R B;  2NS5 A;  2BB6 A;  1LFD A;  4XE0 A;  1TS3 A;  3DCG A;  1E5W A;  2KNB A;  5FR3 A;  2D10 A;  1N6Z A;  5AUK A;  3QCA A;  4LTU A;  1GJZ A;  4ACF A;  2MBO A;  3VQI A;  2QMT A;  4AQ7 A;  1WY8 A;  2J0K A;  3W1S C;  1WXV A;  4MM3 B;  2MBQ A;  1WXA A;  2LJ5 A;  1T6B X;  3WAL A;  2EKI A;  3U30 A;  1E0Z A;  1P3Q U;  2MBE A;  1TS2 A;  1IUE A;  1Z5S B;  1TT5 B;  2ZCC A;  3GZN I;  2WXQ A;  2BS4 B;  3ZUN A;  4FXC A;  2G4D B;  4B95 A;  1P98 A;  4N6E B;  2J53 A;  2L8J A;  5DPR A;  2JVC A;  4BBN F;  3A1Q A;  4GLS C;  4B6W A;  1KH0 A;  5BYR A;  1UNS A;  3ML9 A;  2GLS A;  3D32 A;  2M0X A;  3DVG X;  3LB8 C;  1ZGU B;  2V1Y A;  1E8Z A;  4DXA B;  4JGH B;  1XEE A;  3BK2 A;  3T3O A;  1K52 A;  3AEF B;  4HEA 1;  2JQR B;  1BML C;  3RN9 C;  3AEC B;  3L16 A;  4GSW A;  4DWF A;  3C19 A;  3TEW A;  2ZW1 A;  2DEN B;  2WXK A;  1XCT L;  1RM6 C;  3QA8 A;  2L3Z A;  1EUV B;  5JHB A;  1VD2 A;  2ZZP B;  2CS4 A;  1J7B A;  3VUY A;  3AE6 B;  2BYV E;  1U4A A;  5AUI A;  4KZ0 A;  2E3T A;  1L4Z B;  3MFG A;  1Z2M A;  3VUW A;  1J7C A;  1VZ6 A;  2MBH A;  1JWU D;  2DAF A;  2PTL A;  2Y5C A;  4NAW B;  1FRD A;  2J0M A;  2LRW A;  1AWD A;  1WGH A;  2GOW A;  4IWP A;  3TUO A;  3RI7 C;  4LLG M;  2XK5 A;  5TSS A;  1PYW D;  2HJ8 A;  3C0R B;  3QQ8 B;  4F1S A;  4L1B A;  1JRU A;  4RF0 A;  2IGD A;  4PT5 A;  1E8W A;  1C4C A;  1OEY J;  3Q3O C;  5IKC M;  3ECI A;  3SD5 A;  1GB1 A;  1ROE A;  2L00 B;  1CJE A;  1XO3 A;  4JWS C;  1B9R A;  2WXL A;  1J7A A;  3DHH C;  2JY6 A;  3ALB A;  2BB5 A;  1R7S A;  1UGJ A;  1SE4 A;  4IG7 B;  3NUH B;  3Q3M C;  2WGS A;  3RNB C;  3PRZ A;  2LJI A;  2RD0 A;  3LYY A;  3NZ3 A;  4IOI E;  4TSS A;  1D5M C;  2YLM A;  4FBJ B;  1WXM A;  2LXA A;  3JSV B;  1LXD A;  1UH6 A;  1SJH D;  2L32 A;  4BOZ B;  2UWQ A;  2KKC A;  2JWZ A;  3ZKJ C;  1Q1O A;  3ZIM A;  5AZG A;  5EE0 A;  4GDK B;  1WSP A;  4MJS A;  3M62 B;  3OG5 A;  3N9Y C;  3ETR A;  2KYW A;  2KC2 A;  3K9O B;  2REX A;  1JCK B;  5D6J B;  1VR9 A;  3RNF C;  2LWP A;  4WAF A;  1N5W A;  5J2R A;  4HK2 A;  1OEY A;  2MLB A;  1TS5 A;  1EF5 A;  3IT6 B;  5FK9 C;  2JT4 B;  3IAS 1;  3PZD A;  2RSU A;  1WZ0 A;  2D5G A;  3A9K A;  3GE3 C;  3V61 A;  1TZ1 A;  1YD8 U;  2V4L A;  1M94 A;  1ACC A;  1E7V A;  1B1Z A;  2V3P A;  5HHD G;  3GOE A;  3DBL B;  1C78 A;  2PPH A;  4ZRI A;  2BT6 A;  2GBN A;  1D5X C;  4RH6 A;  3P4P B;  1PFD A;  2KJR A;  4KSL C;  1I4Q A;  4YSX B;  2OJR A;  1FNV A;  1TGZ B;  2V9H A;  1NI3 A;  3SU8 X;  1FIQ A;  2SEB D;  2GBM A;  1WX7 A;  1WWT A;  2MCN B;  5BYQ A;  2UYZ B;  4YTP B;  3E56 