2PEXA

Structure of reduced c22s ohrr from xanthamonas campestris
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
143
structure length
136
Chain Sequence
RTDTLLQLDNQLSFALYSANLAMHKLYRGLLKALDLTYPQYLVMLVLWETDERSVSEIGERLYLDSATLTPLLKRLQAAGLVTRTRVIIALTETGRALRSKAGAVPEQVFCASACSLDELRQLKQELEKLRSSLGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Mechanism of Organic Hydroperoxide Induction of the Transcription Regulator OhrR.
pubmed doi rcsb
source organism Xanthomonas campestris
molecule tags Transcription regulator
molecule keywords Transcriptional regulator OhrR
total genus 43
structure length 136
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2pexA00
4O3MA 5L3EA 2F5DA 4RGUA 1XGNA 1G3SA 1TNSA 4KMUX 4BNCA 5E1XA 1F5TA 2DQLA 2W57A 4BHPA 1LEAA 4ZZDA 2RDPA 3JTGA 1H0MA 1CF7B 4Q48A 4HYEA 3D0SA 3RKYA 1IF1A 3EYYA 1PP8F 1Z1DA 3RDIA 2B0LA 5H20A 2HKXA 3TO7A 3OOPA 2BV6A 3S2WA 1U5TC 4N9HA 4N9IA 1B1BA 5LRRA 1P2FA 2QQBA 4PGGA 1ZYRF 4EJUA 2GXGA 2LNBA 2DK5A 1ONVA 3PQJA 4Y17A 1X3UA 4HDVA 5KK1A 3V8LA 1ZH5A 4GGGA 2GA1A 4BQAA 4U88A 3SFZA 3BWGA 3T8TA 4B8XA 1ZAOA 4KN7X 1U6GA 4XSXF 1IXRC 4QWQA 1HW2A 3P9IA 1KU9A 2LF8A 4ESFA 3ABTA 1U78A 2Y75A 2PEXA 3JSPA 4HQMA 1E2XA 1ODDA 1HSJA 3WODF 1U2WA 2BGCA 3PQKA 1FSEA 2P6TA 4CDGA 2XIGA 4HDUA 3GX4X 1FT9A 2PBIA 4LMYA 2L4AA 5EEHA 1ZHFA 1ZRDA 3BJAA 1QPMA 2CWEA 4I09A 1R00A 4CO8A 5HS7A 2ZFWA 5DEQA 1BM9A 2H6BA 1UHMA 2COMA 4M9SA 5LEJA 2A07F 4WK8F 4MNUA 1FYMA 2EV5A 1IZ1A 5LBQA 1XSXA 3L9FA 1KQ8A 3G3ZA 2OA4A 4PCQA 5FLXK 3WTUC 2OU2A 2WC2A 2UWMA 2EA2A 1QZZA 5LEKA 2YR2A 2CSOA 3O3KA 1FYLA 1UCRA 2A3SA 1I1SA 2P5LC 4UVCA 4ZYDA 1H9TA 2XV4S 3KP3A 1MZBA 1S7OA 5E8IA 2RN7A 5HS8A 2P7CB 4A2UA 2F2EA 3O2PE 3GFLA 3K1MA 2H6CA 2L01A 1MJBA 1XD7A 1SD5A 4ESBA 3RTRA 2G7HA 2O3FA 4EMSA 3I64A 1IRGA 2PMUA 2UZKA 3CUQC 4I2OA 1UHWA 2ZXJA 2M45A 3BY6A 5L3BA 1SFUA 2P7VB 3BP8A 3JAMK 2FE3A 1CGPA 4FX0A 4UXNA 3P9KA 3HTUA 1IN8A 5JI6A 3WTTC 5DYMA 5ICFA 3ZMUA 3B73A 2HQNA 4PGHA 2X4HA 3QOPA 1WI9A 1FP1D 1LEBA 1TW3A 3FX3A 2HS5A 1Z6RA 1KGSA 1H9GA 4L18B 2XAJA 4L9JA 2VC0A 4MQ9F 1RUOA 4HLXA 2GIVA 4UHTA 4KDPA 3K0LA 3MCZA 2KIFA 4I0AA 2IW5A 4RB0A 1SMYF 1S8NA 2D1VA 1TQIA 2ZJ2A 5HVQC 1ZRCA 3VB2A 5BQTA 2NS0A 5TRDA 2WV0A 1ZREA 3EETA 4A0YA 3CUQA 1DP7P 1BN5A 3LQQA 2ZMEA 1S6LA 2W25A 2LSOA 1R5HA 4LG0B 1PP7U 4WXCA 1G3WA 1T2KA 4EGZA 2IP2A 2Z5UA 3JTHA 4KT5C 1J75A 4WXDA 2CO5A 3R4KA 4CHUA 3V4GA 5L3DA 1XGOA 3FM3A 3O6BB 2FQ3A 4A5NA 4LB6B 5CVIA 1HKTA 3VODA 2DTRA 2O6GE 2IVMA 3GEZA 2X0LA 3B02A 1G6NA 2XAGA 1FZPB 4XRFA 2V9VA 4YFNF 1HQCA 1SMTA 1XGSA 1YW8A 3FXRA 1I5ZA 1R1UA 1Z7UA 2GXBA 2DLLA 2LKPA 3IHUA 4QLCU 4HW0A 2KIMA 1YO5C 1J9IA 3R61A 2HKOA 2GA2A 3J81K 2KJBA 2E7WA 1PUEE 2WTEA 4HAMA 1PDNC 4ENJA 2XKPA 4CZZA 1JHHA 5D8LB 1BC8C 3N97A 4OIRF 5LHHA 1FC3A 1XN7A 5F6FA 2NRAC 3MAJA 4GXOA 3ECHA 3CUQB 5E20A 2ZKZA 3GVAA 4IHSA 5JVTA 4OIQF 3TOBA 1R36A 4G7HF 3CO7C 3LAPA 5E1ZB 4CGZA 2XUBA 3BJ6A 3KE2A 1F4KA 4HLYA 2HWVA 4XSZF 4JK1X 4RGXA 4M71A 4ZYEA 4HOBA 1SD7A 2QENA 3RKXA 2JPBA 2EV6A 1LQ1A 4R1HA 5ILUA 2HTJA 2MA3A 4U0VA 1O57A 2UXXA 2M5WA 4I7HA 2ZMEB 4WCGA 3VOEA 3E6MA 1TQMA 4UVBA 2CG4A 1U3EM 2FMLA 3C3WA 5ILSA 3U1DA 4B09A 4HF1A 4P9FA 1FOKA 4NHJA 2O61A 4ENKA 2ETHA 5HOOA 2EA4A 4YIFA 3ZPLA 4AD9A 1V4RA 3WG9A 3Q9SA 1B4AA 3WTXC 1K7AA 2XAQA 2RKHA 4GCVA 2PLYA 5D5XB 3T8RA 3BPXA 5K5RA 4A0ZA 3ULQB 3GYHX 3WTVC 3E6CC 3QP6A 1ZG5A 4EQQA 2LF7A 4LFUA 2QLZA 1ZLKA 5DCFA 2D45A 1T0FA 1XMAA 5CJ9A 5K5OA 1STZA 1XB4A 4LJZF 1ON2A 5K5QA 5J6XA 2VBWA 2P4WA 1XCBA 4PZJA 1Y0UA 2F5FA 2RC4A 2VC1A 4L5JA 1F1ZA 3R0AA 4Q47A 2HZTA 3KLOA 2IA0A 1SFXA 2XRNA 2DT5A 2ZCWA 1D8KA 2YX7A 5LGUA 4HZFA 4ESJA 2VBXA 4KMFA 3QPHA 2AXLA 3Q9VA 3HRTA 1IRFA 5HDKA 5HDGA 1IN6A 2CYYA 2XAFA 5D4SA 2IA1A 2G7UA 3JSOA 4H0EA 1L3LA 4UUVA 3DFGA 1J2XA 3L2CA 1Z9CA 3FMQA 4HBLA 2RNJA 1ZGJA 4HV6A 2G9WA 3F3XA 5BS6A 1QQIA 3K1PA 2Q0OA 2GZWA 5FO5A 3RJPA 2AS5F 2PMHA 3I4PA 3WTYC 3M8EA 2VBYA 4TV7A 2M1BA 1IXCA 5D8KB 2Z9OA 2A6EF 1WQ2A 1OPCA 3GFIA 3I53A 2DBBA 1RI7A 4OOIA 3DEUA 3ML6A 2EB7A 3E5UA 3J80Z 3CJNA 3TQNA 4XLPF 3IC7A 4RB2C 1S3JA 4ZH4F 1KU7A 2KKOA 1JHFA 2EK5A 3HRSA 2JZYA 3L00A 4F7ZA 4JQFA 2P5VA 2YX4A 3WE2A 3GUDA 4DQ2A 3U9GA 1G4DA 4ZYHA 2IRFG 1TQPA 5LGNA 1BBYA 1ZLJA 1ZGAA 4A0XA 5F64A 4HF2A 3GW2A 1WKMA 1D3YA 2F5EA 1KYWA 2V1DA 3I59A 3VFZA 2DW4A 4O6JA 2DPDA 5A2QK 1S29A 5DCMA 4OMYA 3ZMSA 2FF4A 5LHGA 4YFKF 3L09A 2FMYA 2Z33A 1FP2A 2EFOA 3E3VA 5LLQA 2DAOA 3N4MA 4RB1A 3E6DA 5DV5A 4I02A 1CF7A 5BOXA 4RAZA 1HSTA 1R7JA 2Q2EA 4D0PA 2FA5A 3RI4A 1LNWA 2HR3A 3M7GA 5D5VB 1C0WA 4OIOF 1R5GA 1HBXG 5ED4A 5BMZA 2FBKA 1YQAA 4RS8A 1K79A 3R60A 2IPQX 1W5TA 4MGRA 5FLXZ 3BDDA 3V8KA 4FX4A 3ISPA 2CQKA 2D2WA 2EJRA 1F9NA 3KP2A 4Z2YA 2FNAA 1QBJA 3HOTA 1JXSA 3T5XA 3H92A 4ZZLA 2YSRA 4R8HA 2J5PA 4OU0A 3HHHA 3NEUA 3F22A 3WU1B 3SHFA 3GXOA 1YYVA 1ZRFA 3IRQA 1MDMB 1D5VA 2C6YA 4AIHA 2MH2A 3ABUA 2ESHA 4NB5A 2K27A 4UNOA 5IT9K 3DPLC 5JFRA 1BI0A 2L4MA 2Y48A 2FRHA 4G8XA 1Z91A 3W6JB 4Q4ZF 1KU2A 3CUOA 2YU3A 4HF0A 1XSVA 1B59A 1O3TA 4BHBA 4LK0F 1LJ9A 3RYPA 5LGTA 4GYIA 3BPVA 1XDSA 1O7LA 2H94A 1WSUA 2HQRA 2DK8A 3HSEA 3M9AA 2NNNA 2TDXA 2A5YB 2DQRA 5LHIA 2CW0F 1FYKA 3HUGA 4I01A 3DXJF 5H6RA 1JGSA 1DPRA 3AAFA 1EV7A 1OMIA 2H27A 5CVRA 2RGVA 3WE3A 4BH9A 1K78A 3Q5FA 3ZN0A 3K69A 2MBFA 2QYOA 4IXAA 1RIOH 1P6RA 4IRIA 4ENNA 4G6QA 4OIPF 1U5TB 3HHGA 3HSRA 4KYWA 2ELHA 5ICCA 3K2ZA 1DPUA 1WRJA 1BI1A 3I54A 1YIOA 4HX4A 4U0WA 2XHKA 4L9VA 2K86A 5E18F 5K1YA 2BE5F 2PG4A 5E17F 1IW7F 3MFKA 1TTYA 3L7WA 2PN6A 5FFXA 3KFWX 4EV0A 5FD5A 5ICGA 4LB5A 3GLXA 4RB3C 1SAXA 2NAZA 1LVAA 3C7JA 4A6DA 3DKWA 4KIGA 4L9TA 2PFBA 4IHTA 2EV0A 2K4BA 4WXHA 1OYIA 3KP6A 2F5CA 1ZARA 4G7ZF 2BEOA 3KETA 2VT3A 5CVVA 1W7PD 1WWXA 1Z05A 5BPIA 1RZ4A 1J0RA 2JRTA 4Y13A 3D5LA 1G3TA 5IT9Z 5CYVA 3F8CA 3HOSA 5ILVA 1BI2A 1USTA 1T39A 3WGHA 5JR3A 2D1HA 6PAXA 1YFHA 2JSCA 3KP7A 1XCVA 4G6DA 3DQVC 3ZMVA 4GYGA 2PI0A 3F8MA 3BOQA 4S04A 4CXFA 2OAZA 3FMSA 3FF5A 4Q5SF 5DUKA 4KIBA 4Y15A 2UXNA 4IVNA 1REPC 2FOKA 5FGMA 5KVRA 2FNPA 1J5YA 3T0YA 1HW1A 3GFJA 3BZ6A 3TO6A 3KZYA 2L54A 2OBPA 2A61A 4YFXF 1G3YA 4L0YB 1P4AA 3G73A 5DDGA 5J8FA 1UFMA 4EM0B 4A6EA 4LG0A 1XMKA 3TOAA 4MEYF 2XKOA 2L3DA 4FHTA 4G7OF 3RYRA 3QU3A 3VEPA 3WTSC 1MDMA 3CO6C 3GO5A 2HEOA 2Z99A 3SXYA 4EVIA 2A69F 1R22A 2R3SA 1BIAA 5HS9A 1XGMA 4KN4X 2QBYA 1L0OC 4M6YA 3QU6A 2QWWA 4CICA 4ETSA 2BYVE 5AIQA 1O3RA 3F23A 3MZYA 1OYYA 2ISZA 4RGSA 3K9TA 4NQWA 1HW5A 3WGGA 4M72A 2ZNZA 2K02A 3H3UA 3QP5A 1JE8A 2WWYA 4KFCA 1I6XA 4CYDA 2PJPA 2FSWA 1B6AA 1W7PA 3BROA 3M1EA 1ZG3A 4JBAA 2Q8KA 3IWFA 2MLGA 4EM1A 3F6OA 2OQGA 1XDUA 3ZMDA 3F21A 2W24A 2ZO4A 1HKQA 4EM2A 4HV5A 4IRHA 2W85A 3LA3A 2MH9A 2VE8A 3ERED 3I58A 3T1BA 1BC7C 1XSDA 1FWZA 5L3FA 2XVCA 3ZN1A 5E1WA 3KCCA 2LDUA 1MJAA 2XAHA 3HRMA 1MJ9A 3IKTA 3FWEA 2M8EA 2VXZA 4M73A 4P55A 2RV8A 5D6EA 5AONA 1R1VA 1YLFA 1OYWA 1FNNA 4HX7A 1YS7A 1K6OA 2JTVA 3LFKA 3WU0A 2EFWA 1BOAA 2V1UA 1FLIA 3MZHA 3RPQA 3FHZA 5FB2A 1FY7A 2A6HF 4LD5A 5ERIA 2HDCA 2IJLA 3DV8A 3NQOA 1T98A 3JW4A 1DUXC 3IWZA 3KP4A 2ESNA 2XGXA 2FU4A 1TBXA 1A04A 2O03A 1P4XA 2E1NA 2NYXA 2HTSA 2HYFA 2GQQA 3JAMZ 1SD4A 4LLNA 4EJOA 5D6FA 2HFHA 4MHGA 3LA7A 3MEXA 3FXUA 3CDHA 2OQRA 3KP5A 3KZZA 5HLHA 2DO7A 4L0ZB 2V6CA 2MD5A 4MQVA 5IT3A 1I1GA 3P9CA 2BBYA 1KYZA 4U7DA 2OZUA 5E8GA 1P92A 1O7FA 1TNTA 3J7AO 2VONA 1BJAA 4PDKA 3F8NA 4AVPA 2VBZA 3LSTA 2QVOA 4L5IA 1W7PB 4YIIA 4P5OA 4WWCA 3KLNA 3F8BA 3WGIA 3J80K 5DUIA 3IRRA 2QBYB 2QUFA 3HYIA 3E97A 4HX8A 4KIFA 1T38A 3TDZC 2CGPA 1HXDA 2O0YA 4OINF 4FT8A 1MD0A 4UV8A 1NHAA 1KU3A 3TKYA 3V8JA 3P7NA 4K2EA 3C18A 3R0JA 3GFMA 1HKSA 3KEQA 3V7SA 2P5KA 1MKMA 3W6KB 4I0BA 4AWXB 5CVJA 2QQAA 4U7BA 3IKVA 3I71A 2ADUA 2XROA 1IUYA 4G94A 3U2RA 3R6SA 1TW2A 1TLHB 2VOOA 5D5UB 2HGCA 2R7DA 3I5UA 2QZ8A 3QRFF 2ACJA 1OKRA 1EH6A 2VOPA 4EJWA 2A68F 5J8CA 4KNYA 4BYYA 4M74A 1SD6A 2VN2A 4BAYA 4YG2F 3COAC 5HLIA 2VT2A 1S7AA 3LAJA 3MQ0A 4ENMA 4G9YA 1FBUA 3TDUC 5H6QA 4N0BA 4A12A 3E6BA 1LDDA 1BIBA 4HA8A 1V3FA 4IRGA 4I98B 1FBSA 3GF2A 2FBIA 2KJCA 5HDNA 3DP7A 4EJTA 1T6SA 1GXQA 1FSHA 1B9NA 4MTEA 3E5QA 1D8JA 1R58A 1O3SA 4RGRA 1KA8A 3C1DA 3REOA 1IN7A 3J81Z 5HLGA 4ON0A 4KA4A 3FZVA 4S05A 2R7FA 1RUNA 2K7LA 4M6XA 3CLOA 1VTNC 2DI3A 1R23A 3ELKA 1QGPA 3QPTA 3FM5A 4R79A 1LDKB 4LGWA 1YG2A 3F6VA 4O5VA 3M8FA 5F1RA 3HTSB 4IPAA 4MTDA 1AWCA 4AIJA 1QNTA 1E17A 2K4JA 1BI3A 1YW9A 2JPCA 4EJVA 1EH8A 1Q1HA 5EEGA 2IT0A 1IXSB 2M30A 2L02A 1SFEA 3TGNA 1J7KA 2DU9A 5FD6A 5CVUA 2RVCA 3TO9A 1GXPA 4M9XA 2HOEA 5DD8A 2DPUA 1MGTA 4DNCA 5D4RA 2IA2A 4OMZA 3WTZA 1USSA 1U5TA 5TJJA 4EGYA 3IL2A 4M9ZA 3SZPA 1YTYA 4BHCA 1Z6TA 1RNLA 2Y0MA 4LK1F 1OR7A 4ASNA 4U0YA 2FBHA 1U8RA 2V1XA 4P96A 1FPQA 3ECOA 3ZMZA 3QAHA 2GAUA 4BXUA 2EWNA 3EYIA 2MC3A 4UV9A 2E1CA 2HYGD 3ZP5A 5D5WB 3BJOA 1LB2A 3CTAA 2EFQA 5AIPA 2YPRA 2KIUA 1P4WA 1IN4A 1DDNA 2STWA 4AIKA 3K1NA 3NRVA 3GWZA 5FFZA 2STTA 5DD4A 1R1TA 2PQ8A 4WF2A 1B9MA 3F8FA 1W5SA 2CFXA 2RQPA 1IAWA 1QO0D 2DFIA 2V79A 5L3GA 3HRUA 4P9UA 3GZ6A 1ON1A 2KRFA 2ZBKA 2J5OA 3KEOA 3E5XA 2VODA 3I59B 1IN5A 3SZTA 4HQEA 3OV8A 4E70A 2EFPA 2Z3YA 4IF4A 2JT1A 3PFIA 1EH7A 2VE9A 2E7XA 4ZYGA 1KQ9A 3EUHA 2ZNYA 1GHCA 4WX9A 3F72A 1QZYA 2OZ6A 1ZN2A 3EQLF 2MLKA 2QM3A 4XBFA 1LDJA 3EDPA 5CLSA 2P6SA 2OD5A 2P8TA 3HSFA 2ISYA 5A2QZ 3DF8A 1J59A 3FXQA 2FEZA 5BPDA 4RAYA 5JHUA 3GZ5A 3MWMA 2H09A 3H3ZA 1FX7A 4UVAA 2FXAA 1UB9A 2XASA 5DCMB 4XLNF 2NNYA 4KUMA 3DPTA 4GO1A 4IJAA 1ULYA 1ZG1A 1YW7A 3ZMTA 4MEXF 2M87A 3WTWC 3RKWA 1O3QA 4KICA 4LLGF 2W84A 1K78B 1YS6A 3RIRA 2QQ9A 2O8XA 1FBQA 1I27A 3SQNA 3V7CA 5LRSA 1AOYA 2EFNA 3HIFA 2GWRA 1W4MA 3FMRA 4L9NA 3ROUA 3I0TA 5ICEA 5L3CA 4LLLA 1GVJA 3V7RA 3LQRA 3LA2A 1KQ0A 3ZQ7A 3RPUA 4A5MA 3LWFA
chains in the Genus database with same CATH superfamily
2QSGX 5E3NA 4O3MA 2W48A 1Y0NA 5L3EA 3RZDJ 4BQQA 1KONA 2F5DA 2UV1A 4RGUA 1XGNA 4XRSA 1N77A 1G3SA 2EH3A 2W00A 1TNSA 4KMUX 2LY9A 4BNCA 2CH0A 3LMMA 3Q3SA 5E1XA 1F5TA 2KQRA 1I50J 3UKGA 4IQ4A 4XLCA 2IS4A 2DQLA 2W57A 4BHPA 2MC4A 1LEAA 4ZZDA 2RDPA 1BA5A 1V5GA 3JTGA 4V19K 3UR3C 1H0MA 1CF7B 4Q48A 1FOWA 4HYEA 2R5YA 3D0SA 3RKYA 1IF1A 3EYYA 1PP8F 1FMWA 2BOLA 2H8WA 1Z1DA 2LRDA 2VKHA 3RDIA 2B0LA 5H20A 2HKXA 1SC7A 1AKHA 3HDDA 1MMGA 3TO7A 4YELA 2LD5A 3OOPA 4NC8A 4D7NA 2BV6A 1VFCA 1WFXA 1XTAA 3S2WA 1U5TC 2X6YA 2DFEA 4N9HA 4N9IA 5HODA 1ACIA 1B1BA 5LRRA 5EYRA 1P2FA 2QQBA 2O7OA 3TMOA 4PGGA 1ZYRF 4EJUA 2LBFB 1K83J 2CUZA 1N78A 2JA6J 2GXGA 5C4JJ 2LNBA 2DK5A 1ONVA 3PQJA 3K7AJ 4Y17A 1BL0A 1X3UA 4HDVA 5KK1A 3OYLA 3H1CA 3V8LA 1ZH5A 4GGGA 2GA1A 2JQ7A 4U88A 4BQAA 4BXXJ 3SFZA 3BWGA 3T8TA 1GV5A 4B8XA 1ZAOA 4KN7X 3AL0C 1U6GA 1V55H 4XSXF 3LOCA 2LR8A 3DPUA 1QVTA 1IXRC 2CUJA 2DJNA 2BY0A 3P9IA 1KU9A 4QWQA 1HW2A 2LF8A 1PJRA 4AM3A 4ESFA 3ABTA 1U78A 2Y75A 2PEXA 2FD5A 3N05A 1JUPA 3JSPA 4HQMA 1E2XA 1ODDA 1HSJA 4F91B 1DQUA 2B7EA 1U2WA 3WODF 2R7OA 2B9SA 2BGCA 3PQKA 2CUEA 3ABMH 3BG5A 1FSEA 4HG2A 2P6TA 1DGWY 2VPRA 4CDGA 2XIGA 2WB1A 4HDUA 4NQWB 4W1UA 3GX4X 3W2AA 3SDBA 4XM3A 1FT9A 2PBIA 4LMYA 1NK2P 1MBEA 2L4AA 3AG3H 4MLOA 5EEHA 3OYJA 3CCYA 1JGGA 2KFDA 4XN0A 1ZHFA 1OQYA 1KZHA 1ZRDA 3M3YJ 4N4OB 3BJAA 1QPMA 1QRYA 5FJ8J 1SFOJ 1VF9A 1WJCA 2JA2A 2CWEA 3K4BA 2DA1A 1G2HA 4I09A 1R00A 4DBQA 4AU7A 4CO8A 5HS7A 3ZQGA 1Z3XA 2ZFWA 3BC8A 1MMDA 5DEQA 1BM9A 2H6BA 1UHMA 4LG3A 3QPSA 1Y56A 4ZTJA 1FOXA 2COMA 4M9SA 4F93B 5LEJA 2XSJC 2A07F 4WK8F 1ZGWA 4M3EA 4MNUA 3ABLH 2EV5A 4JP0A 1FYMA 1X58A 1IZ1A 2Q1ZB 1XSXA 3L9FA 5LBQA 3HUGB 1TWAJ 3F0CA 3CMEI 3G3ZA 2CQXA 3JRBA 1KQ8A 4HNVA 2OA4A 3AG1H 4PCQA 2L7MP 1WHUA 3ZCOA 5FLXK 3J7AY 4IEJA 2PJRA 4Y7NJ 3WTUC 3ZRGA 1B8IA 2OU2A 3ZOBA 2WC2A 2ZSHB 2UWMA 3FHNA 4KITB 4ZTFA 2EA2A 1QZZA 5LEKA 2YR2A 2CSOA 3J7ZI 1WJDA 2CRGA 3O3KA 1TT5B 1FYLA 1UCRA 2RQQA 1X2MA 2L7KA 2A3SA 4DJAA 3LSRA 3DLLF 2P5LC 2IAIA 