2PEHA

Crystal structure of the uhm domain of human spf45 in complex with sf3b155-ulm5
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
104
structure length
104
Chain Sequence
b'AMGKCPTKVVLLRNMVGAGEVDEDLEVETKEECEKYGKVGKCVIFEIPGAPDDEAVRIFLEFERVESAIKAVVDLNGRYFGGRVVKACFYNLDKFRVLDLAEQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Splicing factor 45
molecule tags Protein binding
source organism Homo sapiens
publication title U2AF-homology motif interactions are required for alternative splicing regulation by SPF45.
pubmed doi rcsb
total genus 26
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2pehA01
1HD0A 2CQDA 1N8RT 2DH7A 4CH0S 2MQMA 3CC2S 2MJUA 5GAGU 1YWXA 2M88A 3FEXB 5GAEU 1KD1T 4ZKAA 2KM8B 2DNPA 3EX7B 2AYBA 1PO6A 2E5JA 1UFWA 1PGZA 2DNLA 2LXIA 1JMTA 5D78A 3G4SS 3I55S 5HL7Q 2E44A 2JX2A 1W2BR 3CCMS 1S72S 5CXTA 1WHVA 3CCUS 2CQBA 2SXLA 2EK1A 1KC8T 1L3KA 2M2BA 2N3OA 4LJMA 1FHTA 1X5TA 3UE2A 1UP1A 2XS5A 2MKJA 3RW6A 4C0OC 1VQ7S 4WFAQ 2MZRA 5IFMA 3DXBA 5GAHU 4YOEA 1ZH5A 1WTBA 1QVGR 2FPHX 1FXLA 5EN1A 4QQBA 4QU7A 1X4DA 3CCLS 1SJ4P 5HO4A 3MXHP 3CTRA 4IOAQ 1WG5A 4UQTA 2L9WA 1DRZA 5DDPC 1KOHA 1X5PA 1YJWS 2KXNB 2VODA 5LXYA 3BEGB 1VBXA 2E5HA 4WFBQ 3VAHA 5H1SV 2MKHA 4YB1P 1BY9A 2LMIA 2DH8A 2DNOA 5D77A 2RQCA 4P6QA 3TO8A 2D9PA 3K0JA 4A8XA 1M5PC 2HVZA 2M52A 3LQVA 2WBRA 2QA4S 3EGNA 1KOOA 2HGLA 2LA6A 1IQTA 1SJQA 4C4WA 2V94A 1HD1A 1WI6A 2ADCA 3G6ES 2MYFA 3SDEB 2CPFA 2DHXA 2DNZA 1Q7YT 1M1KT 1DBDA 2DB1A 2LKZA 3S6EA 3EGZA 2LQ5A 2N82B 3B4DA 1N88A 4WFNQ 1O0PA 3G8SA 2RT3A 2CPHA 1X4HA 2MQQA 3NS6A 3DLLQ 2RS2A 3U1MA 2I2YA 2F9DA 2KRRA 2MHNA 1ZZNA 1A9NB 1K73T 1Q81T 1U6FA 2KU7A 3MDFA 3BO4A 1VQ6S 2CQ2A 4WF9Q 1VQ4S 3S7RA 2DGUA 3UCZP 2RVJA 2CPDA 1U1QA 3US5A 2CPJA 4CQ1A 2LCWA 2X1FA 2ZJRQ 2AYMA 2JRSA 2DGOA 3CF5Q 1D8ZA 2M4MA 2XNQA 3CPWR 3CD6S 2CQ1A 2LEAA 1WF1A 2MQLA 3G9CA 5LJ5Y 2DGVA 3SXLA 3UD4P 2XSFA 2BZ2A 2HGMA 1Q86T 3P6YC 1NO8A 4WCEQ 1X0FA 4F26A 2D3OR 2CQ4A 3MD3A 4RU2A 2RRBA 2U1AA 3ZZYA 5GVQA 3THPA 2RUGA 5CA5A 1SJ3P 1WF2A 1VBZA 4UY8T 2KXFA 4WKRA 1VQKS 1X5OA 1YITS 2E5GA 1U1OA 1QM9A 2DNYA 1U1MA 2G4BA 1KQSR 4PKDB 1YHQS 1YJNS 3PIOQ 3PIPQ 2J0SD 2DGWA 2G0CA 2M0GB 3NNCA 1OWXA 2X1BA 2CQ3A 3NS5A 2JVOA 2KYXA 2DHGA 2KHCA 2L08A 1R8PA 2DGQA 3TP2A 3I56S 1DZ5A 1WHXA 2YKAA 2J0QD 4IUFA 2MQPA 2E5IA 1U1NA 1D9AA 2MSSA 4C7QA 2DHAA 5IQQA 2JWNA 2EVZA 3CCSS 2U2FA 2FC8A 2MXYA 4ERDA 3R1LA 5LXRA 1VQLS 3MI7X 3R27A 1VBYA 2KT5A 4FXVA 5DM6Q 1H2VZ 3NMRA 2MPUA 2HZCA 1AUDA 2MKSA 2DGSA 3FEYB 5CYJA 2QEXS 2L41A 1URNA 1M5KC 3SMZA 3THTA 3JB9k 2OTLS 2DO4A 3Q2SC 4U67Q 2YH1A 1XN9A 2F3JA 3VAGA 1WI8A 2AYEA 2A3JA 1FNXH 4QU6A 2VONA 2CPXA 1FO1A 3LPYA 2VOOA 1WWHA 3TYTA 2RS8A 1G2EA 2LECA 2M70A 2ADBA 5JVHQ 3MUMP 3P49B 2DHSA 5FJ4A 2DNNA 1OO0B 1M5VC 3V4MA 3BO3A 2KRBA 1JJ2R 3B4MA 1HL6A 1X4BA 2ZJQQ 4J5OA 1WELA 1VQ8S 2MZ1A 3CXCR 1VQOS 2DH9A 2MJNA 5DDRC 1FT8A 4QPTA 1VQNS 3L3CA 4YUDA 1Q82T 2CPIA 1WF0A 3CCQS 2HYIB 2CJKA 2MGZA 2DISA 1X5SA 3G96A 2XNRA 3CMAS 2MZTA 4FXWA 2X1GA 4W90B 2MKCA 1M90T 3VAMA 2AD9A 1YJ9S 2XS7A 2KVIA 2CQIA 2N3LA 2MKKA 2OIHA 2MSTA 3P3DA 2CQPA 4F25A 2FY1A 3J7ZT 1K9MT 3CMES 2FC9A 2CQHA 2RQ4A 1WEYA 4Y00A 1X4GA 5LSLA 3CC4S 5IM0B 1P27B 1WHWA 3IRWP 5ITHA 4EGLA 2MGZB 2F9JA 4OZ0A 2JVRA 1VQ9S 1CVJA 5GADU 2CPEA 3CULA 3S01A 2DIUA 3NNHA 1JJHA 5DDQC 1FJCA 3SDEA 2AYGA 2MQNA 5BJRA 4V19X 2MY7A 3ZZZA 2UP1A 4LIRA 2RRAA 2LYVA 2CQCA 2DK2A 3G8TA 1WG4A 1FJ7A 1H2UX 1M5OC 2XB2D 2KN4A 4PRFA 2DNRA 5IM0A 2MZJA 2PEHA 1UW4A 4Y0FA 2MMYA 1B7FA 3OW2R 1VQMS 5DDOC 3CUNA 2Q79A 1YTYA 2NLWA 3S8SA 2YTCA 1VQPS 3NNAA 1U1KA 3UD3P 2M8DB 1F9FA 1K8AT 2HGNA 1YI2S 4TU9A 5LSOA 3H2VE 3RW7A 2ZJPQ 2M8HA 2YH0A 3CCJS 1X4CA 4CIOA 4F02A 4BS2A 3H2UB 2DNGA 1A7GE 3VAJA 2G1DA 1OPIA 3MD1A 2ERRA 3UWTA 2DITA 4TLQA 3VF0B 1JJ4A 2DO0A 2VOPA 1P1TA 2CPZA 2PE8A 2OSQA 2RU3A 2BOPA 2J8AA 3N9UC 3G71S 2KI2A 1H2TZ 1WEXA 2YWKA 2MZSA 2D9OA 2LA4A 3R1HA 4ED5A 3MUTP 2K8GA 3CCES 1HA1A 2NZ4A 2CQGA 2DGTA 3MURP 1U1PA 4IOCQ 4WIIA 1QVFR 2GHPA 2OSRA 2KM8C 3Q2TC 2MB0B 2OTJS 2CQ0A 2MZQA 2KG0A 3CCRS 4IO9Q 3VAKA 2EK6A 1VQ5S 1N54B 3ULHA 3P5TL 2LEBA 5LJ3Y 2KXHA 3BS9A 2DNHA 1U1LA 1OIAA 1S79A 3U1LA 2XS2A 1WG1A 2KG1A 5GMKa 5MLCV 3VAFA 1SXLA 1FJEB 3BO2A 2M9KA 3CC7S 1SJRA 1UAWA 1WHYA 2GO9A 4TU7A 4TU8A 3VAIA 2DIVA 3IWNC 1X4AA 3UCUP 2OJ3A 1NU4A 2QFJA 4PR6A 4CH1A 3MUVP 1VC5A 1SJFA 5DETA 2DGXA 2M7SA 3UCGA 1N52B 4W92B 2KH9A 3J7YU 1VC6A 2KFYA 1U6BA 2O3DA 2LXUA 2B0GA 2X1AA 2DNKA 2CPYA 4Z2XA 3D2WA 2I38A 2DNMA 2DNQA 2MQOA 1RKJA 1YIJS 2MY8A 1U2FA 2N7CA 1H6KX 2MKIA 3HI9A 1DHMA 3CCVS 1ZZFA 2J76E 3VALA 2RNEA 4LMZA 1X4EA 1RK8A 2K3KA 3MOJB 1U1RA 3HHNB 1X4FA 1NJIT 4M5DB 5DM7Q 5JVGQ 1WEZA 4OZ1A 1VC0A 1R8HA 2FHOB
chains in the Genus database with same CATH superfamily