A;  4JPS A;  2B3A A;  3DBL I;  3ZNG C;  4CQN A;  2WXN A;  3Q8B A;  3RFZ B;  2UU7 A;  2FE8 A;  1V80 A;  3KUZ A;  3H9D A;  4II3 B;  4GGQ A;  3WAP A;  2N9K A;  1D4B A;  1KOT A;  1NDD A;  2QIE B;  4REZ A;  2L7R A;  3U52 E;  4YTM B;  4K7U A;  2WXJ A;  3GE8 C;  3H7P B;  4GMV A;  3KYD D;  3I9V 1;  1RRB A;  2O6V A;  1CMX B;  2V3N A;  2GBK A;  2IO3 B;  3AEA B;  2E6X A;  2L83 A;  3A4R A;  4A6Q A;  4C4V A;  1F52 A;  3PZ8 A;  2IND C;  1P7F A;  5FR6 A;  3VH3 B;  3ZJU A;  3RCZ A;  4DXF A;  3A9J A;  5DCN A;  2D3G A;  5D7G A;  1V5O A;  3AEE B;  4FHJ A;  3ZLZ A;  2NBV B;  3NJT A;  1IP9 A;  1DOY A;  3TJP A;  1L0V B;  3TBL D;  4ZYS A;  1UD7 A;  4FLH A;  3DBH B;  1OFF A;  2IBI B;  2RDH A;  3L0W B;  3WCQ A;  5CTR C;  1EM7 A;  1ZDV A;  2BGF A;  2PEA A;  5IN7 A;  1DOI A;  2M8S A;  4IUM B;  2L76 A;  1C79 A;  3MJW A;  1WGG A;  4M8N A;  4M8M A;  4J3O D;  1WE6 A;  1N63 A;  1H4R A;  1C9F A;  4YL8 A;  4W9G A;  1WIA A;  1J0G A;  2PJH A;  1KM7 A;  1VJK A;  2KMM A;  1H8C A;  2EKE C;  1EF1 A;  3X0W A;  2MJD A;  2WXP A;  2GI9 A;  2JYT A;  2DYB A;  4DDI D;  1QF6 A;  2ZPN A;  4C56 C;  2IO1 B;  1WH3 A;  5J18 A;  2DZI A;  2D07 B;  2IY1 B;  5G2N A;  3NVZ A;  4LNN A;  2MP2 B;  4YSZ B;  1YX5 B;  5IOI A;  3VTU A;  4EFO A;  3A4S C;  2GB1 A;  2K5P A;  4R3D A;  1T0Y A;  2ZJD A;  3PHX B;  4DHZ E;  4EKU A;  4NNJ B;  2KXJ A;  1HQR D;  1FO4 A;  4JL9 A;  2KN5 A;  2J7Q B;  3AI5 A;  3UF8 A;  2MEK A;  2V3S A;  2D2Q A;  3Q69 A;  2PE6 B;  2JYE A;  3CMM B;  3N1Z C;  4DHJ D;  3EUB 2;  1WJU A;  5C1Z A;  1XD3 B;  2KC1 A;  2KFK A;  1QQR A;  2BW2 A;  1C3T A;  2K6Q A;  2RMM A;  2KVZ A;  3VFK A;  2WDR B;  1WZ3 A;  3VDZ A;  4HLE A;  3ZGZ A;  4RM8 A;  4CYE A;  4AWJ A;  4BAX A;  1MVK A;  2J52 A;  2JU6 X;  2NVU I;  2KMA A;  2KX0 A;  2AYO B;  4ANW A;  3T8M A;  3N1Y C;  4MJS B;  1SSN A;  3DQV A;  1TIF A;  1OGW A;  1JRP A;  3RT3 B;  3PGE A;  3R8B A;  2OED A;  4H2A A;  2JZ3 B;  3ABV B;  1N61 A;  2EEL A;  1F2R C;  3NVV A;  1YJ1 A;  2PVO D;  4XDC A;  3BII D;  3P4S B;  5D3I B;  1XXG A;  2QDF A;  4WQM A;  3MC8 A;  1QZE A;  4IM3 A;  1VZ8 A;  3W5U B;  3URY A;  2PW9 A;  4RFB A;  1Y8R C;  4A55 A;  1ET9 A;  1YOV B;  4C7Z A;  3LJ3 A;  3UI3 A;  2HTH A;  3NS1 A;  4IDI A;  3DVN V;  3PSE B;  4Q2J A;  3AE9 B;  1L0X B;  2N9E B;  3A1Q B;  5E6P A;  4C80 A;  2BKF A;  1D6E C;  2CHZ A;  3L10 B;  4PYZ A;  3SFE B;  3EA6 A;  3RNC C;  4YT0 B;  3SEB A;  2C5L C;  2HJ1 A;  2YEP B;  3B2G A;  1CK1 A;  1SE9 A;  2BPS A;  3Q3F A;  2LGX A;  2DZK A;  2KLG A;  4W9H A;  2WNM A;  4MM3 A;  