1I1SA 4UVCA 4ZYDA 2F4IA 5E79C 1H9TA 3OYKA 2XV4S 2K9MA 2V9PA 1VQ9I 3ASNH 3KP3A 1MZBA 3HOYJ 1S7OA 2WY8Q 3A2KA 4BBSJ 5E8IA 2RN7A 5HS8A 3HKZN 2P7CB 2F2EA 3O2PE 4A2UA 2DXIA 3GFLA 3K1MA 2JUGA 5IYBJ 2H6CA 2XSDC 2L01A 4BEHA 2BVMA 4ZDOA 1MJBA 2DOFA 2RAEA 1XD7A 1SD5A 2L9VA 4ESBA 3OS1A 1LVKA 4E7ZA 3RTRA 2G7HA 4ITVA 1X1CA 2JRMA 2O3FA 3RCOA 1JUMA 3MKLA 5EZGA 3I64A 4EMSA 3VSLA 5FKNA 3JRIA 5FLVA 2AHQA 1IRGA 2VI6A 2PMUA 2UZKA 3CUQC 3QPLA 4HEA2 3V42A 4DW6A 3FBNB 4I2OA 1UHWA 3OIQA 3PUFA 3OYAA 3IV5A 3L2QA 5DS9A 4E7JA 2ZXJA 2M45A 1ZK8A 3BY6A 2K9QA 3BR5A 5L3BA 3PL8A 1SFUA 2P7VB 4FASD 1VQPI 3BP8A 1VQLI 3JAMK 4FQGA 2FE3A 1CGPA 3ZQCA 3LL7A 5B66C 3H3VK 4FX0A 4UXNA 2W82A 2EINH 5BNGA 3RPUD 3P9KA 3HTUA 1IN8A 5JI6A 5CPRB 3WTTC 5DYMA 5ICFA 3ZMUA 1UZCA 1BR1A 3B73A 4CCNA 2HOAA 2HQNA 4PGHA 2X4HA 3QOPA 1WI9A 4BDYA 1ETWA 1VQ5I 1FP1D 3HOVJ 1LEBA 1TW3A 3FX3A 1TWFJ 2HS5A 1Z6RA 1E3OC 1KGSA 4HNUA 1H9GA 3AFHA 2YUSA 2KMUA 3GTKJ 4C3JJ 4L18B 1FTTA 2XAJA 4L9JA 2VC0A 3IH2A 4MQ9F 1RUOA 4IHVA 3RQIA 4HLXA 1OCCH 2GIVA 2F48A 4CA0A 2R5YB 4UHTA 4KDPA 3K0LA 3MCZA 2KIFA 5J3LA 4I0AA 1T33A 1WGXA 4AYBN 1AHDP 2IW5A 4RB0A 2KP6A 2RNGA 1SMYF 2CQNA 3HL2A 1QPIA 4C2TA 4CCJA 3KZIC 1S8NA 2VKEA 3G1OA 2JK3A 2D1VA 4PSWA 2NVTJ 2ZJ2A 1TQIA 3H35A 1Q1VA 1VZ0A 5HVQC 2QA4I 3GTJJ 1ZRCA 4IHWA 1A5JA 3VB2A 1I3AA 5BQTA 2PMZN 4BE1A 2NS0A 5TRDA 2WV0A 1ZREA 1APLC 2H8RA 3EETA 1Z21A 2GOXB 2VL8A 3LSMA 4A0YA 5LD2C 3CUQA 1BN5A 3LQQA 1DP7P 2ZMEA 1HA8A 1S6LA 3OIPA 1LE8B 2FQ4A 1VQ8I 2W25A 2Z16A 5IOZA 2LSOA 1R5HA 3S1RJ 3BR3A 2AQFA 4BE2A 2A05A 2CS3A 3GBGA 4LG0B 1PP7U 5FKLA 2XRLA 4WXCA 1G3WA 4EGZA 1T2KA 2IP2A 2F6CA 5GAEJ 3OMYA 2Z5UA 3JTHA 5LFAA 2FJ1A 3S32A 1DU6A 4KT5C 1MBKA 1J75A 3PNYA 4QPOA 4WXDA 5HNFA 4ZJZA 2CO5A 4BACA 4XOTA 1IO2A 2DYSH 4DIQA 3R4KA 4CHUA 3V4GA 5L3DA 2R5ZB 1R6RA 1XGOA 1F43A 1RKWA 3FM3A 3O6BB 2FQ3A 2LTPA 4A5NA 4LB6B 5CVIA 4D7MA 1BW6A 1JT0A 1E3PA 1HKTA 3BR0A 3HB9A 3KPHA 3VODA 2DTRA 3RKQA 2O6GE 2IVMA 4KT6A 3GEZA 3K4JA 2X0LA 4AC0A 3B02A 4ABZA 1G6NA 2XAGA 2KIQA 1IV8A 1FZPB 5H2FC 3DBRB 4XRFA 3H0DA 1Y1VJ 2V9VA 4E7HA 4YFNF 1YIJI 2WAQN 1HQCA 1UG2A 4IX7A 1YX5A 1SMTA 1XGSA 1YW8A 3FXRA 1Y8RB 1I5ZA 3VDXA 1E3HA 3U21A 3HOZJ 1R1UA 1Z7UA 3A03A 1IG7A 2DODA 2GXBA 2DLLA 4OAZA 3F9KA 2GOMA 2LKPA 3Q0UA 3I4NJ 2EBIA 3IHUA 4QLCU 4HW0A 2KIMA 1YO5C 3BG6A 3M07A 1J9IA 3R61A 2HKOA 4PK4A 3MKWB 2R7ZJ 4BJTA 2GA2A 3J81K 2KJBA 2E7WA 3H5RA 3FK7A 1PUEE 2PMZA 2WTEA 2CV2A 4HAMA 1PDNC 1NK3P 1OJLA 4ENJA 4BDZA 2XKPA 4CZZA 4NNJA 4DBRA 5EDNA 1JHHA 5D8LB 1BC8C 3N97A 2DA3A 2VB6A 4OIRF 5LHHA 1D1CA 1FC3A 2FX0A 3FISA 2OTJI 1XN7A 4RM3A 2RREA 5F6FA 2NRAC 1H8AC 4XL9A 2WBMA 1ETXA 3MAJA 4RMNA 1LE8A 3CP8A 4GXOA 3SZGA 3ECHA 3CUQB 5E20A 1IGNA 2CV1A 4D9JA 2KDZA 2R7VA 2ZKZA 3TW7A 1RESA 3GVAA 2HOTA 2JJ7A 4IHSA 1VQ6I 1MNEA 4BEHB 5JVTA 4OIQF 3IAM2 1R36A 3TOBA 2HDWA 2CFOA 4G7HF 3GCMA 3CO7C 1I3QJ 3LAPA 2W7NA 3BTCA 5CQEA 5E1ZB 1ZELA 3RQ4A 4CGZA 2XUBA 1S5LC 3BJ6A 3I9V2 3KE2A 3OIOA 4JX5A 4HLYA 2F4MB 1F4KA 2HWVA 3ZXSA 4I76A 4LIUA 2VPLA 2OJED 4IL6C 4XSZF 1IC8A 4JK1X 5E3OA 1EKEA 3S8PA 4RGXA 1TT0A 4M71A 4BY7J 4XQFA 4ZYEA 4HOBA 1SD7A 2QENA 3GTMJ 3RKXA 2L2OA 2CV0A 2JPBA 3D1NI 2EV6A 1LQ1A 2CUFA 1X3WB 4R1HA 4A3DJ 2ZMEC 2HOSA 1RC9A 2EZIA 5ILUA 2HVRA 3S14J 2VJIA 2HTJA 2MA3A 2BVLA 4U0VA 1O57A 2UXXA 4HSRA 2M5WA 1R9TJ 2LOOA 4NUBA 4I7HA 1T95A 2ZMEB 4WCGA 3OS0A 3VOEA 3A0HC 3E6MA 2DN0A 1PUFA 1TQMA 2EQRA 1YI2I 4UVBA 3BTLA 2ZSIB 2M4GA 2CG4A 1U3EM 3KEYA 3FXJA 4ZYAA 3JRFA 4Z6YA 4HSTA 2FMLA 3C3WA 5ILSA 3U1DA 3GTPJ 3W6VA 4B09A 2QKLB 4HF1A 5HNHA 3A1YA 4P9FA 3KX2A 1W0UA 1FOKA 2K3FA 2L9NA 4NHJA 4PSXA 2O61A 2KRHA 4UUSB 4ENKA 2ETHA 5HOOA 2EA4A 4YIFA 3ZPLA 4AD9A 1V4RA 4AIDA 1R71A 1MH4A 3WG9A 2WAEA 3BZKA 3Q9SA 3LSPA 2VJJA 1B4AA 3WTXC 1K7AA 2XAQA 2RKHA 4GCVA 2PLYA 4BY1J 2R93J 5D5XB 2ELKA 3T8RA 3BPXA 5K5RA 4CCOA 4A0ZA 1I6HJ 2HQAA 2AO9A 3ULQB 3GYHX 3FXMA 5C4XJ 3WTVC 3E6CC 4NDLA 3QP6A 3S16J 1ZG5A 1ETKA 3HBLA 4EQQA 1MBHA 2CW8A 3CD6I 2LF7A 3WHBA 4D1QA 4DYRA 1A35A 2M0MA 4LFUA 1IV6A 2QLZA 5IY5H 1ZLKA 1EF4A 5DCFA 1WH5A 2ME0A 4ANJA 2D45A 1T0FA 5GTIC 5EGOA 1XMAA 5FRMA 5CJ9A 3EUKL 4OAYA 5K5OA 1STZA 2R7RA 4G6TB 1XB4A 2OPTA 4LJZF 1ON2A 5K5QA 3DKXA 3WG7H 3PO3J 3CCEI 5J6XA 2VBWA 2VJ4A 2V26A 2P4WA 2DT7B 2Z2SB 1XCBA 4PZJA 1Y0UA 2F5FA 3IP4B 2XGEA 1JKOC 1K6YA 2RC4A 2VC1A 4L5JA 2HVSA 3CF2A 1F1ZA 3I3LA 3BTIA 3R0AA 1YJNI 9ANTA 4PFPA 4Q47A 2HZTA 3KLOA 3OYMA 2IA0A 4G12A 4IHYA 1SFXA 5E3LA 2XGDA 2XRNA 2DT5A 4II3A 2ZCWA 1D8KA 2YX7A 3KYCB 5KAFC 5LGUA 2JVGA 2EIMH 3CESA 4HZFA 4ESJA 2VBXA 4KMFA 1ETQA 3QPHA 2JMWA 3BR2A 3NWTA 2L7FP 2WA0A 4RDUA 1QZEA 2AXLA 3Q9VA 3HRTA 3CJRB 1A31A 1IRFA 2VLAA 2Y30A 2K9SA 2QF7A 1VQ4I 3HZJA 1R4NB 5HDKA 2EIKH 5HDGA 1MMAA 1IN6A 1S9HA 1TWGJ 2CYYA 2XAFA 2V9KA 2DTZA 2NS7A 5D4SA 1MSEC 2IA1A 4B48A 2G7UA 3JSOA 4H0EA 1L3LA 4UUVA 3DFGA 1GDTA 4D5CA 1J2XA 1TZLA 4MFEA 2XF7A 3L2CA 2A5WA 3FMQA 1Z9CA 4HBLA 2RNJA 1ZGJA 4HV6A 2H1LA 4XLHA 2G9WA 2TRTA 2O8KA 2HXOA 3F3XA 4CZCA 5J40A 2GM4A 1S72I 3PJRA 5BS6A 1QQIA 3K1PA 2R7UA 2Q0OA 1W1WE 1OR7C 2GZWA 2ZFUA 4UB6C 2P0WA 5FO5A 1XMXA 3H9QA 3RJPA 2AS5F 3IH3A 2PMHA 3I4PA 3GTGJ 1A6QA 3CZ6A 3WTYC 2EPFA 3M8EA 1Y8QB 2VBYA 4A3MJ 3BQYA 4DZPA 3MKZA 1B72A 4TV7A 4IQJA 4BUPA 3GTLJ 4I6ZA 1HCRA 2M1BA 2XPVA 2NXNB 1IXCA 1VNDA 5D8KB 2Z9OA 4F92B 2A6EF 2GXAA 1WQ2A 3CLQA 3JRGA 3P5JA 1OPCA 3G71I 2KHMA 4PJMA 3GFIA 3I53A 2A6TA 1GUUA 3WU2C 2DBBA 1RI7A 3LSGA 4OOIA 3DEUA 3CCLI 3DKYA 1BR2A 3X2QH 3ML6A 2EB7A 3E5UA 3J80Z 1WJ5A 3CJNA 1ENHA 3TQNA 1EJ9A 1U8BA 4XLPF 3IC7A 4RB2C 3EPZA 1S3JA 3DWLE 3K6GA 4ZH4F 2KKOA 4M3FA 1KU7A 3WHCA 2DMTA 1JHFA 2EK5A 2MG4A 3HOXJ 3HRSA 1V54H 1MMNA 4XRSG 2X6XA 3H9GA 2JZYA 3L00A 3U1KA 1NG7A 4ZDLA 4F7ZA 2NOGA 4GFBA 3QWLA 4JQFA 2P5VA 3OSGA 2E1MB 2HXIA 2JN6A 2YX4A 3Q0WA 3WE2A 2DA7A 3HEFA 3GUDA 2IGKA 5IOYA 4DQ2A 3U9GA 5EEAA 1G4DA 4ZYHA 1YHQI 2IRFG 5FRNA 5J4VA 2VIXA 4F52A 1E0EA 1LFPA 1TQPA 2ECBA 4Y3OA 3L2WA 2K40A 5LGNA 1BBYA 1ZLJA 2L7ZA 4JYKA 2Y9ZA 3ERMA 2E5ZA 1ZGAA 1IDZA 4A0XA 2HYJA 2LK2A 2M34A 5F64A 4HF2A 3GW2A 1WKMA 1D3YA 1W5CC 2F5EA 1ZTRA 4B4CA 1KYWA 1ETYA 1JKQC 2V1DA 3BT9A 3I59A 3K2AA 3VFZA 2DW4A 4O6JA 3HGYA 4Y52J 2DPDA 3S1MJ 3HPHA 5A2QK 4XMYA 1S29A 5DCMA 2LBFA 3I56I 4OMYA 5M5WJ 3K4MA 3OR2C 4BKXA 3ZMSA 3K70D 5EZHA 1SEUA 2FF4A 4BL0B 5LHGA 1LKXA 4YFKF 3A4CA 4UY8I 4YEJA 3L09A 2ZXWH 5TISC 2FMYA 2Z33A 2HI3A 5IP6A 1FP2A 4B44A 2OCEA 3BCAA 2EFOA 3E3VA 3ZGKA 2XAUA 5LLQA 5EJCA 3CC4I 4J19A 2KDOA 2DAOA 1OCOH 3N4MA 4RB1A 3MD2A 3E6DA 5DV5A 1UG0A 4I02A 4BGDA 1CF7A 2DMNA 5BOXA 1YX3A 2EZKA 1HSTA 4RAZA 1D0XA 4C3HJ 5IYDJ 1R7JA 1D0YA 2Q2EA 3PUBA 1ERDA 4D0PA 5EG0B 2FA5A 3RI4A 5B3SH 2HNHA 5K7FA 3AG2H 1LNWA 2MFZA 2HR3A 3M7GA 5D5VB 1C0WA 4OIOF 1R5GA 4PFOA 4XICA 3LSJA 3ZR8X 2M7AA 4IOCF 1HBXG 5ED4A 5BMZA 2FBKA 1YQAA 2KPMA 3G1MA 4RS8A 1WPKA 2I5UA 1K79A 5IP9J 3R60A 4RLQA 2IPQX 2X6OA 1W5TA 2E2HJ 1ITYA 3QYEA 4MGRA 3L1PA 3PM1A 3FBIB 5FLXZ 4LIVA 5KHDA 3DU5A 2KZVA 1QHGA 2QKMB 3BDDA 1NH3A 1SAUA 3V8KA 1FIAA 5M3MJ 3OYGA 4FX4A 3ISPA 2CQKA 2D2WA 4B3AA 2EJRA 3A0BC 1F9NA 3KP2A 4IHXA 4XR6A 3JREA 2DYRH 4Z2YA 2HU9A 3DTEA 2FNAA 1QBJA 3HOTA 2K9LA 1JXSA 3T5XA 3H92A 4ZZLA 2YSRA 1JTYA 4R8HA 2J5PA 3E0JB 4OU0A 3HHHA 3NEUA 3F22A 1QHHD 3MVPA 5F1JA 3WU1B 3SHFA 3GXOA 2H1KA 3HPGA 1YYVA 1ZRFA 3IRQA 1MDMB 1D5VA 4MIMA 4AIHA 2MH2A 2XF5A 3DCFA 2C6YA 3ABUA 1GT0C 2X85A 3OYIA 4E7IA 3S2HJ 2ESHA 2V1NA 5DM7F 4NB5A 2K27A 2E71A 3QODA 4XN3A 4UNOA 3PNVA 5IT9K 5FKOA 3DPLC 5JFRA 1BI0A 2L4MA 2Y48A 2XPWA 3CJQB 2BHZA 2FRHA 2L0KA 2DDBA 2XDVA 4G8XA 4XK4A 2QEXI 3PNTA 4M3DA 1Z91A 3W6JB 1TWCJ 4Q4ZF 4Y4RA 1KU2A 5GTHC 3CUOA 4M3BA 2YU3A 1W36D 4HF0A 3S3NA 2HDDA 1D1BA 1XSVA 2K9NA 1HOMA 3TL4X 3PSFA 1B59A 3E1SA 4BS9A 1O3TA 4BHBA 1Z77A 5B1AH 4LK0F 3QYBA 1LJ9A 2EILH 3W2WA 4M6VA 1JKPC 1N25A 3RYPA 5LGTA 4GYIA 3BPVA 3SEQA 5K7ZA 1XDSA 4UUSA 4W97A 1UAAA 1O7LA 2H94A 1WSUA 5F0CA 2BY1A 2CQ7A 2VJ5A 2LG4A 4UB8C 2BXYA 1YJWI 2BY2A 2HQRA 4DYQA 2LP0A 2DK8A 3HSEA 4CYCA 3M9AA 2NNNA 3O8HA 2M8GX 2TDXA 1MSFC 2A5YB 4X6AJ 2K3PA 2Y69H 2M2EA 2DQRA 2LC2A 5LHIA 2M0CA 2CW0F 1FYKA 4J00A 5C44J 3HUGA 4I01A 3DXJF 5H6RA 1JGSA 1DPRA 3AAFA 3ZQFA 1EV7A 5JHFA 2IS2A 1HLVA 1OMIA 3FXKA 2WAQA 5J4YA 2H27A 2X1EA 2BW3A 1DU0A 2W4SA 3H36A 1XC5A 5CVRA 2RGVA 2HPMA 3WE3A 4V2FA 4BQOA 1MH3A 4BH9A 1K78A 3Q5FA 1FEXA 3ZN0A 3K69A 2MBFA 3PIOF 2QYOA 3HG9A 4IO9F 2ELJA 4IXAA 1RIOH 1P6RA 4IRIA 4ENNA 4XKBA 4G6QA 4OIPF 2HVQA 3HOUJ 2QCOA 1LUJB 3VYTB 4E4HA 3HHGA 1U5TB 1X1DA 3HSRA 1OCTC 2IS1A 4KYWA 2YU9J 2ELHA 4E7KA 5ICCA 2LMDA 3K2ZA 1DPUA 1U0JA 1WRJA 1BI1A 3I54A 1R49A 1YIOA 4PJ0C 2K85A 4HX4A 3CCUI 4U0WA 2XHKA 4L9VA 3CCSI 2K86A 5E18F 5K1YA 1TP4A 2BE5F 2PG4A 5E17F 3RZOJ 1Y1WJ 2NVYJ 1IW7F 3MFKA 1CQTA 1TTYA 5F0FA 1X3ZB 2DA2A 3L7WA 1B8IB 2PN6A 5FFXA 1A36A 3KFWX 5F04A 4EV0A 5FD5A 2MGQA 5ICGA 1X1AA 3SEZA 4FCYA 4LB5A 3GLXA 4RB3C 3K4CA 1SAXA 2NAZA 3M1CA 2K5CA 1LVAA 2DDAA 3MN2A 3C7JA 4A6DA 3DKWA 3HC7A 2L9SA 4KIGA 5J1RA 4L9TA 2PFBA 4IHTA 2EV0A 2K4BA 2CW7A 4WXHA 2ECCA 1OYIA 3KP6A 4RA2A 3CMAI 2F5CA 3G2BA 2KZGA 2JSPA 1J09A 1ZARA 5GAHJ 4G7ZF 2BEOA 4M3GA 2Y9YA 3KETA 2VT3A 5CVVA 1W7PD 1WWXA 1Z05A 2V7FA 1SFKA 1SVMA 5BPIA 4IKFA 1RZ4A 1PUFB 1J0RA 5M5XJ 2JRTA 1EA3A 5J47A 2M7BA 3GTOJ 4Y13A 3D5LA 1Y6IA 3OYBA 3CMYA 1G3TA 3SFIA 3CMMA 5IT9Z 5CYVA 2FUG2 3F8CA 2VQGA 4JOMA 3A01A 3HOSA 5ILVA 1BI2A 4FE7A 1USTA 1T39A 3WGHA 5JR3A 2D1HA 6PAXA 1YFHA 2JSCA 2DMPA 3KP7A 2LYCA 1XCVA 4G6DA 3DQVC 2MABA 3ZMVA 4GYGA 2PI0A 3F8MA 3BOQA 4S04A 3Q0VA 4CXFA 2OAZA 2MYSA 3FMSA 1G8XA 3OOUA 2CQQA 2XC7A 1ZR2A 4P1WA 2XB5A 3FF5A 4Q5SF 5DUKA 4KIBA 4Y15A 4B3XA 2UXNA 3CCMI 1YITI 2DOAA 2ZXHA 4IVNA 1H89C 1REPC 2FOKA 5FGMA 3SYTA 5KVRA 2FNPA 1J5YA 3T0YA 1VQMI 1HW1A 3S1QJ 1T8IA 3GFJA 3BZ6A 3TO6A 3KZYA 1W0TA 2L54A 2OBPA 2A61A 1YE9A 4YFXF 1G3YA 4A3LJ 2IEKA 1TL8A 4L0YB 1P4AA 2L9RA 1JT6A 4L5EA 1FOYA 3G73A 5DDGA 5J8FA 2R92J 1UFMA 2PJRB 5HLTA 3EUHC 4YIRX 4EM0B 4BXFA 4A6EA 4LG0A 1HDDC 1XMKA 3TOAA 4MEYF 2XKOA 2L3DA 4FHTA 2OTLI 4G7OF 2IXSA 3RYRA 1MBFA 2D5VA 3QU3A 3CDIA 3VEPA 3WTSC 1MDMA 4XKCA 3CO6C 3GO5A 4CUGA 2KT0A 3CF5F 2G0EA 2E35A 2ZC2A 2HEOA 3LFUA 5DM6F 2Z99A 3SXYA 5GP9A 1X4PA 1NTCA 2KRCA 4BBRJ 4EVIA 2A69F 1R22A 3ZQIA 1WJFA 3K10A 4RLFA 1IUFA 1ETOA 2R3SA 1VQKI 3M8JA 1BIAA 2TCTA 1YJ9I 5HS9A 1SVOA 1XGMA 2F4OB 2F5VA 4KN4X 2OV7A 4II2A 2QBYA 1L0OC 4M6YA 3QU6A 1UMQA 4HRIA 2QWWA 4CICA 4YRVA 5FLMJ 4ETSA 2ZJPF 2BYVE 1GV2A 4CSWA 5AIQA 2VUMJ 3BQZA 3FKIJ 2HQ5A 4XKVA 1O3RA 1A6IA 3F23A 1FTZA 2R0QC 3MZYA 3DLAA 1X1PA 4DOZA 3S15J 3D5RC 1OYYA 1X4OA 4NBQA 2ISZA 4RGSA 3K9TA 4E6KG 3FXLA 4NQWA 1HW5A 1UHSA 3WGGA 3DTIA 1IRXA 3H5AA 3CC2I 1IDYA 2ME6A 3JR9A 3NARA 4M72A 1U9OA 2ZNZA 2K02A 3L2VA 3H3UA 3QP5A 2IGOA 1JE8A 2WWYA 1XX5A 4KFCA 1OISA 4RAFA 1I6XA 4CYDA 2R7XA 5KNLA 2PJPA 2Q2EB 2FSWA 1D0ZA 1B6AA 1W7PA 3BROA 3M1EA 4CCLA 1ZG3A 1SVLA 2X1CA 1UELB 4PJJA 4JBAA 4A3IJ 1RETA 3IWFA 2MLGA 2Q8KA 2R5ZA 2FOWA 1G59A 5M3FJ 1BW5A 4EM1A 3GZNB 5F08A 3F6OA 2OQGA 5E3MA 1HF0A 1XDUA 2ZJRF 2MW8A 1QA6A 2E5NA 5KAIC 3ZMDA 3F21A 1ZR4A 2W24A 1JI8A 2ZO4A 4XNFA 1HKQA 4EM2A 4HV5A 1DGRM 5KCMA 4IRHA 2KL4A 1MMSA 2W85A 4H4KC 4NC7A 3LA3A 2MH9A 3ASOH 3DU6A 2VE8A 3ERED 3I58A 3T1BA 1BC7C 1XSDA 1O4XA 4AYBA 5GAGJ 4A3KJ 4A3BJ 2LREA 1FWZA 5L3FA 2MD0A 4PJLA 2XVCA 3SJMA 3S17J 3ZN1A 3I4MJ 2LKSA 4XORA 5E1WA 3KCCA 2Y2ZA 2LDUA 1MJAA 2XAHA 1D1AA 3DEEA 1JJ8C 3CCJI 1WZ2A 2GBYA 3HRMA 1MJ9A 3K4LA 3ZQQA 2V4JC 3IKTA 2R7TA 3OWTA 3FWEA 2M8EA 2E60A 2VXZA 2NVQJ 3B6AA 4X0GA 4M73A 4P55A 2RV8A 5D6EA 4D5FA 5GADJ 2AQEA 5AONA 4F3QA 1R1VA 1YLFA 1OYWA 3IAS2 1FNNA 4HX7A 1JJ6C 3KIOA 4DYCA 3C2HA 1YS7A 1K6OA 4J01A 4C2UA 2KLOA 2JTVA 3LFKA 3LSIA 4Y33A 3WU0A 2EFWA 1BOAA 2V1UA 1FLIA 3MZHA 3RPQA 3FHZA 5FB2A 4XIDA 2DA5A 1FY7A 3ONQA 2A6HF 4E7SA 4LD5A 5ERIA 2HDCA 4QSHA 1M1EB 2IJLA 