3KWMA 2FJXA 3A13A 2E29A 4JV1A 2YQ1A 1FJGF 4A8OA 1MLAA 4NASA 1U0HA 1S59A 3CC2S 3W3SA 3W9JA 1DQ8A 2M88A 3FEXB 2HHHF 3HK2A 4F0KA 1JNZB 1NDLA 3K89A 1B4SA 5AXNA 2J6UA 4M5NA 4K50A 4ZKAA 1T9WA 4CO5A 2AYBA 3I5AA 2ASYA 4Q7AA 1UFWA 4B17A 1KEKA 1QSLA 2OEKA 2P8IA 3BM7A 4RO0A 5KFEA 4OI1A 3D54A 2HNZB 5J2QB 4F0MA 4DZ6A 1CJVB 2HW3A 2AJQA 5HATA 5HL7Q 1S1TB 2NXCA 3HP6A 1KBRA 4HL9A 2WSFC 1TAQA 3ITHA 3IBWA 2XULA 3U1NA 1W2BR 2DXFA 1WHVA 3ET6A 2CQBA 2VICA 1Y11A 4WYLA 4ZCMA 1GEHA 1UWBA 2XSJA 2M2BA 2GIFA 1L5UA 4LJMA 4LFCJ 4LFBJ 4ELUA 2BJ3A 2OI2A 3G87A 4XTTA 1NJXA 2FYXA 4OX9J 3OL8A 3UE2A 3LGMA 2UV8G 2BDPA 3GU0A 2XS5A 2MKJA 4ZCLA 1GK8A 1UMJA 4YP3A 5DO2A 1RU2A 3CEDA 4H4MB 4NLSA 3M6XA 2YBVA 1IBLF 1P8GA 2OPRA 3J81j 3IM8A 3AT1B 1WTBA 2FPHX 4MKBA 5EN1A 2HVIA 4QU7A 2EG2A 3CCLS 4LBHA 1TUWA 3GFXA 3AXMA 3IMQJ 4DN0A 4K4UA 3MHYA 1WG5A 2BJ8A 2RILA 4K2JA 3I9V9 4DX6A 5CCMA 3E2EA 1G1XA 1FWPA 2VBYA 5DDPC 2W8LA 1ZAXA 4O4GA 3V6KA 5K14A 1T05B 4M5JA 3SQGB 4OYOA 4ETXA 2GIQA 5JMNA 4QW9A 3M30A 3KYLA 3PZPA 2KXNB 1YJWS 3NWRA 1SKRA 1LXNA 2B9EA 5FLXU 2VODA 5LXYA 4ECTA 4C8KA 3FBFA 4WFBQ 3OR2B 3UVJA 2UUAJ 1RAOA 1WC3A 8ATCB 2N7YA 5L8RC 2WB4A 1U2RA 3W5ZA 3OXLA 3PEJA 1NSPA 1BQMA 3E01B 2D9PA 3PHEA 4I7FB 2QMWA 2AJFE 2XBPA 3K0JA 2P6TA 1FRXA 1M5PC 2P5VA 2HVZA 2G2OA 3K7RA 2ZH2A 3RRGA 2M52A 5A0YB 1TL7A 3LQVA 2EFOA 4OI2A 2K1RB 3ETOA 1BQNA 1R0AB 1T7PA 1RBAA 1OS5A 2VPZB 2JLGA 1KOOA 5DZ7A 3H4DA 1IQTA 5CYMB 4CLZA 1SJQA 2UUAF 1IM6A 1NH8A 2R7TA 3CSKA 3OXGA 4F67A 1M0SA 4PXDA 4QOTA 1HD1A 1WI6A 1QD1A 1T94A 1Y9OA 2ADCA 1GH8A 4OZ3A 1N5VA 2L9NA 2MYFA 1B64A 1FNMA 3DOMB 3RAXA 3GZ7A 4OYZA 2UUWA 2DJWA 2C1EB 4OV1A 2LKZA 3BN4A 4P72A 1HHTP 2IMWP 4LVNP 2JEJA 4LF6J 3D3CJ 3EGZA 2N82B 1N88A 4NCGA 4NRUA 2J9DE 5LSRA 3MZIA 2G9OA 3ENVA 1NH7A 1LW2A 2VPYB 3NS6A 2F4FA 3AB4B 3D1OA 4YDXA 4DV6F 2I2YA 2IYGA 2HQFA 2C3PA 2YKQA 1RHMB 4URSA 4F36A 2KO1A 2ZDPA 3EICA 4NPOA 3C46A 2Q43A 4EWTA 3S1TA 2HLUA 1U0SA 3ISZA 3KLHA 4LQ3A 5B0FA 4U7UD 1VQ6S 1G7CB 5FDLA 1TK0A 4ILLA 1RJJA 2E1AA 3CCTA 3A3PB 2GVZB 1EZZB 1ZPWX 3GSDA 2JNJA 3F41A 1PKUA 2CKWA 2QX0A 4CQ1A 3OVBA 3OR1A 1XMQJ 5I3UB 2AYMA 3LH2S 2R7SA 1WC0A 4FXDA 5EHHA 3ZTRA 2VU5A 3NCRA 3WX4A 5D8HB 1BQMB 4GC7A 2AIRB 2HMIA 4CLLA 2IC3B 5I4MA 2BANA 2V67A 3Q8RB 2CZVC 2ZM6F 3UD4P 1HYSA 2BZ2A 4PWWA 1JLAB 2VFSA 3PRDA 3L9ZA 3E8OA 3CJ2A 3QLHA 4DS4A 1NO8A 4OYPA 3BGRB 1PYSB 1GXTA 3R7BB 3GR0A 1WC4A 5D3GA 4RW8A 3W2VB 3MD3A 1NSAA 5GMEA 2XO6A 2U1AA 1Y00A 3IBFB 1LWFA 3ZZYA 3HVAA 3KHLA 1SJ3P 2XYGB 3KK1A 5HBMA 2VKZG 4C8NA 2V4JB 1JXLA 1OQ6A 1Q4RA 2CVEA 4FBTA 4PWDA 2HFSA 4DL6A 5BXIA 4ER8A 1IR2A 3MM9B 3BGOP 4IG0B 4U96A 4F7VA 2V9WA 1MWQA 4MFBA 3C15B 3PHTA 4CLFA 2A18A 1VYAA 4LSLB 3PCOB 2EFVA 3WIVA 1Y4ZB 2DY9A 3FBEA 4ILRA 1HHQA 5KT4A 2A6OA 3KG1A 2C42A 2AKWB 3HVTA 3T1HF 3KMQA 5E3PA 1FX4A 3SYZA 4G1PA 4YS2A 2OHDA 3IR6B 2I5JB 4M5GA 2PEBA 4F0HA 2ZBPA 1QAJA 1TFYA 4JV0A 5K8MA 2NYIA 4JP8A 2YXLA 3ZNUA 3PIPQ 1QSSA 2G0CA 2HRTA 4ZVOB 4F4YA 5CH7B 3ZZ0A 1DJ0A 2X1BA 4F50A 4ZPVR 5U47A 4E0DA 3M2UA 3EVMA 1SKSA 2DHGA 2L48A 3NCPA 5C42A 2C28A 4C8OA 3TP2A 1DZ5A 5EWGA 1IBMJ 3JTPA 1NK0A 2J0QD 2IA6A 4XDDA 1RT3A 4NLVA 1L3UA 5KFXA 3BH6B 4NEZA 1S6QB 1ICEB 3A12A 4LUBA 4DL5A 3GILA 3SZ2A 2R8GA 4RW9A 1GMVA 2MSSA 2H4YB 4LFCF 3V4IA 4C7QA 1IJFB 3PM9A 1HQEA 4OQJA 4KHRA 2ZC3A 3QIDA 2MEWA 2DRAA 3QRPA 3ENQA 4N77A 4NLTA 2MXYA 3PJ9A 4JYAF 2FD2A 2OPRB 4KBIA 4BHQA 3MI7X 3QBCA 5HMYA 3DU6A 3FUYA 3UDVA 3P8BB 5DM6Q 3RR7A 3J7Z5 2AEFA 3DC2A 3EGWB 4AD6A 2E9ZA 3R7SB 5A8KA 1H2VZ 4CCHA 2FGOA 2MPUA 4DOZA 1DTQB 4EBDA 2UVVA 5I42A 4F3OA 1AUDA 1CSJA 1VLOA 4WP9A 4NLPA 4CLTA 2RDJA 1NMEB 1PJ7A 5KFUA 3FEYB 2CWKA 3KLIA 1CC8A 1S1XA 4ZLJA 5F9LA 3IA0A 1URNA 3RUBL 4IFYB 1O8BA 4E2FB 4DQRA 2OTLS 4U67Q 3I0RA 3DDNA 1YRXA 4CNZA 1N6QA 4YB6A 2F3JA 3FKBA 2BKOA 3LP0B 1WI8A 3NOGA 4M5KA 3VAGA 4ICLA 5B09A 3OTBA 2CPXA 5D4OA 2HNYA 3MPUB 3QQCD 5AJ3F 4OX9F 3R8YA 2QZ8A 4PEOA 1T3NA 1SL0A 1WWHA 1KP6A 4ZPAA 1U24A 3D5MA 3TYTA 1GTHA 1RYRA 2B9XA 1SQFA 3HHLA 5IZHA 5MAOA 2A1BA 4YR2A 4YY3F 5JVHQ 4OI3A 3T5KA 4X66J 4ZCKA 1S1VA 1IBLJ 3P49B 3QT7A 1KVKA 1VS3A 4NMLA 4HDHA 3T6JA 4KKOA 5FJ4A 3MAHA 1OO0B 3LGHA 4DX7A 4DV2J 4ANCA 3OTOJ 4IQXA 3ENAA 1CC7A 1HL6A 1RHRB 3JQJA 4YR0A 3HVRA 5THWA 1H38A 3NP5A 5KFJA 4NYPA 4CH7A 3OUYA 4ED8A 3FQLA 5KTQA 2BBEA 1IKVA 3L09A 1VQ8S 4B3OB 2MJNA 1LWXA 1AUSL 1RT4B 4QPTA 1TL5A 4YY3J 5DRKA 1VQNS 3L3CA 3PX4A 3QGHA 4JB8B 2ATLA 2IBKA 4LF5F 3PG9A 2CPIA 3HFZB 3PFOA 4DV2F 6AT1B 4I2QB 3OTOF 3PW7A 5LMNF 3IS9A 3T5JA 1RTJB 2CJKA 4LF7J 3RAQA 3QFWA 2ABYA 3KJFB 2CJAA 4O4RA 2XM3A 1S97A 3AOCA 2DYAA 2XNRA 3MFHA 3EPIA 5B0AA 4F4ZA 3VCDA 2V34A 3GWCA 3PX0A 1IBCB 3KOAA 3ILJA 2HFVA 2O66A 3NAIA 4KY3A 2JFDA 3NRBA 3TVYA 1YJ9S 2N3LA 3DN9A 2ZUGA 1ZM4A 2MSTA 5F8IA 4B9LA 5E41A 2I1RA 3K5OA 1B0PA 4UW2A 2I8EA 2R8IA 5LMNJ 1K9MT 2FVPA 2VPWB 2OEMA 1VBKA 2CAJA 2WW4A 3LW5C 1NNDA 3E51A 5LSLA 1MSWD 3UPFA 4K4WA 3HO1A 1Q7LB 5ITHA 4K4ZA 4EGLA 3AXKA 1TK5A 4RR5A 1HBOA 4C8LA 2LU2A 1S76D 2F9JA 2HAIA 2JVRA 1FRIA 1HFEL 5C7PA 4N76A 3CWJA 4DL4A 1IWAA 3BGUA 2AZ3A 5F9NA 4ECWA 3CJRA 2BOAA 2HBRB 4MJKA 4KHPF 2H9ZA 4RKUC 5DDQC 4H4OB 3SDEA 4DV6J 3NG8A 4HHJA 3AB2B 2UP1A 4K5RA 1AA1B 1Q79A 3DGPA 4XK8C 1HBOB 3ENWA 4NEYA 4E8UA 3KLVA 3FVYA 1WG4A 4J9QA 4PRFA 1VI7A 4DF8A 3C8YA 1F1BB 2XCPA 1T3OA 2MZJA 4WJBA 5F3TA 3SCLE 4KC5A 2HHUA 3LPEA 1I3OB 3JSYA 2CG4A 4FVCA 3CJKA 5D4NA 1AZSA 1VQMS 1KSPA 3C2PA 1UCNA 1TKZA 3EWGA 2Q79A 1S10A 5KG1A 2NLWA 4PXBA 1FKAF 4ED6A 1NB2A 1U1KA 2WSCC 3JTNA 4JI3J 1RWMB 2GV1A 2O1PA 5DJBA 1BMQB 2YX4A 4FKXA 5A8WA 1HBUA 