2PFBA

Structure of oxidized ohrr from xanthamonas campestris
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
136
structure length
129
Chain Sequence
LLQLDNQLCFALYSANLAMHKLYRGLLKALDLTYPQYLVMLVLWETDERSVSEIGERLYLDSATLTPLLKRLQAAGLVTRTRVIIALTETGRALRSKAGAVPEQVFCASASSLDELRQLKQELEKLRSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator OhrR
publication title Structural Mechanism of Organic Hydroperoxide Induction of the Transcription Regulator OhrR.
pubmed doi rcsb
source organism Xanthomonas campestris
molecule tags Transcription regulator
total genus 41
structure length 129
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2pfbA00
5CLSA 3EDPA 3WE3A 4HV6A 3I4PA 2H27A 5IT9K 1HXDA 3REOA 3HOTA 1EH6A 2FSWA 5DCFA 2P8TA 4P9UA 1YIOA 3GLXA 3F6VA 1I1SA 1YLFA 3F8CA 5D5UB 2KIMA 2FXAA 2LKPA 1ZHFA 4KT5C 1IXCA 5L3CA 5BQTA 3KLOA 4AIKA 2HDCA 4IPAA 1O57A 3K69A 5ED4A 3O3KA 2W25A 2R3SA 2ZKZA 3BP8A 1KU2A 4WXDA 4AWXB 1RIOH 4HQEA 3LA7A 3HRUA 3M8FA 1PDNC 2OBPA 2XAFA 4EGZA 1ONVA 1PP7U 4GGGA 2NS0A 1KA8A 1J75A 4G7ZF 1ZAOA 2YU3A 1JHFA 1W7PD 1XDUA 2PMUA 2KIUA 4MTEA 1UB9A 4IVNA 5ICFA 4I0AA 2OAZA 3DV8A 1HW1A 3V7RA 1GHCA 1XMKA 3WU1B 2O3FA 1P4WA 2E1NA 4HX8A 3K2ZA 4A0YA 2C6YA 2IT0A 4CYDA 4IXAA 5D6FA 5BOXA 2EB7A 3WTVC 5CVVA 2A6HF 1BI3A 4RS8A 2STTA 1R58A 2K4JA 3E5UA 5CVIA 3ZMUA 4ZZDA 4CDGA 2P6TA 1B9NA 3DFGA 4KN7X 1IZ1A 4QWQA 3TO9A 1YS6A 3QP6A 1ZG1A 2GIVA 2CG4A 1D5VA 1FWZA 1JHHA 3HRSA 1XD7A 3SFZA 3KLNA 1G3TA 4LMYA 1YW8A 2O0YA 2VODA 3GZ5A 2VOPA 1B9MA 4RGUA 3VOEA 3LA2A 2JPBA 4LFUA 2FQ3A 5BMZA 4M73A 2ISYA 1T6SA 1WSUA 1IN8A 4PCQA 2DFIA 5HLIA 4FX0A 2P7VB 3WGHA 2XKOA 3SXYA 4S05A 4P5OA 2MD5A 3VEPA 3BPXA 3WTZA 4S04A 2V9VA 1J0RA 4LJZF 4LLNA 1BIAA 2ZCWA 