3CSF A;  1VLB A;  1LQB A;  1E10 A;  2GMI C;  4GU2 A;  3PT2 B;  4WJN A;  1KF6 B;  4HCP B;  3ONS A;  2Y5B B;  4GDL B;  4BVU C;  4MH8 A;  2VH2 A;  1Y56 A;  5BO4 B;  1R4M B;  2KDE B;  2K8B A;  4HPL B;  1E8X A;  2LI5 A;  3CST A;  1T0R C;  2D3A A;  4OVV A;  1N60 A;  3EGR A;  4HXD A;  1XCQ L;  2ASQ A;  3RUI B;  2KVR A;  4LJP B;  1SIF A;  3VAW A;  2FUG 1;  1XLQ A;  2AL3 A;  1HXY D;  3FIL A;  3ML8 A;  4ZRK A;  1FXA A;  2WXH A;  2QCZ A;  2LXC A;  2QEJ C;  2WX1 A;  4ARI A;  1IBX B;  3DBS A;  5BMG A;  4E74 A;  4NPN A;  3NZS A;  4GB9 A;  3MTN B;  3EFC A;  5KHQ A;  5HG2 A;  3AV8 A;  1GC7 A;  2IY0 B;  3IAM 1;  3TSS A;  1YQB A;  1YMH E;  4GOC A;  2RDG A;  1SEB D;  1SBB B;  4W9D A;  2WLB A;  1FFU A;  4TUU A;  4EE2 A;  2DHZ A;  2BYT A;  4BZA A;  3QX1 A;  2MH7 A;  1HZ6 A;  1FXT B;  4FAD A;  3Q2A C;  2KX3 A;  3NZU A;  4N9F 4;  3OWE B;  5E6N A;  3VRB B;  3HM6 X;  4WWO A;  1SGH A;  1N62 A;  1RWS A;  1HTO A;  4GXB A;  3UQA A;  2J0J A;  1WMH B;  1D3Z A;  2O6V D;  1ET6 A;  2N4F A;  2WHI A;  4GDK A;  5LNK 1;  3U7Z A;  3PZ7 A;  1J8C A;  1JML A;  1ISN A;  2WWZ A;  2BBC A;  1WGK A;  3MC0 B;  2KWU B;  2XBB C;  4DDG D;  3PRP B;  3B2F A;  1MG4 A;  3AMZ A;  3ZDM C;  1SJE D;  3H7S A;  1TYG B;  2MWS B;  2QIL A;  3R7Q A;  1MHX A;  4HKQ A;  3W5V B;  2LEK A;  2INN E;  4F8C B;  1P1A A;  3QK0 A;  2D11 A;  3X23 A;  1HZ5 A;  2K6D B;  2ZVN A;  3NOB A;  2PVG C;  2JZZ A;  3S2A A;  2WP9 B;  1LGR A;  2BS3 B;  4YTN B;  3Q8E A;  1MFW A;  5IP4 D;  2LHE A;  2AX5 A;  2KD0 A;  1TKG A;  2CJO A;  1TZO A;  1WR6 E;  1WR1 A;  2Y5P A;  2INP E;  2CR5 A;  4JE3 B;  4WJO A;  5EDS A;  3R2T A;  3APF A;  2O2V A;  3ZRC A;  3HHM A;  1P9D U;  3VHT C;  2XN9 C;  5LXI B;  3SHQ A;  4IW0 A;  2M56 B;  2EMS A;  1WJ4 A;  4EZJ A;  2X38 A;  3DWG C;  1TKE A;  3KWL A;  1FNU A;  3WA0 A;  2V4I B;  3KYC D;  3Q8A A;  3APC A;  2G9H D;  1S1Q B;  4D2K A;  1XLP A;  4MSM B;  4L23 A;  2D3C A;  2QJL A;  4M02 A;  1HE8 A;  3ZQ4 A;  4W9E A;  2JF5 A;  3SDL C;  1J19 A;  2YEP F;  2LUE A;  4W9C A;  3VTW A;  2W55 A;  4DHJ B;  3HK0 A;  1GAQ B;  2LFI A;  4G0N B;  5C23 A;  3IXS A;  3DBR I;  1ZP0 B;  1BXT A;  1KRH A;  4K3C A;  2MRP A;  2M17 A;  2I2Y A;  1L7Y A;  2K1F A;  1E8Y A;  2BS2 B;  1M4V A;  2N7E A;  1SE3 A;  4MGI E;  2W3R A;  3OJ4 B;  2LGY A;  3NVY A;  1ZXH A;  1YIW A;  2H88 B;  1SE2 A;  3W1Y A;  1WGY A;  1NYR A;  1XT9 B;  4NJC A;  3KUC B;  5IO9 A;  3DDC B;  2WDV B;  4ICU A;  3ZO5 B;  5EE3 A;  1E7U A;  1KJT A;  1WYW B;  2DNF A;  2MBB B;  3BY4 B;  4C00 A;  2NPT A;  2B76 B;  