2M8DB 2HHQA 1KVJA 2YKNB 2DR9A 2XHCA 2DTJA 2DPJA 2VL1A 4GO7X 4FF4A 1P9YA 3TUZC 4O0NA 5LSOA 4OX8A 1S1UB 2OPQB 1MWZA 3M05A 3RW7A 1M90T 2YH0A 6FDRA 2ZH5A 4CIOA 3QRQA 5F8JA 2EC0A 2V2ZA 3LGNA 5IC6B 4DR5J 1YZ7A 1EETB 2BE7D 4ICLB 1N5SA 3UN5A 3EVWA 3HD1A 3M8ZA 4LRCA 2DITA 4TLQA 4WK3A 4RLEA 3VF0B 4DF4A 4G1QB 2DO0A 1P1TA 1C0UB 3U02A 2JFKA 4J9LA 3DOLB 1N5YB 2BOPA 1OJ4A 2FHKA 4S0MA 2XMAA 1KHVA 3G71S 3DMJA 5J1PA 2CA9A 3ILLA 4WYWA 4C3MA 1KFSA 4X62F 3CO0P 4ZVQB 2RSQA 2YWKA 3W62A 1RTDA 4GVBA 2LA4A 4J9SA 4ANDA 3G86A 5EWFA 2LQ8A 3R1HA 5HLFA 4HKQA 3KTQA 1U25A 3ZTSA 1GX6A 3BV8A 4X4TA 3D4JA 3ET6B 3TAPA 2GX8A 1S0OA 1RI7A 4DUZF 4DR1J 3ITHB 4X64J 2VG7A 2XLIA 1SV5B 3W1YC 4J9VA 1LV5A 4I67A 2DR5A 2FJDB 4FN5A 4IO1A 4P74A 3DLKA 5GMDA 4C11B 4X65F 1QVFR 2KL8A 2HNZA 3ZZUA 2EFPA 2MZQA 4X62J 3W61A 1HQ2A 2CNLB 2DRDA 2VH7A 2B7CB 1TU0B 1F0XA 3PRBA 1G6BA 1VQ5S 2VC0A 3I0RB 3ULHA 3M2UB 2EFQA 5KFAA 2LEBA 5LJ3Y 2QMXA 2FUG9 2DNHA 3BS9A 2IM2A 3DI6B 4V1Ak 2ASDA 4Y65A 5KFGA 2MKYA 1OIAA 4C9DA 4ZP6A 5CQGA 3MEEA 3LUYA 4DI6A 1N34J 2KG1A 4LVOP 1WC5A 1S9EA 1SXLA 3VAFA 3BO2A 4RBVA 5SZTA 2OEJA 2Y1LB 4ED1A 4LFBF 3QZ7A 2VJUA 3SSQA 2OD6A 3W5XA 2EWHA 2WK4A 4ZPCA 4F04B 3OSPA 4TU7A 2Z2YB 1PAEX 1C1CA 4DXLA 4RNMA 4TU8A 4HTIA 3VAIA 4NXNF 3JSRA 4A48A 4Z7YA 3UCUP 2Z58B 2GNKA 3KUEA 2GJFA 2KKHA 4RNFA 3F73A 4NLOA 4PR6A 1S6OA 4CH1A 2QE5A 1HQEB 1NHKL 1RCOB 1RT3B 2Z4PA 3HHLC 1N34F 4IRDA 3KDOA 1S1UA 5HAOA 5KFHA 2DGXA 5HP1A 4JI5F 2BVZA 1N52B 2M7SA 3DYAA 4W98A 3JS9A 3UCGA 2KH9A 3H98A 4Q2LA 3R5JB 3C15A 4BWMA 4RW8B 5LMUJ 1FXRA 4ED2A 2FLNA 4USIA 4ZJOA 2V8DA 2OMLA 3N6NA 4R5PA 4UOFA 4ZVRB 4X4NA 2UUCJ 4QR0A 3JAMY 3T1AA 2B0GA 3EM1A 4HHUA 4JI6F 3NGDA 2I38A 4ECUA 4AQYF 4USMA 3IXQA 4ZP7A 1YIJS 3RR8A 1UPPA 1H6KX 3HVTB 4DG1B 1GAOA 2QL5B 2HNDB 3LP2A 3HI9A 1S1WB 2VQFF 3RRHA 3CJ3A 4WFZA 1XMBA 2HQ3A 3K8WA 3MPWA 2ASLA 1Y5IB 1CG2A 1BLUA 1CJUA 3UN3A 2W1BA 3O3LA 3PW5A 3OFEA 3FMBA 4ZVEA 2VFVA 1KDNA 2EFNA 2Y0SD 5F0UA 2AQ4A 2BR0A 5HROA 3J81U 2J76E 3AD7C 2RNEA 1F3VA 4PAAA 3HXMA 3QJJA 1R3NA 3CDBA 2A10A 4LMZA 4PG6A 2BQRA 5E7OB 1IM4A 1JJCB 3DRXA 4OV6A 3PRVA 3HHNB 2ZBCA 1RT5A 2H4WB 4K4VA 4Y2MA 4AYBD 5T41A 4OZ1A 3MCNA 3QATA 3BB5A 1OY8A 3DRRB 4EU0A 4X4OA 3H25A 1R8HA 5L38A 3W8GA 2CQ3A 2FHOB 3G82B 3O6QA 1K1QA 2OGUA 4CLUA 2KVQE 3M8SA 1T11A 2LEPA 1BHNA 2MQMA 2IM1A 5JJBA 1N0UA 4KQZA 2XO7A 1FDAA 3CW2C 2GHVC 4DLEA 1FDNA 4J37A 4ECYA 3PKMA 1EARA 1RZMA 3TEGA 1VRTA 4QWDA 4J9KA 3N6LA 3RU0A 4CT8A 2R7UA 3O2IA 3GPAA 2DXEA 5DQIA 5IWAJ 1PO6A 2BE2B 4L72B 2E5LF 2W2OP 2LFVA 3HFKA 3HKZD 1NCLA 2AV5A 1XBWA 1JMTA 2HHPA 1HBNA 3I5CA 5J1NA 3G4SS 1QLNA 4P2FA 2CVIA 4DPOA 3DRSB 1HWLA 2F1FA 1HI0P 1QE1A 1H72C 3QT8A 3PW4A 3FBBA 2QN6B 1TP7A 3SSSA 2E44A 1LFWA 5J2NB 1GMWA 4U7CA 3CCMS 5DG7A 3GV5B 4QIWD 3IRXA 1J5OA 1OSDA 1XTZA 2EK1A 4HLBA 1BUXA 3L7OA 2N3OA 4CTAB 1RT1B 3T1YF 4ZPBA 1XNQJ 4PWDB 1S6UA 1X5TA 2ILZA 2C2MB 3QSIA 4XIUA 3OL7A 4WXWA 4RBTA 5IOLA 3Q8VA 2JJ4D 2ZNYA 3M2VA 4WFAQ 1J5EJ 4P52A 1VQSA 5IFMA 1HNZJ 2WVEA 4LRFA 4OYWA 5GAHU 4YOEA 2ZM6J 2F63A 4Y28C 1IXKA 4RNHA 2XMKA 1SC6A 5BYSA 1AYEA 2DEIA 2FY8A 2J0WA 2EG1A 2M5YA 2W9CA 2W7OA 2WCXA 1LOUA 4Q44A 2ZHBA 2A6MA 2D41A 3OFHA 4O3OA 4WKYA 1C4CA 2QTWA 1O5JA 2WVBA 1KQGB 3PEHA 2DR6A 1FI4A 4QYRA 3DLGA 2OKQA 3BBCA 3IS9B 1BWVA 3D6FB 2H65B 4M1KA 5HMZA 4RNOA 1R0AA 1RT7B 5E2QA 1P6TA 1SC1B 2FZGB 3QIPB 4ZHRA 5HP1B 2GFFA 2ZOGA 3VZHA 1XR7A 4GKKJ 4LT6A 2PD1A 2VZ9A 3V81A 2Y1JA 3Q24A 1REVB 5IV4A 3PX6A 2K2PA 4PWUA 5C2GA 4JI7J 2LMIA 4A8FA 1RBOB 2DNOA 1QAIA 1JB0C 3PR5B 1RWOB 2RQCA 4I0WA 4IH5A 2D7SA 4KH0B 9RUBA 2J7KA 5CD4H 5ETOA 4ZVFA 3MAAB 5HMWA 3KNGA 1ZA2B 2HHVA 1X8DA 2B3TB 1Q8LA 4J7CA 4HDGA 5D4LA 3MEEB 1HBMB 4KO0A 4FYYB 4C3LA 4DUTA 5D0GA 2W9BB 2GMJA 3QMQA 2ZNZA 1FJGJ 3RBZA 3NCQA 4ZVHA 2BXJA 2ZUAA 3W64A 3OTDA 5HN0A 4O3NA 3N6MA 3M30B 1AB8A 1SCJB 4KGMA 4ZN1A 3KK3B 3UDLA 4C8MA 1RUSA 2UXBF 4LIWA 1MMLA 1RWXB 1M1KT 4ZITA 1DBDA 2CNKB 1KRPA 3PXGa 4A4JA 3HHKA 3J80Y 4Y2AA 1HARA 2E1MC 3SEOA 3M8WA 4ECXA 3M6WA 1WKKA 3BQ1A 4ZDNA 2HQIA 1K44A 2HPUA 3IAS9 4DEZA 2YPYA 3BSCA 2MQQA 2F8EX 1I51B 5DLGA 3K5LA 4DR1F 4EEYA 3MOZA 4TY8B 3FK4A 3DLLQ 1NJWA 1VMBA 5A8KB 1IJEB 3OL9A 2OUGA 1S4EA 3DMJB 4WFYA 1ZZNA 4JI4F 4K8RA 1LK7A 1U0HB 2CWXA 2IJRA 2KU7A 1Q81T 1ZM3A 3V6DA 1RTDB 1VRQC 1KVIA 3FCWA 2CQ2A 1UVLA 1JLCB 3NLCA 3S7RA 3FSIA 4P71A 3DGVA 3QO9A 4ELTA 3UCZP 3W9HA 2RVJA 1B0TA 1RADB 2QLJB 3CJ8A 4M5HA 1U1QA 1S0MA 4P2XA 1TAUA 1JQGA 2RH3A 4A8KA 3AOBA 1T8EA 2B56A 3IFEA 1KN6A 2IFXA 2COLA 1SV5A 3V6JA 2LXFA 1HW8A 2DGOA 3UO0A 4LRBA 4P10A 3DXSX 4RW4A 4UOGA 4N8OA 1RHUB 1VJQA 2KYZA 2V2QA 5A8WB 4WBFA 2LEAA 4DQIA 1RWNB 3D68A 3ILIA 2JH3A 5BR8J 1JLQA 1RWKB 5KFMA 2RUSA 1KR4A 2J6TA 4AL6A 2RDIA 1N4LA 4JV5J 5LJ5Y 4MTPA 3HZEA 3LAKA 2HVEA 5C24B 2HGMA 4R25A 5C25A 3RAMA 1KLNA 5G0RB 1XIQA 4USJC 1X0PA 4I69A 4RUHA 5E33A 1V9OA 7AT1B 2NXJA 4NI2B 3P6YC 3TEHB 2LQJA 1C0UA 8AT1B 2D3OR 1JKHA 1B99A 4MIWA 2RRBA 1FKPA 2RUGA 2Q6BA 3ZTQA 4B3TF 5EUHA 1YBUA 4DV1J 2AGQA 2OMOA 5KT6A 1QTNB 1FTRA 2FHJD 3C16B 2UU9F 4UY8T 4WKRA 4USHA 3GG0A 3QGGA 1ZTWA 5HQLA 2UVWA 3MCSA 2HG4A 2D3O1 3GMGA 1YITS 3GLJA 4AQYJ 1I94J 4DL2A 3VV2B 2DNYA 2HK2A 4AUKA 