5LGUA 2TDXA 4OMZA 4KIBA 4KN4X 2KRFA 1BJAA 4N9IA 3WTXC 4BHBA 3FX3A 2V1DA 4KUMA 2NNYA 1ZN2A 3R60A 3WGIA 1VTNC 2V1XA 2XAQA 4FT8A 2P7CB 3ZMVA 5DCMA 4LG0B 3BJ6A 3L7WA 2Z5UA 1XB4A 1J9IA 3R4KA 3RKXA 1ZLJA 1LDKB 1ULYA 1Z05A 1GXQA 3E3VA 3TO7A 5DYMA 2DW4A 4GCVA 3ECOA 3D5LA 5H6QA 4HX4A 1SFXA 4A6EA 3MQ0A 3V8KA 3ROUA 3P9KA 1HW2A 2PG4A 2OQRA 3ZN1A 2MLKA 2D45A 3MZHA 1FZPB 1CGPA 3E6MA 3WGGA 5TJJA 3WODF 4Y15A 1IN6A 4RB2C 3HOSA 4G6QA 1BC7C 2F5CA 3QU3A 4HA8A 3U1DA 3M8EA 2YX4A 3VODA 2J5PA 1E2XA 1OYWA 1C0WA 3KP6A 4MQ9F 5FGMA 3GYHX 1T38A 1FC3A 5EEHA 4MGRA 3GW2A 1P2FA 3CUQC 1UFMA 4L18B 2PN6A 2QWWA 3P9IA 2FA5A 2PI0A 1A04A 4ENJA 3WTYC 5AIPA 2HKXA 1BI1A 4U7BA 3KZZA 1O3RA 5L3GA 3J80K 4I98B 1RZ4A 5LGTA 3I53A 2ADUA 5L3DA 2JRTA 1FP1D 2QZ8A 3WU0A 1MGTA 1LDDA 3NEUA 3AAFA 5DD4A 4F7ZA 4L5JA 4WK8F 2FMYA 1HBXG 2RNJA 5FFZA 5HS8A 4M9ZA 4ZYHA 2LSOA 2LF7A 1SMYF 4PDKA 3RKYA 1BM9A 2COMA 5FO5A 4JK1X 5BS6A 2K02A 3OV8A 4UNOA 4IRIA 4L0YB 2GA1A 1XDSA 2OQGA 5FD5A 2DK5A 2RV8A 2ESNA 1IN7A 3COAC 3KEOA 3EYYA 1WQ2A 3GWZA 3H3UA 2L54A 2QLZA 5ILSA 1LVAA 3MAJA 2E1CA 1J7KA 4Y13A 3J81K 1PP8F 1KU9A 3L09A 1FBQA 1IAWA 1E17A 1U2WA 3DPTA 1ON1A 1F1ZA 2CWEA 1SD6A 2XGXA 2HKOA 5DEQA 4Q4ZF 5K5QA 4GYIA 5A2QZ 4EMSA 1D8JA 4L9NA 3FXRA 2OA4A 2VE8A 2XVCA 2KJCA 2W84A 3H92A 3GFJA 2IA2A 2FMLA 1EH8A 5ICEA 2XRNA 1U78A 4OIRF 1YO5C 2VONA 5DDGA 1S7AA 2RVCA 2FNPA 2VN2A 2RQPA 3KP7A 4ON0A 4DNCA 4A12A 1W4MA 2F5DA 5L3FA 2X4HA 4UHTA 3BPVA 1TW3A 2ESHA 3IL2A 5LHIA 2CFXA 1D8KA 3U2RA 2Z99A 4HW0A 1TW2A 5CYVA 5DCMB 3VB2A 3B73A 5E1ZB 4ENKA 5ICCA 3TGNA 3I71A 5IT9Z 2Z3YA 1P92A 2A07F 3ZP5A 5CJ9A 3EQLF 3F23A 1TQMA 2UWMA 5DD8A 3TO6A 2HYFA 2IP2A 3ZMTA 3GX4X 4KYWA 2CQKA 3CLOA 4RGSA 1SAXA 2DTRA 4G6DA 3DP7A 1QO0D 4BH9A 