1V8C A;  5DPW A;  4A9A A;  3UIP B;  1V2Y A;  3Q14 C;  2K22 A;  2GBJ A;  4ZHO A;  3L17 A;  2KTR B;  4N59 A;  3TCA A;  1S3S G;  3ZYY X;  2LD9 A;  1JAL A;  3QIJ A;  2NR2 A;  2ZNV C;  4FJV B;  4TQ1 A;  1E9M A;  1LM8 B;  2DAJ A;  3AB5 A;  4ASW C;  1L5P A;  4RCO A;  2D3B A;  4YXD B;  2N7D A;  4XWW A;  2KDF B;  3JVZ X;  1IPG A;  4OHJ A;  1JWA D;  2VRR B;  3PHW B;  3ZNZ B;  2MQJ A;  1FEH A;  1DGJ A;  4ANX A;  4EUT A;  4W9F A;  4LDT B;  1F9J A;  1IYF A;  1OTR B;  2BWE S;  5FKA C;  4BBN C;  4W9I A;  3O65 B;  4CO7 A;  4IC7 B;  3BK1 A;  4O1N A;  4PS3 A;  2WXM A;  1WF9 A;  2MP2 A;  2IO0 B;  1GPX A;  3RUL A;  2I1K A;  1NYQ A;  4ANU A;  1UWX A;  1GC6 A;  3V05 A;  2DYM A;  3V3X A;  5JZE B;  3DBH I;  3EHV A;  3QAR A;  4E3C A;  2K3U A;  3WAM A;  1STE A;  2JUO A;  5IA7 A;  1QOA A;  4EZK A;  2OHF A;  4NZL B;  4I6P A;  3ZRF A;  2I1J A;  3GP7 A;  1MPE A;  4XZ4 A;  1JW9 D;  4DBG A;  2W9N A;  4BKT A;  1WM3 A;  3QAQ A;  3KLS X;  2PKO A;  2K0P A;  3NS8 A;  1FPY A;  2K8C A;  1EO6 A;  2KJ6 A;  2C7N B;  3K9P B;  5HFY A;  3TEY A;  2X8X X;  5AZH A;  2DWQ A;  1RFK A;  2W82 A;  3V6C B;  1QT9 A;  3P2B A;  3AE4 B;  4HDO A;  4WWM A;  1VRA B;  4JLC A;  4C7Y A;  1WX9 A;  5GXG B;  3UGB B;  2KDI A;  4RNA A;  3BZD B;  1WM2 A;  1FRR A;  2N1V A;  5G55 A;  2QHO A;  3VUX A;  5C3J B;  1N5X A;  4EEW A;  2ZEQ A;  2HE7 A;  1R4M I;  4HRO A;  3SFD B;  4KVG B;  2R2O A;  2FCM A;  3PRM B;  3ZJT A;  2C7M B;  1TY0 A;  4LNI A;  2KHW B;  2R61 A;  3W1S A;  2VZK D;  1FCC C;  3I63 C;  3DOW A;  1FM0 D;  1DOX A;  2KAC A;  3ZNH B;  2AQ3 B;  2G1E A;  2MSE D;  1KFY B;  3RD2 A;  3WAO A;  3ZNI D;  2IGG A;  1JQ4 A;  4NAM A;  4P6V F;  2BWF A;  1L2N A;  2KWV B;  4A8X C;  3P42 A;  1V49 A;  2N9P C;  2HD5 B;  3IBE A;  4TV3 A;  1ZW7 A;  3B0A A;  3M95 A;  3U7D A;  3HUI A;  1UBQ A;  4HWI B;  1Q10 A;  3A33 B;  4PS8 A;  1XLN A;  4LDT D;  1ENF A;  5JXV A;  1P7E A;  2FCN A;  2WXF A;  3AEB B;  3KW5 B;  2WDQ B;  2M19 A;  1V1P B;  3JSV A;  3B1L X;  2C60 A;  4IM2 A;  1GG3 A;  5GMV A;  2V0G A;  4DQO C;  4KKI A;  1RAX A;  3WAN A;  5HKH A;  3N3K B;  3I57 A;  3P4Q B;  4RGN A;  1F77 A;  3AEG B;  4YSY B;  5C2T B;  1D5Z C;  4A90 A;  1PGX A;  1ESF A;  2NBU A;  4GDL A;  2LHD A;  1VDV A;  3M63 B;  1SB3 C;  1C77 A;  2M4N A;  1PQS A;  1LO5 D;  2RPV A;  3QHT A;  1UF0 A;  1YJJ A;  3MHZ A;  1YJI A;  1EWC A;  5LXH A;  2EMT A;  1QOG A;  4ZOH C;  3LDZ E;  1KLG D;  2JRH A;  1E6E B;  3AE5 B;  3W2D A;  1RFA A;  4NJ7 A;  4KZC A;  1F0Z A;  3U4E G;  4KKJ A;  4I6N B;  4FA6 A;  1V1O A;  2CU3 