2JOQA 1U1MA 5KFCA 3MCOA 3LANA 1URRA 4OLPA 3BQ0A 4PKDB 3M8RA 2F40A 4C98A 4FBUA 4DV1F 1M5SA 3KXDA 4ZPWR 1YJNS 2F7VA 4C97A 4ZLNA 3PIOQ 2ZH9A 3BBFA 3QLHB 4CLWA 4B3RF 1E6YB 2DGWA 2GQCA 3Q8SB 3RRKA 3NNCA 4QWCA 3F44A 3KKFA 4LF6F 3NS5A 1CJTB 2JVOA 2QLFB 1LNQA 3L7UA 5ETVA 5KFVA 3Q23A 2KHCA 1CPZA 4UZBA 1YBTA 2WONB 4CLPA 3QRRA 1UFLA 1SH0A 1WHXA 2MHEA 2YKAA 4U6PA 2C3UA 5KG4A 4ANEA 3LAMA 5A6PA 5E3RA 2HSEB 2YPZA 1JLBA 3G6XA 4MYTA 2YNIA 1U1NA 3M8QA 2RHQB 1D9AA 3SCKE 3T1YJ 2W4DA 1WACA 3MTJA 4PABA 3MF5A 3OR1B 1SKUB 4ZA1A 5B0CA 2CDQA 2DHAA 1EB0A 3A3OB 2JWNA 3KDNA 3MPVA 1NLKL 3C66A 5DGBA 1KQKA 1WSVA 3GB0A 3DRYA 2BEFA 2XQCA 3TANA 2AJ0A 1R43A 4KRWA 1HR0J 4F4XA 5K8NA 2FZKB 1YKWA 3BSNA 1MROB 1QAYA 1VIOA 4ZVUB 3H8YA 3MWBA 3QT5A 3WDOA 1VQLS 4KHPJ 2EEYA 2GGPB 2IPOB 3H0PA 3R27A 3TA1A 4B9SA 3AQPA 1T9UA 3DRRA 1YJVA 1SB6A 5F8LA 3VQSA 5G4DA 2RQMA 3HT0A 2HZCA 1Y5NB 3UNGC 4MYUA 1FRKA 2MKSA 5D4PA 2DGSA 3SCIE 3VR1A 4JYAJ 5CYJA 4Y34A 4ES1A 4DQSA 1HR0F 3B8HA 4F4KA 2L41A 1YDLA 1M5KC 1XEZA 1DTTB 1WC6A 1GTEA 1Y3JA 4K59A 3SMZA 1LW0A 3THTA 3JB9k 2JEGA 3TX8A 2CUYA 3MMCA 4JV5F 3BQ2A 4OYXA 4DPXA 3OL6A 2AYEA 2A3JA 3H59A 3JQMA 1FNXH 1TKXA 2VONA 4QU6A 2Y0BB 4WE1A 3P4UB 3LPYA 2P9GA 3HDSA 4I1TA 2HNDA 3AJ2A 3LP2B 2KZMA 2HS3A 3RYLA 1NHUA 2H48B 5KFYA 2NPIA 3FMWA 2ZWOA 1SIWB 2D1CA 5FD1A 3IAM9 1RT4A 3HKWA 1S99A 4DMZA 2FVSA 3UDCA 1CEZA 2L9DA 3GIRA 3HVWA 2QA1A 3D0IE 4DSJA 2Q66A 3FZ2A 1IKXB 3B4MA 4UUWA 5KFDA 2UXDF 2QV6A 2E1RA 2A2CA 4Z37A 3EYZA 1RT2B 2AJ2A 3CCZA 1JLEB 3D66A 2ILYA 5HJYA 4NLGA 1JLQB 4J5OA 4JI2F 3NGRA 5CHCB 3ZC4A 4J9NA 1EAYC 3GFZA 4ED7A 2MZ1A 3PJXA 2IRUA 4LFAJ 3VTIA 5K8OA 5DDRC 3P96A 4PYDA 4RW7B 1EP4B 4O3SA 5T7LB 3DLBA 3CNQP 2FVCA 1Q8IA 4GMKA 2FVRA 3GR1A 3NKYA 3GYGA 2XC9A 5J2MA 1RWVB 2HYIB 3I5BA 3TAQA 4DUYJ 2CJBA 4JI7F 3BR9A 1WORA 1WD6A 2UXDJ 2DISA 3G96A 5IC4B 4CO4A 2C2KB 1GMWD 3BH7B 4E98A 4ED0A 2J7UA 1HI8A 3CMAS 2MZTA 4N41A 2HHSA 1V5VA 1CJKA 4WWSA 1N36J 4C48A 3QGIA 2IJNA 4RBUA 4C0BA 1S1WA 4RUAA 1U45A 2CQIA 1F3FA 3BPSP 3QO9B 4I6WA 1HNVA 1KQFB 4RWXA 2MKKA 2RDDA 2ZHOA 3O44A 2CQPA 1WDTA 3CJ5A 9ATCB 2RIJA 3W65A 1S9EB 1T03B 3CMES 4ZJQA 4ZP9A 1NSQA 1BGXT 4DWIA 1WEYA 3I6PA 4LF1A 3PKYA 4OX7A 2OPSB 2UXBJ 5F41A 1VHFA 1WHWA 2VC1A 3M8PA 1VDHA 2ROPA 3LALA 1F9HA 4ITSA 4M5DA 4OZ0A 1HHSA 4J9RA 2VV5A 3ZTPA 3BKTA 3ILOA 5J2MB 4Y2KA 1FERA 2F4VJ 1U6ZA 2J8SA 3DLEA 2R42A 3CVKA 1MU2A 2DIUA 3N5BA 3W60A 3NNHA 2XI2A 5AT1B 1AW0A 1JLFA 2FJBB 2MQNA 4NXNJ 3MAQA 5CZXA 1J2VA 1Y10A 3CIMA 1F5AA 5E3CA 4XPCA 3KK3A 1OSCA 3TQ1A 1QTMA 2HHHJ 2RRAA 4JI4J 4V19X 1KWMA 2CQCA 2DK2A 5KFSA 1H73A 2VUGA 1M5OC 3TZXA 2KN4A 1D9DA 1HWIA 1W2IA 1IVZA 3KK1B 2ZH8A 2OFGX 4LF9F 4M8LA 1LWFB 2MMYA 4Y0FA 5IT9Y 4LF7F 5DDOC 2H54B 3CUNA 2XY6A 5GADI 3VGUA 1N5YA 3C6TB 2LDIA 3BGRA 1NPKA 2IDLA 3R7NB 1MMDA 2YNHA 4NWBA 4ZIWA 3S8SA 5KFQA 1VQPS 3NNAA 1OYDA 1AFIA 4QYZJ 2Y1IA 2HGNA 1YI2S 1VK8A 1Q95G 1C0TA 2BJ7A 3ZTOA 3H5YA 5J2NA 1RISA 2LQ9A 3HHDA 4MK9A 2BABA 3CD7A 3EZUA 2AU0A 1LW0B 1PBAA 1X4CA 1BQXA 4G6VB 2GZOA 1P9QC 2B5JA 2BYCA 5F0WA 1HBUB 2QG9B 7FD1A 2NR0A 2AW0A 4K4TA 3DLHA 3N79A 3JSMA 1OPIA 4OI0A 4YB7A 4YN3B 4EMDA 2ZH4A 2VDHA 3TI0A 2VOPA 2AJ1A 4DCJB 2F65A 2B4VA 1DQAA 4CDIA 2YKNA 2J8AA 2OELA 2OPPA 1H3DA 4USKA 2IDEA 2LVWA 2F5GA 2R7QA 1NK6A 5HVFA 3LF0A 2DD8S 4HT7A 5ADZA 4B3TJ 1IR0A 1CS4A 3DLJA 1CQMA 3BBBA 1NUEA 4OJ3A 2Y8YA 1VFJA 4ED5A 2CYYA 2MLZA 2PDAA 2K8GA 2IVYA 4DPYA 4NZ0A 3IRXB 4TN2A 4PQAA 2GGPA 3D67A 1OY9A 2CQGA 4UQGA 2AMCB 3LWLA 3DGPB 4O3RA 2Z2MA 4WIIA 1SIZA 5AE1A 1AROP 2W2QP 2D3UA 2GHPA 3Q8YA 5B0BA 2B8QA 4DU7A 3DRSA 2CQ0A 2MB0B 5HQ8A 4UY85 3POTB 4RL1A 4NA2A 1NJYA 3FCVA 5D0HA 3QJLA 4IO9Q 4WK1A 3KHRA 3EPGA 3VAKA 1GXUA 1KLMA 2O5DA 1N54B 2RJZA 3NY0A 1CJTA 3J7A1 1H0HB 2C22A 3GQCA 4AL7A 2NPFA 2Y9HA 3HHEA 2V63A 3BGLA 3BSAA 3I9ZA 4FYVB 2NUHA 4YHHJ 3T41A 4EBEA 4ZLLA 1U1LA 2XS2A 5HMXA 2XMVA 2DKOB 5GMKa 1SJ1A 1VRTB 4GC6A 4GKJF 4DR5F 4OHYA 3BYRA 1FJEB 3AD9C 2X51A 4NCGB 3U27A 2BJDA 2RKIA 3M7VA 3ICLA 4L76A 1EX8A 4PG5A 1FKOA 2WB1D 4OYMA 1WHYA 4RUCA 2KTQA 3PYEA 4BBYA 4OIXA 2YNIB 2B6AB 3AH6A 1Z2ZA 2R8KA 1T05A 4OJGA 1NU4A 2NUUG 2QSFA 3MEDB 2NYHA 1S57A 4CRJA 3MUVP 3CDUA 4NL5A 5DETA 1SJFA 4X4UA 4IFVB 4DSEA 3C3LA 1NXIA 3V2UC 3C19A 3UDEA 3J7YU 3OHAA 1K47A 5D0EA 4JI8J 3A8EA 3FSYA 3MMBA 2KFYA 3H4BA 1FK9A 2HWIA 2FB0A 5IT9U 1PCAA 1IN0A 1SC4B 1M5HA 2Z56B 3HSDA 2IVMA 1TL3B 5CD4A 4DUZJ 1U4BA 2IY5B 4OZLA 2AX0A 2DPIA 3E01A 4A8WA 2DCLA 3D2WA 4Z2XA 4B3OA 1R0BG 2KHDA 3MM5B 1SQGA 2DNQA 2MQOA 4K4YA 2JC1A 2QA4G 2MY8A 4IG3B 4ECQA 1S0VA 2PFFB 1U2FA 4DX8H 2N7CA 4DCPB 4PQUA 1EJ7L 4DHVA 1JLGA 5AE3A 3MMAA 4ZVSB 4QBUA 1XMQF 2ROEA 4NLQA 3JYTA 1ZAVA 1FD8A 1YRUA 4ZIVA 1FEHA 2VBZA 4RU9A 5L1JA 3LTOA 4IR1A 1XK8A 1D3WA 1YQHA 2V8VA 4O4GB 1ZZFA 2IJFA 1Q53A 2QL7B 2AJ4A 3VALA 3NL0A 3C14B 2HHWA 4CO1A 5FLXY 1RK8A 3RJMB 1Y3KA 3DNCA 3DOKB 4K7QA 1N33F 3D6MB 3IWLA 1X4FA 1Y5LB 3EXYA 3VZIA 3H2LA 4M5DB 2JZ5A 3CD0A 1Q5VA 3ETMA 4X4SA 3SI8A 3PO4A 1T02A 4ZVTB 1S7IA 1FXDA 4QPXA 5JVGQ 1XR6A 1WEZA 3L95X 4AFFA 2QLWA 2KT2A 4K0KJ 1NZAA 4MT1A 1NDKA 2AEJA 1R6YA 4BCAA 1IBMF 2CQDA 3OUYB 1WSRA 1N8RT 2DH7A 5F8GA 4CH0S 3PYFA 4JI5J 2C2RA 1Q16B 3J80U 