5FB2A 1ZREA 5JVTA 2P5KA 3WG9A 4FX4A 2LDUA 4L0ZB 4Z2YA 3ERED 1TNSA 3IRQA 3ZMZA 3K0LA 3BJAA 1FYKA 1U5TC 3QU6A 4AD9A 1FP2A 4GYGA 4LG0A 4CGZA 2Q8KA 1T0FA 3JAMK 5J8CA 3J7AO 2HGCA 2F5EA 4XLNF 3BDDA 2HTJA 3L00A 1R36A 3R6SA 1IN4A 4UV9A 4KA4A 4ZH4F 1Y0UA 5CVRA 3EUHA 3MFKA 3F72A 2NYXA 4O6JA 1SD4A 1KU7A 2Y75A 1I1GA 2XUBA 1K6OA 3HSFA 5L3BA 3Q5FA 3PFIA 5D8LB 1FBSA 4U0WA 3LWFA 1FX7A 2HZTA 2KJBA 1MZBA 3E5QA 3QAHA 5E18F 2EV6A 2PMHA 4M9SA 2QQBA 2M1BA 2Z33A 3RTRA 3JTGA 1K7AA 4EJOA 3RYRA 2H6CA 4IJAA 5LHGA 2JSCA 1OYIA 3MWMA 1MJBA 2HOEA 4KMUX 2H6BA 2QQ9A 2D2WA 4R1HA 1SFUA 2EFQA 1S6LA 4M71A 1MD0A 1ZARA 2BE5F 4WXCA 4UVAA 2BBYA 5HS9A 3HRTA 2EA4A 3C7JA 3FF5A 1WKMA 3ABUA 2KIFA 1OR7A 2V6CA 3WE2A 3F8NA 1U5TB 4CICA 1RNLA 3IKTA 2YPRA 4O5VA 1K79A 2Y48A 1QNTA 2EWNA 1WI9A 4O3MA 3K9TA 1IN5A 4ESJA 5HDKA 1ZG3A 1DDNA 2DQLA 1WRJA 2GZWA 2ZO4A 3M9AA 1HSTA 3T8RA 1XGOA 4EQQA 5D5XB 3FXUA 4ENMA 3R0AA 1I27A 2Q0OA 1XMAA 1USSA 1LQ1A 2P5LC 4MEXF 4A2UA 2VBZA 1V4RA 2E7XA 2NAZA 5LBQA 4WXHA 3R61A 3GF2A 3KETA 4EJTA 4XSXF 5H20A 2QENA 5D5VB 3FZVA 1ZRCA 4M74A 2XAGA 4Q47A 1DP7P 2B0LA 2RDPA 3CUQA 4N0BA 5D6EA 3ECHA 3VFZA 3ULQB 1S3JA 3Q9SA 3FM5A 5E20A 2LNBA 1W7PA 2DI3A 1R1UA 1K78A 3N4MA 4IHSA 1CF7A 3TOBA 2VT2A 4HZFA 1ZYRF 3ISPA 2XAJA 3G3ZA 5CVJA 2QYOA 2P5VA 4EVIA 1FOKA 1EV7A 1J5YA 1XCBA 4OIQF 1HKTA 1YW7A 1BI2A 5E17F 2H94A 1IW7F 3HHHA 4P96A 3I58A 3KP4A 1F5TA 4GO1A 1TTYA 5ICGA 2OU2A 4MEYF 1P4AA 1Z1DA 2DT5A 1R1VA 3GUDA 5LEKA 2P4WA 5D4SA 1MJAA 1UHMA 4A0ZA 2CO5A 3QRFF 2QBYA 4HF0A 4I7HA 1MKMA 5F6FA 4K2EA 1R00A 2DQRA 4D0PA 1XSDA 1XN7A 1HKQA 4AIJA 3J80Z 3FMSA 2FU4A 2IW5A 3ZMDA 2A61A 2OZUA 1DPRA 3SQNA 1J59A 3LSTA 4L9TA 2R7DA 3CDHA 2GAUA 3V8JA 4R8HA 4HF2A 4RAYA 3RYPA 1BN5A 4PZJA 