3K4NA 3DV8A 2BHYA 3NQOA 1T98A 3JW4A 1RR7A 1U9NA 2GIZA 2AXTC 4I99C 1VQOI 1DUXC 3QQAA 3IWZA 3KP4A 2ESNA 3TP3A 2XGXA 2FU4A 3OYNA 3I55I 1TBXA 4C2MJ 1A04A 4ZC3A 2O03A 3OYFA 3GTQJ 4ZDPA 1OLTA 2I8DA 1P4XA 2E1NA 1Z7LA 2NYXA 2HTSA 2HYFA 4QIWN 3RSNA 2GQQA 2DFHA 3JAMZ 5JLXA 1SD4A 4LLNA 4EJOA 5D6FA 2HFHA 4MHGA 3LA7A 3KYLA 2BW3B 3CDLA 3JRDA 2Z1DA 3MEXA 3FXUA 3CDHA 2OQRA 3KP5A 3KZZA 5HLHA 1DP3A 2DO7A 1T56A 1YOVB 4L0ZB 2V6CA 2MD5A 2ZB9A 4MQVA 3DBHB 1SANA 1XS9A 5C3EJ 5IT3A 2R7SA 1I1GA 1Z67A 2R7QA 2BBYA 1KYZA 3P9CA 2DA6A 4U7DA 1V5EA 2OZUA 1WH7A 1T0FC 5E8GA 3BG9A 1R5ID 1P92A 1O7FA 2X48A 4FETA 1TNTA 3J7AO 2VONA 1BJAA 2E36A 4PDKA 3F8NA 1Y39A 3ZQLA 4AVPA 2JWTA 2VBZA 3TP0A 3LSTA 3CCVI 1VI0A 2QVOA 4C30A 4L5IA 3S2DJ 4BJ6C 1W7PB 4YIIA 4P5OA 2NVXJ 4WWCA 3KLNA 3F8BA 3WGIA 3J80K 3NAUA 5DUIA 3IRRA 2QBYB 2ZXIA 3FK6A 3VYUB 2QUFA 1RKTA 3E97A 3HYIA 4HX8A 3BG3A 4HPQA 4HNTA 3G4SI 1K4SA 2WAFA 2W1OA 4KIFA 2KISA 4JX6A 2WV1A 1T38A 3TDZC 1VQNI 4BQNA 2CGPA 1HXDA 3FIWA 2DOEA 1JTXA 2O0YA 4OINF 4FT8A 1MD0A 4UV8A 3VYRB 1NHAA 4X1EA 4B43A 2JVHA 3K70C 1KU3A 3TKYA 1D5YA 1GVDA 3V8JA 2ID6A 3P7NA 3A02A 4K2EA 3C18A 3R0JA 1ORKA 3OS2A 1Z3YA 3TBIA 1B72B 3GFMA 1HKSA 5IPAA 3KEQA 3BLYA 2JA8J 1K61A 3OL3A 4IZZA 3V7SA 4EEFG 4CCKA 1N75A 4JX4A 1MBGA 2P5KA 1MKMA 3OY9A 3W6KB 2IS6A 4I0BA 2VQHA 4AWXB 2VQCA 3S93A 5CVJA 2QQAA 4CYCB 4U7BA 3IKVA 3I71A 2ADUA 2XROA 1IUYA 4G94A 3U2RA 3R6SA 1TW2A 1TLHB 1IJWC 2VOOA 5D5UB 2HGCA 2R7DA 3I5UA 2M4KA 2QZ8A 2R7WA 3QRFF 2ACJA 2DT6A 4QPQA 1OKRA 3OSFA 2O9LA 1EH6A 2VOPA 3TW6A 4EJWA 2A68F 1LFBA 3G1LA 4BU2A 1OCPA 3H9JA 4A69C 3E7LA 5J8CA 4KNYA 2BZTA 2OC6A 4BYYA 4M74A 4FTHA 2EZHA 1JKRC 1QU3A 1SD6A 2VN2A 1OCRH 4BAYA 4YG2F 3COAC 5HLIA 3TEDA 2VT2A 1S7AA 1K4TA 3LAJA 3MQ0A 4ENMA 3M4OJ 4G9YA 5B5EC 1FBUA 3TDUC 5H6QA 5EF6A 5TGTA 2N8GA 3H5NA 2QGUA 4N0BA 4A12A 1HC8A 3E6BA 1LDDA 1BIBA 2WB1N 1V3FA 4HA8A 2XPUA 4IRGA 4I98B 1FBSA 3LNQA 1MIJA 3VWBA 2LKXA 3GF2A 2FBIA 3D5SC 1JUSA 1TC3C 4B1RA 2KJCA 5HDNA 3DP7A 4AVZA 4GDFA 1I39A 3HJEA 1T6SA 4EJTA 1GXQA 3QYFA 3BZCA 1FSHA 3DEWA 3SDGA 1B9NA 4MTEA 2LY1A 2E2JJ 3S3MA 4NC6A 5CKTA 2BXZA 3E5QA 5F27A 5GPAA 1D8JA 2DJIA 1R58A 1O3SA 2CMPA 4LITA 4RGRA 1FJLA 1KA8A 3C1DA 3REOA 1X1BA 2UUZA 1IN7A 4XKWA 2E34A 2Y31A 3AKZA 5JVGF 3J81Z 5HLGA 2V6EA 1S7EA 4ON0A 3L2RA 4KA4A 4BE0A 3FZVA 2X51A 4S05A 2R7FA 3MKYB 1LPQA 1RUNA 2K7LA 1BR4A 4M6XA 5K7HA 3CLOA 1VTNC 3MZ8A 2CJJA 2DI3A 1NG6A 3FXOA 2VASA 1R23A 3ELKA 2VKDA 2X9DA 1W36C 1QGPA 2DMUA 3QPTA 3BCBA 2OUMA 3FM5A 4R79A 2HZDA 1VQ7I 1LDKB 3JRAA 1WVRA 4LGWA 1X2NA 1MNDA 1YG2A 1ZKGA 1OCZH 2WADA 3F6VA 4O5VA 3C2BA 3M8FA 2ZJQF 5F1RA 5IYCJ 5FKMA 3HTSB 3HXLA 4IPAA 4MTDA 3OYEA 1AWCA 2EIJH 4AIJA 3BR1A 1QNTA 1E17A 2K4JA 1BI3A 1YW9A 2R4GA 2JPCA 2QSFX 3CJTB 2E1MC 4EJVA 4PJNA 2DFFA 2LVSA 2Y0SN 3HKZA 1EH8A 1Q1HA 5EEGA 5EGOB 1GLNA 4XOPA 3CCRI 3DBLB 5JLWA 3IUOA 1YRNA 2IT0A 4RM2A 3HOWJ 1PVEA 1IXSB 2M30A 3O8GA 1WJEA 2L02A 1P9QC 1SFEA 3TGNA 2CU7A 1J7KA 3HGGA 1AU7A 2WY7Q 2M3AA 2DU9A 5FD6A 3FKJA 5CVUA 3OYHA 3A01B 2PX9A 1R4MB 2RVCA 4C3IJ 3TO9A 1GXPA 4M9XA 2HOEA 2ID3A 3KYDB 5DD8A 3S3OA 1MGTA 2DPUA 2COBA 3GMEA 1X19A 4DNCA 2QQ8A 4MO7A 1OFCX 3BTJA 5D4RA 2IA2A 5DTDA 3OYDA 5CQGA 4OMZA 4XLFA 3WTZA 1USSA 1U5TA 5TJJA 4EGYA 1P7JA 3IL2A 4KJZA 4M9ZA 1TWHJ 3HM5A 3H0GJ 3W2VA 2XGCA 4OWRB 4A93J 3ZQHA 2X6WA 3SZPA 2E1OA 1YTYA 4BHCA 5FKKA 1WI3A 1RNLA 1Z6TA 2Y0MA 4LK1F 1OR7A 4ASNA 4U0YA 2FBHA 3PSIA 3PIPF 5J1UA 1U8RA 2V1XA 3J7YJ 1H88C 2IGNA 4P96A 1FPQA 1Z0XA 1AA7A 3ECOA 3ZMZA 2NOJB 4QTRA 3QAHA 4U87A 2GAUA 4BXUA 2QSHX 2EWNA 3EYIA 2MC3A 4UV9A 3L2UA 2E1CA 2HYGD 2IGMA 1AKHB 3ZP5A 5D5WB 1WJBA 3BJOA 3ABKH 1LB2A 3CCQI 3IH4A 3CTAA 2EFQA 5AIPA 2DMQA 1FIPA 2YPRA 3VPRA 4IOAF 3JCUC 3CC7I 2KIUA 3OL4A 1P4WA 1IN4A 5EG0A 2O5RA 2VQLA 1IRZA 1YRNB 2NS8A 1DDNA 2STWA 4AIKA 3K1NA 3NRVA 5J1YA 4B47A 1XG1A 3GWZA 2MSYA 5FFZA 4PUSA 2STTA 1MNMC 1F36A 5DD4A 3JRCA 1PYVA 1R1TA 4N4NB 2PQ8A 5IP7J 4KISA 3EUAA 4WF2A 1UJ8A 4FISA 4A3CJ 2DCEA 4BJ5C 1B9MA 3F8FA 1W5SA 2LFBA 2HPIA 2E2IJ 1T08B 4A3FJ 2CFXA 2RQPA 5GPCA 1IAWA 1QO0D 2NVUB 2JUCA 4XRMA 4LOCA 2DFIA 2V79A 2LLKA 3HRUA 5L3GA 4P9UA 3UNGC 3GZ6A 1BJZA 4DGWB 1P7IA 1ON1A 2KRFA 2ZBKA 4CCMA 2DA4A 2J5OA 3KEOA 3MMYB 2GLOA 3ESWB 3E5XA 3GLLA 3NWSA 2VODA 3I59B 1IN5A 2XF6A 4A3GJ 3SZTA 3QOEA 4HQEA 3OV8A 4E70A 2EFPA 4RBOA 4EATA 2Z3YA 2I10A 4A3JJ 4S0HB 4IF4A 2VXDA 1MBJA 4AUXA 2JT1A 3LSHA 3PFIA 1EH7A 2YS9A 3CP2A 2VE9A 2E7XA 4ZYGA 1KQ9A 1XPXA 3W3CA 3EUHA 4RAGA 2ZNYA 1GHCA 4WX9A 3F72A 2OF7A 1QZYA 2OZ6A 1ZN2A 3EQLF 5F0HA 2MLKA 2QM3A 4XBFA 1LDJA 4MFDA 1LFUP 3EDPA 5CLSA 4A3EJ 4XLEA 2P6SA 3PFYA 3VYSB 5FROA 2B63J 2OD5A 2P8TA 3CQZJ 3HSFA 3AL0B 2ISYA 3BR6A 5A2QZ 1WJAA 2IBDA 2EZLA 2VKVA 3DF8A 1J59A 3FXQA 1HDPA 3JRHA 5B1BH 2M9HA 1ETVA 1MW7A 3DTKA 2E19A 2FEZA 2X1DA 4C9YA 1BOBA 5BPDA 1RPWA 2LH9A 4RAYA 1POGA 4GRIA 5JHUA 3S1NJ 3GZ5A 3MWMA 4CH7A 2H09A 3H3ZA 1FX7A 3LSKA 4UVAA 2FXAA 3B6CA 1UB9A 2LY2A 4DZJA 2XASA 3FDYA 5DCMB 4XLNF 2NNYA 4KUMA 3G6EI 3DPTA 4GO1A 4IJAA 1ULYA 1ZG1A 1YW7A 3ZMTA 4F55A 3OR1C 4MEXF 1V5FA 2M87A 3WTWC 1WCMJ 3RKWA 1ZQ3P 1O3QA 4KICA 4LLGF 5M5YJ 3OYCA 3K4KA 4XONA 2ICWG 2W84A 1K78B 1YS6A 3RIRA 2QQ9A 2O8XA 2OCCH 1RR8C 1FBQA 1I27A 2JA7J 3SQNA 3V7CA 5LRSA 1RRJA 4V2GA 1AOYA 2EFNA 3HIFA 3AG4H 2GWRA 1W4MA 4UUTA 3BG7A 2Y0SA 4E7LA 3FMRA 4L9NA 3ROUA 1FMVA 1QVUA 2L5QA 2XB0X 3I0TA 4XLAA 5ICEA 5L3CA 2BY3A 2P81A 3VSKA 3PO2J 4LLLA 1GVJA 4FE4A 3V7RA 3LQRA 3C2GA 3LA2A 1KQ0A 3ZQ7A 3RPUA 4A5MA 3LWFA 2JA5J
chains in the Genus database with same CATH topology
4O3MA 5L3EA 2F5DA 4RGUA 1XGNA 1G3SA 1TNSA 4KMUX 4BNCA 5E1XA 1F5TA 2DQLA 2W57A 4BHPA 1LEAA 4ZZDA 2RDPA 3JTGA 1H0MA 1CF7B 4Q48A 4HYEA 3D0SA 3RKYA 1IF1A 3EYYA 1PP8F 1Z1DA 3RDIA 2B0LA 5H20A 2HKXA 3TO7A 3OOPA 2BV6A 3S2WA 1U5TC 4N9HA 4N9IA 1B1BA 5LRRA 1P2FA 2QQBA 4PGGA 1ZYRF 4EJUA 2GXGA 2LNBA 2DK5A 1ONVA 3PQJA 4Y17A 1X3UA 4HDVA 5KK1A 3V8LA 1ZH5A 4GGGA 2GA1A 4BQAA 4U88A 3SFZA 3BWGA 3T8TA 4B8XA 1ZAOA 4KN7X 1U6GA 4XSXF 1IXRC 4QWQA 1HW2A 3P9IA 1KU9A 2LF8A 4ESFA 3ABTA 1U78A 2Y75A 2PEXA 3JSPA 4HQMA 1E2XA 1ODDA 1HSJA 3WODF 1U2WA 2BGCA 3PQKA 1FSEA 2P6TA 4CDGA 2XIGA 4HDUA 3GX4X 1FT9A 2PBIA 4LMYA 2L4AA 5EEHA 1ZHFA 1ZRDA 3BJAA 1QPMA 2CWEA 4I09A 1R00A 4CO8A 5HS7A 2ZFWA 5DEQA 1BM9A 2H6BA 1UHMA 2COMA 4M9SA 5LEJA 2A07F 4WK8F 4MNUA 1FYMA 2EV5A 1IZ1A 5LBQA 1XSXA 3L9FA 1KQ8A 3G3ZA 2OA4A 4PCQA 5FLXK 3WTUC 2OU2A 2WC2A 2UWMA 2EA2A 1QZZA 5LEKA 2YR2A 2CSOA 3O3KA 1FYLA 1UCRA 2A3SA 1I1SA 2P5LC 4UVCA 4ZYDA 1H9TA 2XV4S 3KP3A 1MZBA 1S7OA 5E8IA 2RN7A 5HS8A 2P7CB 4A2UA 2F2EA 3O2PE 3GFLA 3K1MA 2H6CA 2L01A 1MJBA 1XD7A 1SD5A 4ESBA 3RTRA 2G7HA 2O3FA 4EMSA 3I64A 1IRGA 2PMUA 2UZKA 3CUQC 4I2OA 1UHWA 2ZXJA 2M45A 3BY6A 5L3BA 1SFUA 2P7VB 3BP8A 3JAMK 2FE3A 1CGPA 4FX0A 4UXNA 3P9KA 3HTUA 1IN8A 5JI6A 3WTTC 5DYMA 5ICFA 3ZMUA 3B73A 2HQNA 4PGHA 2X4HA 3QOPA 1WI9A 1FP1D 1LEBA 1TW3A 3FX3A 2HS5A 1Z6RA 1KGSA 1H9GA 4L18B 2XAJA 4L9JA 2VC0A 4MQ9F 1RUOA 4HLXA 2GIVA 4UHTA 4KDPA 3K0LA 3MCZA 2KIFA 4I0AA 2IW5A 4RB0A 1SMYF 1S8NA 2D1VA 1TQIA 2ZJ2A 5HVQC 1ZRCA 3VB2A 5BQTA 2NS0A 5TRDA 2WV0A 1ZREA 3EETA 4A0YA 3CUQA 1DP7P 1BN5A 3LQQA 2ZMEA 1S6LA 2W25A 2LSOA 1R5HA 4LG0B 1PP7U 4WXCA 1G3WA 1T2KA 4EGZA 2IP2A 2Z5UA 3JTHA 4KT5C 1J75A 4WXDA 2CO5A 3R4KA 4CHUA 3V4GA 5L3DA 1XGOA 3FM3A 3O6BB 2FQ3A 4A5NA 4LB6B 5CVIA 1HKTA 3VODA 2DTRA 2O6GE 2IVMA 3GEZA 2X0LA 3B02A 1G6NA 2XAGA 1FZPB 4XRFA 2V9VA 4YFNF 1HQCA 1SMTA 1XGSA 1YW8A 3FXRA 1I5ZA 1R1UA 1Z7UA 2GXBA 2DLLA 2LKPA 3IHUA 4QLCU 4HW0A 2KIMA 1YO5C 1J9IA 3R61A 2HKOA 2GA2A 3J81K 2KJBA 2E7WA 1PUEE 2WTEA 4HAMA 1PDNC 4ENJA 2XKPA 4CZZA 1JHHA 5D8LB 1BC8C 3N97A 4OIRF 5LHHA 1FC3A 1XN7A 5F6FA 2NRAC 3MAJA 4GXOA 3ECHA 3CUQB 5E20A 2ZKZA 3GVAA 4IHSA 5JVTA 4OIQF 3TOBA 1R36A 4G7HF 3CO7C 3LAPA 5E1ZB 4CGZA 2XUBA 3BJ6A 3KE2A 1F4KA 4HLYA 2HWVA 4XSZF 4JK1X 4RGXA 4M71A 4ZYEA 4HOBA 1SD7A 2QENA 3RKXA 2JPBA 2EV6A 1LQ1A 4R1HA 5ILUA 2HTJA 2MA3A 4U0VA 1O57A 2UXXA 2M5WA 4I7HA 2ZMEB 4WCGA 3VOEA 3E6MA 1TQMA 4UVBA 2CG4A 1U3EM 2FMLA 3C3WA 5ILSA 3U1DA 4B09A 4HF1A 4P9FA 1FOKA 4NHJA 2O61A 4ENKA 2ETHA 5HOOA 2EA4A 4YIFA 3ZPLA 4AD9A 1V4RA 3WG9A 3Q9SA 1B4AA 3WTXC 1K7AA 2XAQA 2RKHA 4GCVA 2PLYA 5D5XB 3T8RA 3BPXA 5K5RA 4A0ZA 3ULQB 3GYHX 3WTVC 3E6CC 3QP6A 1ZG5A 4EQQA 2LF7A 4LFUA 2QLZA 1ZLKA 5DCFA 2D45A 1T0FA 1XMAA 5CJ9A 5K5OA 1STZA 1XB4A 4LJZF 1ON2A 5K5QA 5J6XA 2VBWA 2P4WA 1XCBA 4PZJA 1Y0UA 2F5FA 2RC4A 2VC1A 4L5JA 1F1ZA 3R0AA 4Q47A 2HZTA 3KLOA 2IA0A 1SFXA 2XRNA 2DT5A 2ZCWA 1D8KA 2YX7A 5LGUA 4HZFA 4ESJA 2VBXA 4KMFA 3QPHA 2AXLA 3Q9VA 3HRTA 1IRFA 5HDKA 5HDGA 1IN6A 2CYYA 2XAFA 5D4SA 2IA1A 2G7UA 3JSOA 4H0EA 1L3LA 4UUVA 3DFGA 1J2XA 3L2CA 1Z9CA 3FMQA 4HBLA 2RNJA 1ZGJA 4HV6A 2G9WA 3F3XA 5BS6A 1QQIA 3K1PA 2Q0OA 2GZWA 5FO5A 3RJPA 2AS5F 2PMHA 3I4PA 3WTYC 3M8EA 2VBYA 4TV7A 2M1BA 1IXCA 5D8KB 2Z9OA 2A6EF 1WQ2A 1OPCA 3GFIA 3I53A 2DBBA 1RI7A 4OOIA 3DEUA 3ML6A 2EB7A 3E5UA 3J80Z 3CJNA 3TQNA 4XLPF 3IC7A 4RB2C 1S3JA 4ZH4F 1KU7A 2KKOA 1JHFA 2EK5A 3HRSA 2JZYA 3L00A 4F7ZA 4JQFA 2P5VA 2YX4A 3WE2A 3GUDA 4DQ2A 3U9GA 1G4DA 4ZYHA 2IRFG 1TQPA 5LGNA 1BBYA 1ZLJA 1ZGAA 4A0XA 5F64A 4HF2A 3GW2A 1WKMA 1D3YA 2F5EA 1KYWA 2V1DA 3I59A 3VFZA 2DW4A 4O6JA 2DPDA 5A2QK 1S29A 5DCMA 4OMYA 3ZMSA 2FF4A 5LHGA 4YFKF 3L09A 2FMYA 2Z33A 1FP2A 2EFOA 3E3VA 5LLQA 2DAOA 3N4MA 4RB1A 3E6DA 5DV5A 4I02A 1CF7A 5BOXA 4RAZA 1HSTA 1R7JA 2Q2EA 4D0PA 2FA5A 3RI4A 1LNWA 2HR3A 3M7GA 5D5VB 1C0WA 4OIOF 1R5GA 1HBXG 5ED4A 5BMZA 2FBKA 1YQAA 4RS8A 1K79A 3R60A 2IPQX 1W5TA 4MGRA 5FLXZ 3BDDA 3V8KA 4FX4A 3ISPA 2CQKA 2D2WA 2EJRA 1F9NA 3KP2A 4Z2YA 2FNAA 1QBJA 3HOTA 1JXSA 3T5XA 3H92A 4ZZLA 2YSRA 4R8HA 2J5PA 4OU0A 3HHHA 3NEUA 3F22A 3WU1B 3SHFA 3GXOA 1YYVA 1ZRFA 3IRQA 1MDMB 1D5VA 2C6YA 4AIHA 2MH2A 3ABUA 2ESHA 4NB5A 2K27A 4UNOA 5IT9K 3DPLC 5JFRA 1BI0A 2L4MA 2Y48A 2FRHA 4G8XA 1Z91A 3W6JB 4Q4ZF 1KU2A 3CUOA 2YU3A 4HF0A 1XSVA 1B59A 1O3TA 4BHBA 4LK0F 1LJ9A 3RYPA 5LGTA 4GYIA 3BPVA 1XDSA 1O7LA 2H94A 1WSUA 2HQRA 2DK8A 3HSEA 3M9AA 2NNNA 2TDXA 2A5YB 2DQRA 5LHIA 2CW0F 1FYKA 3HUGA 4I01A 3DXJF 5H6RA 1JGSA 1DPRA 3AAFA 1EV7A 1OMIA 2H27A 5CVRA 2RGVA 3WE3A 4BH9A 1K78A 3Q5FA 3ZN0A 3K69A 2MBFA 2QYOA 4IXAA 1RIOH 1P6RA 4IRIA 4ENNA 4G6QA 4OIPF 1U5TB 3HHGA 3HSRA 4KYWA 2ELHA 5ICCA 3K2ZA 1DPUA 1WRJA 1BI1A 3I54A 1YIOA 4HX4A 4U0WA 2XHKA 4L9VA 2K86A 5E18F 5K1YA 2BE5F 2PG4A 5E17F 1IW7F 3MFKA 1TTYA 3L7WA 2PN6A 5FFXA 3KFWX 4EV0A 5FD5A 5ICGA 4LB5A 3GLXA 4RB3C 1SAXA 2NAZA 1LVAA 3C7JA 4A6DA 3DKWA 4KIGA 4L9TA 2PFBA 4IHTA 2EV0A 2K4BA 4WXHA 1OYIA 3KP6A 2F5CA 1ZARA 4G7ZF 2BEOA 3KETA 2VT3A 5CVVA 1W7PD 1WWXA 1Z05A 5BPIA 1RZ4A 1J0RA 2JRTA 4Y13A 3D5LA 1G3TA 5IT9Z 5CYVA 3F8CA 3HOSA 5ILVA 1BI2A 1USTA 1T39A 3WGHA 5JR3A 2D1HA 6PAXA 1YFHA 2JSCA 3KP7A 1XCVA 4G6DA 3DQVC 3ZMVA 4GYGA 2PI0A 3F8MA 3BOQA 4S04A 4CXFA 2OAZA 3FMSA 3FF5A 4Q5SF 5DUKA 4KIBA 4Y15A 2UXNA 4IVNA 1REPC 2FOKA 5FGMA 5KVRA 2FNPA 1J5YA 3T0YA 1HW1A 3GFJA 3BZ6A 3TO6A 3KZYA 2L54A 2OBPA 2A61A 4YFXF 1G3YA 4L0YB 1P4AA 3G73A 5DDGA 5J8FA 1UFMA 4EM0B 4A6EA 4LG0A 1XMKA 3TOAA 4MEYF 2XKOA 2L3DA 4FHTA 4G7OF 3RYRA 3QU3A 3VEPA 3WTSC 1MDMA 3CO6C 3GO5A 2HEOA 2Z99A 3SXYA 4EVIA 2A69F 1R22A 2R3SA 1BIAA 5HS9A 1XGMA 4KN4X 2QBYA 1L0OC 4M6YA 3QU6A 2QWWA 4CICA 4ETSA 2BYVE 5AIQA 1O3RA 3F23A 3MZYA 1OYYA 2ISZA 4RGSA 3K9TA 4NQWA 1HW5A 3WGGA 4M72A 2ZNZA 2K02A 3H3UA 3QP5A 1JE8A 2WWYA 4KFCA 1I6XA 4CYDA 2PJPA 2FSWA 1B6AA 1W7PA 3BROA 3M1EA 1ZG3A 4JBAA 2Q8KA 3IWFA 2MLGA 4EM1A 3F6OA 2OQGA 1XDUA 3ZMDA 3F21A 2W24A 2ZO4A 1HKQA 4EM2A 4HV5A 4IRHA 2W85A 3LA3A 2MH9A 2VE8A 3ERED 3I58A 3T1BA 1BC7C 1XSDA 1FWZA 5L3FA 2XVCA 3ZN1A 5E1WA 3KCCA 2LDUA 1MJAA 2XAHA 3HRMA 1MJ9A 3IKTA 3FWEA 2M8EA 2VXZA 4M73A 4P55A 2RV8A 5D6EA 5AONA 1R1VA 1YLFA 1OYWA 1FNNA 4HX7A 1YS7A 1K6OA 2JTVA 3LFKA 3WU0A 2EFWA 1BOAA 