5ETRA 5IV3A 1DRZA 1X7VA 4PCQA 3WHIA 3GE9A 1IBKJ 1AXQA 4AL5A 5GAEU 1ZS6A 3FFIB 2B9YA 4KB7A 2DNPA 2KM8B 4DR7J 4M63A 1S1TA 1B7YB 2E5JA 4CLYA 1UKUA 4KYZA 1PGZA 2PO4A 2G0JA 4KTQA 2A0FB 2LXIA 5D78A 1Q78A 3O8WA 4C0HA 2V9KA 2ROGA 2YKPA 4NZ7A 2YWWA 2R8HA 4USTA 1RU1A 2OFHX 3DLKB 3MM7B 3EMTA 3MECA 3QFHA 2W9BA 1S77D 3NBPB 4CWBA 5DG9A 2R3VA 4MAKA 5DZ6A 5C42B 2VQFJ 3R2CJ 5I3PA 2GHWA 2V6AA 2JSXA 2HBQB 4K4XA 4XDCA 2BJ1A 3M8PB 1UFKA 2ZE2B 2XTJP 1TVRA 4MIAA 3D6TB 1NKCA 1I6JA 2XGPA 3FFIA 3V6DB 1GMUA 1IKXA 2RMLA 3BR8A 1UP1A 2QRRA 3ZFVA 2NSBA 4LRDA 4ECVA 2FJWA 2QLXA 4J9OA 1FA0A 1DLOA 3DOLA 2Z0GA 2C2OB 3DXBA 3Q8UA 1JK9B 1SI9A 1R7IA 2G13A 2O01C 3M6UA 4OZ2A 4CYUA 1JIHA 1UJ5A 5AJ3J 4KPCA 1OYEA 1QVGR 1X60A 3K5PA 2CRLA 4QQBA 3TOQA 1EETA 1X4DA 1XQIA 2F8HA 2R7RA 1ZTTA 2QGFB 4Y2CA 5HO4A 2VFRA 3CTRA 2V0NA 3KLGA 1U48A 4PUOB 3MXHP 5K9FA 4UQTA 4IOAQ 3D7SB 2QSWA 2GAHC 2HIYA 3NAHA 2QC3A 1U6BA 1HBMA 1WTFA 4KO0B 4LSLA 5KG5A 2KZZA 5AE2A 3HJFA 4IFVA 3MAAA 2D69A 2IYIA 5KFRA 4ATNA 1N56A 4DV0J 4Q45A 3TZZA 2WRMA 5ETLA 4KAIA 2JLFA 3BEGB 4B9MA 1ITPA 1VBXA 1SVDA 2HZAA 1R27B 2MKHA 2ZKUA 2YWEA 3MEKA 4KV8A 2V69A 2DH8A 5D77A 5L39A 1C4AA 1UTAA 3WZ0A 3TUJC 3FSXA 2E66A 3TO8A 4H4KA 5BYRA 2XLKA 4LF5J 4B3MF 1JLAA 4PQUB 1H7XA 3DFEA 2ZD1A 2WOMA 2OD4A 3R5BA 4GO5X 4OI6A 3AQOA 1YVFA 1KLMB 1CULA 2QA4S 1UEUA 3KLFB 5D3GB 2HGLA 2LQBA 5B0EA 3V81B 3BDEA 1Z4UA 4I68A 3UFCX 4C4WA 1H74A 2G0IA 1FRJA 2GVZA 3MM6A 3M9OB 2PT0A 4BWJA 4RPFA 3GV8B 4MFBB 3G6ES 2C2DA 3J7AN 2PI5A 2AWZA 1DAXA 2WVCA 4H4OA 3SDEB 5KFPA 4DFJA 2CPFA 5IWAF 5L1KA 2DB1A 3D3BJ 3S6EA 3FDSA 4DV5F 2RKIB 2UVUA 2BE9B 1FDBA 1NDPA 1O0PA 2VG6B 2YQ0A 3DRPA 3WQPA 2RT3A 4JI1F 1C2PA 1TUGB 2CPHA 4ZCIA 1X4HA 2ZOFA 4FNHA 1CS4B 2RS2A 1L3VA 3U1MA 3BSOA 1RT1A 2ZVIA 3OVAA 2CNOB 1PYOB 1YZ6A 2MHNA 2EW9A 3GIJA 4ZPDA 2FDNA 1E6VA 1K73T 4Q43A 2EPIA 1U6FA 3MR2A 1D1UA 4X4VA 4TYAA 4ID5A 2BM0A 4MKAA 3BO4A 4DFKA 2M3DA 3M1VA 4M95A 4WF9Q 3I87A 1XNQF 1FWLA 2Y3YA 1GQEA 4FPRA 1F9EB 2IAJB 3SBMA 2XY7A 1Q8BA 3LO3A 4FF3A 4DR2F 3US5A 3EDRB 3MM8A 3TVZA 1I5OB 5L1IA 2LCWA 4ZVGA 2WBMA 4ZOSA 3RBXA 3LP0A 3MGJA 2V4RA 2X1FA 2FHMA 2XWYA 3BPDA 4YHHF 3M8QB 4NLXA 3CF5Q 3OHBA 2ZFHA 1ROFA 1QDUB 3IBCB 2XNQA 3FJ2A 3POTA 5L9NA 3HSJA 1IKVB 3F56A 1TL4A 1KFDA 1SQEA 5KG7A 2MQLA 3G9CA 4XO0A 4IRKA 4WPAA 2C3MA 1ULRA 3BYPA 3ZZTA 2PIIA 2DGVA 2NSCA 1KHWA 2EI5A 4WP8A 3SXLA 1BWEA 1RAHB 2R4FA 1F60B 1Q86T 1UVNA 5F8NA 2OPPB 2RAQA 3JAMU 1RP5A 5KFFA 3Q22A 4NXMF 4WCEQ 1X0FA 4RUBA 4F26A 3OSNA 2R7XA 3ZZPA 3TWZA 4N5SA 1S9GA 2CQ4A 2POKA 4FPIA 4PXEA 3IC1A 2PA3A 4QJVA 2I6WA 2GMLA 5GVQA 3THPA 2CZ4A 4Q0BB 3RB0A 2QO3A 3FRYA 3UNYA 2AP6A 1H7WA 3QWUA 1WF2A 5KAKA 3WIUA 2VPXB 4K2XA 4NLWA 1NBEB 3IR5B 3DOMA 4FYXB 4M94A 2NREA 5KG2A 1X5OA 2V5HG 2DT9A 2HWTA 2V68A 2FTRA 3NGKA 1RQ0A 4H54A 4TYBA 4EBCA 1TMMA 5D0RA 2E5GA 3OJSA 5IT4A 1H98A 1QM9A 2W2MP 2D3ZA 2MTLA 4H4MA 1U1OA 3EDQB 2R7WA 4DU8A 5DQHA 1U2CA 3HX9A 1RT6A 4P73A 1KQSR 1FKPB 4OJ1A 2JEFA 1IBKF 4URGA 1RTZA 5DG8A 2C2ZB 3I82A 4IDKB 5KG0A 1YHQS 1XNRF 1OPZA 1WNEA 4DR7F 1VLYA 5B08A 4PXCA 3M8YA 5KOWA 1NJZA 3AJDA 1RHQB 3PW0A 4WTYA 2JEIA 1OWXA 1TTHB 3C6UA 4O44B 1FNOA 4QWAA 3KLEB 2KYXA 3EUNA 2LLZA 1FD2A 1MN9A 2A2DA 2L08A 1R8PA 4LRAA 4M5LA 2DGQA 4ALZA 5BR8F 1MWYA 5LL6d 3OV7A 3R6LB 1WOSA 4IUFA 4U9RA 2MQPA 2E5IA 3ISNC 2H5JB 3WBZA 2QJ3A 4K0KF 2FLOA 2AHOB 4KGZB 5I3QA 2YVSA 4C11A 4RW4B 4Q2MA 3H5UA 1SL2A 3RBDA 5K8PA 4JI0J 4A8MP 1Z1ZA 3CD5A 5A76A 4NLRA 2GQQA 1UVKA 4WIQA 2NQPA 2E7VA 2B51A 2Z57B 3CCSS 1PJ5A 3L4BC 2VF3A 3HT3A 2FQQB 4ERDA 3C6UB 3R1LA 4F2RA 2NXUA 2PMWA 2V2VA 3KFWX 1WKJA 1FCAA 2GA7A 2KT5A 2XWXA 2OPSA 2J9CA 4DL7A 1RACB 2JHEA 1NPRA 3CIZA 3GYXB 1T03A 2O67A 2YNGA 4RU2A 2G1HA 1TKTB 1Q1KA 1RAIB 4MK8A 2HBYB 2R9LA 4DQPA 1UA1A 2QEXS 2UUBF 4MKVA 3CJ0A 3TARA 3QIPA 4CO2A 4QIFA 3T6BA 4KGKA 4N56A 2YH1A 1HLWA 2OPQA 1HNWF 1KKHA 1TK8A 2B4UA 1Q0NA 3LA0A 3OT9A 4KFBA 3NBPA 5L9XA 4I6YA 4NYZA 1S5ZA 3MCMA 4UTGA 2V4JA 1FO1A 1HMVB 2J9DA 1PYTA 2VOOA 5RUBA 3C14A 3D1QA 2WTFA 1TV6B 3JYTB 1VGYA 1V3RA 1YG0A 2F8MA 3K2YA 2YNFB 3CJQA 5HI7A 3TNVA 2YKOA 1C1BA 4F4WA 1WOPA 2LECA 4OMFG 4EO8A 2PA8D 7FDRA 4YFUA 2UUBJ 1TL1B 4Y6IA 1AZSB 1EP4A 2HHTA 4UOHA 4U8YA 2DNNA 3CT9A 1FRMA 1U49A 4HT5A 2ZVSA 1I94F 1Z2LA 4QR2A 4P2SA 3QT6A 1X4BA 1SPBP 2FGCA 3BKUA 2ZJQQ 4KE5A 4HYKA 3G8QA 3CJKB 2HBZB 2GAGC 3MR5A 1B70B 2BRLA 2EBGA 4LSNA 4DFMA 1WELA 3ADAC 4URQU 1SUQA 2V2KA 2R8JA 3R9LA 1L3SA 1HYSB 1FT8A 2BKPA 2HURA 3LWMA 4DV0F 1IWGA 1FK9B 4ZHRB 3R5GA 1EKRA 1Q82T 1NPPA 3LOUA 1WF0A 2EKNA 3CCQS 4X2BA 4B3SF 3ONQA 1RABB 3CO9A 1G3OA 1FE0A 1QAXA 4IOBA 4ETZA 2HK3A 4Z7CA 2VG5B 1DARA 3OD2A 2JLEA 5L1LA 2H5IB 2KB2A 1TL7B 1VJWA 1UZDA 2X1GA 2YX1A 3FEZA 1GFWB 4GVLA 3MM8B 3KHGA 4CP5A 2ALZA 1ZYQA 3A3NB 2AD9A 3KG0A 2FLPA 3G2XA 4X4PA 4AT1B 2XS7A 5CAAA 4QIGA 4F25A 2Y8WA 4F8RA 3J7ZT 5IXUA 2GCFA 1G4CA 1ZA1B 2GMHA 4UF4A 4B3SJ 2Y1RI 4F2SA 2IHR1 1VQYA 2CQHA 3I31A 2IRYA 4KGXB 4PG7A 1X4GA 4P9SA 3H20A 4U95A 1NK7A 2OH2A 3LP1A 4YDDB 1LWCA 3H5SA 4ZP8A 5IM0B 5DLFA 3QJPA 3O5TB 4DZDA 4ED3A 2EFGA 4IKAA 1TL3A 1B3TA 2GIRA 3WC2A 4GKJJ 1PBUA 1UZHA 2FJAB 1VQ9S 4OYBA 1N5QA 2VG6A 5GADU 2CPEA 3OTEA 4JBCA 4J9PA 