3F6OA 2NNNA 3L2CA 1F4KA 2DAOA 2VC1A 3GFLA 1OYYA 2MA3A 1P4XA 1O3SA 2MLGA 3GEZA 2O61A 1HKSA 1H0MA 3ML6A 1MDMB 3I59B 2QUFA 1LB2A 1SD5A 2ZBKA 2QM3A 2ZXJA 2FBIA 1U8RA 1FNNA 4LB6B 5LGNA 1XCVA 2A68F 2XHKA 2L01A 3K1MA 2HQNA 3J81Z 2QVOA 5JFRA 2YSRA 4G7HF 2G9WA 4UVBA 3LFKA 5ILVA 1S8NA 2ZNZA 3IWZA 5DUIA 2PEXA 4EM0B 2CSOA 3BJOA 3FM3A 3PQJA 3E5XA 3CO7C 4KNYA 2HR3A 3HSRA 2IRFG 4I02A 4A6DA 4GXOA 2A3SA 2XKPA 3DPLC 4JQFA 2O6GE 2BGCA 1DPUA 2K86A 1LNWA 5F64A 3LAPA 5ERIA 1G6NA 2FNAA 4A5NA 4ZYGA 3WTWC 1UCRA 5HDGA 2L02A 3P7NA 4QLCU 4RB0A 4HYEA 4L9JA 2IA0A 5ILUA 1R5GA 3KCCA 1U5TA 3E6DA 4OINF 3BZ6A 3I0TA 1REPC 3F22A 3C1DA 2ZJ2A 2O8XA 3FMQA 3LAJA 3GVAA 1ODDA 2VC0A 2EFWA 1RUNA 2K7LA 3M1EA 1Z9CA 3CUQB 3IC7A 5E1WA 5AONA 1SMTA 4B8XA 1G4DA 3C3WA 3JTHA 5BPDA 5D4RA 1W5SA 3KZYA 1QGPA 3DQVC 4LGWA 1KQ8A 4OOIA 1W7PB 1K78B 4UV8A 1J2XA 1CF7B 1S29A 1YTYA 4YFNF 2VXZA 5K5OA 4HLYA 5FLXZ 3RJPA 2GXGA 1TQIA 2VBYA 2R7FA 1IRFA 3ELKA 1I6XA 3BOQA 1L0OC 1QZZA 1S7OA 2XASA 3QPTA 3GFIA 1ZGJA 3QPHA 3V4GA 5D5WB 1LJ9A 5IT3A 1ZGAA 2IJLA 2CW0F 5F1RA 1DUXC 4EV0A 1O3QA 2DBBA 4RB1A 2FF4A 3M7GA 3WTTC 4FHTA 4N9HA 2QBYB 2V1UA 2A69F 2EFNA 3QOPA 2HS5A 3DF8A 1B4AA 3ZPLA 1JE8A 4IHTA 4ENNA 1X3UA 4LK0F 5A2QK 2FBHA 2PFBA 4KICA 2RC4A 5BPIA 5HS7A 4ZYDA 1FYLA 4LB5A 4AIHA 4B09A 3SZTA 3FWEA 1FT9A 4KIFA 3HTUA 3IKVA 4WWCA 2FOKA 1IUYA 4KDPA 1BC8C 2DU9A 3GO5A 1QBJA 2M5WA 4CHUA 3I54A 2XIGA 2MH2A 1KQ9A 2ZMEA 4P55A 5J6XA 1XSXA 2YX7A 3HUGA 2JPCA 1R1TA 2EV0A 3LA3A 4WCGA 1T98A 3I64A 1OKRA 3U9GA 4HV5A 2P6SA 4BYYA 4LD5A 1ZRDA 3K1NA 4CXFA 4M9XA 5L3EA 2WWYA 4I0BA 3WTUC 2M30A 3MEXA 5AIQA 4M6YA 1B59A 1FLIA 1RI7A 2FE3A 1QQIA 1OMIA 2OD5A 3HHGA 1YG2A 3G73A 1ZG5A 2LF8A 1YYVA 3KP3A 1IF1A 4I01A 1XGNA 2WV0A 1MDMA 