2V1UA 1FLIA 3MZHA 3RPQA 3FHZA 5FB2A 1FY7A 2A6HF 4LD5A 5ERIA 2HDCA 2IJLA 3DV8A 3NQOA 1T98A 3JW4A 1DUXC 3IWZA 3KP4A 2ESNA 2XGXA 2FU4A 1TBXA 1A04A 2O03A 1P4XA 2E1NA 2NYXA 2HTSA 2HYFA 2GQQA 3JAMZ 1SD4A 4LLNA 4EJOA 5D6FA 2HFHA 4MHGA 3LA7A 3MEXA 3FXUA 3CDHA 2OQRA 3KP5A 3KZZA 5HLHA 2DO7A 4L0ZB 2V6CA 2MD5A 4MQVA 5IT3A 1I1GA 3P9CA 2BBYA 1KYZA 4U7DA 2OZUA 5E8GA 1P92A 1O7FA 1TNTA 3J7AO 2VONA 1BJAA 4PDKA 3F8NA 4AVPA 2VBZA 3LSTA 2QVOA 4L5IA 1W7PB 4YIIA 4P5OA 4WWCA 3KLNA 3F8BA 3WGIA 3J80K 5DUIA 3IRRA 2QBYB 2QUFA 3HYIA 3E97A 4HX8A 4KIFA 1T38A 3TDZC 2CGPA 1HXDA 2O0YA 4OINF 4FT8A 1MD0A 4UV8A 1NHAA 1KU3A 3TKYA 3V8JA 3P7NA 4K2EA 3C18A 3R0JA 3GFMA 1HKSA 3KEQA 3V7SA 2P5KA 1MKMA 3W6KB 4I0BA 4AWXB 5CVJA 2QQAA 4U7BA 3IKVA 3I71A 2ADUA 2XROA 1IUYA 4G94A 3U2RA 3R6SA 1TW2A 1TLHB 2VOOA 5D5UB 2HGCA 2R7DA 3I5UA 2QZ8A 3QRFF 2ACJA 1OKRA 1EH6A 2VOPA 4EJWA 2A68F 5J8CA 4KNYA 4BYYA 4M74A 1SD6A 2VN2A 4BAYA 4YG2F 3COAC 5HLIA 2VT2A 1S7AA 3LAJA 3MQ0A 4ENMA 4G9YA 1FBUA 3TDUC 5H6QA 4N0BA 4A12A 3E6BA 1LDDA 1BIBA 4HA8A 1V3FA 4IRGA 4I98B 1FBSA 3GF2A 2FBIA 2KJCA 5HDNA 3DP7A 4EJTA 1T6SA 1GXQA 1FSHA 1B9NA 4MTEA 3E5QA 1D8JA 1R58A 1O3SA 4RGRA 1KA8A 3C1DA 3REOA 1IN7A 3J81Z 5HLGA 4ON0A 4KA4A 3FZVA 4S05A 2R7FA 1RUNA 2K7LA 4M6XA 3CLOA 1VTNC 2DI3A 1R23A 3ELKA 1QGPA 3QPTA 3FM5A 4R79A 1LDKB 4LGWA 1YG2A 3F6VA 4O5VA 3M8FA 5F1RA 3HTSB 4IPAA 4MTDA 1AWCA 4AIJA 1QNTA 1E17A 2K4JA 1BI3A 1YW9A 2JPCA 4EJVA 1EH8A 1Q1HA 5EEGA 2IT0A 1IXSB 2M30A 2L02A 1SFEA 3TGNA 1J7KA 2DU9A 5FD6A 5CVUA 2RVCA 3TO9A 1GXPA 4M9XA 2HOEA 5DD8A 2DPUA 1MGTA 4DNCA 5D4RA 2IA2A 4OMZA 3WTZA 1USSA 1U5TA 5TJJA 4EGYA 3IL2A 4M9ZA 3SZPA 1YTYA 4BHCA 1Z6TA 1RNLA 2Y0MA 4LK1F 1OR7A 4ASNA 4U0YA 2FBHA 1U8RA 2V1XA 4P96A 1FPQA 3ECOA 3ZMZA 3QAHA 2GAUA 4BXUA 2EWNA 3EYIA 2MC3A 4UV9A 2E1CA 2HYGD 3ZP5A 5D5WB 3BJOA 1LB2A 3CTAA 2EFQA 5AIPA 2YPRA 2KIUA 1P4WA 1IN4A 1DDNA 2STWA 4AIKA 3K1NA 3NRVA 3GWZA 5FFZA 2STTA 5DD4A 1R1TA 2PQ8A 4WF2A 1B9MA 3F8FA 1W5SA 2CFXA 2RQPA 1IAWA 1QO0D 2DFIA 2V79A 5L3GA 3HRUA 4P9UA 3GZ6A 1ON1A 2KRFA 2ZBKA 2J5OA 3KEOA 3E5XA 2VODA 3I59B 1IN5A 3SZTA 4HQEA 3OV8A 4E70A 2EFPA 2Z3YA 4IF4A 2JT1A 3PFIA 1EH7A 2VE9A 2E7XA 4ZYGA 1KQ9A 3EUHA 2ZNYA 1GHCA 4WX9A 3F72A 1QZYA 2OZ6A 1ZN2A 3EQLF 2MLKA 2QM3A 4XBFA 1LDJA 3EDPA 5CLSA 2P6SA 2OD5A 2P8TA 3HSFA 2ISYA 5A2QZ 3DF8A 1J59A 3FXQA 2FEZA 5BPDA 4RAYA 5JHUA 3GZ5A 3MWMA 2H09A 3H3ZA 1FX7A 4UVAA 2FXAA 1UB9A 2XASA 5DCMB 4XLNF 2NNYA 4KUMA 3DPTA 4GO1A 4IJAA 1ULYA 1ZG1A 1YW7A 3ZMTA 4MEXF 2M87A 3WTWC 3RKWA 1O3QA 4KICA 4LLGF 2W84A 1K78B 1YS6A 3RIRA 2QQ9A 2O8XA 1FBQA 1I27A 3SQNA 3V7CA 5LRSA 1AOYA 2EFNA 3HIFA 2GWRA 1W4MA 3FMRA 4L9NA 3ROUA 3I0TA 5ICEA 5L3CA 4LLLA 1GVJA 3V7RA 3LQRA 3LA2A 1KQ0A 3ZQ7A 3RPUA 4A5MA 3LWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O3M A;  5L3E A;  2F5D A;  4RGU A;  1XGN A;  1G3S A;  1TNS A;  4KMU X;  4BNC A;  5E1X A;  1F5T A;  2DQL A;  2W57 A;  4BHP A;  1LEA A;  4ZZD A;  2RDP A;  3JTG A;  1H0M A;  1CF7 B;  4Q48 A;  4HYE A;  3D0S A;  3RKY A;  1IF1 A;  3EYY A;  1PP8 F;  1Z1D A;  3RDI A;  2B0L A;  5H20 A;  2HKX A;  3TO7 A;  3OOP A;  2BV6 A;  3S2W A;  1U5T C;  4N9H A;  4N9I A;  1B1B A;  5LRR A;  1P2F A;  2QQB A;  4PGG A;  1ZYR F;  4EJU A;  2GXG A;  2LNB A;  2DK5 A;  1ONV A;  3PQJ A;  4Y17 A;  1X3U A;  4HDV A;  5KK1 A;  3V8L A;  1ZH5 A;  4GGG A;  2GA1 A;  4BQA A;  4U88 A;  3SFZ A;  3BWG A;  3T8T A;  4B8X A;  1ZAO A;  4KN7 X;  1U6G A;  4XSX F;  1IXR C;  4QWQ A;  1HW2 A;  3P9I A;  1KU9 A;  2LF8 A;  4ESF A;  3ABT A;  1U78 A;  2Y75 A;  2PEX A;  3JSP A;  4HQM A;  1E2X A;  1ODD A;  1HSJ A;  3WOD F;  1U2W A;  2BGC A;  3PQK A;  1FSE A;  2P6T A;  4CDG A;  2XIG A;  4HDU A;  3GX4 X;  1FT9 A;  2PBI A;  4LMY A;  2L4A A;  5EEH A;  1ZHF A;  1ZRD A;  3BJA A;  1QPM A;  2CWE A;  4I09 A;  1R00 A;  4CO8 A;  5HS7 A;  2ZFW A;  5DEQ A;  1BM9 A;  2H6B A;  1UHM A;  2COM A;  4M9S A;  5LEJ A;  2A07 F;  4WK8 F;  4MNU A;  1FYM A;  2EV5 A;  1IZ1 A;  5LBQ A;  1XSX A;  3L9F A;  1KQ8 A;  3G3Z A;  2OA4 A;  4PCQ A;  5FLX K;  3WTU C;  2OU2 A;  2WC2 A;  2UWM A;  2EA2 A;  1QZZ A;  5LEK A;  2YR2 A;  2CSO A;  3O3K A;  1FYL A;  1UCR A;  2A3S A;  1I1S A;  2P5L C;  4UVC A;  4ZYD A;  1H9T A;  2XV4 S;  3KP3 A;  1MZB A;  1S7O A;  5E8I A;  2RN7 A;  5HS8 A;  2P7C B;  4A2U A;  2F2E A;  3O2P E;  3GFL A;  3K1M A;  2H6C A;  2L01 A;  1MJB A;  1XD7 A;  1SD5 A;  4ESB A;  3RTR A;  2G7H A;  2O3F A;  4EMS A;  3I64 A;  1IRG A;  2PMU A;  2UZK A;  3CUQ C;  4I2O A;  1UHW A;  2ZXJ A;  2M45 A;  3BY6 A;  5L3B A;  1SFU A;  2P7V B;  3BP8 A;  3JAM K;  2FE3 A;  1CGP A;  4FX0 A;  4UXN A;  3P9K A;  3HTU A;  1IN8 A;  5JI6 A;  3WTT C;  5DYM A;  5ICF A;  3ZMU A;  3B73 A;  2HQN A;  4PGH A;  2X4H A;  3QOP A;  1WI9 A;  1FP1 D;  1LEB A;  1TW3 A;  3FX3 A;  2HS5 A;  1Z6R A;  1KGS A;  1H9G A;  4L18 B;  2XAJ A;  4L9J A;  2VC0 A;  4MQ9 F;  1RUO A;  4HLX A;  2GIV A;  4UHT A;  4KDP A;  3K0L A;  3MCZ A;  2KIF A;  4I0A A;  2IW5 A;  4RB0 A;  1SMY F;  1S8N A;  2D1V A;  1TQI A;  2ZJ2 A;  5HVQ C;  1ZRC A;  3VB2 A;  5BQT A;  2NS0 A;  5TRD A;  2WV0 A;  1ZRE A;  3EET A;  4A0Y A;  3CUQ A;  1DP7 P;  1BN5 A;  3LQQ A;  2ZME A;  1S6L A;  2W25 A;  2LSO A;  1R5H A;  4LG0 B;  1PP7 U;  4WXC A;  1G3W A;  1T2K A;  4EGZ A;  2IP2 A;  2Z5U A;  3JTH A;  4KT5 C;  1J75 A;  4WXD A;  2CO5 A;  3R4K A;  4CHU A;  3V4G A;  5L3D A;  1XGO A;  3FM3 A;  3O6B B;  2FQ3 A;  4A5N A;  4LB6 B;  5CVI A;  1HKT A;  3VOD A;  2DTR A;  2O6G E;  2IVM A;  3GEZ A;  2X0L A;  3B02 A;  1G6N A;  2XAG A;  1FZP B;  4XRF A;  2V9V A;  4YFN F;  1HQC A;  1SMT A;  1XGS A;  1YW8 A;  3FXR A;  1I5Z A;  1R1U A;  1Z7U A;  2GXB A;  2DLL A;  2LKP A;  3IHU A;  4QLC U;  4HW0 A;  2KIM A;  1YO5 C;  1J9I A;  3R61 A;  2HKO A;  2GA2 A;  3J81 K;  2KJB A;  2E7W A;  1PUE E;  2WTE A;  4HAM A;  1PDN C;  4ENJ A;  2XKP A;  4CZZ A;  1JHH A;  5D8L B;  1BC8 C;  3N97 A;  4OIR F;  5LHH A;  1FC3 A;  1XN7 A;  5F6F A;  2NRA C;  3MAJ A;  4GXO A;  3ECH A;  3CUQ B;  5E20 A;  2ZKZ A;  3GVA A;  4IHS A;  5JVT A;  4OIQ F;  3TOB A;  1R36 A;  4G7H F;  3CO7 C;  3LAP A;  5E1Z B;  4CGZ A;  2XUB A;  3BJ6 A;  3KE2 A;  1F4K A;  4HLY A;  2HWV A;  4XSZ F;  4JK1 X;  4RGX A;  4M71 A;  4ZYE A;  4HOB A;  1SD7 A;  2QEN A;  3RKX A;  2JPB A;  2EV6 A;  1LQ1 A;  4R1H A;  5ILU A;  2HTJ A;  2MA3 A;  4U0V A;  1O57 A;  2UXX A;  2M5W A;  4I7H A;  2ZME B;  4WCG A;  3VOE A;  3E6M A;  1TQM A;  4UVB A;  2CG4 A;  1U3E M;  2FML A;  3C3W A;  5ILS A;  3U1D A;  4B09 A;  4HF1 A;  4P9F A;  1FOK A;  4NHJ A;  2O61 A;  4ENK A;  2ETH A;  5HOO A;  2EA4 A;  4YIF A;  3ZPL A;  4AD9 A;  1V4R A;  3WG9 A;  3Q9S A;  1B4A A;  3WTX C;  1K7A A;  2XAQ A;  2RKH A;  4GCV A;  2PLY A;  5D5X B;  3T8R A;  3BPX A;  5K5R A;  4A0Z A;  3ULQ B;  3GYH X;  3WTV C;  3E6C C;  3QP6 A;  1ZG5 A;  4EQQ A;  2LF7 A;  4LFU A;  2QLZ A;  1ZLK A;  5DCF A;  2D45 A;  1T0F A;  1XMA A;  5CJ9 A;  5K5O A;  1STZ A;  1XB4 A;  4LJZ F;  1ON2 A;  5K5Q A;  5J6X A;  2VBW A;  2P4W A;  1XCB A;  4PZJ A;  1Y0U A;  2F5F A;  2RC4 A;  2VC1 A;  4L5J A;  1F1Z A;  3R0A A;  4Q47 A;  2HZT A;  3KLO A;  2IA0 A;  1SFX A;  2XRN A;  2DT5 A;  2ZCW A;  1D8K A;  2YX7 A;  5LGU A;  4HZF A;  4ESJ A;  2VBX A;  4KMF A;  3QPH A;  2AXL A;  3Q9V A;  3HRT A;  1IRF A;  5HDK A;  5HDG A;  1IN6 A;  2CYY A;  2XAF A;  5D4S A;  2IA1 A;  2G7U A;  3JSO A;  4H0E A;  1L3L A;  4UUV A;  3DFG A;  1J2X A;  3L2C A;  1Z9C A;  3FMQ A;  4HBL A;  2RNJ A;  1ZGJ A;  4HV6 A;  2G9W A;  3F3X A;  5BS6 A;  1QQI A;  3K1P A;  2Q0O A;  2GZW A;  5FO5 A;  3RJP A;  2AS5 F;  2PMH A;  3I4P A;  3WTY C;  3M8E A;  2VBY A;  4TV7 A;  2M1B A;  1IXC A;  5D8K B;  2Z9O A;  2A6E F;  1WQ2 A;  1OPC A;  3GFI A;  3I53 A;  2DBB A;  1RI7 A;  4OOI A;  3DEU A;  3ML6 A;  2EB7 A;  3E5U A;  3J80 Z;  3CJN A;  3TQN A;  4XLP F;  3IC7 A;  4RB2 C;  1S3J A;  4ZH4 F;  1KU7 A;  2KKO A;  1JHF A;  2EK5 A;  3HRS A;  2JZY A;  3L00 A;  4F7Z A;  4JQF A;  2P5V A;  2YX4 A;  3WE2 A;  3GUD A;  4DQ2 A;  3U9G A;  1G4D A;  4ZYH A;  2IRF G;  1TQP A;  5LGN A;  1BBY A;  1ZLJ A;  1ZGA A;  4A0X A;  5F64 A;  4HF2 A;  3GW2 A;  1WKM A;  1D3Y A;  2F5E A;  1KYW A;  2V1D A;  3I59 A;  3VFZ A;  2DW4 A;  4O6J A;  2DPD A;  5A2Q K;  1S29 A;  5DCM A;  4OMY A;  3ZMS A;  2FF4 A;  5LHG A;  4YFK F;  3L09 A;  2FMY A;  2Z33 A;  1FP2 A;  2EFO A;  3E3V A;  5LLQ A;  2DAO A;  3N4M A;  4RB1 A;  3E6D A;  5DV5 A;  4I02 A;  1CF7 A;  5BOX A;  4RAZ A;  1HST A;  1R7J A;  2Q2E A;  4D0P A;  2FA5 A;  3RI4 A;  1LNW A;  2HR3 A;  3M7G A;  5D5V B;  1C0W A;  4OIO F;  1R5G A;  1HBX G;  5ED4 A;  5BMZ A;  2FBK A;  1YQA A;  4RS8 A;  1K79 A;  3R60 A;  2IPQ X;  1W5T A;  4MGR A;  5FLX Z;  3BDD A;  3V8K A;  4FX4 A;  3ISP A;  2CQK A;  2D2W A;  2EJR A;  1F9N A;  3KP2 A;  4Z2Y A;  2FNA A;  1QBJ A;  3HOT A;  1JXS A;  3T5X A;  3H92 A;  4ZZL A;  2YSR A;  4R8H A;  2J5P A;  4OU0 A;  3HHH A;  3NEU A;  3F22 A;  3WU1 B;  3SHF A;  3GXO A;  1YYV A;  1ZRF A;  3IRQ A;  1MDM B;  1D5V A;  2C6Y A;  4AIH A;  2MH2 A;  3ABU A;  2ESH A;  4NB5 A;  2K27 A;  4UNO A;  5IT9 K;  3DPL C;  5JFR A;  1BI0 A;  2L4M A;  2Y48 A;  2FRH A;  4G8X A;  1Z91 A;  3W6J B;  4Q4Z F;  1KU2 A;  3CUO A;  2YU3 A;  4HF0 A;  1XSV A;  1B59 A;  1O3T A;  4BHB A;  4LK0 F;  1LJ9 A;  3RYP A;  5LGT A;  4GYI A;  3BPV A;  1XDS A;  1O7L A;  2H94 A;  1WSU A;  2HQR A;  2DK8 A;  3HSE A;  3M9A A;  2NNN A;  2TDX A;  2A5Y B;  2DQR A;  5LHI A;  2CW0 F;  1FYK A;  3HUG A;  4I01 A;  3DXJ F;  5H6R A;  1JGS A;  1DPR A;  3AAF A;  1EV7 A;  1OMI A;  2H27 A;  5CVR A;  2RGV A;  3WE3 A;  4BH9 A;  1K78 A;  3Q5F A;  3ZN0 A;  3K69 A;  2MBF A;  2QYO A;  4IXA A;  1RIO H;  1P6R A;  4IRI A;  4ENN A;  4G6Q A;  4OIP F;  1U5T B;  3HHG A;  3HSR A;  4KYW A;  2ELH A;  5ICC A;  3K2Z A;  1DPU A;  1WRJ A;  1BI1 A;  3I54 A;  1YIO A;  4HX4 A;  4U0W A;  2XHK A;  4L9V A;  2K86 A;  5E18 F;  5K1Y A;  2BE5 F;  2PG4 A;  5E17 F;  1IW7 F;  3MFK A;  1TTY A;  3L7W A;  2PN6 A;  5FFX A;  3KFW X;  4EV0 A;  5FD5 A;  5ICG A;  4LB5 A;  3GLX A;  4RB3 C;  1SAX A;  2NAZ A;  1LVA A;  3C7J A;  4A6D A;  3DKW A;  4KIG A;  4L9T A;  2PFB A;  4IHT A;  2EV0 A;  2K4B A;  4WXH A;  1OYI A;  3KP6 A;  2F5C A;  1ZAR A;  4G7Z F;  2BEO A;  3KET A;  2VT3 A;  5CVV A;  1W7P D;  1WWX A;  1Z05 A;  5BPI A;  1RZ4 A;  1J0R A;  2JRT A;  4Y13 A;  3D5L A;  1G3T A;  5IT9 Z;  5CYV A;  3F8C A;  3HOS A;  5ILV A;  1BI2 A;  1UST A;  1T39 A;  3WGH A;  5JR3 A;  2D1H A;  6PAX A;  1YFH A;  2JSC A;  3KP7 A;  1XCV A;  4G6D A;  3DQV C;  3ZMV A;  4GYG A;  2PI0 A;  3F8M A;  3BOQ A;  4S04 A;  4CXF A;  2OAZ A;  3FMS A;  3FF5 A;  4Q5S F;  5DUK A;  4KIB A;  4Y15 A;  2UXN A;  4IVN A;  1REP C;  2FOK A;  5FGM A;  5KVR A;  2FNP A;  1J5Y A;  3T0Y A;  1HW1 A;  3GFJ A;  3BZ6 A;  3TO6 A;  3KZY A;  2L54 A;  2OBP A;  2A61 A;  4YFX F;  1G3Y A;  4L0Y B;  1P4A A;  3G73 A;  5DDG A;  5J8F A;  1UFM A;  4EM0 B;  4A6E A;  4LG0 A;  1XMK A;  3TOA A;  4MEY F;  2XKO A;  2L3D A;  4FHT A;  4G7O F;  3RYR A;  3QU3 A;  3VEP A;  3WTS C;  1MDM A;  3CO6 C;  3GO5 A;  2HEO A;  2Z99 A;  3SXY A;  4EVI A;  2A69 F;  1R22 A;  2R3S A;  1BIA A;  5HS9 A;  1XGM A;  4KN4 X;  2QBY A;  1L0O C;  4M6Y A;  3QU6 A;  2QWW A;  4CIC A;  4ETS A;  2BYV E;  5AIQ A;  1O3R A;  3F23 A;  3MZY A;  1OYY A;  2ISZ A;  4RGS A;  3K9T A;  4NQW A;  1HW5 A;  3WGG A;  4M72 A;  2ZNZ A;  2K02 A;  3H3U A;  3QP5 A;  1JE8 A;  2WWY A;  4KFC A;  1I6X A;  4CYD A;  2PJP A;  2FSW A;  1B6A A;  1W7P A;  3BRO A;  3M1E A;  1ZG3 A;  4JBA A;  2Q8K A;  3IWF A;  2MLG A;  4EM1 A;  3F6O A;  2OQG A;  1XDU A;  3ZMD A;  3F21 A;  2W24 A;  2ZO4 A;  1HKQ A;  4EM2 A;  4HV5 A;  4IRH A;  2W85 A;  3LA3 A;  2MH9 A;  2VE8 