5DGAA 2P2CB 2IBOA 2VDIA 1MN7A 1R8CA 1JJHA 2DBBA 2N4CA 2DCUB 4JI2J 2RF2A 2AYGA 2WONA 3K58A 5B0GA 2R2TA 5BJRA 4LFAF 4DL3A 2MY7A 2W25A 3AJ1A 3RZAA 5F3ZA 2E9TA 4LIRA 1UVIA 4I56A 4FS2A 2ACMA 2VBWA 3G8TA 1K0VA 1U8SA 1H2UX 4I7FA 2XB2D 4DX5A 2DNRA 3PJWA 5IM0A 2E5LJ 4JV2A 1UW4A 4JI8F 3K57A 2OLWA 3OW2R 2WSEC 5CCLA 1TELA 5A0YA 1NDCA 1S1VB 2HFOA 4KV8B 4C3KA 4A8SA 1S12A 5ETSA 4ZMMA 1YTYA 4OZ5A 4PZVA 3UD3P 1KTQA 2XZTB 2XSJB 4DV4F 1S9FA 1SL1A 2ZZNA 4KSEB 4ZPTR 3ZNJ1 4F3QA 1F9FA 1K8AT 1BXNA 2XYPB 4C8YA 5M2UA 2PMZD 1EIYB 4ZN3A 1BE4A 2CADA 5ETPA 3W2WA 4TU9A 3GIMA 3DYAB 1YBAA 2OAUA 3DKDA 2W01A 3HPOA 1JWWA 2M8HA 3CCJS 3W9IA 2J6SA 3GV7B 2CFXA 2NCKL 1N32F 4EK2A 1YGYA 3MMJA 2G2YA 1A7GE 3VAJA 4DR6F 2G1DA 4DR6J 3KLIB 4LSZB 2ERRA 3UWTA 4EZ9A 3T3FA 1WUUA 2YNHB 5L46A 3OXFA 1HPZA 1ZETA 4PPZA 2OSQA 2RU3A 1K1SA 3HZGA 4CM0A 3KLGB 4NLDA 3IGNA 2KI2A 4F3MA 5C25B 4KKOB 4TY8A 1S6PB 1JKHB 1ZAWA 3BZQA 4I2PB 3HSZA 1YLXA 3ZZRA 4NA1A 1RE1B 3RBEA 1C1BB 3EVOA 3D0GE 1N32J 4L3KA 4LF8J 3V5RA 1HNIB 4NOHA 1RLDA 5G0RA 4DL0C 2UXCF 4JI0F 1HA1A 3UI3A 4HEA9 4R8UA 3VGTA 3H7HB 4GKKF 3N28A 3MURP 3VVTA 1U1PA 3X1LB 4DQQA 4IH6A 3V6HA 4DCOB 2ZE2A 3IN5A 4IRCA 4PYAA 3Q2TC 2EKYA 2K7KA 2PFDA 3DHWC 2X3GA 3OJUA 3KJVB 3HMJG 4CO3A 3IGVA 5A2QY 4J9UE 1SC3B 1X31C 3CCRS 1XNRJ 4EUVA 1XC9A 2WHOA 1RTIA 2Z2ZA 3DLEB 1FF2A 3EGVA 1U47A 2XGQA 2EK6A 5H9EJ 4CNYA 4EFAC 1FEEA 2KFNA 3CJ4A 3AFGA 2H5EA 1Q8KA 3DDKA 3P5TL 2UXCJ 2GC8A 2CNNB 2KXHA 2CJXB 2IA0A 5EX3A 2F4VF 2X3DA 1R8BA 2WAQD 2H3EB 1S79A 4LR7A 3NGTA 2QT7A 3U1LA 1UA0A 4ELVA 4FYDA 4FF1A 1CJKB 3R2DJ 1RTHB 5DQGA 5LT5A 5HANA 3TAMA 1DTQA 1U7LA 2XHWA 1SBRA 3GJTB 1RLCL 2H1YA 3NGSA 1LFPA 4OHZA 3KLEA 2CG8A 4B9NA 4K4SA 2GS8A 2GJIA 4LF2A 2FIUA 2ZBIA 4X66F 2LU1A 5CZVA 1SJRA 3GFYA 5KFTA 1X9WA 4XPEA 3W5YA 1RAAB 2PMHA 4DSFA 2RD5C 3GJQB 2QFIA 1IQZA 1RA6A 3FNNA 1HIYA 1O6XA 3MR7A 4NMXA 4ZS6A 3K5MA 1PAUB 2HRUA 4L73A 3W7BA 2HRYA 4NZ6A 5JUMA 2WW8A 4NCAA 4W92B 1QY7A 3OLBA 4Q0BA 2AX1A 1VC6A 1HQUB 4RW6A 3GONA 1JLEA 2HKEA 4NLYA 3L7PA 2O3DA 1QJHA 4HHHA 5T7LA 2ATCB 1JXEA 2LXUA 5A2QU 4R8UB 1D9FA 4J90A 1IKYB 2X1AA 4A8YA 2DNKA 1WDDA 4U7UK 4CI0B 1NAQA 3N4WA 2CXEA 2I5JA 2BANB 3GIKA 1FFGB 1RKJA 4WTOB 1FRHA 1U8WA 4GVBB 5ETMA 3NEKA 3Q86A 1HNWJ 1S6PA 3QWPA 1APSA 3M2VB 3RB4A 1LKZA 1UVMA 4AXIA 2XEXA 4DLGA 5F8HA 2MLXA 2B9WA 1WC1A 1LEOA 1RB0A 2IC3A 1ELOA 1U09A 3MMBB 4KGVB 2IVFB 4BLGA 1LK5A 2DY1A 3CDAA 2UUTA 3HD2A 8RUCA 5GAEI 1S4FA 1IUJA 2ZZTA 4KR0B 4QYZK 3JQKA 2P9EA 4J9MA 3AOAA 1X4EA 3IM9A 4OFZA 1BD6A 1HBNB 4R0JA 2W9CB 3OBIA 3MOJB 5KFZA 1U1RA 3IG1B 2E7XA 3U7JA 4TVAB 1MNEA 4USVA 1NHVA 3DLGB 1TFWA 1NK5A 3OTCA 4ID5B 3W2WB 3R5AA 2V8GA 4Y2IA 1FKOB 1Q5YA 1E6VB 4CLSA 3D0HE 2NS1B 4EZ6A 2IAJA 4WZMA 2HFZA 5A8RA 2FHJA 2VB6A 1NK9A 1RWWB 3M1VB 1HD0A 3PO5A 2YY3A 1PIEA 2K06A 1RSCA 4MIBA 1HWKA 4QIEA 3MEGA 1RT2A 3SIPB 3UD5A 4B02A 5IQ6A 3KLHB 2XMJA 1NEEA 1YSJA 5E0OA 3T5HA 2ZITA 3HCXA 2CZ9A 4TXSA 2MJUA 4Y3CA 5GAGU 1YK9A 1YWXA 3CJSA 4N47A 3OLAA 4DSKA 2MQ8A 4JI1J 1RKIA 2C3OA 2R7VA 4DPTA 1KD1T 3A1YG 3EX7B 1D09B 1TZ0A 1P1LA 4FZVA 5A6WA 1MROA 1DQ9A 4LR9A 2ZH3A 4GRSA 3UQSA 3TA2A 2AGOA 2E9RX 2DNLA 2GJ2A 1PC4A 1LXJA 2YWGA 4ECRA 2BQ3A 1T9TA 4P7TA 4I2QA 1A0OB 5CYMA 3MR6A 4MH8A 2HQGA 3H40A 5H9FK 3I55S 2ZH7A 4HACB 2JX2A 1NK4A 1S72S 5CXTA 4W4MA 2IRXA 4D3HA 1JLBB 3CCUS 2SXLA 3A4TA 5ETTA 3KUGA 2XY5A 3B54A 1L3KA 1N0VC 1VOMA 2VBXA 3TQEA 1KC8T 1UETA 1VHIA 4X4RA 5H9EK 4YB5A 4RX6A 4DV4J 1FHTA 1QUPA 5AXKA 3J7YI 4OI4A 2N4DA 2J9EA 3HHLD 5EDWA 2PI4A 4MK7A 4K5SA 3RW6A 4L74A 4XAKA 3GJSB 3PTWA 1MG7A 1W26A 1YJTA 2MZRA 4C0OC 1VQ7S 1TKDA 4JI3F 2VQEF 4LF4F 2R7OA 3FCHA 1ZH5A 2PC6A 4F4AA 1AFJA 2DR7A 5C2CA 5T14A 1FXLA 1HKAA 3NXZA 1YJRA 1JLFB 5CABA 2V4QA 1XJWB 1R31A 3E3XA 3GP9A 3GG1A 5KT5A 1D0EA 4OZNA 1RXOB 2FJEB 2L9WA 2W2PP 3DHXA 4OYAA 1N6QB 4DSLA 1KOHA 3AODA 1X5PA 3I32A 3JSMB 4PG8A 1HWJA 4IFYA 2ZOMA 4A46A 5KT7A 3PV8A 2KDOA 1RAFB 4X64F 1DLOB 5KFBA 1FFWB 2GW8A 2ZH6A 1DY3A 4ILMA 2E5HA 2BW7A 2DHHA 5HK4A 3VAHA 2YNGB 5H1SV 3C6TA 4WU2A 3TRGA 1RHKB 4YB1P 4MKYA 2BMBA 4KJIA 1BY9A 2DVIA 3A8KA 2QLBB 3GIIA 3KHHA 1ZBTA 4P6QA 1OMSA 4YEAA 4NRTA 1S0NA 1VISA 3N01A 4FDFA 4A8XA 2B4PA 4CO0A 2V8HA 2FZCB 4OHVA 2XCAA 3F0NA 4DPWA 1GXLA 4NX9A 2WBRA 4LREA 5K14B 1JNRB 2Q6CA 2BUNA 5SUHA 4PG4A 4DR4F 3EGNA 1CJVA 2LA6A 4ED4A 1REGX 2LDYA 4RW9B 2V94A 1N36F 4QWBA 4B9TA 1UVJA 5KFWA 1V3ZA 4P2MA 3WX8A 2CJQA 3NS7B 4C2MA 3SQGA 5KT2A 3MPYA 2DHXA 1F2HA 2DNZA 2YKMA 4IH7A 5J2PB 1Q7YT 4KPYA 1R0CB 2Z30B 2VA3A 1FTCA 3GJRB 1RAGB 2LQ5A 3HFVA 3B4DA 4WFNQ 2FVQA 4LF8F 3G8SA 1S1XB 4DR4J 1F5CA 4C8ZA 5HLFB 1C1CB 1W25A 4O44A 2YX7A 3PACA 4I2PA 1SKWA 4TKTA 1RAJA 3TJ9A 1HNVB 1UWBB 3QGPA 2F9DA 2KRRA 3K59A 4FS1A 1HNIA 1A9NB 5J1EA 3B6BA 1NKBA 2XMWA 5IT0A 2KT3A 4DUYF 1FVSA 2YKMB 3BJYA 5J2PA 2IIHA 1IKWB 4I4BA 3TVKA 3MDFA 5HVGA 1CLFA 2XYHB 1Y0HA 4A47A 4AXJA 1VQ4S 2DGUA 2RQKA 3KG4A 4J91A 4QR1A 2RRNA 2Z2LA 1XR5A 3R5CA 5CYQA 2CPDA 5IS2A 2FJVA 1KNZA 1QUVA 1U26A 4RZRA 2HQDA 2CPJA 2NZCA 3AY0A 3WC0A 5KT3A 4RWWA 3D1HA 4NYOA 2ZJRQ 3MM9A 2JRSA 1RTIB 4IG0A 1NB7A 1D8ZA 3MECB 1FE4A 5BYQA 2M4MA 3R97A 3X3UA 1RAEB 2E1PA 5KOXA 3QZ8A 3KJVA 3CPWR 2BACA 