2PECA

The refined three-dimensional structure of pectate lyase c from erwinia chrysanthemi at 2.2 angstroms resolution: implications for an enzymatic mechanism
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
352
structure length
352
Chain Sequence
ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Protein motifs. 3. The parallel beta helix and other coiled folds.
pubmed rcsb
source organism Erwinia chrysanthemi
molecule tags Lyase (acting on polysaccharides)
molecule keywords PECTATE LYASE C
total genus 142
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 1994-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2pecA00
4XLAA 1OFMA 2X85A 4YZ0A 4XLEA 1X0CA 4YEJA 4XKVA 4XLFA 2PECA 2NTPA 2O1DA 1IDKA 4U49A 3LMWA 1KTWA 1VBLA 4OZZA 1IDJA 3VSVA 4XN3A 3KRGA 1AIRA 1HG8A 3VMWA 4W8QA 1JRGA 4W8TA 4XLCA 1KCDA 4OJPA 4XOTA 5C1CA 4XM3A 4Z03A 2VBEA 1KCCA 3GQ9A 1WMRA 4XL9A 2VJIA 1O8FA 4YZQA 5C1EA 2X3HA 4HWVA 3T9GA 4XN0A 1RMGA 4EW9A 4NK6A 2VBMA 4OZYA 1O8KA 4OJOA 4U4BA 4MXNA 1JTAA 1O8LA 4XNFA 3VSTA 1CZFA 1PLUA 2PYGA 4YELA 1O8DA 2NTBA 1NHCA 3GQ8A 4XKWA 1DBGA 3FY3A 2VJJA 4PMHA 4URRA 3VMVA 1O8JA 3EQOA 4OJ5A 4XOPA 1RU4A 4I84A 2O0WA 4XMYA 2NT9A 1BN8A 2IQ7A 2QX3A 1GQ8A 4YZAA 2Z8GA 3GQ7A 4W8RA 4C2LA 1O8GA 1RWRA 4W8SA 1PXZA 2O04A 2X6XA 4Z05A 2O0VA 2INUA 2O17A 2PYHA 4XORA 1IA5A 4XLHA 4YZXA 1OFLA 1O8HA 3ZPPA 4XONA 1DBOA 1XG2A 1K5CA 1QJVA 2NTQA 2INVA 1O8IA 4XR6A 1OOCA 2UVEA 3SUCA 4NK8A 1O8EA 2VBKA 3B4NA 4Z06A 3JURA 2NT6A 2UVFA 1O88A 1PE9A 4XQFA 3GRHA 3ZSCA 2X6YA 1O8MA 3B90A 3WWGA 1QCXA 4OJ6A 2BSPA 2NSPA 2EWEA 2NZMA 1OGMX 1BHEA 1H80A 5AMVA 4AVZA 3GQAA 4OJLA 1OGOX 2X6WA 3VSUA 4MR0A 2QXZA 1EE6A 2ODLA 2QY1A 3B8YA 3EQNA 3UW0A 2NSTA 1IB4A
chains in the Genus database with same CATH superfamily