A;  3ERE D;  3I58 A;  3T1B A;  1BC7 C;  1XSD A;  1FWZ A;  5L3F A;  2XVC A;  3ZN1 A;  5E1W A;  3KCC A;  2LDU A;  1MJA A;  2XAH A;  3HRM A;  1MJ9 A;  3IKT A;  3FWE A;  2M8E A;  2VXZ A;  4M73 A;  4P55 A;  2RV8 A;  5D6E A;  5AON A;  1R1V A;  1YLF A;  1OYW A;  1FNN A;  4HX7 A;  1YS7 A;  1K6O A;  2JTV A;  3LFK A;  3WU0 A;  2EFW A;  1BOA A;  2V1U A;  1FLI A;  3MZH A;  3RPQ A;  3FHZ A;  5FB2 A;  1FY7 A;  2A6H F;  4LD5 A;  5ERI A;  2HDC A;  2IJL A;  3DV8 A;  3NQO A;  1T98 A;  3JW4 A;  1DUX C;  3IWZ A;  3KP4 A;  2ESN A;  2XGX A;  2FU4 A;  1TBX A;  1A04 A;  2O03 A;  1P4X A;  2E1N A;  2NYX A;  2HTS A;  2HYF A;  2GQQ A;  3JAM Z;  1SD4 A;  4LLN A;  4EJO A;  5D6F A;  2HFH A;  4MHG A;  3LA7 A;  3MEX A;  3FXU A;  3CDH A;  2OQR A;  3KP5 A;  3KZZ A;  5HLH A;  2DO7 A;  4L0Z B;  2V6C A;  2MD5 A;  4MQV A;  5IT3 A;  1I1G A;  3P9C A;  2BBY A;  1KYZ A;  4U7D A;  2OZU A;  5E8G A;  1P92 A;  1O7F A;  1TNT A;  3J7A O;  2VON A;  1BJA A;  4PDK A;  3F8N A;  4AVP A;  2VBZ A;  3LST A;  2QVO A;  4L5I A;  1W7P B;  4YII A;  4P5O A;  4WWC A;  3KLN A;  3F8B A;  3WGI A;  3J80 K;  5DUI A;  3IRR A;  2QBY B;  2QUF A;  3HYI A;  3E97 A;  4HX8 A;  4KIF A;  1T38 A;  3TDZ C;  2CGP A;  1HXD A;  2O0Y A;  4OIN F;  4FT8 A;  1MD0 A;  4UV8 A;  1NHA A;  1KU3 A;  3TKY A;  3V8J A;  3P7N A;  4K2E A;  3C18 A;  3R0J A;  3GFM A;  1HKS A;  3KEQ A;  3V7S A;  2P5K A;  1MKM A;  3W6K B;  4I0B A;  4AWX B;  5CVJ A;  2QQA A;  4U7B A;  3IKV A;  3I71 A;  2ADU A;  2XRO A;  1IUY A;  4G94 A;  3U2R A;  3R6S A;  1TW2 A;  1TLH B;  2VOO A;  5D5U B;  2HGC A;  2R7D A;  3I5U A;  2QZ8 A;  3QRF F;  2ACJ A;  1OKR A;  1EH6 A;  2VOP A;  4EJW A;  2A68 F;  5J8C A;  4KNY A;  4BYY A;  4M74 A;  1SD6 A;  2VN2 A;  4BAY A;  4YG2 F;  3COA C;  5HLI A;  2VT2 A;  1S7A A;  3LAJ A;  3MQ0 A;  4ENM A;  4G9Y A;  1FBU A;  3TDU C;  5H6Q A;  4N0B A;  4A12 A;  3E6B A;  1LDD A;  1BIB A;  4HA8 A;  1V3F A;  4IRG A;  4I98 B;  1FBS A;  3GF2 A;  2FBI A;  2KJC A;  5HDN A;  3DP7 A;  4EJT A;  1T6S A;  1GXQ A;  1FSH A;  1B9N A;  4MTE A;  3E5Q A;  1D8J A;  1R58 A;  1O3S A;  4RGR A;  1KA8 A;  3C1D A;  3REO A;  1IN7 A;  3J81 Z;  5HLG A;  4ON0 A;  4KA4 A;  3FZV A;  4S05 A;  2R7F A;  1RUN A;  2K7L A;  4M6X A;  3CLO A;  1VTN C;  2DI3 A;  1R23 A;  3ELK A;  1QGP A;  3QPT A;  3FM5 A;  4R79 A;  1LDK B;  4LGW A;  1YG2 A;  3F6V A;  4O5V A;  3M8F A;  5F1R A;  3HTS B;  4IPA A;  4MTD A;  1AWC A;  4AIJ A;  1QNT A;  1E17 A;  2K4J A;  1BI3 A;  1YW9 A;  2JPC A;  4EJV A;  1EH8 A;  1Q1H A;  5EEG A;  2IT0 A;  1IXS B;  2M30 A;  2L02 A;  1SFE A;  3TGN A;  1J7K A;  2DU9 A;  5FD6 A;  5CVU A;  2RVC A;  3TO9 A;  1GXP A;  4M9X A;  2HOE A;  5DD8 A;  2DPU A;  1MGT A;  4DNC A;  5D4R A;  2IA2 A;  4OMZ A;  3WTZ A;  1USS A;  1U5T A;  5TJJ A;  4EGY A;  3IL2 A;  4M9Z A;  3SZP A;  1YTY A;  4BHC A;  1Z6T A;  1RNL A;  2Y0M A;  4LK1 F;  1OR7 A;  4ASN A;  4U0Y A;  2FBH A;  1U8R A;  2V1X A;  4P96 A;  1FPQ A;  3ECO A;  3ZMZ A;  3QAH A;  2GAU A;  4BXU A;  2EWN A;  3EYI A;  2MC3 A;  4UV9 A;  2E1C A;  2HYG D;  3ZP5 A;  5D5W B;  3BJO A;  1LB2 A;  3CTA A;  2EFQ A;  5AIP A;  2YPR A;  2KIU A;  1P4W A;  1IN4 A;  1DDN A;  2STW A;  4AIK A;  3K1N A;  3NRV A;  3GWZ A;  5FFZ A;  2STT A;  5DD4 A;  1R1T A;  2PQ8 A;  4WF2 A;  1B9M A;  3F8F A;  1W5S A;  2CFX A;  2RQP A;  1IAW A;  1QO0 D;  2DFI A;  2V79 A;  5L3G A;  3HRU A;  4P9U A;  3GZ6 A;  1ON1 A;  2KRF A;  2ZBK A;  2J5O A;  3KEO A;  3E5X A;  2VOD A;  3I59 B;  1IN5 A;  3SZT A;  4HQE A;  3OV8 A;  4E70 A;  2EFP A;  2Z3Y A;  4IF4 A;  2JT1 A;  3PFI A;  1EH7 A;  2VE9 A;  2E7X A;  4ZYG A;  1KQ9 A;  3EUH A;  2ZNY A;  1GHC A;  4WX9 A;  3F72 A;  1QZY A;  2OZ6 A;  1ZN2 A;  3EQL F;  2MLK A;  2QM3 A;  4XBF A;  1LDJ A;  3EDP A;  5CLS A;  2P6S A;  2OD5 A;  2P8T A;  3HSF A;  2ISY A;  5A2Q Z;  3DF8 A;  1J59 A;  3FXQ A;  2FEZ A;  5BPD A;  4RAY A;  5JHU A;  3GZ5 A;  3MWM A;  2H09 A;  3H3Z A;  1FX7 A;  4UVA A;  2FXA A;  1UB9 A;  2XAS A;  5DCM B;  4XLN F;  2NNY A;  4KUM A;  3DPT A;  4GO1 A;  4IJA A;  1ULY A;  1ZG1 A;  1YW7 A;  3ZMT A;  4MEX F;  2M87 A;  3WTW C;  3RKW A;  1O3Q A;  4KIC A;  4LLG F;  2W84 A;  1K78 B;  1YS6 A;  3RIR A;  2QQ9 A;  2O8X A;  1FBQ A;  1I27 A;  3SQN A;  3V7C A;  5LRS A;  1AOY A;  2EFN A;  3HIF A;  2GWR A;  1W4M A;  3FMR A;  4L9N A;  3ROU A;  3I0T A;  5ICE A;  5L3C A;  4LLL A;  1GVJ A;  3V7R A;  3LQR A;  3LA2 A;  1KQ0 A;  3ZQ7 A;  3RPU A;  4A5M A;  3LWF A; 
#chains in the Genus database with same CATH topology
 2QSG X;  5E3N A;  4O3M A;  2W48 A;  1Y0N A;  5L3E A;  3RZD J;  4BQQ A;  1KON A;  2F5D A;  2UV1 A;  4RGU A;  1XGN A;  4XRS A;  1N77 A;  1G3S A;  2EH3 A;  2W00 A;  1TNS A;  4KMU X;  2LY9 A;  4BNC A;  2CH0 A;  3LMM A;  3Q3S A;  5E1X A;  1F5T A;  2KQR A;  1I50 J;  3UKG A;  4IQ4 A;  4XLC A;  2IS4 A;  2DQL A;  2W57 A;  4BHP A;  2MC4 A;  1LEA A;  4ZZD A;  2RDP A;  1BA5 A;  1V5G A;  3JTG A;  4V19 K;  3UR3 C;  1H0M A;  1CF7 B;  4Q48 A;  1FOW A;  4HYE A;  2R5Y A;  3D0S A;  3RKY A;  1IF1 A;  3EYY A;  1PP8 F;  1FMW A;  2BOL A;  2H8W A;  1Z1D A;  2LRD A;  2VKH A;  3RDI A;  2B0L A;  5H20 A;  2HKX A;  1SC7 A;  1AKH A;  3HDD A;  1MMG A;  3TO7 A;  4YEL A;  2LD5 A;  3OOP A;  4NC8 A;  4D7N A;  2BV6 A;  1VFC A;  1WFX A;  1XTA A;  3S2W A;  1U5T C;  2X6Y A;  2DFE A;  4N9H A;  4N9I A;  5HOD A;  1ACI A;  1B1B A;  5LRR A;  5EYR A;  1P2F A;  2QQB A;  2O7O A;  3TMO A;  4PGG A;  1ZYR F;  4EJU A;  2LBF B;  1K83 J;  2CUZ A;  1N78 A;  2JA6 J;  2GXG A;  5C4J J;  2LNB A;  2DK5 A;  1ONV A;  3PQJ A;  3K7A J;  4Y17 A;  1BL0 A;  1X3U A;  4HDV A;  5KK1 A;  3OYL A;  3H1C A;  3V8L A;  1ZH5 A;  4GGG A;  2GA1 A;  2JQ7 A;  4U88 A;  4BQA A;  4BXX J;  3SFZ A;  3BWG A;  3T8T A;  1GV5 A;  4B8X A;  1ZAO A;  4KN7 X;  3AL0 C;  1U6G A;  1V55 H;  4XSX F;  3LOC A;  2LR8 A;  3DPU A;  1QVT A;  1IXR C;  2CUJ A;  2DJN A;  2BY0 A;  3P9I A;  1KU9 A;  4QWQ A;  1HW2 A;  2LF8 A;  1PJR A;  4AM3 A;  4ESF A;  3ABT A;  1U78 A;  2Y75 A;  2PEX A;  2FD5 A;  3N05 A;  1JUP A;  3JSP A;  4HQM A;  1E2X A;  1ODD A;  1HSJ A;  4F91 B;  1DQU A;  2B7E A;  1U2W A;  3WOD F;  2R7O A;  2B9S A;  2BGC A;  3PQK A;  2CUE A;  3ABM H;  3BG5 A;  1FSE A;  4HG2 A;  2P6T A;  1DGW Y;  2VPR A;  4CDG A;  2XIG A;  2WB1 A;  4HDU A;  4NQW B;  4W1U A;  3GX4 X;  3W2A A;  3SDB A;  4XM3 A;  1FT9 A;  2PBI A;  4LMY A;  1NK2 P;  1MBE A;  2L4A A;  3AG3 H;  4MLO A;  5EEH A;  3OYJ A;  3CCY A;  1JGG A;  2KFD A;  4XN0 A;  1ZHF A;  1OQY A;  1KZH A;  1ZRD A;  3M3Y J;  4N4O B;  3BJA A;  1QPM A;  1QRY A;  5FJ8 J;  1SFO J;  1VF9 A;  1WJC A;  2JA2 A;  2CWE A;  3K4B A;  2DA1 A;  1G2H A;  4I09 A;  1R00 A;  4DBQ A;  4AU7 A;  4CO8 A;  5HS7 A;  3ZQG A;  1Z3X A;  2ZFW A;  3BC8 A;  1MMD A;  5DEQ A;  1BM9 A;  2H6B A;  1UHM A;  4LG3 A;  3QPS A;  1Y56 A;  4ZTJ A;  1FOX A;  2COM A;  4M9S A;  4F93 B;  5LEJ A;  2XSJ C;  2A07 F;  4WK8 F;  1ZGW A;  4M3E A;  4MNU A;  3ABL H;  2EV5 A;  4JP0 A;  1FYM A;  1X58 A;  1IZ1 A;  2Q1Z B;  1XSX A;  3L9F A;  5LBQ A;  3HUG B;  1TWA J;  3F0C A;  3CME I;  3G3Z A;  2CQX A;  3JRB A;  1KQ8 A;  4HNV A;  2OA4 A;  3AG1 H;  4PCQ A;  2L7M P;  1WHU A;  3ZCO A;  5FLX K;  3J7A Y;  4IEJ A;  2PJR A;  4Y7N J;  3WTU C;  3ZRG A;  1B8I A;  2OU2 A;  3ZOB A;  2WC2 A;  2ZSH B;  2UWM A;  3FHN A;  4KIT B;  4ZTF A;  2EA2 A;  1QZZ A;  5LEK A;  2YR2 A;  2CSO A;  3J7Z I;  1WJD A;  2CRG A;  3O3K A;  1TT5 B;  1FYL A;  1UCR A;  2RQQ A;  1X2M A;  2L7K A;  2A3S A;  4DJA A;  3LSR A;  3DLL F;  2P5L C;  2IAI A;  1I1S A;  4UVC A;  4ZYD A;  2F4I A;  5E79 C;  1H9T A;  3OYK A;  2XV4 S;  2K9M A;  2V9P A;  1VQ9 I;  3ASN H;  3KP3 A;  1MZB A;  3HOY J;  1S7O A;  2WY8 Q;  3A2K A;  4BBS J;  5E8I A;  2RN7 A;  5HS8 A;  3HKZ N;  2P7C B;  2F2E A;  3O2P E;  4A2U A;  2DXI A;  3GFL A;  3K1M A;  2JUG A;  5IYB J;  2H6C A;  2XSD C;  2L01 A;  4BEH A;  2BVM A;  4ZDO A;  1MJB A;  2DOF A;  2RAE A;  1XD7 A;  1SD5 A;  2L9V A;  4ESB A;  3OS1 A;  1LVK A;  4E7Z A;  3RTR A;  2G7H A;  4ITV A;  1X1C A;  2JRM A;  2O3F A;  3RCO A;  1JUM A;  3MKL A;  5EZG A;  3I64 A;  4EMS A;  3VSL A;  5FKN A;  3JRI A;  5FLV A;  2AHQ A;  1IRG A;  2VI6 A;  2PMU A;  2UZK A;  3CUQ C;  3QPL A;  4HEA 2;  3V42 A;  4DW6 A;  3FBN B;  4I2O A;  1UHW A;  3OIQ A;  3PUF A;  3OYA A;  3IV5 A;  3L2Q A;  5DS9 A;  4E7J A;  2ZXJ A;  2M45 A;  1ZK8 A;  3BY6 A;  2K9Q A;  3BR5 A;  5L3B A;  3PL8 A;  1SFU A;  2P7V B;  4FAS D;  1VQP I;  3BP8 A;  1VQL I;  3JAM K;  4FQG A;  2FE3 A;  1CGP A;  3ZQC A;  3LL7 A;  5B66 C;  3H3V K;  4FX0 A;  4UXN A;  2W82 A;  2EIN H;  5BNG A;  3RPU D;  3P9K A;  3HTU A;  1IN8 A;  5JI6 A;  5CPR B;  3WTT C;  5DYM A;  5ICF A;  3ZMU A;  1UZC A;  1BR1 A;  3B73 A;  4CCN A;  2HOA A;  2HQN A;  4PGH A;  2X4H A;  3QOP A;  1WI9 A;  4BDY A;  1ETW A;  1VQ5 I;  1FP1 D;  3HOV J;  1LEB A;  1TW3 A;  3FX3 A;  1TWF J;  2HS5 A;  1Z6R A;  1E3O C;  1KGS A;  4HNU A;  1H9G A;  3AFH A;  2YUS A;  2KMU A;  3GTK J;  4C3J J;  4L18 B;  1FTT A;  2XAJ A;  4L9J A;  2VC0 A;  3IH2 A;  4MQ9 F;  1RUO A;  4IHV A;  3RQI A;  4HLX A;  1OCC H;  2GIV A;  2F48 A;  4CA0 A;  2R5Y B;  4UHT A;  4KDP A;  3K0L A;  3MCZ A;  2KIF A;  5J3L A;  4I0A A;  1T33 A;  1WGX A;  4AYB N;  1AHD P;  2IW5 A;  4RB0 A;  2KP6 A;  2RNG A;  1SMY F;  2CQN A;  3HL2 A;  1QPI A;  4C2T A;  4CCJ A;  3KZI C;  1S8N A;  2VKE A;  3G1O A;  2JK3 A;  2D1V A;  4PSW A;  2NVT J;  2ZJ2 A;  1TQI A;  3H35 A;  1Q1V A;  1VZ0 A;  5HVQ C;  2QA4 I;  3GTJ J;  1ZRC A;  4IHW A;  1A5J A;  3VB2 A;  1I3A A;  5BQT A;  2PMZ N;  4BE1 A;  2NS0 A;  5TRD A;  2WV0 A;  1ZRE A;  1APL C;  2H8R A;  3EET A;  1Z21 A;  2GOX B;  2VL8 A;  3LSM A;  4A0Y A;  5LD2 C;  3CUQ A;  1BN5 A;  3LQQ A;  1DP7 P;  2ZME A;  1HA8 A;  1S6L A;  3OIP A;  1LE8 B;  2FQ4 A;  1VQ8 I;  2W25 A;  2Z16 A;  5IOZ A;  2LSO A;  1R5H A;  3S1R J;  3BR3 A;  2AQF A;  4BE2 A;  2A05 A;  2CS3 A;  3GBG A;  4LG0 B;  1PP7 U;  5FKL A;  2XRL A;  4WXC A;  1G3W A;  4EGZ A;  1T2K A;  2IP2 A;  2F6C A;  5GAE J;  3OMY A;  2Z5U A;  3JTH A;  5LFA A;  2FJ1 A;  3S32 A;  1DU6 A;  4KT5 C;  1MBK A;  1J75 A;  3PNY A;  4QPO A;  4WXD A;  5HNF A;  4ZJZ A;  2CO5 A;  4BAC A;  4XOT A;  1IO2 A;  2DYS H;  4DIQ A;  3R4K A;  4CHU A;  3V4G A;  5L3D A;  2R5Z B;  1R6R A;  1XGO A;  1F43 A;  1RKW A;  3FM3 A;  3O6B B;  2FQ3 A;  2LTP A;  4A5N A;  4LB6 B;  5CVI A;  4D7M A;  1BW6 A;  1JT0 A;  1E3P A;  1HKT A;  3BR0 A;  3HB9 A;  3KPH A;  3VOD A;  2DTR A;  3RKQ A;  2O6G E;  2IVM A;  4KT6 A;  3GEZ A;  3K4J A;  2X0L A;  4AC0 A;  3B02 A;  4ABZ A;  1G6N A;  2XAG A;  2KIQ A;  1IV8 A;  1FZP B;  5H2F C;  3DBR B;  4XRF A;  3H0D A;  1Y1V J;  2V9V A;  4E7H A;  4YFN F;  1YIJ I;  2WAQ N;  1HQC A;  1UG2 A;  4IX7 A;  1YX5 A;  1SMT A;  1XGS A;  1YW8 A;  3FXR A;  1Y8R B;  1I5Z A;  3VDX A;  1E3H A;  3U21 A;  3HOZ J;  1R1U A;  1Z7U A;  3A03 A;  1IG7 A;  2DOD A;  2GXB A;  2DLL A;  4OAZ A;  3F9K A;  2GOM A;  2LKP A;  3Q0U A;  3I4N J;  2EBI A;  3IHU A;  4QLC U;  4HW0 A;  2KIM A;  1YO5 C;  3BG6 A;  3M07 A;  1J9I A;  3R61 A;  2HKO A;  4PK4 A;  3MKW B;  2R7Z J;  4BJT A;  2GA2 A;  3J81 K;  2KJB A;  2E7W A;  3H5R A;  3FK7 A;  1PUE E;  2PMZ A;  2WTE A;  2CV2 A;  4HAM A;  1PDN C;  1NK3 P;  1OJL A;  4ENJ A;  4BDZ A;  2XKP A;  4CZZ A;  4NNJ A;  4DBR A;  5EDN A;  1JHH A;  5D8L B;  1BC8 C;  3N97 A;  2DA3 A;  2VB6 A;  4OIR F;  5LHH A;  1D1C A;  1FC3 A;  2FX0 A;  3FIS A;  2OTJ I;  1XN7 A;  4RM3 A;  2RRE A;  5F6F A;  2NRA C;  1H8A C;  4XL9 A;  2WBM A;  1ETX A;  3MAJ A;  4RMN A;  1LE8 A;  3CP8 A;  4GXO A;  3SZG A;  3ECH A;  3CUQ B;  5E20 A;  1IGN A;  2CV1 A;  4D9J A;  2KDZ A;  2R7V A;  2ZKZ A;  3TW7 A;  1RES A;  3GVA A;  