4BC7A 3CD6S 1CBKA 2VA2A 2CQ1A 1WF1A 4N8NA 4ID8A 4ZLPA 1V5IB 5B7WA 2ZH1A 3AA9A 1JLGB 4JOUA 5CYQB 4C6AA 1X9MA 2BJEA 1ZM9A 3RB6A 1DURA 2QA2A 2XSFA 1M1HA 1SH3A 3J81Y 1REVA 1NZ8A 3B82A 1RWUA 5LMUF 1ZOTA 3FGVA 3RG6A 3SV4A 3DM2A 2MDAA 3GCWP 4EYIB 2UUCF 4QZVB 3W66A 4IQMA 4WP3A 2LP4A 2RB7A 5CA5A 4DFPA 3DOKA 1WKLA 1RT6B 2L3MA 4OYIA 1FDDA 2VHGA 1TKXB 1RA7A 5ETNA 1VBZA 2KXFA 2B4OA 5EX0A 3THVA 1L3TA 1RHJB 5I3UA 3H42A 1B0VA 3TW0A 1VQKS 2B6AA 4LF9J 4UT4A 4HH0A 1GX5A 1UEKA 1YJ7A 2HQCA 3QPIA 3QYYA 6FD1A 1FESA 4MMOA 1UW9A 1EKSA 3Q83A 3TR5A 1LWCB 4YMEA 2XI3A 3CJTA 4D3GA 3FBCA 2HZVA 4H4KC 3VVUA 5HSPA 2B8PA 3NWGA 2EBEA 3Q89A 2ZBQA 3N5FA 4LBIA 2YQ3A 4O23A 3MM5A 2ZEJA 3W2VA 3SV3A 1YX2A 4Q8FA 2QYGA 4FNIA 4DV3J 3QAUA 2J7WA 2J0SD 3M32B 1ZM2A 3KK2A 1QSYA 2YWFA 3MMAB 2ALYB 3A8IA 1MMNA 2K7JA 2M0GB 3R3TA 1ACMB 3UR0A 2W24A 4DV5J 5E3QA 5HQMA 1PJ6A 5KFLA 2HFUA 3CE8A 3I56S 1BC6A 3Q8PB 1RGVA 3W8PA 2C2EA 4TY9A 2W2NP 5D6GA 2W4PA 4OHXA 2VJVA 2CJYB 1J5OB 5ETQA 4HR2A 1NSKL 1YJUA 4R0EA 2XMTA 5M2RA 1NK8A 4P75A 2I0XA 4L3NA 2VG5A 1J5EF 1HNZF 4CLKA 1DFDA 3I96A 3FRZA 5IQQA 5KFNA 3EXCX 4AE5A 1NKEA 4DR3F 2EVZA 1RTJA 3ZZOA 3CGIA 4Q5VA 1M1GA 4DV7J 2V50A 1TMJA 2U2FA 2CJ9A 4P7VA 2FC8A 3BN7A 4DR2J 2BE2A 3FC9A 2CDRB 5LXRA 4ECSA 2IM0A 2KFZA 1VBYA 3G82A 1FX2A 2EC2A 4HVZA 3ZO7A 4FXVA 3FZBA 3HJVA 3SQOP 3TUIC 3IO1A 4ZVPB 5KG6A 3LP1B 5EWEA 3T9ZA 4JUZA 3AD8C 4KT0C 3DU5A 4DPUA 3HM9A 4DBQA 3KNAA 3NMRA 1TL1A 4LBPA 4DS5A 3PYDA 3OR2A 1S49A 3SSRA 3UVJB 3OQ2A 3HHLB 4OZJA 2DRBA 4IR9A 4DR3J 2YNFA 3JTOA 3DRPB 1XMOJ 4B9VA 4DV7F 4HI2A 3EZOA 4NLUA 3G6VA 4FF2A 1UL3A 3BF4A 3K17A 4NE9C 1PG5B 3A8JA 2DO4A 3Q2SC 4KIAA 4B9UA 4A8QA 1EHWA 4HACA 1RT5B 1XN9A 3CMQA 4DDFA 4OX6A 2ZHAA 4LR8A 5GAHI 4OHWA 3TX0A 2XG8A 1T9VA 4TQRA 1W7WA 2NXEA 1UEVA 2WZ1A 1D8YA 2BX6A 2CIMA 2J0XA 2XZDB 2E1CA 2RS8A 4LSNB 1G2EA 1KS2A 3TA0A 3VHQA 3EZ5A 5KFOA 2R2UA 5E5NA 5HVHA 2M70A 2PN6A 3HULA 2ADBA 4LF4J 2K1RA 3MUMP 5I42B 2ZDOA 5AXLA 3CB4A 2R2SA 2DHSA 2ZD1B 1SH2A 4B08A 1M5VC 2BM1A 3V4MA 3BO3A 5B0DA 1WJ9A 2KRBA 1JJ2R 1I1GA 1R89A 4PPDA 4DJBA 1HNXF 4V19J 2BA9A 4R5PB 4L75A 1TKTA 3M9NB 1TVRB 1T95A 2HHXA 5DS7A 3RGIA 2ZC4A 3DM2B 4L6V3 3NGUA 1N33J 1TV6A 3GFHA 3KMSA 3IWXA 3CXCR 1VQOS 2DH9A 1IKYA 1R8AA 2HNYB 2WVFA 3CDWA 2H51B 3V4IB 3UW1A 1F6TA 4YUDA 4X4QA 2BW2A 1HI1A 2G4BA 3VQTA 1C0TB 3MM7A 1LWEB 3I0SB 2JDJA 1RYSA 1NRKA 3SCJE 1FFSB 2MGZA 4OL8A 1X5SA 2B5JB 1MU2B 5K5MA 3GCXP 4KH1B 4YR3A 1OQ3A 5D15A 3QNWB 3MTKA 4FXWA 1KONA 2X7IA 4O3QA 2HEKA 1UWAA 2HLTA 3BKFA 2MKCA 3TZYA 4W90B 3MFIA 2PGCA 3VAMA 3KJQB 3P45B 3BREA 3ISND 4CT9A 2KVIA 1VRUB 4RNNA 3Q0AA 2OIHA 1T9YA 3FQKA 1S48A 1JLCA 1FRLA 2AEMA 3P3DA 4OLOA 4IDKA 4CM2A 2FY1A 2K3IA 2GO8A 2AF6A 4ENOA 3IR7B 3KUHA 5EGYA 2W4CA 2FC9A 3PR4A 4TQSA 2XLJA 3G6YA 2RQ4A 4USWA 4Y00A 4TLRA 3CC4S 3RB3A 2DXDA 3SFGA 1P27B 2HAFA 2IMOA 2QYCA 3IP0A 4UZCA 3IRWP 1LQ9A 2AZ1A 2MGZB 1GT8A 3B78A 1CVJA 5GAGI 1HQUA 4RW6B 1EQMA 5KFKA 1S6QA 3EJMA 3CULA 3N0VA 3EE3A 4WU3A 1TUVA 2VD3A 3S01A 5K20B 2QIFA 1Y7PA 1FJCA 4WFXA 4NA3A 4G3IA 3GYNA 1XWLA 4BDPA 2RE1A 1FWKA 2HVHA 3ZZZA 1TR0A 3P5BP 2LYVA 4U8VA 2VFTA 3H90A 3ZXWA 1FJ7A 4N7TA 1VRUA 1HW9A 3KJNB 1TQLA 2PEHA 2RU9A 2C2NA 4HH1A 4X65J 1F5BA 1B7FA 3R6GB 2W9AA 2DEJA 2V8PA 1RTHA 2G2ZA 3HLUA 1HPZB 2YTCA 3QAEA 4CTAA 4LQ9A 2FLLA 3D9BA 3I4HX 1JXVA 1RWPB 2EXUA 5E3AA 5LM7E 3M9MB 4Q8EA 2VQEJ 3DI6A 1V6HA 4RJVA 1CQNA 3NMAA 3I0SA 4ZK7M 1S7HA 1N5TA 2B7BB 3CCWA 3GSIA 4HI1A 2HMIB 1O51A 3H2VE 4B3RJ 1GNKA 1RDRA 3BGFA 3MMCB 2ZJPQ 2E7WA 2ZZMA 1PC5A 4NCBA 2HS0A 2J5AA 4RW7A 1DTTA 3MEDA 4BS2A 4F02A 2C3YA 2UU9J 3D28A 2DNGA 3H2UB 2GVDB 4WE1B 1LWEA 1RT7A 3HSGA 1U02A 3MD1A 1JJ4A 1X9SA 1K0TA 1PILA 2APOA 2CPZA 2PE8A 2VG7B 2GQ2A 1IR1A 3VGSA 4ES2A 2W7AA 4IYQA 5C5JA 3N9UC 2YWHA 3D6HB 5HBMB 1AT1B 2D74B 1H2TZ 1S9GB 3MEGB 4OJHA 1WEXA 3VWSA 2MZSA 2DR8A 2D9OA 4IG3A 3BDPA 1VK3A 2QMUB 4BC9A 5F8MA 3MUTP 3JSBA 5HJXA 3M2RA 3CCES 3QSYB 2HWHA 1N48A 4QIVA 1OY6A 2NZ4A 2DGTA 4IOCQ 4G1QA 5H9FJ 3IG1A 4JI6J 3JXOA 2OSRA 1QE1B 2KM8C 2P6SA 3R5DA 2OTJS 5ETKA 2RF2B 2P9CA 4O0IA 2KG0A 4UOCA 2NXNA 2VIHA 3KLFA 4DV3F 4KHMA 1A6LA 5FDLB 5M2PA 2RHSB 2OP5A 4QCLA 4FVMA 1HWUA 4UUXA 5KG3A 3TZWA 1WOOA 4B3MJ 4WZQA 4FKYA 3MM6B 1PSDA 2BRKA 3M2RB 1VR6A 3M4XA 3OFGA 4DN9A 3DDIA 3K5NA 1EQ0A 4EI2A 3SFUA 2XMUA 3T19A 3M6VA 1BQNB 1RCXB 1WG1A 2W8KA 5LOQA 1TKZB 4HTJA 4I64A 4DSIA 4ZJLA 4I6AA 5MLCV 2XMMA 3PY8A 5A8RB 2AGPA 3H5XA 1YRTA 2UV8A 1SJ4P 4O3PA 2M9KA 3CC7S 3OPKA 1T0TV 2BJ9A 5JXSA 1UAWA 1LW2B 2GO9A 3NOCA 4EO6A 2Q3PA 2DIVA 4YQWA 3W63A 1X4AA 2GVDA 2OJ3A 3IWNC 2HVDA 2VKRA 3O1LA 1F2GA 2QFJA 3UN2A 5HROB 1VC5A 3TUPA 3RTVA 3PVXA 2KJVA 1UJ6A 4EYHB 3OFFA 2WOMB 2I9SA 4WXOA 2Q1LA 2QL9B 2ZBRA 3CDEA 3GTYX 2PSZA 3HF5A 1NM2A 3T9NA 2ZWPA 4DG1A 1E6YA 2B43A 2AT1B 3PFEA 2MLYA 1SUQB 1CULB 2CPYA 2IM3A 1R6VA 2DNMA 3AA8A 2WVDA 4G1IA 4G65A 3T5LA 1XMOF 3TJ8A 1CJUB 2VASA 2KJWA 4FYWB 4CYUB 4QW8A 4USUA 1MW7A 5FIIA 4ECZA 1ZPVA 2BKNA 3AHPA 2XZWA 2W7PA 3MPDA 3PNIA 3T1HJ 4NI2A 2Z8QA 4M5MA 3M32A 3KK2B 1J27A 1UJ4A 1KTVA 2MKIA 2R2RA 5C24A 1RBLA 1V3SA 2BV3A 1XERA 1DHMA 3I4PA 4FP9A 3TJAA 3VGVA 2BQUA 3PDNA 1VIXA 3CCVS 3PYGA 4TNOA 1VCTA 4M5IA 3OVSA 3C16A 3MR3A 3K8VA 2HFNA 3DCAA 4PUOA 4CZCA 4ES3A 1T9XA 1HMVA 2K3KA 2OO4A 5AXMA 2ASJA 3UR3C 3Q8QB 5KFIA 1NJIT 2UZAA 4KFBB 3ELHA 4X84A 3PW2A 5DM7Q 1IKWA 4QWEA 1HNXJ 4NXMJ 1FVQA 5J2QA 5J1EB 2HIQA 1JX4A 2ACYA 2VFUA 1UPMB 2ZKTA 3AAWB 1VC0A 2UVRA 2HS4A 2JL9A 2JC0A 3TAMB