3I59A 1GVJA 3CO6C 1T2KA 3S2WA 3Q9VA 1KQ0A 1Z91A 1KGSA 2Z9OA 5FFXA 2DPUA 5LLQA 3ABTA 4HAMA 1O7LA 3DXJF 5K5RA 2G7UA 4OIPF 5HLGA 4ZZLA 1Z7UA 1U6GA 1HSJA 2A5YB 3LQRA 1XGSA 2EV5A 4JBAA 1AOYA 4ESBA 3CJNA 2IPQX 2BEOA 1TBXA 1O7FA 4YIIA 2Y0MA 2HWVA 1BI0A 4KMFA 3TQNA 2Q2EA 4EJWA 3CTAA 2MC3A 4AVPA 4WX9A 4RGRA 4I09A 1TLHB 3DKWA 4BQAA 1BIBA 2E7WA 2XROA 1R22A 1G3YA 1XSVA 2O03A 1TQPA 3GXOA 4MHGA 4BHPA 2VE9A 1H9TA 4HDVA 1OPCA 2M87A 1FYMA 2RKHA 1D3YA 4E70A 4U0YA 4EM2A 4HDUA 3MCZA 4RGXA 2OZ6A 1HQCA 3ZMSA 3C18A 5K1YA 4EJVA 1ZH5A 2F5FA 4G94A 2CYYA 2W24A 4PGHA 1I5ZA 2XAHA 2ISZA 3D0SA 4WF2A 2HTSA 1V3FA 4U7DA 3F8FA 2J5OA 3GFMA 4L9VA 6PAXA 1FSHA 3JSOA 3JW4A 2DLLA 4YIFA 1GXPA 2VBWA 1H9GA 3T1BA 1ON2A 2IA1A 1B6AA 3NRVA 4R79A 3RPQA 4EM1A 1IRGA 2BV6A 3T5XA 2JZYA 2W57A 2HEOA 2GQQA 4U0VA 1G3WA 3E6CC 3K1PA 2G7HA 3DEUA 1P6RA 1EH7A 1JXSA 4LK1F 4OMYA 3L9FA 3HIFA 2AS5F 2ZMEB 3BY6A 3F21A 3CUOA 4G9YA 3R0JA 4A0XA 3WTSC 3GZ6A 2PBIA 1YQAA 3TKYA 1G3SA 3B02A 4BAYA 4G8XA 5E8GA 4HQMA 1FBUA 3KP5A 2FRHA 4U88A 1JGSA 4NB5A 3NQOA 4Q5SF 3EETA 1QPMA 2BYVE 1YW9A 3ZQ7A 5DV5A 2PJPA 3RI4A 3RPUA 5LEJA 4Q48A 3OOPA 2L3DA 2GA2A 1BOAA 4UVCA 3I5UA 4KIGA 3KFWX 1TNTA 1SFEA 3LQQA 1T39A 1FPQA 5E8IA 2H09A 2HYGD 1W5TA 2FEZA 1AWCA 4UUVA 4M6XA 5HVQC 3IHUA 5KVRA 4RB3C 2L4MA 4ZYEA 3V8LA 4OIOF 4MQVA 4LLLA 1YS7A 1O3TA 1WWXA 3V7SA 3MZYA 1XGMA 3F8BA 4I2OA 4YFXF 2PQ8A 4IRHA 4CO8A 2EK5A 1FSEA 3HRMA 1USTA 5CVUA 5HDNA 3RIRA 5LHHA 1PUEE 3ZN0A 1Z6RA 2EFOA 5JHUA 1MJ9A 4HBLA 4RAZA 3HTSB 3SZPA 4IF4A 3W6KB 2STWA 4MNUA 2HQRA 2ZFWA 4DQ2A 5KK1A 1ZRFA 2JTVA 2GXBA 2K27A 2WC2A 3BWGA 1Q1HA 1BBYA 1YFHA 3E6BA 4KFCA 2JT1A 2M45A 3RDIA 5LRSA 4CZZA 1LEBA 5FD6A 2EJRA 1Z6TA 4BXUA 2DO7A 2HFHA 1UHWA 2ETHA 3W6JB 4L5IA 