A;  2DBY A;  4WIP A;  1HA5 A;  2BYF A;  5AZF A;  3M3J A;  3A9K B;  1I4X A;  1MJD A;  2LZ6 A;  3PRE A;  1NI2 A;  3LXF A;  4NJ6 A;  2ACZ B;  3HVZ A;  1I42 A;  1V86 A;  3W9C B;  3OAW A;  5D3D A;  2JWU A;  2G3Q B;  4KDI C;  1FD6 A;  2WQY B;  4M00 A;  4E71 A;  4II2 B;  4OVU A;  5H92 C;  3RMK C;  3AED B;  5BMI A;  2ZVO A;  2RGF A;  1IBX A;  4N58 A;  2DZM A;  4PS7 A;  5CX3 A;  3U2S C;  3B9J A;  1WFY A;  2FUH B;  2KDM A;  1JWM D;  4WWN A;  4W9L A;  1K8R B;  4MAC A;  3L4P A;  2IJ0 A;  4P1B C;  1WMH A;  2BF8 B;  2K9X A;  4LJO B;  4USA A;  1EWY C;  1L4D B;  2FCS A;  2N9L A;  3FKY A;  2IPK D;  2L0T A;  1L6U A;  2L0F A;  2WDT B;  2VH1 A;  2WYQ A;  3DVG Y;  5L83 A;  4MGY E;  1YN4 A;  4C4V B;  1WYG A;  4RMA A;  4RF1 A;  5JHA A;  2JXT A;  2HTM E;  3L08 A;  1RYJ A;  1QOB A;  4S0R A;  2KQS A;  3UQB A;  2W3S A;  1TJE A;  3TEX A;  2QSD A;  1WE7 A;  3Q6B A;  4P16 A;  2WX0 A;  1I7H A;  2HDE A;  2RPQ A;  2L1A A;  3AH7 A;  4B0E A;  4GIV A;  2BTE A;  4M0W B;  3IHP C;  2I38 A;  2OJW A;  2JZP A;  4RGM A;  1JWS D;  5JH5 C;  1MHH E;  4HDQ A;  4AOF A;  1Q0W B;  3V60 A;  1L6V A;  4EZL A;  2ONQ A;  4AUQ C;  1BT0 A;  3GZN B;  2AWT A;  3DHG C;  3PO0 A;  1EU3 A;  1TTN A;  3A9J B;  3H1U A;  3C8Y A;  3R66 C;  2BKR B;  2OOB B;  3RNA C;  4LNK A;  3AUL A;  3WIM A;  3KQ4 A;  1PGB A;  4BKG A;  4K81 A;  2JRI B;  3KH0 A;  1T5X D;  2LRU A;  2N7J A;  1JWB D;  1YQ3 B;  5G5G A;  2AL6 A;  3DVN U;  4LCD E;  2A4Z A;  4KSK C; 
#chains in the Genus database with same CATH homology
 5AEK B;  5DPW A;  3L13 A;  3UIP B;  1V2Y A;  4YL8 A;  3NY5 A;  2GBJ A;  4HCN B;  4W9G A;  1WIA A;  2FCQ A;  3H7P A;  3L17 A;  1J0G A;  4I6L B;  2KTR B;  2PJH A;  1KM7 A;  3EFU A;  3TCA A;  1H8C A;  1S3S G;  2EKE C;  1EF1 A;  2G45 B;  3X0W A;  2LD9 A;  3EC8 A;  3QC8 B;  4MEM A;  3TL5 A;  4A20 A;  3V6E B;  1NBF C;  3L54 A;  1R4N I;  4K7W A;  2DYB A;  4DDI D;  1Q5W B;  2ZPN A;  2C7H A;  1UEL A;  2IO1 B;  3QIJ A;  1WH3 A;  2NR2 A;  2ZNV C;  4WJQ A;  2DZI A;  4FJV B;  1XQQ A;  4TQ1 A;  4W9J A;  5DPT A;  1LM8 B;  2DAJ A;  3U8Z A;  4ASW C;  2D07 B;  1UBI A;  5D94 A;  4IWQ A;  2NPT B;  2IY1 B;  2N7D A;  2R2Q A;  2K39 A;  2KJH B;  5G2N A;  3ZVV A;  2KDF B;  1VCB A;  3JVZ X;  2MP2 B;  3AU4 A;  1IPG A;  1YX5 B;  2RR9 A;  2VRR B;  1V9J A;  2XK5 B;  3PHW B;  4FJZ A;  4MDK E;  1WX8 A;  2MQJ A;  3ZNZ B;  1C1Y B;  3ZTC A;  3VTU A;  4EFO A;  3A4S C;  3AXC A;  2FID A;  4TKN A;  4ANX A;  2KZR A;  4EUT A;  1T0Y A;  4F7Z A;  3KUD B;  4W9F A;  2ZJD A;  4PYU A;  3PHX B;  4DHZ E;  4EKU A;  4LDT B;  4NNJ B;  1E90 A;  2KFK B;  4URK A;  1F9J A;  2KOX A;  4KV2 A;  2KXJ A;  1V5T A;  2CHW A;  4JL9 A;  1IYF A;  1OTR B;  2KN5 A;  3IFW B;  2BWE S;  5D2M B;  4BBN C;  4ANV A;  2BYE A;  4W9I A;  4XX5 A;  3O65 B;  4CO7 A;  4K1R B;  4IC7 B;  2NS5 A;  2J7Q B;  3AI5 A;  4PS3 A;  1LFD A;  2MW5 A;  3UF8 A;  4FHK A;  1WF9 A;  2MP2 A;  2V3S A;  3DCG A;  1E5W A;  2IO0 B;  2D2Q A;  2KNB A;  3RUL A;  2D10 A;  2KTR A;  2I1K A;  3ZW3 A;  4ANU A;  2PE6 B;  3CMM B;  3QCA A;  4DHJ D;  1V6E A;  1GC6 A;  1WJU A;  2DYM A;  5C1Z A;  5JZE B;  3DBH I;  1XD3 B;  3EHV A;  3QAR A;  3R7R A;  4E3C A;  1GJZ A;  2MBO A;  3VQI A;  4NQK E;  2KC1 A;  3WAM A;  2KFK A;  3ENE A;  2JUO A;  4NQL B;  5IA7 A;  4BKS A;  1C3T A;  4EZK A;  2K6Q A;  1WY8 A;  2J0K A;  3W1S C;  1WXV A;  4I6P A;  2MBQ A;  3ZRF A;  4AP4 C;  3VFK A;  1WXA A;  2I1J A;  1WZ3 A;  2LJ5 A;  3VDZ A;  4XZ4 A;  4HLE A;  3WAL A;  4RM8 A;  4CYE A;  4DBG A;  4AWJ A;  3U30 A;  1P3Q U;  2W9N A;  3NHE B;  4BKT A;  2MBE A;  1WM3 A;  3QAQ A;  2NVU I;  2KMA A;  2KX0 A;  3PV1 A;  2AYO B;  4ANW A;  3T8M A;  1Z5S B;  3NS8 A;  1MG8 A;  2K8C A;  2ZCC A;  3GZN I;  1EO6 A;  2KJ6 A;  2KLC A;  4MJS B;  2N9X A;  2C7N B;  3ZUN A;  3K9P B;  2G4D B;  4B95 A;  3DQV A;  5AZH A;  1OGW A;  1P98 A;  4NAW A;  3RT3 B;  4MGK E;  3PGE A;  3V6C B;  2L8J A;  3B08 A;  5DPR A;  4J6I A;  2JZ3 B;  4MSQ B;  2JVC A;  4BBN F;  3A1Q A;  3I3T B;  3P2B A;  1YJ1 A;  4B6W A;  4ICV A;  4HDO A;  1WGR A;  2IYD B;  4G11 A;  4JLC A;  1WX9 A;  3ML9 A;  5DPS A;  3JYU A;  3D32 A;  3UGB B;  1QZE A;  2KDI A;  2M0X A;  3DVG X;  1ZGU B;  2V1Y A;  4AJY B;  4IM3 A;  1E8Z A;  3QWZ B;  1WM2 A;  4DXA B;  2N1V A;  4JGH B;  4AJW A;  5G55 A;  1Y8R C;  1WI0 A;  2QHO A;  3LJ3 A;  2LGD A;  3VUX A;  2Z0E B;  2HTH A;  1V81 A;  3DVN V;  3PSE B;  4HJK A;  4EEW A;  1P0R A;  2ZEQ A;  2N9E B;  3A1Q B;  2K8H A;  3L16 A;  2BKF A;  2HE7 A;  5E6P A;  4GSW A;  1R4M I;  4DWF A;  2CHZ A;  3L10 B;  3TMP B;  4PYZ A;  4KVG B;  2R2O A;  4KIK A;  2FCM A;  3PRM B;  2C7M B;  2DEN B;  2C5L C;  2KHW B;  1SE9 A;  2BPS A;  4FJY A;  3QA8 A;  3W1S A;  2L3Z A;  1EUV B;  3Q3F A;  2LGX A;  5JHB A;  2DZK A;  2KLG A;  4W9H A;  1VD2 A;  2ZZP B;  2CS4 A;  4MM3 A;  3CSF A;  3DOW A;  2KDB A;  1LQB A;  2NCN A;  5TR5 A;  3VUY A;  2GMI C;  2DZJ A;  2BYV E;  5E6O A;  1U4A A;  3ZNH B;  2MSE D;  4GU2 A;  3PT2 B;  4WJN A;  3RD2 A;  4KZ0 A;  3WAO A;  4HCP B;  3ZNI D;  3VH4 B;  1YX6 B;  1Z2M A;  3VUW A;  3ONS A;  2Y5B B;  4GDL B;  2MBH A;  4BVU C;  