4XLAA 5JLVC 1OFMA 2X85A 4YZ0A 2VFMA 3P4GA 4XLEA 1X0CA 4YEJA 4XKVA 4XLFA 3SZEA 2PECA 2NTPA 2O1DA 1IDKA 4U49A 3LMWA 5DNSA 1KTWA 1VBLA 4OZZA 1IDJA 3VSVA 4XN3A 1QRCA 1AIRA 1HG8A 2J8KA 2O6WA 3KRGA 3ML3A 2QYUA 4W8QA 3VMWA 1JRGA 3H09A 3PSZA 1LLWA 2XTYA 4W8TA 4XLCA 1KCDA 1EZGA 1KQ5A 3LJYA 4OJPA 4XOTA 5C1CA 4XM3A 2VFPA 2J8IA 4YDTA 4Z03A 2VBEA 1KCCA 1TYVA 3GQ9A 1OFEA 3N90A 1WMRA 4XL9A 1WXRA 1OFDA 1O8FA 2VJIA 2BM7A 4YZQA 2VFOA 5C1EA 2X3HA 4HWVA 2BX6A 3T9GA 4XN0A 1RMGA 3NAWA 2G0YA 1LLZA 4EW9A 4NK6A 2VBMA 4V02C 4OZYA 1O8KA 4OJOA 4U4BA 3DU1X 4MXNA 1JTAA 1EA0A 1O8LA 4XNFA 3VSTA 1LM1A 1CZFA 4YFOA 1PLUA 2PYGA 4YELA 1O8DA 1K8FA 2NTBA 1TYXA 1NHCA 1DABA 4JRAC 3GQ8A 4XKWA 1DBGA 3LYCA 3AK5A 3FY3A 2IOUG 1QQ1A 1TYWA 2VJJA 4PMHA 4URRA 1O8JA 3EQOA 2VFQA 4OJ5A 4XOPA 1TYUA 1RU4A 2XTWA 2O0WA 3JX8A 2NT9A 4I84A 4KH3A 4XMYA 1BN8A 2IQ7A 2QX3A 2XTXA 1GQ8A 4YZAA 2Z8GA 3GQ7A 4W8RA 4C2LA 1K4ZA 1O8GA 1RWRA 4W8SA 2XT4A 3VMVA 1CLWA 1PXZA 2O04A 2X6XA 4Z05A 1TSPA 2O0VA 2XC1A 3RIQA 2INUA 2O17A 3NB2A 2PYHA 1QA2A 3SYJA 4XORA 2BM4A 1IA5A 4XLHA 4YZXA 2V5IA 1OFLA 2W7ZA 4YC5A 4YEIA 1O8HA 4YCQA 3ZPPA 4XONA 1QA3A 4OPWA 1DBOA 1XG2A 2QZAA 1QJVA 2NTQA 2INVA 3N6ZA 1K5CA 1O8IA 4XR6A 1OOCA 2UVEA 3SUCA 2BM5A 2F3LA 4NK8A 1O8EA 2VBKA 2XT2A 3B4NA 4Z06A 3TH0A 3JURA 2NT6A 2UVFA 3SY2A 1QRBA 1O88A 1PE9A 4XQFA 3GRHA 1L1IA 3ZSCA 2X6YA 1O8MA 3B90A 3WWGA 5JMCB 2YUHA 2VFNA 1QCXA 3BH7B 2BSPA 4OJ6A 2NSPA 2EWEA 2NZMA 1OGMX 1BHEA 1H80A 5AMVA 4OM9A 1HF2A 1QA1A 4AVZA 3GQAA 4OJLA 3PETA 1OGOX 2X6WA 3VSUA 4MR0A 2QXZA 1EE6A 2ODLA 3BH6B 2QY1A 3B8YA 3SQVA 3EQNA 2B0RA 3UW0A 2NSTA 1IB4A 2BM6A 3PSSA
chains in the Genus database with same CATH topology
4XLAA 1OFMA 2X85A 4YZ0A 4XLEA 1X0CA 4YEJA 4XKVA 4XLFA 2PECA 2NTPA 2O1DA 1IDKA 4U49A 3LMWA 1KTWA 1VBLA 4OZZA 1IDJA 3VSVA 4XN3A 3KRGA 1AIRA 1HG8A 3VMWA 4W8QA 1JRGA 4W8TA 4XLCA 1KCDA 4OJPA 4XOTA 5C1CA 4XM3A 4Z03A 2VBEA 1KCCA 3GQ9A 1WMRA 4XL9A 2VJIA 1O8FA 4YZQA 5C1EA 2X3HA 4HWVA 3T9GA 4XN0A 1RMGA 4EW9A 4NK6A 2VBMA 4OZYA 1O8KA 4OJOA 4U4BA 4MXNA 1JTAA 1O8LA 4XNFA 3VSTA 1CZFA 1PLUA 2PYGA 4YELA 1O8DA 2NTBA 1NHCA 3GQ8A 4XKWA 1DBGA 3FY3A 2VJJA 4PMHA 4URRA 3VMVA 1O8JA 3EQOA 4OJ5A 4XOPA 1RU4A 4I84A 2O0WA 4XMYA 2NT9A 1BN8A 2IQ7A 2QX3A 1GQ8A 4YZAA 2Z8GA 3GQ7A 4W8RA 4C2LA 1O8GA 1RWRA 4W8SA 1PXZA 2O04A 2X6XA 4Z05A 2O0VA 2INUA 2O17A 2PYHA 4XORA 