2HOT A;  2JJ7 A;  4IHS A;  1VQ6 I;  1MNE A;  4BEH B;  5JVT A;  4OIQ F;  3IAM 2;  1R36 A;  3TOB A;  2HDW A;  2CFO A;  4G7H F;  3GCM A;  3CO7 C;  1I3Q J;  3LAP A;  2W7N A;  3BTC A;  5CQE A;  5E1Z B;  1ZEL A;  3RQ4 A;  4CGZ A;  2XUB A;  1S5L C;  3BJ6 A;  3I9V 2;  3KE2 A;  3OIO A;  4JX5 A;  4HLY A;  2F4M B;  1F4K A;  2HWV A;  3ZXS A;  4I76 A;  4LIU A;  2VPL A;  2OJE D;  4IL6 C;  4XSZ F;  1IC8 A;  4JK1 X;  5E3O A;  1EKE A;  3S8P A;  4RGX A;  1TT0 A;  4M71 A;  4BY7 J;  4XQF A;  4ZYE A;  4HOB A;  1SD7 A;  2QEN A;  3GTM J;  3RKX A;  2L2O A;  2CV0 A;  2JPB A;  3D1N I;  2EV6 A;  1LQ1 A;  2CUF A;  1X3W B;  4R1H A;  4A3D J;  2ZME C;  2HOS A;  1RC9 A;  2EZI A;  5ILU A;  2HVR A;  3S14 J;  2VJI A;  2HTJ A;  2MA3 A;  2BVL A;  4U0V A;  1O57 A;  2UXX A;  4HSR A;  2M5W A;  1R9T J;  2LOO A;  4NUB A;  4I7H A;  1T95 A;  2ZME B;  4WCG A;  3OS0 A;  3VOE A;  3A0H C;  3E6M A;  2DN0 A;  1PUF A;  1TQM A;  2EQR A;  1YI2 I;  4UVB A;  3BTL A;  2ZSI B;  2M4G A;  2CG4 A;  1U3E M;  3KEY A;  3FXJ A;  4ZYA A;  3JRF A;  4Z6Y A;  4HST A;  2FML A;  3C3W A;  5ILS A;  3U1D A;  3GTP J;  3W6V A;  4B09 A;  2QKL B;  4HF1 A;  5HNH A;  3A1Y A;  4P9F A;  3KX2 A;  1W0U A;  1FOK A;  2K3F A;  2L9N A;  4NHJ A;  4PSX A;  2O61 A;  2KRH A;  4UUS B;  4ENK A;  2ETH A;  5HOO A;  2EA4 A;  4YIF A;  3ZPL A;  4AD9 A;  1V4R A;  4AID A;  1R71 A;  1MH4 A;  3WG9 A;  2WAE A;  3BZK A;  3Q9S A;  3LSP A;  2VJJ A;  1B4A A;  3WTX C;  1K7A A;  2XAQ A;  2RKH A;  4GCV A;  2PLY A;  4BY1 J;  2R93 J;  5D5X B;  2ELK A;  3T8R A;  3BPX A;  5K5R A;  4CCO A;  4A0Z A;  1I6H J;  2HQA A;  2AO9 A;  3ULQ B;  3GYH X;  3FXM A;  5C4X J;  3WTV C;  3E6C C;  4NDL A;  3QP6 A;  3S16 J;  1ZG5 A;  1ETK A;  3HBL A;  4EQQ A;  1MBH A;  2CW8 A;  3CD6 I;  2LF7 A;  3WHB A;  4D1Q A;  4DYR A;  1A35 A;  2M0M A;  4LFU A;  1IV6 A;  2QLZ A;  5IY5 H;  1ZLK A;  1EF4 A;  5DCF A;  1WH5 A;  2ME0 A;  4ANJ A;  2D45 A;  1T0F A;  5GTI C;  5EGO A;  1XMA A;  5FRM A;  5CJ9 A;  3EUK L;  4OAY A;  5K5O A;  1STZ A;  2R7R A;  4G6T B;  1XB4 A;  2OPT A;  4LJZ F;  1ON2 A;  5K5Q A;  3DKX A;  3WG7 H;  3PO3 J;  3CCE I;  5J6X A;  2VBW A;  2VJ4 A;  2V26 A;  2P4W A;  2DT7 B;  2Z2S B;  1XCB A;  4PZJ A;  1Y0U A;  2F5F A;  3IP4 B;  2XGE A;  1JKO C;  1K6Y A;  2RC4 A;  2VC1 A;  4L5J A;  2HVS A;  3CF2 A;  1F1Z A;  3I3L A;  3BTI A;  3R0A A;  1YJN I;  9ANT A;  4PFP A;  4Q47 A;  2HZT A;  3KLO A;  3OYM A;  2IA0 A;  4G12 A;  4IHY A;  1SFX A;  5E3L A;  2XGD A;  2XRN A;  2DT5 A;  4II3 A;  2ZCW A;  1D8K A;  2YX7 A;  3KYC B;  5KAF C;  5LGU A;  2JVG A;  2EIM H;  3CES A;  4HZF A;  4ESJ A;  2VBX A;  4KMF A;  1ETQ A;  3QPH A;  2JMW A;  3BR2 A;  3NWT A;  2L7F P;  2WA0 A;  4RDU A;  1QZE A;  2AXL A;  3Q9V A;  3HRT A;  3CJR B;  1A31 A;  1IRF A;  2VLA A;  2Y30 A;  2K9S A;  2QF7 A;  1VQ4 I;  3HZJ A;  1R4N B;  5HDK A;  2EIK H;  5HDG A;  1MMA A;  1IN6 A;  1S9H A;  1TWG J;  2CYY A;  2XAF A;  2V9K A;  2DTZ A;  2NS7 A;  5D4S A;  1MSE C;  2IA1 A;  4B48 A;  2G7U A;  3JSO A;  4H0E A;  1L3L A;  4UUV A;  3DFG A;  1GDT A;  4D5C A;  1J2X A;  1TZL A;  4MFE A;  2XF7 A;  3L2C A;  2A5W A;  3FMQ A;  1Z9C A;  4HBL A;  2RNJ A;  1ZGJ A;  4HV6 A;  2H1L A;  4XLH A;  2G9W A;  2TRT A;  2O8K A;  2HXO A;  3F3X A;  4CZC A;  5J40 A;  2GM4 A;  1S72 I;  3PJR A;  5BS6 A;  1QQI A;  3K1P A;  2R7U A;  2Q0O A;  1W1W E;  1OR7 C;  2GZW A;  2ZFU A;  4UB6 C;  2P0W A;  5FO5 A;  1XMX A;  3H9Q A;  3RJP A;  2AS5 F;  3IH3 A;  2PMH A;  3I4P A;  3GTG J;  1A6Q A;  3CZ6 A;  3WTY C;  2EPF A;  3M8E A;  1Y8Q B;  2VBY A;  4A3M J;  3BQY A;  4DZP A;  3MKZ A;  1B72 A;  4TV7 A;  4IQJ A;  4BUP A;  3GTL J;  4I6Z A;  1HCR A;  2M1B A;  2XPV A;  2NXN B;  1IXC A;  1VND A;  5D8K B;  2Z9O A;  4F92 B;  2A6E F;  2GXA A;  1WQ2 A;  3CLQ A;  3JRG A;  3P5J A;  1OPC A;  3G71 I;  2KHM A;  4PJM A;  3GFI A;  3I53 A;  2A6T A;  1GUU A;  3WU2 C;  2DBB A;  1RI7 A;  3LSG A;  4OOI A;  3DEU A;  3CCL I;  3DKY A;  1BR2 A;  3X2Q H;  3ML6 A;  2EB7 A;  3E5U A;  3J80 Z;  1WJ5 A;  3CJN A;  1ENH A;  3TQN A;  1EJ9 A;  1U8B A;  4XLP F;  3IC7 A;  4RB2 C;  3EPZ A;  1S3J A;  3DWL E;  3K6G A;  4ZH4 F;  2KKO A;  4M3F A;  1KU7 A;  3WHC A;  2DMT A;  1JHF A;  2EK5 A;  2MG4 A;  3HOX J;  3HRS A;  1V54 H;  1MMN A;  4XRS G;  2X6X A;  3H9G A;  2JZY A;  3L00 A;  3U1K A;  1NG7 A;  4ZDL A;  4F7Z A;  2NOG A;  4GFB A;  3QWL A;  4JQF A;  2P5V A;  3OSG A;  2E1M B;  2HXI A;  2JN6 A;  2YX4 A;  3Q0W A;  3WE2 A;  2DA7 A;  3HEF A;  3GUD A;  2IGK A;  5IOY A;  4DQ2 A;  3U9G A;  5EEA A;  1G4D A;  4ZYH A;  1YHQ I;  2IRF G;  5FRN A;  5J4V A;  2VIX A;  4F52 A;  1E0E A;  1LFP A;  1TQP A;  2ECB A;  4Y3O A;  3L2W A;  2K40 A;  5LGN A;  1BBY A;  1ZLJ A;  2L7Z A;  4JYK A;  2Y9Z A;  3ERM A;  2E5Z A;  1ZGA A;  1IDZ A;  4A0X A;  2HYJ A;  2LK2 A;  2M34 A;  5F64 A;  4HF2 A;  3GW2 A;  1WKM A;  1D3Y A;  1W5C C;  2F5E A;  1ZTR A;  4B4C A;  1KYW A;  1ETY A;  1JKQ C;  2V1D A;  3BT9 A;  3I59 A;  3K2A A;  3VFZ A;  2DW4 A;  4O6J A;  3HGY A;  4Y52 J;  2DPD A;  3S1M J;  3HPH A;  5A2Q K;  4XMY A;  1S29 A;  5DCM A;  2LBF A;  3I56 I;  4OMY A;  5M5W J;  3K4M A;  3OR2 C;  4BKX A;  3ZMS A;  3K70 D;  5EZH A;  1SEU A;  2FF4 A;  4BL0 B;  5LHG A;  1LKX A;  4YFK F;  3A4C A;  4UY8 I;  4YEJ A;  3L09 A;  2ZXW H;  5TIS C;  2FMY A;  2Z33 A;  2HI3 A;  5IP6 A;  1FP2 A;  4B44 A;  2OCE A;  3BCA A;  2EFO A;  3E3V A;  3ZGK A;  2XAU A;  5LLQ A;  5EJC A;  3CC4 I;  4J19 A;  2KDO A;  2DAO A;  1OCO H;  3N4M A;  4RB1 A;  3MD2 A;  3E6D A;  5DV5 A;  1UG0 A;  4I02 A;  4BGD A;  1CF7 A;  2DMN A;  5BOX A;  1YX3 A;  2EZK A;  1HST A;  4RAZ A;  1D0X A;  4C3H J;  5IYD J;  1R7J A;  1D0Y A;  2Q2E A;  3PUB A;  1ERD A;  4D0P A;  5EG0 B;  2FA5 A;  3RI4 A;  5B3S H;  2HNH A;  5K7F A;  3AG2 H;  1LNW A;  2MFZ A;  2HR3 A;  3M7G A;  5D5V B;  1C0W A;  4OIO F;  1R5G A;  4PFO A;  4XIC A;  3LSJ A;  3ZR8 X;  2M7A A;  4IOC F;  1HBX G;  5ED4 A;  5BMZ A;  2FBK A;  1YQA A;  2KPM A;  3G1M A;  4RS8 A;  1WPK A;  2I5U A;  1K79 A;  5IP9 J;  3R60 A;  4RLQ A;  2IPQ X;  2X6O A;  1W5T A;  2E2H J;  1ITY A;  3QYE A;  4MGR A;  3L1P A;  3PM1 A;  3FBI B;  5FLX Z;  4LIV A;  5KHD A;  3DU5 A;  2KZV A;  1QHG A;  2QKM B;  3BDD A;  1NH3 A;  1SAU A;  3V8K A;  1FIA A;  5M3M J;  3OYG A;  4FX4 A;  3ISP A;  2CQK A;  2D2W A;  4B3A A;  2EJR A;  3A0B C;  1F9N A;  3KP2 A;  4IHX A;  4XR6 A;  3JRE A;  2DYR H;  4Z2Y A;  2HU9 A;  3DTE A;  2FNA A;  1QBJ A;  3HOT A;  2K9L A;  1JXS A;  3T5X A;  3H92 A;  4ZZL A;  2YSR A;  1JTY A;  4R8H A;  2J5P A;  3E0J B;  4OU0 A;  3HHH A;  3NEU A;  3F22 A;  1QHH D;  3MVP A;  5F1J A;  3WU1 B;  3SHF A;  3GXO A;  2H1K A;  3HPG A;  1YYV A;  1ZRF A;  3IRQ A;  1MDM B;  1D5V A;  4MIM A;  4AIH A;  2MH2 A;  2XF5 A;  3DCF A;  2C6Y A;  3ABU A;  1GT0 C;  2X85 A;  3OYI A;  4E7I A;  3S2H J;  2ESH A;  2V1N A;  5DM7 F;  4NB5 A;  2K27 A;  2E71 A;  3QOD A;  4XN3 A;  4UNO A;  3PNV A;  5IT9 K;  5FKO A;  3DPL C;  5JFR A;  1BI0 A;  2L4M A;  2Y48 A;  2XPW A;  3CJQ B;  2BHZ A;  2FRH A;  2L0K A;  2DDB A;  2XDV A;  4G8X A;  4XK4 A;  2QEX I;  3PNT A;  4M3D A;  1Z91 A;  3W6J B;  1TWC J;  4Q4Z F;  4Y4R A;  1KU2 A;  5GTH C;  3CUO A;  4M3B A;  2YU3 A;  1W36 D;  4HF0 A;  3S3N A;  2HDD A;  1D1B A;  1XSV A;  2K9N A;  1HOM A;  3TL4 X;  3PSF A;  1B59 A;  3E1S A;  4BS9 A;  1O3T A;  4BHB A;  1Z77 A;  5B1A H;  4LK0 F;  3QYB A;  1LJ9 A;  2EIL H;  3W2W A;  4M6V A;  1JKP C;  1N25 A;  3RYP A;  5LGT A;  4GYI A;  3BPV A;  3SEQ A;  5K7Z A;  1XDS A;  4UUS A;  4W97 A;  1UAA A;  1O7L A;  2H94 A;  1WSU A;  5F0C A;  2BY1 A;  2CQ7 A;  2VJ5 A;  2LG4 A;  4UB8 C;  2BXY A;  1YJW I;  2BY2 A;  2HQR A;  4DYQ A;  2LP0 A;  2DK8 A;  3HSE A;  4CYC A;  3M9A A;  2NNN A;  3O8H A;  2M8G X;  2TDX A;  1MSF C;  2A5Y B;  4X6A J;  2K3P A;  2Y69 H;  2M2E A;  2DQR A;  2LC2 A;  5LHI A;  2M0C A;  2CW0 F;  1FYK A;  4J00 A;  5C44 J;  3HUG A;  4I01 A;  3DXJ F;  5H6R A;  1JGS A;  1DPR A;  3AAF A;  3ZQF A;  1EV7 A;  5JHF A;  2IS2 A;  1HLV A;  1OMI A;  3FXK A;  2WAQ A;  5J4Y A;  2H27 A;  2X1E A;  2BW3 A;  1DU0 A;  2W4S A;  3H36 A;  1XC5 A;  5CVR A;  2RGV A;  2HPM A;  3WE3 A;  4V2F A;  4BQO A;  1MH3 A;  4BH9 A;  1K78 A;  3Q5F A;  1FEX A;  3ZN0 A;  3K69 A;  2MBF A;  3PIO F;  2QYO A;  3HG9 A;  4IO9 F;  2ELJ A;  4IXA A;  1RIO H;  1P6R A;  4IRI A;  4ENN A;  4XKB A;  4G6Q A;  4OIP F;  2HVQ A;  3HOU J;  2QCO A;  1LUJ B;  3VYT B;  4E4H A;  3HHG A;  1U5T B;  1X1D A;  3HSR A;  1OCT C;  2IS1 A;  4KYW A;  2YU9 J;  2ELH A;  4E7K A;  5ICC A;  2LMD A;  3K2Z A;  1DPU A;  1U0J A;  1WRJ A;  1BI1 A;  3I54 A;  1R49 A;  1YIO A;  4PJ0 C;  2K85 A;  4HX4 A;  3CCU I;  4U0W A;  2XHK A;  4L9V A;  3CCS I;  2K86 A;  5E18 F;  5K1Y A;  1TP4 A;  2BE5 F;  2PG4 A;  5E17 F;  3RZO J;  1Y1W J;  2NVY J;  1IW7 F;  3MFK A;  1CQT A;  1TTY A;  5F0F A;  1X3Z B;  2DA2 A;  3L7W A;  1B8I B;  2PN6 A;  5FFX A;  1A36 A;  3KFW X;  5F04 A;  4EV0 A;  5FD5 A;  2MGQ A;  5ICG A;  1X1A A;  3SEZ A;  4FCY A;  4LB5 A;  3GLX A;  4RB3 C;  3K4C A;  1SAX A;  2NAZ A;  3M1C A;  2K5C A;  1LVA A;  2DDA A;  3MN2 A;  3C7J A;  4A6D A;  3DKW A;  3HC7 A;  2L9S A;  4KIG A;  5J1R A;  4L9T A;  2PFB A;  4IHT A;  2EV0 A;  2K4B A;  2CW7 A;  4WXH A;  2ECC A;  1OYI A;  3KP6 A;  4RA2 A;  3CMA I;  2F5C A;  3G2B A;  2KZG A;  2JSP A;  1J09 A;  1ZAR A;  5GAH J;  4G7Z F;  2BEO A;  4M3G A;  2Y9Y A;  3KET A;  2VT3 A;  5CVV A;  1W7P D;  1WWX A;  1Z05 A;  2V7F A;  1SFK A;  1SVM A;  5BPI A;  4IKF A;  1RZ4 A;  1PUF B;  1J0R A;  5M5X J;  2JRT A;  1EA3 A;  5J47 A;  2M7B A;  3GTO J;  4Y13 A;  3D5L A;  1Y6I A;  3OYB A;  3CMY A;  1G3T A;  3SFI A;  3CMM A;  5IT9 Z;  5CYV A;  2FUG 2;  3F8C A;  2VQG A;  4JOM A;  3A01 A;  3HOS A;  5ILV A;  1BI2 A;  4FE7 A;  1UST A;  1T39 A;  3WGH A;  5JR3 A;  2D1H A;  6PAX A;  1YFH A;  2JSC A;  2DMP A;  3KP7 A;  2LYC A;  1XCV A;  4G6D A;  3DQV C;  2MAB A;  3ZMV A;  4GYG A;  2PI0 A;  3F8M A;  3BOQ A;  4S04 A;  3Q0V A;  4CXF A;  2OAZ A;  2MYS A;  3FMS A;  1G8X A;  3OOU A;  2CQQ A;  2XC7 A;  1ZR2 A;  4P1W A;  2XB5 A;  3FF5 A;  4Q5S F;  5DUK A;  4KIB A;  4Y15 A;  4B3X A;  2UXN A;  3CCM I;  1YIT I;  2DOA A;  2ZXH A;  4IVN A;  1H89 C;  1REP C;  2FOK A;  5FGM A;  3SYT A;  5KVR A;  2FNP A;  1J5Y A;  3T0Y A;  1VQM I;  1HW1 A;  3S1Q J;  1T8I A;  3GFJ A;  3BZ6 A;  3TO6 A;  3KZY A;  1W0T A;  2L54 A;  2OBP A;  2A61 A;  1YE9 A;  4YFX F;  1G3Y A;  4A3L J;  2IEK A;  1TL8 A;  4L0Y B;  1P4A A;  2L9R A;  1JT6 A;  4L5E A;  1FOY A;  3G73 A;  5DDG A;  5J8F A;  2R92 J;  1UFM A;  2PJR B;  5HLT A;  3EUH C;  4YIR X;  4EM0 B;  4BXF A;  4A6E A;  4LG0 A;  1HDD C;  1XMK A;  3TOA A;  4MEY F;  2XKO A;  2L3D A;  4FHT A;  2OTL I;  4G7O F;  2IXS A;  3RYR A;  1MBF A;  2D5V A;  3QU3 A;  3CDI A;  3VEP A;  3WTS C;  1MDM A;  4XKC A;  3CO6 C;  3GO5 A;  4CUG A;  2KT0 A;  3CF5 F;  2G0E A;  2E35 A;  2ZC2 A;  2HEO A;  3LFU A;  5DM6 F;  2Z99 A;  3SXY A;  5GP9 A;  1X4P A;  1NTC A;  2KRC A;  4BBR J;  4EVI A;  2A69 F;  1R22 A;  3ZQI A;  1WJF A;  3K10 A;  4RLF A;  1IUF A;  1ETO A;  2R3S A;  1VQK I;  3M8J A;  1BIA A;  2TCT A;  1YJ9 I;  5HS9 A;  1SVO A;  1XGM A;  2F4O B;  2F5V A;  4KN4 X;  2OV7 A;  4II2 A;  2QBY A;  1L0O C;  4M6Y A;  3QU6 A;  1UMQ A;  4HRI A;  2QWW A;  4CIC A;  4YRV A;  5FLM J;  4ETS A;  2ZJP F;  2BYV E;  1GV2 A;  4CSW A;  5AIQ A;  2VUM J;  3BQZ A;  3FKI J;  2HQ5 A;  4XKV A;  1O3R A;  1A6I A;  3F23 A;  1FTZ A;  2R0Q C;  3MZY A;  3DLA A;  1X1P A;  4DOZ A;  3S15 J;  3D5R C;  1OYY A;  1X4O A;  4NBQ A;  2ISZ A;  4RGS A;  3K9T A;  4E6K G;  3FXL A;  4NQW A;  1HW5 A;  1UHS A;  3WGG A;  3DTI A;  1IRX A;  3H5A A;  3CC2 I;  1IDY A;  2ME6 A;  3JR9 