2DAF A;  5L95 C;  2BWF A;  1L2N A;  2KWV B;  5BO4 B;  1V49 A;  2KDE B;  2N9P C;  4NAW B;  2HD5 B;  2K8B A;  3IBE A;  4TV3 A;  1ZW7 A;  2J0M A;  2LRW A;  3B0A A;  3M95 A;  4HPL B;  3U7D A;  3V62 A;  1UBQ A;  2XEW A;  1WGH A;  1E8X A;  2GOW A;  4W9K A;  3DPD A;  2C9W B;  3BIN A;  2LI5 A;  3CST A;  4HWI B;  4IWP A;  5CHW A;  4PS8 A;  2XK5 A;  3A33 B;  2IO2 B;  4OVV A;  3UIN B;  2HJ8 A;  2L05 A;  4HXD A;  4LDT D;  4CHK A;  3C0R B;  4EOY A;  3QQ8 B;  2CHX A;  3Q3J A;  4F1S A;  2JPH A;  2ASQ A;  2FCN A;  4G3X B;  3RUI B;  3ZTD A;  1JRU A;  2KVR A;  3PPA A;  3KW5 B;  1E8W A;  1SIF A;  4LJP B;  1OEY J;  3VAW A;  1I35 A;  4JIO U;  3JSV A;  2AL3 A;  3ECI A;  3SD5 A;  3B1L X;  4ZYN A;  2C60 A;  3ML8 A;  4IM2 A;  1GG3 A;  2M1M A;  5GMV A;  4ZRK A;  2L00 B;  4A3O A;  3N32 A;  1RAX A;  3R3M A;  3WAN A;  5HKH A;  2YVC A;  3N3K B;  2JY6 A;  2LXC A;  2WX1 A;  3ALB A;  4WAA A;  2LVO A;  2N1W A;  4IG7 B;  1WJN A;  3H6N A;  3DBS A;  4E74 A;  4BKS D;  4P7I A;  4NPN A;  3NZS A;  4GB9 A;  1G6J A;  3MTN B;  3PRZ A;  1KLV A;  2RD0 A;  5CHF A;  2NBU A;  5KHQ A;  3JW0 X;  3PVL A;  4GDL A;  3T9L A;  4RM9 A;  3M63 B;  3VTV A;  1GC7 A;  2IY0 B;  2YLM A;  4FBJ B;  4HPM B;  1WXM A;  2LXA A;  2M4N A;  3AU5 A;  1PQS A;  3PLU A;  4JQW C;  3JSV B;  1LXD A;  1UH6 A;  3PLV A;  4BOZ B;  2UWQ A;  2KKC A;  3QHT A;  3IVF A;  1YQB A;  2JWZ A;  5LXH A;  4GOC A;  2EMT A;  2A5U A;  3ZKJ C;  3LDZ E;  4WWP A;  4DK5 A;  2JRH A;  4W9D A;  1Q1O A;  1RFA A;  3ZIM A;  4NJ7 A;  4TUU A;  3VVW B;  2K25 A;  2DHZ A;  2LVQ A;  5AZG A;  4KZC A;  4K7S A;  4I6N B;  4GDK B;  3QX1 A;  4FA6 A;  3UIO B;  5KHO A;  3EEC A;  4MJS A;  1FXT B;  3M62 B;  4IM0 A;  3APD A;  2IZV B;  2BYF A;  2KC2 A;  3K9O B;  5AZF A;  4B9K A;  2REX A;  2CKH B;  3M3J A;  2FAZ A;  4FAD A;  3A9K B;  1OQY A;  5D6J B;  2KX3 A;  2MA9 B;  2LWP A;  3NZU A;  2LZ6 A;  3PRE A;  4N9F 4;  5E6N A;  3HM6 X;  1NI2 A;  4WWO A;  1SGH A;  4NJ6 A;  5J2R A;  3MHS D;  1OEY A;  4HK2 A;  1I42 A;  1V86 A;  4GXB A;  2MLB A;  2MX2 A;  3OAW A;  2J0J A;  1WMH B;  3UQA A;  4X57 B;  1D3Z A;  2G3Q B;  2O6V D;  4FUL A;  2N4F A;  1EF5 A;  4KDI C;  2JT4 B;  4GDK A;  1J8C A;  3PZD A;  2RSU A;  2Z59 B;  1ISN A;  2O6V B;  2NBW B;  2WWZ A;  4E71 A;  1WZ0 A;  4II2 B;  4OVU A;  2JXX A;  3A9K A;  3V61 A;  1TZ1 A;  1YD8 U;  2V4L A;  2LAS A;  2KWU B;  2XBB C;  2KMC A;  5IAA C;  1M94 A;  1X1M A;  2RGF A;  2PE9 A;  2ZVO A;  4DDG D;  1E7V A;  3PRP B;  2KFJ A;  4HVB A;  4BFR A;  3GOE A;  3ZDM C;  2PPH A;  3H7S A;  4ZRI