1IA5A 4XLHA 4YZXA 1OFLA 1O8HA 3ZPPA 4XONA 1DBOA 1XG2A 1K5CA 1QJVA 2NTQA 2INVA 1O8IA 4XR6A 1OOCA 2UVEA 3SUCA 4NK8A 1O8EA 2VBKA 3B4NA 4Z06A 3JURA 2NT6A 2UVFA 1O88A 1PE9A 4XQFA 3GRHA 3ZSCA 2X6YA 1O8MA 3B90A 3WWGA 1QCXA 4OJ6A 2BSPA 2NSPA 2EWEA 2NZMA 1OGMX 1BHEA 1H80A 5AMVA 4AVZA 3GQAA 4OJLA 1OGOX 2X6WA 3VSUA 4MR0A 2QXZA 1EE6A 2ODLA 2QY1A 3B8YA 3EQNA 3UW0A 2NSTA 1IB4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XLA A;  1OFM A;  2X85 A;  4YZ0 A;  4XLE A;  1X0C A;  4YEJ A;  4XKV A;  4XLF A;  2PEC A;  2NTP A;  2O1D A;  1IDK A;  4U49 A;  3LMW A;  1KTW A;  1VBL A;  4OZZ A;  1IDJ A;  3VSV A;  4XN3 A;  3KRG A;  1AIR A;  1HG8 A;  3VMW A;  4W8Q A;  1JRG A;  4W8T A;  4XLC A;  1KCD A;  4OJP A;  4XOT A;  5C1C A;  4XM3 A;  4Z03 A;  2VBE A;  1KCC A;  3GQ9 A;  1WMR A;  4XL9 A;  2VJI A;  1O8F A;  4YZQ A;  5C1E A;  2X3H A;  4HWV A;  3T9G A;  4XN0 A;  1RMG A;  4EW9 A;  4NK6 A;  2VBM A;  4OZY A;  1O8K A;  4OJO A;  4U4B A;  4MXN A;  1JTA A;  1O8L A;  4XNF A;  3VST A;  1CZF A;  1PLU A;  2PYG A;  4YEL A;  1O8D A;  2NTB A;  1NHC A;  3GQ8 A;  4XKW A;  1DBG A;  3FY3 A;  2VJJ A;  4PMH A;  4URR A;  3VMV A;  1O8J A;  3EQO A;  4OJ5 A;  4XOP A;  1RU4 A;  4I84 A;  2O0W A;  4XMY A;  2NT9 A;  1BN8 A;  2IQ7 A;  2QX3 A;  1GQ8 A;  4YZA A;  2Z8G A;  3GQ7 A;  4W8R A;  4C2L A;  1O8G A;  1RWR A;  4W8S A;  1PXZ A;  2O04 A;  2X6X A;  4Z05 A;  2O0V A;  2INU A;  2O17 A;  2PYH A;  4XOR A;  1IA5 A;  4XLH A;  4YZX A;  1OFL A;  1O8H A;  3ZPP A;  4XON A;  1DBO A;  1XG2 A;  1K5C A;  1QJV A;  2NTQ A;  2INV A;  1O8I A;  4XR6 A;  1OOC A;  2UVE A;  3SUC A;  4NK8 A;  1O8E A;  2VBK A;  3B4N A;  4Z06 A;  3JUR A;  2NT6 A;  2UVF A;  1O88 A;  1PE9 A;  4XQF A;  3GRH A;  3ZSC A;  2X6Y A;  1O8M A;  3B90 A;  3WWG A;  1QCX A;  4OJ6 A;  2BSP A;  2NSP A;  2EWE A;  2NZM A;  1OGM X;  1BHE A;  1H80 A;  5AMV A;  4AVZ A;  3GQA A;  4OJL A;  1OGO X;  2X6W A;  3VSU A;  4MR0 A;  2QXZ A;  1EE6 A;  2ODL A;  2QY1 A;  3B8Y A;  3EQN A;  3UW0 A;  2NST A;  1IB4 A; 
#chains in the Genus database with same CATH topology
 4XLA A;  5JLV C;  1OFM A;  2X85 A;  4YZ0 A;  2VFM A;  3P4G A;  4XLE A;  1X0C A;  4YEJ A;  4XKV A;  4XLF A;  3SZE A;  2PEC A;  2NTP A;  2O1D A;  1IDK A;  4U49 A;  3LMW A;  5DNS A;  1KTW A;  1VBL A;  4OZZ A;  1IDJ A;  3VSV A;  4XN3 A;  1QRC A;  1AIR A;  1HG8 A;  2J8K A;  2O6W A;  3KRG A;  3ML3 A;  2QYU A;  4W8Q A;  3VMW A;  1JRG A;  3H09 A;  3PSZ A;  1LLW A;  2XTY A;  4W8T A;  4XLC A;  1KCD A;  1EZG A;  1KQ5 A;  3LJY A;  4OJP A;  4XOT A;  5C1C A;  4XM3 A;  2VFP A;  2J8I A;  4YDT A;  4Z03 A;  2VBE A;  1KCC A;  1TYV A;  3GQ9 A;  1OFE A;  3N90 A;  1WMR A;  4XL9 A;  1WXR A;  1OFD A;  1O8F A;  2VJI A;  2BM7 A;  4YZQ A;  2VFO A;  5C1E A;  2X3H A;  4HWV A;  2BX6 A;  3T9G A;  4XN0 A;  1RMG A;  3NAW A;  2G0Y A;  1LLZ A;  4EW9 A;  4NK6 A;  2VBM A;  4V02 C;  4OZY A;  1O8K A;  4OJO A;  4U4B A;  3DU1 X;  4MXN A;  1JTA A;  1EA0 A;  1O8L A;  4XNF A;  3VST A;  1LM1 A;  1CZF A;  4YFO A;  1PLU A;  2PYG A;  4YEL A;  1O8D A;  1K8F A;  2NTB A;  1TYX A;  1NHC A;  1DAB A;  4JRA C;  3GQ8 A;  4XKW A;  1DBG A;  3LYC A;  3AK5 A;  3FY3 A;  2IOU G;  1QQ1 A;  1TYW A;  2VJJ A;  4PMH A;  4URR A;  1O8J A;  3EQO A;  2VFQ A;  4OJ5 A;  4XOP A;  1TYU A;  1RU4 A;  2XTW A;  2O0W A;  3JX8 A;  2NT9 A;  4I84 A;  4KH3 A;  4XMY A;  1BN8 A;  2IQ7 A;  2QX3 A;  2XTX A;  1GQ8 A;  4YZA A;  2Z8G A;  3GQ7 A;  4W8R A;  4C2L A;  1K4Z A;  1O8G A;  1RWR A;  4W8S A;  2XT4 A;  3VMV A;  1CLW A;  1PXZ A;  2O04 A;  2X6X A;  4Z05 A;  1TSP A;  2O0V A;  2XC1 A;  3RIQ A;  2INU A;  2O17 A;  3NB2 A;  2PYH A;  1QA2 A;  3SYJ A;  4XOR A;  2BM4 A;  1IA5 A;  4XLH A;  4YZX A;  2V5I A;  1OFL A;  2W7Z A;  4YC5 A;  4YEI A;  1O8H A;  4YCQ A;  3ZPP A;  4XON A;  1QA3 A;  4OPW A;  1DBO A;  1XG2 A;  2QZA A;  1QJV A;  2NTQ A;  2INV A;  3N6Z A;  1K5C A;  1O8I A;  4XR6 A;  1OOC A;  2UVE A;  3SUC A;  2BM5 A;  2F3L A;  4NK8 A;  1O8E A;  2VBK A;  2XT2 A;  3B4N A;  4Z06 A;  3TH0 A;  3JUR A;  2NT6 A;  2UVF A;  3SY2 A;  1QRB A;  1O88 A;  1PE9 A;  4XQF A;  3GRH A;  1L1I A;  3ZSC A;  2X6Y A;  1O8M A;  3B90 A;  3WWG