A;  3NAR A;  4M72 A;  1U9O A;  2ZNZ A;  2K02 A;  3L2V A;  3H3U A;  3QP5 A;  2IGO A;  1JE8 A;  2WWY A;  1XX5 A;  4KFC A;  1OIS A;  4RAF A;  1I6X A;  4CYD A;  2R7X A;  5KNL A;  2PJP A;  2Q2E B;  2FSW A;  1D0Z A;  1B6A A;  1W7P A;  3BRO A;  3M1E A;  4CCL A;  1ZG3 A;  1SVL A;  2X1C A;  1UEL B;  4PJJ A;  4JBA A;  4A3I J;  1RET A;  3IWF A;  2MLG A;  2Q8K A;  2R5Z A;  2FOW A;  1G59 A;  5M3F J;  1BW5 A;  4EM1 A;  3GZN B;  5F08 A;  3F6O A;  2OQG A;  5E3M A;  1HF0 A;  1XDU A;  2ZJR F;  2MW8 A;  1QA6 A;  2E5N A;  5KAI C;  3ZMD A;  3F21 A;  1ZR4 A;  2W24 A;  1JI8 A;  2ZO4 A;  4XNF A;  1HKQ A;  4EM2 A;  4HV5 A;  1DGR M;  5KCM A;  4IRH A;  2KL4 A;  1MMS A;  2W85 A;  4H4K C;  4NC7 A;  3LA3 A;  2MH9 A;  3ASO H;  3DU6 A;  2VE8 A;  3ERE D;  3I58 A;  3T1B A;  1BC7 C;  1XSD A;  1O4X A;  4AYB A;  5GAG J;  4A3K J;  4A3B J;  2LRE A;  1FWZ A;  5L3F A;  2MD0 A;  4PJL A;  2XVC A;  3SJM A;  3S17 J;  3ZN1 A;  3I4M J;  2LKS A;  4XOR A;  5E1W A;  3KCC A;  2Y2Z A;  2LDU A;  1MJA A;  2XAH A;  1D1A A;  3DEE A;  1JJ8 C;  3CCJ I;  1WZ2 A;  2GBY A;  3HRM A;  1MJ9 A;  3K4L A;  3ZQQ A;  2V4J C;  3IKT A;  2R7T A;  3OWT A;  3FWE A;  2M8E A;  2E60 A;  2VXZ A;  2NVQ J;  3B6A A;  4X0G A;  4M73 A;  4P55 A;  2RV8 A;  5D6E A;  4D5F A;  5GAD J;  2AQE A;  5AON A;  4F3Q A;  1R1V A;  1YLF A;  1OYW A;  3IAS 2;  1FNN A;  4HX7 A;  1JJ6 C;  3KIO A;  4DYC A;  3C2H A;  1YS7 A;  1K6O A;  4J01 A;  4C2U A;  2KLO A;  2JTV A;  3LFK A;  3LSI A;  4Y33 A;  3WU0 A;  2EFW A;  1BOA A;  2V1U A;  1FLI A;  3MZH A;  3RPQ A;  3FHZ A;  5FB2 A;  4XID A;  2DA5 A;  1FY7 A;  3ONQ A;  2A6H F;  4E7S A;  4LD5 A;  5ERI A;  2HDC A;  4QSH A;  1M1E B;  2IJL A;  3K4N A;  3DV8 A;  2BHY A;  3NQO A;  1T98 A;  3JW4 A;  1RR7 A;  1U9N A;  2GIZ A;  2AXT C;  4I99 C;  1VQO I;  1DUX C;  3QQA A;  3IWZ A;  3KP4 A;  2ESN A;  3TP3 A;  2XGX A;  2FU4 A;  3OYN A;  3I55 I;  1TBX A;  4C2M J;  1A04 A;  4ZC3 A;  2O03 A;  3OYF A;  3GTQ J;  4ZDP A;  1OLT A;  2I8D A;  1P4X A;  2E1N A;  1Z7L A;  2NYX A;  2HTS A;  2HYF A;  4QIW N;  3RSN A;  2GQQ A;  2DFH A;  3JAM Z;  5JLX A;  1SD4 A;  4LLN A;  4EJO A;  5D6F A;  2HFH A;  4MHG A;  3LA7 A;  3KYL A;  2BW3 B;  3CDL A;  3JRD A;  2Z1D A;  3MEX A;  3FXU A;  3CDH A;  2OQR A;  3KP5 A;  3KZZ A;  5HLH A;  1DP3 A;  2DO7 A;  1T56 A;  1YOV B;  4L0Z B;  2V6C A;  2MD5 A;  2ZB9 A;  4MQV A;  3DBH B;  1SAN A;  1XS9 A;  5C3E J;  5IT3 A;  2R7S A;  1I1G A;  1Z67 A;  2R7Q A;  2BBY A;  1KYZ A;  3P9C A;  2DA6 A;  4U7D A;  1V5E A;  2OZU A;  1WH7 A;  1T0F C;  5E8G A;  3BG9 A;  1R5I D;  1P92 A;  1O7F A;  2X48 A;  4FET A;  1TNT A;  3J7A O;  2VON A;  1BJA A;  2E36 A;  4PDK A;  3F8N A;  1Y39 A;  3ZQL A;  4AVP A;  2JWT A;  2VBZ A;  3TP0 A;  3LST A;  3CCV I;  1VI0 A;  2QVO A;  4C30 A;  4L5I A;  3S2D J;  4BJ6 C;  1W7P B;  4YII A;  4P5O A;  2NVX J;  4WWC A;  3KLN A;  3F8B A;  3WGI A;  3J80 K;  3NAU A;  5DUI A;  3IRR A;  2QBY B;  2ZXI A;  3FK6 A;  3VYU B;  2QUF A;  1RKT A;  3E97 A;  3HYI A;  4HX8 A;  3BG3 A;  4HPQ A;  4HNT A;  3G4S I;  1K4S A;  2WAF A;  2W1O A;  4KIF A;  2KIS A;  4JX6 A;  2WV1 A;  1T38 A;  3TDZ C;  1VQN I;  4BQN A;  2CGP A;  1HXD A;  3FIW A;  2DOE A;  1JTX A;  2O0Y A;  4OIN F;  4FT8 A;  1MD0 A;  4UV8 A;  3VYR B;  1NHA A;  4X1E A;  4B43 A;  2JVH A;  3K70 C;  1KU3 A;  3TKY A;  1D5Y A;  1GVD A;  3V8J A;  2ID6 A;  3P7N A;  3A02 A;  4K2E A;  3C18 A;  3R0J A;  1ORK A;  3OS2 A;  1Z3Y A;  3TBI A;  1B72 B;  3GFM A;  1HKS A;  5IPA A;  3KEQ A;  3BLY A;  2JA8 J;  1K61 A;  3OL3 A;  4IZZ A;  3V7S A;  4EEF G;  4CCK A;  1N75 A;  4JX4 A;  1MBG A;  2P5K A;  1MKM A;  3OY9 A;  3W6K B;  2IS6 A;  4I0B A;  2VQH A;  4AWX B;  2VQC A;  3S93 A;  5CVJ A;  2QQA A;  4CYC B;  4U7B A;  3IKV A;  3I71 A;  2ADU A;  2XRO A;  1IUY A;  4G94 A;  3U2R A;  3R6S A;  1TW2 A;  1TLH B;  1IJW C;  2VOO A;  5D5U B;  2HGC A;  2R7D A;  3I5U A;  2M4K A;  2QZ8 A;  2R7W A;  3QRF F;  2ACJ A;  2DT6 A;  4QPQ A;  1OKR A;  3OSF A;  2O9L A;  1EH6 A;  2VOP A;  3TW6 A;  4EJW A;  2A68 F;  1LFB A;  3G1L A;  4BU2 A;  1OCP A;  3H9J A;  4A69 C;  3E7L A;  5J8C A;  4KNY A;  2BZT A;  2OC6 A;  4BYY A;  4M74 A;  4FTH A;  2EZH A;  1JKR C;  1QU3 A;  1SD6 A;  2VN2 A;  1OCR H;  4BAY A;  4YG2 F;  3COA C;  5HLI A;  3TED A;  2VT2 A;  1S7A A;  1K4T A;  3LAJ A;  3MQ0 A;  4ENM A;  3M4O J;  4G9Y A;  5B5E C;  1FBU A;  3TDU C;  5H6Q A;  5EF6 A;  5TGT A;  2N8G A;  3H5N A;  2QGU A;  4N0B A;  4A12 A;  1HC8 A;  3E6B A;  1LDD A;  1BIB A;  2WB1 N;  1V3F A;  4HA8 A;  2XPU A;  4IRG A;  4I98 B;  1FBS A;  3LNQ A;  1MIJ A;  3VWB A;  2LKX A;  3GF2 A;  2FBI A;  3D5S C;  1JUS A;  1TC3 C;  4B1R A;  2KJC A;  5HDN A;  3DP7 A;  4AVZ A;  4GDF A;  1I39 A;  3HJE A;  1T6S A;  4EJT A;  1GXQ A;  3QYF A;  3BZC A;  1FSH A;  3DEW A;  3SDG A;  1B9N A;  4MTE A;  2LY1 A;  2E2J J;  3S3M A;  4NC6 A;  5CKT A;  2BXZ A;  3E5Q A;  5F27 A;  5GPA A;  1D8J A;  2DJI A;  1R58 A;  1O3S A;  2CMP A;  4LIT A;  4RGR A;  1FJL A;  1KA8 A;  3C1D A;  3REO A;  1X1B A;  2UUZ A;  1IN7 A;  4XKW A;  2E34 A;  2Y31 A;  3AKZ A;  5JVG F;  3J81 Z;  5HLG A;  2V6E A;  1S7E A;  4ON0 A;  3L2R A;  4KA4 A;  4BE0 A;  3FZV A;  2X51 A;  4S05 A;  2R7F A;  3MKY B;  1LPQ A;  1RUN A;  2K7L A;  1BR4 A;  4M6X A;  5K7H A;  3CLO A;  1VTN C;  3MZ8 A;  2CJJ A;  2DI3 A;  1NG6 A;  3FXO A;  2VAS A;  1R23 A;  3ELK A;  2VKD A;  2X9D A;  1W36 C;  1QGP A;  2DMU A;  3QPT A;  3BCB A;  2OUM A;  3FM5 A;  4R79 A;  2HZD A;  1VQ7 I;  1LDK B;  3JRA A;  1WVR A;  4LGW A;  1X2N A;  1MND A;  1YG2 A;  1ZKG A;  1OCZ H;  2WAD A;  3F6V A;  4O5V A;  3C2B A;  3M8F A;  2ZJQ F;  5F1R A;  5IYC J;  5FKM A;  3HTS B;  3HXL A;  4IPA A;  4MTD A;  3OYE A;  1AWC A;  2EIJ H;  4AIJ A;  3BR1 A;  1QNT A;  1E17 A;  2K4J A;  1BI3 A;  1YW9 A;  2R4G A;  2JPC A;  2QSF X;  3CJT B;  2E1M C;  4EJV A;  4PJN A;  2DFF A;  2LVS A;  2Y0S N;  3HKZ A;  1EH8 A;  1Q1H A;  5EEG A;  5EGO B;  1GLN A;  4XOP A;  3CCR I;  3DBL B;  5JLW A;  3IUO A;  1YRN A;  2IT0 A;  4RM2 A;  3HOW J;  1PVE A;  1IXS B;  2M30 A;  3O8G A;  1WJE A;  2L02 A;  1P9Q C;  1SFE A;  3TGN A;  2CU7 A;  1J7K A;  3HGG A;  1AU7 A;  2WY7 Q;  2M3A A;  2DU9 A;  5FD6 A;  3FKJ A;  5CVU A;  3OYH A;  3A01 B;  2PX9 A;  1R4M B;  2RVC A;  4C3I J;  3TO9 A;  1GXP A;  4M9X A;  2HOE A;  2ID3 A;  3KYD B;  5DD8 A;  3S3O A;  1MGT A;  2DPU A;  2COB A;  3GME A;  1X19 A;  4DNC A;  2QQ8 A;  4MO7 A;  1OFC X;  3BTJ A;  5D4R A;  2IA2 A;  5DTD A;  3OYD A;  5CQG A;  4OMZ A;  4XLF A;  3WTZ A;  1USS A;  1U5T A;  5TJJ A;  4EGY A;  1P7J A;  3IL2 A;  4KJZ A;  4M9Z A;  1TWH J;  3HM5 A;  3H0G J;  3W2V A;  2XGC A;  4OWR B;  4A93 J;  3ZQH A;  2X6W A;  3SZP A;  2E1O A;  1YTY A;  4BHC A;  5FKK A;  1WI3 A;  1RNL A;  1Z6T A;  2Y0M A;  4LK1 F;  1OR7 A;  4ASN A;  4U0Y A;  2FBH A;  3PSI A;  3PIP F;  5J1U A;  1U8R A;  2V1X A;  3J7Y J;  1H88 C;  2IGN A;  4P96 A;  1FPQ A;  1Z0X A;  1AA7 A;  3ECO A;  3ZMZ A;  2NOJ B;  4QTR A;  3QAH A;  4U87 A;  2GAU A;  4BXU A;  2QSH X;  2EWN A;  3EYI A;  2MC3 A;  4UV9 A;  3L2U A;  2E1C A;  2HYG D;  2IGM A;  1AKH B;  3ZP5 A;  5D5W B;  1WJB A;  3BJO A;  3ABK H;  1LB2 A;  3CCQ I;  3IH4 A;  3CTA A;  2EFQ A;  5AIP A;  2DMQ A;  1FIP A;  2YPR A;  3VPR A;  4IOA F;  3JCU C;  3CC7 I;  2KIU A;  3OL4 A;  1P4W A;  1IN4 A;  5EG0 A;  2O5R A;  2VQL A;  1IRZ A;  1YRN B;  2NS8 A;  1DDN A;  2STW A;  4AIK A;  3K1N A;  3NRV A;  5J1Y A;  4B47 A;  1XG1 A;  3GWZ A;  2MSY A;  5FFZ A;  4PUS A;  2STT A;  1MNM C;  1F36 A;  5DD4 A;  3JRC A;  1PYV A;  1R1T A;  4N4N B;  2PQ8 A;  5IP7 J;  4KIS A;  3EUA A;  4WF2 A;  1UJ8 A;  4FIS A;  4A3C J;  2DCE A;  4BJ5 C;  1B9M A;  3F8F A;  1W5S A;  2LFB A;  2HPI A;  2E2I J;  1T08 B;  4A3F J;  2CFX A;  2RQP A;  5GPC A;  1IAW A;  1QO0 D;  2NVU B;  2JUC A;  4XRM A;  4LOC A;  2DFI A;  2V79 A;  2LLK A;  3HRU A;  5L3G A;  4P9U A;  3UNG C;  3GZ6 A;  1BJZ A;  4DGW B;  1P7I A;  1ON1 A;  2KRF A;  2ZBK A;  4CCM A;  2DA4 A;  2J5O A;  3KEO A;  3MMY B;  2GLO A;  3ESW B;  3E5X A;  3GLL A;  3NWS A;  2VOD A;  3I59 B;  1IN5 A;  2XF6 A;  4A3G J;  3SZT A;  3QOE A;  4HQE A;  3OV8 A;  4E70 A;  2EFP A;  4RBO A;  4EAT A;  2Z3Y A;  2I10 A;  4A3J J;  4S0H B;  4IF4 A;  2VXD A;  1MBJ A;  4AUX A;  2JT1 A;  3LSH A;  3PFI A;  1EH7 A;  2YS9 A;  3CP2 A;  2VE9 A;  2E7X A;  4ZYG A;  1KQ9 A;  1XPX A;  3W3C A;  3EUH A;  4RAG A;  2ZNY A;  1GHC A;  4WX9 A;  3F72 A;  2OF7 A;  1QZY A;  2OZ6 A;  1ZN2 A;  3EQL F;  5F0H A;  2MLK A;  2QM3 A;  4XBF A;  1LDJ A;  4MFD A;  1LFU P;  3EDP A;  5CLS A;  4A3E J;  4XLE A;  2P6S A;  3PFY A;  3VYS B;  5FRO A;  2B63 J;  2OD5 A;  2P8T A;  3CQZ J;  3HSF A;  3AL0 B;  2ISY A;  3BR6 A;  5A2Q Z;  1WJA A;  2IBD A;  2EZL A;  2VKV A;  3DF8 A;  1J59 A;  3FXQ A;  1HDP A;  3JRH A;  5B1B H;  2M9H A;  1ETV A;  1MW7 A;  3DTK A;  2E19 A;  2FEZ A;  2X1D A;  4C9Y A;  1BOB A;  5BPD A;  1RPW A;  2LH9 A;  4RAY A;  1POG A;  4GRI A;  5JHU A;  3S1N J;  3GZ5 A;  3MWM A;  4CH7 A;  2H09 A;  3H3Z A;  1FX7 A;  3LSK A;  4UVA A;  2FXA A;  3B6C A;  1UB9 A;  2LY2 A;  4DZJ A;  2XAS A;  3FDY A;  5DCM B;  4XLN F;  2NNY A;  4KUM A;  3G6E I;  3DPT A;  4GO1 A;  4IJA A;  1ULY A;  1ZG1 A;  1YW7 A;  3ZMT A;  4F55 A;  3OR1 C;  4MEX F;  1V5F A;  2M87 A;  3WTW C;  1WCM J;  3RKW A;  1ZQ3 P;  1O3Q A;  4KIC A;  4LLG F;  5M5Y J;  3OYC A;  3K4K A;  4XON A;  2ICW G;  2W84 A;  1K78 B;  1YS6 A;  3RIR A;  2QQ9 A;  2O8X A;  2OCC H;  1RR8 C;  1FBQ A;  1I27 A;  2JA7 J;  3SQN A;  3V7C A;  5LRS A;  1RRJ A;  4V2G A;  1AOY A;  2EFN A;  3HIF A;  3AG4 H;  2GWR A;  1W4M A;  4UUT A;  3BG7 A;  2Y0S A;  4E7L A;  3FMR A;  4L9N A;  3ROU A;  1FMV A;  1QVU A;  2L5Q A;  2XB0 X;  3I0T A;  4XLA A;  5ICE A;  5L3C A;  2BY3 A;  2P81 A;  3VSK A;  3PO2 J;  4LLL A;  1GVJ A;  4FE4 A;  3V7R A;  3LQR A;  3C2G A;  3LA2 A;  1KQ0 A;  3ZQ7 A;  3RPU A;  4A5M A;  3LWF A;  2JA5 J; 
#chains in the Genus database with same CATH homology