chains in the Genus database with same CATH topology
3KWMA 2FJXA 4JV1A 2E29A 1FJGF 3CC2S 3W3SA 1DQ8A 2M88A 3FEXB 2HHHF 3HK2A 1JNZB 5AXNA 2J6UA 4K50A 4ZKAA 4CO5A 2AYBA 3I5AA 2ASYA 4Q7AA 1UFWA 4B17A 1KEKA 1QSLA 3BM7A 5KFEA 4OI1A 3D54A 2HNZB 5J2QB 2HW3A 2AJQA 5HL7Q 1S1TB 3HP6A 4HL9A 3U1NA 2WSFC 1TAQA 3ITHA 3IBWA 2XULA 1W2BR 1WHVA 2CQBA 4WYLA 4ZCMA 2XSJA 1UWBA 1L5UA 2M2BA 4LJMA 4ELUA 1NJXA 3OL8A 3UE2A 3LGMA 2UV8G 2BDPA 2XS5A 2MKJA 4ZCLA 1UMJA 4YP3A 5DO2A 3CEDA 4H4MB 4NLSA 3M6XA 1IBLF 1P8GA 2OPRA 1WTBA 2FPHX 4MKBA 5EN1A 2HVIA 4QU7A 2EG2A 3CCLS 3GFXA 4DN0A 4K4UA 3MHYA 1WG5A 2RILA 3I9V9 5CCMA 3E2EA 1G1XA 2VBYA 5DDPC 2W8LA 1ZAXA 4O4GA 3V6KA 5K14A 1T05B 3SQGB 4QW9A 4ETXA 2GIQA 3KYLA 3PZPA 3M30A 1YJWS 2KXNB 1SKRA 1LXNA 2VODA 5LXYA 4ECTA 4C8KA 4WFBQ 3OR2B 2N7YA 5L8RC 2WB4A 1U2RA 3OXLA 3PEJA 1BQMA 3E01B 2D9PA 3PHEA 4I7FB 2QMWA 2AJFE 2XBPA 3K0JA 2P6TA 1FRXA 1M5PC 2P5VA 2HVZA 2ZH2A 3K7RA 3RRGA 2M52A 5A0YB 3LQVA 2EFOA 4OI2A 2K1RB 3ETOA 1BQNA 1R0AB 1T7PA 2VPZB 1OS5A 2JLGA 1KOOA 3H4DA 1IQTA 5CYMB 2R7TA 1SJQA 2UUAF 1NH8A 3CSKA 3OXGA 4F67A 1M0SA 4PXDA 4QOTA 1HD1A 1WI6A 1Y9OA 1T94A 1GH8A 2ADCA 1N5VA 2L9NA 2MYFA 1B64A 1FNMA 3RAXA 3GZ7A 2UUWA 2DJWA 4OV1A 2LKZA 3BN4A 1HHTP 2JEJA 2IMWP 4LVNP 3EGZA 2N82B 1N88A 4NCGA 4NRUA 2J9DE 5LSRA 3MZIA 2G9OA 3ENVA 1NH7A 1LW2A 3NS6A 3AB4B 3D1OA 4YDXA 4DV6F 2I2YA 2IYGA 2YKQA 2C3PA 4URSA 2KO1A 2ZDPA 4NPOA 3C46A 2Q43A 4EWTA 3S1TA 2HLUA 3ISZA 3KLHA 4LQ3A 5B0FA 1VQ6S 1G7CB 5FDLA 1TK0A 4ILLA 1RJJA 2E1AA 3CCTA 1ZPWX 3GSDA 3F41A 4CQ1A 2CKWA 3OVBA 3OR1A 5I3UB 2AYMA 3LH2S 2R7SA 4FXDA 5EHHA 3NCRA 3WX4A 5D8HB 1BQMB 4GC7A 2HMIA 2IC3B 5I4MA 2BANA 3Q8RB 2ZM6F 2CZVC 3UD4P 1HYSA 2BZ2A 1JLAB 2VFSA 3PRDA 3E8OA 3CJ2A 3QLHA 4DS4A 1NO8A 3BGRB 1GXTA 3GR0A 4RW8A 3W2VB 3MD3A 2U1AA 1Y00A 3ZZYA 1LWFA 3KHLA 3HVAA 1SJ3P 3KK1A 5HBMA 2VKZG 4C8NA 2V4JB 1JXLA 1OQ6A 1Q4RA 2CVEA 4DL6A 3MM9B 4IG0B 2V9WA 4MFBA 2A18A 4LSLB 2EFVA 1Y4ZB 5KT4A 4ILRA 3KG1A 2C42A 3HVTA 3T1HF 5E3PA 4G1PA 3IR6B 2I5JB 1QAJA 4JV0A 5K8MA 2NYIA 3PIPQ 1QSSA 2G0CA 4F4YA 5CH7B 3ZZ0A 1DJ0A 2X1BA 4F50A 4ZPVR 5U47A 4E0DA 3M2UA 1SKSA 2DHGA 2L48A 3NCPA 5C42A 2C28A 4C8OA 3TP2A 1DZ5A 5EWGA 2J0QD 3JTPA 1NK0A 2IA6A 4XDDA 1RT3A 4NLVA 1L3UA 5KFXA 1S6QB 4DL5A 4LUBA 3GILA 3SZ2A 2R8GA 4RW9A 2MSSA 4LFCF 3V4IA 4C7QA 1IJFB 3PM9A 1HQEA 4OQJA 4KHRA 2ZC3A 3QIDA 2DRAA 3ENQA 4N77A 4NLTA 2MXYA 2FD2A 2OPRB 4KBIA 4BHQA 3MI7X 5HMYA 3DU6A 5DM6Q 3RR7A 3J7Z5 3DC2A 3EGWB 2E9ZA 5A8KA 1H2VZ 4CCHA 2FGOA 2MPUA 4DOZA 1DTQB 4EBDA 2UVVA 5I42A 4F3OA 1AUDA 1CSJA 4NLPA 2RDJA 5KFUA 3FEYB 3KLIA 1CC8A 1S1XA 5F9LA 3IA0A 1URNA 4DQRA 4IFYB 1O8BA 2OTLS 4U67Q 3I0RA 3DDNA 1YRXA 4CNZA 1N6QA 4YB6A 2F3JA 3LP0B 3VAGA 1WI8A 4ICLA 5B09A 3OTBA 2CPXA 5D4OA 2HNYA 5AJ3F 4OX9F 2QZ8A 1T3NA 1SL0A 1WWHA 4ZPAA 3TYTA 1U24A 3D5MA 1GTHA 1RYRA 2B9XA 3HHLA 5IZHA 4YR2A 5MAOA 2A1BA 4YY3F 5JVHQ 4OI3A 3T5KA 4ZCKA 1S1VA 3P49B 1VS3A 4NMLA 4HDHA 3T6JA 4KKOA 5FJ4A 3MAHA 1OO0B 4IQXA 1CC7A 1HL6A 4YR0A 3HVRA 5THWA 1H38A 3NP5A 5KFJA 4NYPA 4CH7A 3OUYA 4ED8A 3FQLA 5KTQA 2BBEA 1IKVA 3L09A 1VQ8S 4B3OB 2MJNA 1RT4B 4QPTA 1TL5A 5DRKA 1VQNS 3L3CA 3PX4A 3QGHA 2ATLA 2IBKA 4LF5F 2CPIA 3PFOA 4DV2F 4I2QB 3OTOF 3PW7A 5LMNF 3IS9A 3T5JA 1RTJB 2CJKA 3RAQA 2ABYA 4O4RA 2CJAA 1S97A 2XNRA 3MFHA 3EPIA 5B0AA 4F4ZA 3VCDA 3GWCA 3PX0A 3KOAA 2O66A 3NAIA 2JFDA 3NRBA 3TVYA 1YJ9S 2N3LA 3DN9A 2ZUGA 1ZM4A 2MSTA 5F8IA 4B9LA 5E41A 2I1RA 3K5OA 1B0PA 4UW2A 2I8EA 2R8IA 1K9MT 2FVPA 2VPWB 5LSLA 3LW5C 1NNDA 3E51A 1MSWD 3UPFA 4K4WA 3HO1A 1Q7LB 5ITHA 4K4ZA 4EGLA 1TK5A 4C8LA 1HBOA 2LU2A 1S76D 2F9JA 2HAIA 2JVRA 1FRIA 1HFEL 4N76A 3CWJA 4DL4A 3BGUA 5F9NA 4ECWA 4MJKA 4KHPF 2H9ZA 4RKUC 5DDQC 4H4OB 3SDEA 3NG8A 4HHJA 3AB2B 2UP1A 4K5RA 4XK8C 1Q79A 3DGPA 1HBOB 3ENWA 3KLVA 4E8UA 4J9QA 3FVYA 1WG4A 4PRFA 1VI7A 4DF8A 3C8YA 2XCPA 1T3OA 2MZJA 4WJBA 5F3TA 3SCLE 4KC5A 2HHUA 3JSYA 2CG4A 4FVCA 3CJKA 5D4NA 1VQMS 3C2PA 1KSPA 1TKZA 2Q79A 1S10A 5KG1A 2NLWA 4PXBA 1FKAF 4ED6A 1U1KA 2WSCC 3JTNA 2GV1A 2O1PA 5DJBA 2YX4A 5A8WA 2M8DB 1KVJA 1HBUA 2HHQA 2YKNB 2DR9A 2DPJA 2DTJA 2VL1A 4GO7X 4FF4A 3TUZC 5LSOA 4OX8A 1S1UB 2OPQB 1MWZA 3M05A 3RW7A 2YH0A 6FDRA 2ZH5A 4CIOA 5F8JA 2EC0A 3LGNA 1EETB 4ICLB 1N5SA 1TFYA 2DITA 4TLQA 4WK3A 4RLEA 3VF0B 4DF4A 4G1QB 2DO0A 1P1TA 1C0UB 3U02A 2JFKA 4J9LA 3DOLB 1N5YB 2BOPA 2FHKA 1KHVA 3G71S 3DMJA 5J1PA 4WYWA 4C3MA 1KFSA 4X62F 2RSQA 2YWKA 1RTDA 2LA4A 4J9SA 5EWFA 3G86A 3R1HA 5HLFA 4HKQA 3KTQA 1U25A 1GX6A 4X4TA 3TAPA 2GX8A 1S0OA 1RI7A 4DUZF 3ITHB 2VG7A 2XLIA 1SV5B 1LV5A 4I67A 2DR5A 2FJDB 4FN5A 4IO1A 4C11B 3DLKA 4X65F 1QVFR 2HNZA 3ZZUA 2EFPA 2MZQA 2VH7A 2B7CB 1F0XA 3PRBA 1G6BA 1VQ5S 2VC0A 3I0RB 3ULHA 3M2UB 2EFQA 5KFAA 2LEBA 5LJ3Y 2QMXA 2FUG9 2DNHA 3BS9A 2IM2A 3DI6B 2ASDA 4Y65A 5KFGA 4C9DA 1OIAA 4ZP6A 5CQGA 3MEEA 3LUYA 2KG1A 4LVOP 1S9EA 1SXLA 3VAFA 3BO2A 4RBVA 5SZTA 4ED1A