A;  5JMC B;  2YUH A;  2VFN A;  1QCX A;  3BH7 B;  2BSP A;  4OJ6 A;  2NSP A;  2EWE A;  2NZM A;  1OGM X;  1BHE A;  1H80 A;  5AMV A;  4OM9 A;  1HF2 A;  1QA1 A;  4AVZ A;  3GQA A;  4OJL A;  3PET A;  1OGO X;  2X6W A;  3VSU A;  4MR0 A;  2QXZ A;  1EE6 A;  2ODL A;  3BH6 B;  2QY1 A;  3B8Y A;  3SQV A;  3EQN A;  2B0R A;  3UW0 A;  2NST A;  1IB4 A;  2BM6 A;  3PSS A; 
#chains in the Genus database with same CATH homology
 4XLA A;  1OFM A;  2X85 A;  4YZ0 A;  4XLE A;  1X0C A;  4YEJ A;  4XKV A;  4XLF A;  2PEC A;  2NTP A;  2O1D A;  1IDK A;  4U49 A;  3LMW A;  1KTW A;  1VBL A;  4OZZ A;  1IDJ A;  3VSV A;  4XN3 A;  3KRG A;  1AIR A;  1HG8 A;  3VMW A;  4W8Q A;  1JRG A;  4W8T A;  4XLC A;  1KCD A;  4OJP A;  4XOT A;  5C1C A;  4XM3 A;  4Z03 A;  2VBE A;  1KCC A;  3GQ9 A;  1WMR A;  4XL9 A;  2VJI A;  1O8F A;  4YZQ A;  5C1E A;  2X3H A;  4HWV A;  3T9G A;  4XN0 A;  1RMG A;  4EW9 A;  4NK6 A;  2VBM A;  4OZY A;  1O8K A;  4OJO A;  4U4B A;  4MXN A;  1JTA A;  1O8L A;  4XNF A;  3VST A;  1CZF A;  1PLU A;  2PYG A;  4YEL A;  1O8D A;  2NTB A;  1NHC A;  3GQ8 A;  4XKW A;  1DBG A;  3FY3 A;  2VJJ A;  4PMH A;  4URR A;  3VMV A;  1O8J A;  3EQO A;  4OJ5 A;  4XOP A;  1RU4 A;  4I84 A;  2O0W A;  4XMY A;  2NT9 A;  1BN8 A;  2IQ7 A;  2QX3 A;  1GQ8 A;  4YZA A;  2Z8G A;  3GQ7 A;  4W8R A;  4C2L A;  1O8G A;  1RWR A;  4W8S A;  1PXZ A;  2O04 A;  2X6X A;  4Z05 A;  2O0V A;  2INU A;  2O17 A;  2PYH A;  4XOR A;  1IA5 A;  4XLH A;  4YZX A;  1OFL A;  1O8H A;  3ZPP A;  4XON A;  1DBO A;  1XG2 A;  1K5C A;  1QJV A;  2NTQ A;  2INV A;  1O8I A;  4XR6 A;  1OOC A;  2UVE A;  3SUC A;  4NK8 A;  1O8E A;  2VBK A;  3B4N A;  4Z06 A;  3JUR A;  2NT6 A;  2UVF A;  1O88 A;  1PE9 A;  4XQF A;  3GRH A;  3ZSC A;  2X6Y A;  1O8M A;  3B90 A;  3WWG A;  1QCX A;  4OJ6 A;  2BSP A;  2NSP A;  2EWE A;  2NZM A;  1OGM X;  1BHE A;  1H80 A;  5AMV A;  4AVZ A;  3GQA A;  4OJL A;  1OGO X;  2X6W A;  3VSU A;  4MR0 A;  2QXZ A;  1EE6 A;  2ODL A;  2QY1 A;  3B8Y A;  3EQN A;  3UW0 A;  2NST A;  1IB4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...