A;  2DZM A;  2GBN A;  2MWS B;  4PS7 A;  3HIZ A;  5CX3 A;  3R7Q A;  4KIK B;  1GNU A;  2KJR A;  1P1A A;  2ZPY A;  3QK0 A;  1WFY A;  4A3P A;  4F8C B;  1A5R A;  2D11 A;  3X23 A;  4MGZ E;  2FUH B;  4ZRJ A;  2K6D B;  1WJ6 A;  2FNJ B;  1WRD B;  3HM3 A;  2DX5 B;  2ZVN A;  4KSL C;  3NOB A;  4ZDV A;  2JZZ A;  2OJR A;  4G50 A;  1TGZ B;  3S2A A;  4WWN A;  2LVP A;  4W9L A;  3SU8 X;  1K8R B;  2O2V B;  1UGM A;  2GBM A;  3RZF A;  1WX7 A;  2AEH A;  2MCN B;  1WMH A;  2BF8 B;  2UYZ B;  3OLM D;  4LJO B;  3TIX A;  2FCS A;  3IG3 A;  2B3A A;  1UZX B;  3DBL I;  3CF6 E;  3ZNG C;  4KDL B;  4FN2 A;  2L0T A;  4XC2 A;  1WXS A;  2KD0 A;  2L0F A;  1WR6 E;  2WDT B;  1WR1 A;  2CR5 A;  1AAR A;  1V80 A;  2WYQ A;  3DVG Y;  3KUZ A;  2G4S A;  5L83 A;  4MGY E;  4WJO A;  3ZDT A;  5EDS A;  3H9D A;  4II3 B;  4GGQ A;  3WAP A;  3APF A;  2O2V A;  4RMA A;  3ZRC A;  1NDD A;  3HHM A;  1P9D U;  1KOT A;  3VHT C;  5JHA A;  2L7R A;  5LXI B;  3L08 A;  3SHQ A;  4K7U A;  4IW0 A;  2EMS A;  2KQS A;  3OJ3 A;  1WJ4 A;  4EZJ A;  3UQB A;  3H7P B;  4GMV A;  1WE7 A;  4MEL A;  3KYD D;  2WX0 A;  1RRB A;  2O6V A;  2KK8 A;  1CMX B;  3WA0 A;  3PS6 A;  2GBK A;  5CHV C;  2RPQ A;  2IO3 B;  3KYC D;  3APC A;  2KTF A;  1S1Q B;  5LLI A;  4GIV A;  4MSM B;  3RYT A;  3A4R A;  4M0W B;  5FR6 A;  3IHP C;  3VH3 B;  1HE8 A;  3RCZ A;  4TQ0 A;  3A9J A;  4W9E A;  5DCN A;  2D3G A;  3KVF B;  4DHZ B;  2GBR A;  2JF5 A;  5D7G A;  3SDL C;  1J19 A;  1V5O A;  2LUE A;  4FHJ A;  3ZLZ A;  2NBV B;  4W9C A;  3VTW A;  4HDQ A;  5JH5 C;  4DHJ B;  3HK0 A;  4WQO B;  4AOF A;  4G0N B;  1IP9 A;  5C23 A;  3N30 A;  2FIF A;  1Q0W B;  3DBR I;  3QJZ A;  3V60 A;  2ZCB A;  1TBE A;  3TJP A;  4EZL A;  3PTF C;  3TBL D;  2MRP A;  1UD7 A;  2M17 A;  4FLH A;  4MH0 E;  4AUQ C;  1BT0 A;  1RLF A;  2Z0D B;  1L7Y A;  2K1F A;  5J18 A;  2IBI B;  1ZKH A;  3L0W B;  2AWT A;  4GN1 A;  4WJP A;  5CTR C;  2KO3 A;  1GUA B;  1E8Y A;  4BOS C;  2N7E A;  2BGF A;  2KQ7 A;  4MGI E;  1TTN A;  2PEA A;  3A9J B;  3H1U A;  2LGY A;  3OJ4 B;  3R66 C;  2BKR B;  2OOB B;  1YIW A;  3W1Y A;  3VXW A;  3AUL A;  1WGY A;  1XT9 B;  2M8S A;  4IUM B;  2L76 A;  1WGD A;  2ZNV B;  3WIM A;  4BKG A;  3KUC B;  3MJW A;  4NY0 A;  4K81 A;  1WGG A;  3DDC B;  5J17 A;  2KWC A;  4ICU A;  2JRI B;  2CU1 A;  4M8N A;  3RZW C;  3ZO5 B;  1E7U A;  1KJT A;  1WYW B;  4IWO A;  3KH0 A;  4M8M A;  2LRU A;  1WE6 A;  2MBB B;  3BY4 B;  2DYO A;  1H4R A;  2NPT A;  2AL6 A;  3DVN U;  4LCD E;  2A4Z A;  2KAN A;  4KSK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...