 4O3M A;  5L3E A;  2F5D A;  4RGU A;  1XGN A;  1G3S A;  1TNS A;  4KMU X;  4BNC A;  5E1X A;  1F5T A;  2DQL A;  2W57 A;  4BHP A;  1LEA A;  4ZZD A;  2RDP A;  3JTG A;  1H0M A;  1CF7 B;  4Q48 A;  4HYE A;  3D0S A;  3RKY A;  1IF1 A;  3EYY A;  1PP8 F;  1Z1D A;  3RDI A;  2B0L A;  5H20 A;  2HKX A;  3TO7 A;  3OOP A;  2BV6 A;  3S2W A;  1U5T C;  4N9H A;  4N9I A;  1B1B A;  5LRR A;  1P2F A;  2QQB A;  4PGG A;  1ZYR F;  4EJU A;  2GXG A;  2LNB A;  2DK5 A;  1ONV A;  3PQJ A;  4Y17 A;  1X3U A;  4HDV A;  5KK1 A;  3V8L A;  1ZH5 A;  4GGG A;  2GA1 A;  4BQA A;  4U88 A;  3SFZ A;  3BWG A;  3T8T A;  4B8X A;  1ZAO A;  4KN7 X;  1U6G A;  4XSX F;  1IXR C;  4QWQ A;  1HW2 A;  3P9I A;  1KU9 A;  2LF8 A;  4ESF A;  3ABT A;  1U78 A;  2Y75 A;  2PEX A;  3JSP A;  4HQM A;  1E2X A;  1ODD A;  1HSJ A;  3WOD F;  1U2W A;  2BGC A;  3PQK A;  1FSE A;  2P6T A;  4CDG A;  2XIG A;  4HDU A;  3GX4 X;  1FT9 A;  2PBI A;  4LMY A;  2L4A A;  5EEH A;  1ZHF A;  1ZRD A;  3BJA A;  1QPM A;  2CWE A;  4I09 A;  1R00 A;  4CO8 A;  5HS7 A;  2ZFW A;  5DEQ A;  1BM9 A;  2H6B A;  1UHM A;  2COM A;  4M9S A;  5LEJ A;  2A07 F;  4WK8 F;  4MNU A;  1FYM A;  2EV5 A;  1IZ1 A;  5LBQ A;  1XSX A;  3L9F A;  1KQ8 A;  3G3Z A;  2OA4 A;  4PCQ A;  5FLX K;  3WTU C;  2OU2 A;  2WC2 A;  2UWM A;  2EA2 A;  1QZZ A;  5LEK A;  2YR2 A;  2CSO A;  3O3K A;  1FYL A;  1UCR A;  2A3S A;  1I1S A;  2P5L C;  4UVC A;  4ZYD A;  1H9T A;  2XV4 S;  3KP3 A;  1MZB A;  1S7O A;  5E8I A;  2RN7 A;  5HS8 A;  2P7C B;  4A2U A;  2F2E A;  3O2P E;  3GFL A;  3K1M A;  2H6C A;  2L01 A;  1MJB A;  1XD7 A;  1SD5 A;  4ESB A;  3RTR A;  2G7H A;  2O3F A;  4EMS A;  3I64 A;  1IRG A;  2PMU A;  2UZK A;  3CUQ C;  4I2O A;  1UHW A;  2ZXJ A;  2M45 A;  3BY6 A;  5L3B A;  1SFU A;  2P7V B;  3BP8 A;  3JAM K;  2FE3 A;  1CGP A;  4FX0 A;  4UXN A;  3P9K A;  3HTU A;  1IN8 A;  5JI6 A;  3WTT C;  5DYM A;  5ICF A;  3ZMU A;  3B73 A;  2HQN A;  4PGH A;  2X4H A;  3QOP A;  1WI9 A;  1FP1 D;  1LEB A;  1TW3 A;  3FX3 A;  2HS5 A;  1Z6R A;  1KGS A;  1H9G A;  4L18 B;  2XAJ A;  4L9J A;  2VC0 A;  4MQ9 F;  1RUO A;  4HLX A;  2GIV A;  4UHT A;  4KDP A;  3K0L A;  3MCZ A;  2KIF A;  4I0A A;  2IW5 A;  4RB0 A;  1SMY F;  1S8N A;  2D1V A;  1TQI A;  2ZJ2 A;  5HVQ C;  1ZRC A;  3VB2 A;  5BQT A;  2NS0 A;  5TRD A;  2WV0 A;  1ZRE A;  3EET A;  4A0Y A;  3CUQ A;  1DP7 P;  1BN5 A;  3LQQ A;  2ZME A;  1S6L A;  2W25 A;  2LSO A;  1R5H A;  4LG0 B;  1PP7 U;  4WXC A;  1G3W A;  1T2K A;  4EGZ A;  2IP2 A;  2Z5U A;  3JTH A;  4KT5 C;  1J75 A;  4WXD A;  2CO5 A;  3R4K A;  4CHU A;  3V4G A;  5L3D A;  1XGO A;  3FM3 A;  3O6B B;  2FQ3 A;  4A5N A;  4LB6 B;  5CVI A;  1HKT A;  3VOD A;  2DTR A;  2O6G E;  2IVM A;  3GEZ A;  2X0L A;  3B02 A;  1G6N A;  2XAG A;  1FZP B;  4XRF A;  2V9V A;  4YFN F;  1HQC A;  1SMT A;  1XGS A;  1YW8 A;  3FXR A;  1I5Z A;  1R1U A;  1Z7U A;  2GXB A;  2DLL A;  2LKP A;  3IHU A;  4QLC U;  4HW0 A;  2KIM A;  1YO5 C;  1J9I A;  3R61 A;  2HKO A;  2GA2 A;  3J81 K;  2KJB A;  2E7W A;  1PUE E;  2WTE A;  4HAM A;  1PDN C;  4ENJ A;  2XKP A;  4CZZ A;  1JHH A;  5D8L B;  1BC8 C;  3N97 A;  4OIR F;  5LHH A;  1FC3 A;  1XN7 A;  5F6F A;  2NRA C;  3MAJ A;  4GXO A;  3ECH A;  3CUQ B;  5E20 A;  2ZKZ A;  3GVA A;  4IHS A;  5JVT A;  4OIQ F;  3TOB A;  1R36 A;  4G7H F;  3CO7 C;  3LAP A;  5E1Z B;  4CGZ A;  2XUB A;  3BJ6 A;  3KE2 A;  1F4K A;  4HLY A;  2HWV A;  4XSZ F;  4JK1 X;  4RGX A;  4M71 A;  4ZYE A;  4HOB A;  1SD7 A;  2QEN A;  3RKX A;  2JPB A;  2EV6 A;  1LQ1 A;  4R1H A;  5ILU A;  2HTJ A;  2MA3 A;  4U0V A;  1O57 A;  2UXX A;  2M5W A;  4I7H A;  2ZME B;  4WCG A;  3VOE A;  3E6M A;  1TQM A;  4UVB A;  2CG4 A;  1U3E M;  2FML A;  3C3W A;  5ILS A;  3U1D A;  4B09 A;  4HF1 A;  4P9F A;  1FOK A;  4NHJ A;  2O61 A;  4ENK A;  2ETH A;  5HOO A;  2EA4 A;  4YIF A;  3ZPL A;  4AD9 A;  1V4R A;  3WG9 A;  3Q9S A;  1B4A A;  3WTX C;  1K7A A;  2XAQ A;  2RKH A;  4GCV A;  2PLY A;  5D5X B;  3T8R A;  3BPX A;  5K5R A;  4A0Z A;  3ULQ B;  3GYH X;  3WTV C;  3E6C C;  3QP6 A;  1ZG5 A;  4EQQ A;  2LF7 A;  4LFU A;  2QLZ A;  1ZLK A;  5DCF A;  2D45 A;  1T0F A;  1XMA A;  5CJ9 A;  5K5O A;  1STZ A;  1XB4 A;  4LJZ F;  1ON2 A;  5K5Q A;  5J6X A;  2VBW A;  2P4W A;  1XCB A;  4PZJ A;  1Y0U A;  2F5F A;  2RC4 A;  2VC1 A;  4L5J A;  1F1Z A;  3R0A A;  4Q47 A;  2HZT A;  3KLO A;  2IA0 A;  1SFX A;  2XRN A;  2DT5 A;  2ZCW A;  1D8K A;  2YX7 A;  5LGU A;  4HZF A;  4ESJ A;  2VBX A;  4KMF A;  3QPH A;  2AXL A;  3Q9V A;  3HRT A;  1IRF A;  5HDK A;  5HDG A;  1IN6 A;  2CYY A;  2XAF A;  5D4S A;  2IA1 A;  2G7U A;  3JSO A;  4H0E A;  1L3L A;  4UUV A;  3DFG A;  1J2X A;  3L2C A;  1Z9C A;  3FMQ A;  4HBL A;  2RNJ A;  1ZGJ A;  4HV6 A;  2G9W A;  3F3X A;  5BS6 A;  1QQI A;  3K1P A;  2Q0O A;  2GZW A;  5FO5 A;  3RJP A;  2AS5 F;  2PMH A;  3I4P A;  3WTY C;  3M8E A;  2VBY A;  4TV7 A;  2M1B A;  1IXC A;  5D8K B;  2Z9O A;  2A6E F;  1WQ2 A;  1OPC A;  3GFI A;  3I53 A;  2DBB A;  1RI7 A;  4OOI A;  3DEU A;  3ML6 A;  2EB7 A;  3E5U A;  3J80 Z;  3CJN A;  3TQN A;  4XLP F;  3IC7 A;  4RB2 C;  1S3J A;  4ZH4 F;  1KU7 A;  2KKO A;  1JHF A;  2EK5 A;  3HRS A;  2JZY A;  3L00 A;  4F7Z A;  4JQF A;  2P5V A;  2YX4 A;  3WE2 A;  3GUD A;  4DQ2 A;  3U9G A;  1G4D A;  4ZYH A;  2IRF G;  1TQP A;  5LGN A;  1BBY A;  1ZLJ A;  1ZGA A;  4A0X A;  5F64 A;  4HF2 A;  3GW2 A;  1WKM A;  1D3Y A;  2F5E A;  1KYW A;  2V1D A;  3I59 A;  3VFZ A;  2DW4 A;  4O6J A;  2DPD A;  5A2Q K;  1S29 A;  5DCM A;  4OMY A;  3ZMS A;  2FF4 A;  5LHG A;  4YFK F;  3L09 A;  2FMY A;  2Z33 A;  1FP2 A;  2EFO A;  3E3V A;  5LLQ A;  2DAO A;  3N4M A;  4RB1 A;  3E6D A;  5DV5 A;  4I02 A;  1CF7 A;  5BOX A;  4RAZ A;  1HST A;  1R7J A;  2Q2E A;  4D0P A;  2FA5 A;  3RI4 A;  1LNW A;  2HR3 A;  3M7G A;  5D5V B;  1C0W A;  4OIO F;  1R5G A;  1HBX G;  5ED4 A;  5BMZ A;  2FBK A;  1YQA A;  4RS8 A;  1K79 A;  3R60 A;  2IPQ X;  1W5T A;  4MGR A;  5FLX Z;  3BDD A;  3V8K A;  4FX4 A;  3ISP A;  2CQK A;  2D2W A;  2EJR A;  1F9N A;  3KP2 A;  4Z2Y A;  2FNA A;  1QBJ A;  3HOT A;  1JXS A;  3T5X A;  3H92 A;  4ZZL A;  2YSR A;  4R8H A;  2J5P A;  4OU0 A;  3HHH A;  3NEU A;  3F22 A;  3WU1 B;  3SHF A;  3GXO A;  1YYV A;  1ZRF A;  3IRQ A;  1MDM B;  1D5V A;  2C6Y A;  4AIH A;  2MH2 A;  3ABU A;  2ESH A;  4NB5 A;  2K27 A;  4UNO A;  5IT9 K;  3DPL C;  5JFR A;  1BI0 A;  2L4M A;  2Y48 A;  2FRH A;  4G8X A;  1Z91 A;  3W6J B;  4Q4Z F;  1KU2 A;  3CUO A;  2YU3 A;  4HF0 A;  1XSV A;  1B59 A;  1O3T A;  4BHB A;  4LK0 F;  1LJ9 A;  3RYP A;  5LGT A;  4GYI A;  3BPV A;  1XDS A;  1O7L A;  2H94 A;  1WSU A;  2HQR A;  2DK8 A;  3HSE A;  3M9A A;  2NNN A;  2TDX A;  2A5Y B;  2DQR A;  5LHI A;  2CW0 F;  1FYK A;  3HUG A;  4I01 A;  3DXJ F;  5H6R A;  1JGS A;  1DPR A;  3AAF A;  1EV7 A;  1OMI A;  2H27 A;  5CVR A;  2RGV A;  3WE3 A;  4BH9 A;  1K78 A;  3Q5F A;  3ZN0 A;  3K69 A;  2MBF A;  2QYO A;  4IXA A;  1RIO H;  1P6R A;  4IRI A;  4ENN A;  4G6Q A;  4OIP F;  1U5T B;  3HHG A;  3HSR A;  4KYW A;  2ELH A;  5ICC A;  3K2Z A;  1DPU A;  1WRJ A;  1BI1 A;  3I54 A;  1YIO A;  4HX4 A;  4U0W A;  2XHK A;  4L9V A;  2K86 A;  5E18 F;  5K1Y A;  2BE5 F;  2PG4 A;  5E17 F;  1IW7 F;  3MFK A;  1TTY A;  3L7W A;  2PN6 A;  5FFX A;  3KFW X;  4EV0 A;  5FD5 A;  5ICG A;  4LB5 A;  3GLX A;  4RB3 C;  1SAX A;  2NAZ A;  1LVA A;  3C7J A;  4A6D A;  3DKW A;  4KIG A;  4L9T A;  2PFB A;  4IHT A;  2EV0 A;  2K4B A;  4WXH A;  1OYI A;  3KP6 A;  2F5C A;  1ZAR A;  4G7Z F;  2BEO A;  3KET A;  2VT3 A;  5CVV A;  1W7P D;  1WWX A;  1Z05 A;  5BPI A;  1RZ4 A;  1J0R A;  2JRT A;  4Y13 A;  3D5L A;  1G3T A;  5IT9 Z;  5CYV A;  3F8C A;  3HOS A;  5ILV A;  1BI2 A;  1UST A;  1T39 A;  3WGH A;  5JR3 A;  2D1H A;  6PAX A;  1YFH A;  2JSC A;  3KP7 A;  1XCV A;  4G6D A;  3DQV C;  3ZMV A;  4GYG A;  2PI0 A;  3F8M A;  3BOQ A;  4S04 A;  4CXF A;  2OAZ A;  3FMS A;  3FF5 A;  4Q5S F;  5DUK A;  4KIB A;  4Y15 A;  2UXN A;  4IVN A;  1REP C;  2FOK A;  5FGM A;  5KVR A;  2FNP A;  1J5Y A;  3T0Y A;  1HW1 A;  3GFJ A;  3BZ6 A;  3TO6 A;  3KZY A;  2L54 A;  2OBP A;  2A61 A;  4YFX F;  1G3Y A;  4L0Y B;  1P4A A;  3G73 A;  5DDG A;  5J8F A;  1UFM A;  4EM0 B;  4A6E A;  4LG0 A;  1XMK A;  3TOA A;  4MEY F;  2XKO A;  2L3D A;  4FHT A;  4G7O F;  3RYR A;  3QU3 A;  3VEP A;  3WTS C;  1MDM A;  3CO6 C;  3GO5 A;  2HEO A;  2Z99 A;  3SXY A;  4EVI A;  2A69 F;  1R22 A;  2R3S A;  1BIA A;  5HS9 A;  1XGM A;  4KN4 X;  2QBY A;  1L0O C;  4M6Y A;  3QU6 A;  2QWW A;  4CIC A;  4ETS A;  2BYV E;  5AIQ A;  1O3R A;  3F23 A;  3MZY A;  1OYY A;  2ISZ A;  4RGS A;  3K9T A;  4NQW A;  1HW5 A;  3WGG A;  4M72 A;  2ZNZ A;  2K02 A;  3H3U A;  3QP5 A;  1JE8 A;  2WWY A;  4KFC A;  1I6X A;  4CYD A;  2PJP A;  2FSW A;  1B6A A;  1W7P A;  3BRO A;  3M1E A;  1ZG3 A;  4JBA A;  2Q8K A;  3IWF A;  2MLG A;  4EM1 A;  3F6O A;  2OQG A;  1XDU A;  3ZMD A;  3F21 A;  2W24 A;  2ZO4 A;  1HKQ A;  4EM2 A;  4HV5 A;  4IRH A;  2W85 A;  3LA3 A;  2MH9 A;  2VE8 A;  3ERE D;  3I58 A;  3T1B A;  1BC7 C;  1XSD A;  1FWZ A;  5L3F A;  2XVC A;  3ZN1 A;  5E1W A;  3KCC A;  2LDU A;  1MJA A;  2XAH A;  3HRM A;  1MJ9 A;  3IKT A;  3FWE A;  2M8E A;  2VXZ A;  4M73 A;  4P55 A;  2RV8 A;  5D6E A;  5AON A;  1R1V A;  1YLF A;  1OYW A;  1FNN A;  4HX7 A;  1YS7 A;  1K6O A;  2JTV A;  3LFK A;  3WU0 A;  2EFW A;  1BOA A;  2V1U A;  1FLI A;  3MZH A;  3RPQ A;  3FHZ A;  5FB2 A;  1FY7 A;  2A6H F;  4LD5 A;  5ERI A;  2HDC A;  2IJL A;  3DV8 A;  3NQO A;  1T98 A;  3JW4 A;  1DUX C;  3IWZ A;  3KP4 A;  2ESN A;  2XGX A;  2FU4 A;  1TBX A;  1A04 A;  2O03 A;  1P4X A;  2E1N A;  2NYX A;  2HTS A;  2HYF A;  2GQQ A;  3JAM Z;  1SD4 A;  4LLN A;  4EJO A;  5D6F A;  2HFH A;  4MHG A;  3LA7 A;  3MEX A;  3FXU A;  3CDH A;  2OQR A;  3KP5 A;  3KZZ A;  5HLH A;  2DO7 A;  4L0Z B;  2V6C A;  2MD5 A;  4MQV A;  5IT3 A;  1I1G A;  3P9C A;  2BBY A;  1KYZ A;  4U7D A;  2OZU A;  5E8G A;  1P92 A;  1O7F A;  1TNT A;  3J7A O;  2VON A;  1BJA A;  4PDK A;  3F8N A;  4AVP A;  2VBZ A;  3LST A;  2QVO A;  4L5I A;  1W7P B;  4YII A;  4P5O A;  4WWC A;  3KLN A;  3F8B A;  3WGI A;  3J80 K;  5DUI A;  3IRR A;  2QBY B;  2QUF A;  3HYI A;  3E97 A;  4HX8 A;  4KIF A;  1T38 A;  3TDZ C;  2CGP A;  1HXD A;  2O0Y A;  4OIN F;  4FT8 A;  1MD0 A;  4UV8 A;  1NHA A;  1KU3 A;  3TKY A;  3V8J A;  3P7N A;  4K2E A;  3C18 A;  3R0J A;  3GFM A;  1HKS A;  3KEQ A;  3V7S A;  2P5K A;  1MKM A;  3W6K B;  4I0B A;  4AWX B;  5CVJ A;  2QQA A;  4U7B A;  3IKV A;  3I71 A;  2ADU A;  2XRO A;  1IUY A;  4G94 A;  3U2R A;  3R6S A;  1TW2 A;  1TLH B;  2VOO A;  5D5U B;  2HGC A;  2R7D A;  3I5U A;  2QZ8 A;  3QRF F;  2ACJ A;  1OKR A;  1EH6 A;  2VOP A;  4EJW A;  2A68 F;  5J8C A;  4KNY A;  4BYY A;  4M74 A;  1SD6 A;  2VN2 A;  4BAY A;  4YG2 F;  3COA C;  5HLI A;  2VT2 A;  1S7A A;  3LAJ A;  3MQ0 A;  4ENM A;  4G9Y A;  1FBU A;  3TDU C;  5H6Q A;  4N0B A;  4A12 A;  3E6B A;  1LDD A;  1BIB A;  4HA8 A;  1V3F A;  4IRG A;  4I98 B;  1FBS A;  3GF2 A;  2FBI A;  2KJC A;  5HDN A;  3DP7 A;  4EJT A;  1T6S A;  1GXQ A;  1FSH A;  1B9N A;  4MTE A;  3E5Q A;  1D8J A;  1R58 A;  1O3S A;  4RGR A;  1KA8 A;  3C1D A;  3REO A;  1IN7 A;  3J81 Z;  5HLG A;  4ON0 A;  4KA4 A;  3FZV A;  4S05 A;  2R7F A;  1RUN A;  2K7L A;  4M6X A;  3CLO A;  1VTN C;  2DI3 A;  1R23 A;  3ELK A;  1QGP A;  3QPT A;  3FM5 A;  4R79 A;  1LDK B;  4LGW A;  1YG2 A;  3F6V A;  4O5V A;  3M8F A;  5F1R A;  3HTS B;  4IPA A;  4MTD A;  1AWC A;  4AIJ A;  1QNT A;  1E17 A;  2K4J A;  1BI3 A;  1YW9 A;  2JPC A;  4EJV A;  1EH8 A;  1Q1H A;  5EEG A;  2IT0 A;  1IXS B;  2M30 A;  2L02 A;  1SFE A;  3TGN A;  1J7K A;  2DU9 A;  5FD6 A;  5CVU A;  2RVC A;  3TO9 A;  1GXP A;  4M9X A;  2HOE A;  5DD8 A;  2DPU A;  1MGT A;  4DNC A;  5D4R A;  2IA2 A;  4OMZ A;  3WTZ A;  1USS A;  1U5T A;  5TJJ A;  4EGY A;  3IL2 A;  4M9Z A;  3SZP A;  1YTY A;  4BHC A;  1Z6T A;  1RNL A;  2Y0M A;  4LK1 F;  1OR7 A;  4ASN A;  4U0Y A;  2FBH A;  1U8R A;  2V1X A;  4P96 A;  1FPQ A;  3ECO A;  3ZMZ A;  3QAH A;  2GAU A;  4BXU A;  2EWN A;  3EYI A;  2MC3 A;  4UV9 A;  2E1C A;  2HYG D;  3ZP5 A;  5D5W B;  3BJO A;  1LB2 A;  3CTA A;  2EFQ A;  5AIP A;  2YPR A;  2KIU A;  1P4W A;  1IN4 A;  1DDN A;  2STW A;  4AIK A;  3K1N A;  3NRV A;  3GWZ A;  5FFZ A;  2STT A;  5DD4 A;  1R1T A;  2PQ8 A;  4WF2 A;  1B9M A;  3F8F A;  1W5S A;  2CFX A;  2RQP A;  1IAW A;  1QO0 D;  2DFI A;  2V79 A;  5L3G A;  3HRU A;  4P9U A;  3GZ6 A;  1ON1 A;  2KRF A;  2ZBK A;  2J5O A;  3KEO A;  3E5X A;  2VOD A;  3I59 B;  1IN5 A;  3SZT A;  4HQE A;  3OV8 A;  4E70 A;  2EFP A;  2Z3Y A;  4IF4 A;  2JT1 A;  3PFI A;  1EH7 A;  2VE9 A;  2E7X A;  4ZYG A;  1KQ9 A;  3EUH A;  2ZNY A;  1GHC A;  4WX9 A;  3F72 A;  1QZY A;  2OZ6 A;  1ZN2 A;  3EQL F;  2MLK A;  2QM3 A;  4XBF A;  1LDJ A;  3EDP A;  5CLS A;  2P6S A;  2OD5 A;  2P8T A;  3HSF A;  2ISY A;  5A2Q Z;  3DF8 A;  1J59 A;  3FXQ A;  2FEZ A;  5BPD A;  4RAY A;  5JHU A;  3GZ5 A;  3MWM A;  2H09 A;  3H3Z A;  1FX7 A;  4UVA A;  2FXA A;  1UB9 A;  2XAS A;  5DCM B;  4XLN F;  2NNY A;  4KUM A;  3DPT A;  4GO1 A;  4IJA A;  1ULY A;  1ZG1 A;  1YW7 A;  3ZMT A;  4MEX F;  2M87 A;  3WTW C;  3RKW A;  1O3Q A;  4KIC A;  4LLG F;  2W84 A;  1K78 B;  1YS6 A;  3RIR A;  2QQ9 A;  2O8X A;  1FBQ A;  1I27 A;  3SQN A;  3V7C A;  5LRS A;  1AOY A;  2EFN A;  3HIF A;  2GWR A;  1W4M A;  3FMR A;  4L9N A;  3ROU A;  3I0T A;  5ICE A;  5L3C A;  4LLL A;  1GVJ A;  3V7R A;  3LQR A;  3LA2 A;  1KQ0 A;  3ZQ7 A;  3RPU A;  4A5M A;  3LWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...