3P9CA 4M72A 3IWFA 3FMRA 4P9FA 2K4BA 5J8FA 1HW5A 4A5MA 2X0LA 5E1XA 3QP5A 5D8KB 5JI6A 3EYIA 5H6RA 4TV7A 2ZNYA 2YR2A 2D1VA 2NRAC 2UXNA 1LEAA 3O2PE 2MBFA 3T8TA 1F9NA 4H0EA 4OU0A 3T0YA 1NHAA 1RUOA 3PQKA 2DPDA 2IVMA 2F2EA 2RN7A 3KEQA 4XBFA 3BROA 4NQWA 1FY7A 3JSPA 2AXLA 3N97A 2UZKA 4HLXA 3IRRA 3JAMZ 3FXQA 4LLGF 4YFKF 2DK8A 1SD7A 3KP2A 4BHCA 1R7JA 2VT3A 1IXSB 4ESFA 4Y17A 1ZLKA 4HOBA 4HF1A 1LDJA 2A6EF 3TDUC 2EA2A 3O6BB 1L3LA 2V79A 1KU3A 1KYZA 3RKWA 3E97A 4EJUA 5JR3A 3TOAA 2M8EA 2EFPA 1QZYA 4XSZF 2XV4S 4XLPF 5TRDA 4HX7A 4MTDA 2VOOA 4NHJA 3FHZA 1B1BA 4XRFA 4EGYA 4G7OF 1R5HA 2QQAA 2KKOA 5FLXK 2UXXA 2PLYA 2VBXA 4ETSA 2FBKA 1U3EM 5LRRA 4YG2F 5EEGA 1STZA 3SHFA 1IXRC 3HSEA 4IRGA 1R23A 3H3ZA 4BNCA 5HOOA 5DUKA 2CGPA 3F3XA 2W85A 2WTEA 1KYWA 2D1HA 3HYIA 2RGVA 4UXNA 2L4AA 4PGGA 3KE2A 2MH9A 3TDZC 3F8MA 5HLHA 2ELHA 2GWRA 3V7CA 4ASNA 2ACJA
chains in the Genus database with same CATH superfamily
1VQ5I 2E34A 1QVTA 1TT5B 5CLSA 3EDPA 3WE3A 3G4SI 1MNMC 4AU7A 3EPZA 4E4HA 2QKMB 4HV6A 3I4PA 2H27A 1FMWA 3UR3C 2IEKA 3OYGA 1HXDA 1UG2A 3REOA 2V7FA 2HI3A 5IT9K 3HOTA 1E3HA 1MMGA 4I76A 1EH6A 3G2BA 2FSWA 5M5XJ 5DCFA 5KHDA 3DBLB 4JP0A 1ZELA 2L7FP 2P8TA 4P9UA 2CUEA 1YIOA 3GLXA 2LTPA 3DCFA 3F6VA 1ETYA 1I1SA 1YLFA 3F8CA 5D5UB 3TBIA 2KIMA 2FXAA 2HU9A 2LKPA 2R7TA 2MD0A 4CYCB 2EBIA 1ZHFA 4ZDPA 2I5UA 1YIJI 1E3OC 4KT5C 1IUFA 1ETXA 1IXCA 2F6CA 2PMZA 5L3CA 1ZGWA 5BQTA 3KLOA 4AIKA 2HDCA 4IPAA 2CV1A 1O57A 1OCPA 3K69A 2R7VA 5ED4A 3O3KA 2W25A 2M8GX 4L5EA 2R3SA 2LRDA 2ZKZA 4B1RA 3BP8A 3ONQA 1KU2A 3OYBA 1I6HJ 4WXDA 1YRNA 4AWXB 3CQZJ 3VYSB 4HQEA 1RIOH 2AXTC 3J7YJ 3KYLA 4DZPA 3LA7A 4NC8A 3HRUA 4GDFA 2E2JJ 3I4NJ 3M8FA 3QYEA 2QGUA 4PJNA 3VYTB 2KZVA 3ASNH 1VQ9I 3I9V2 3PNVA 5B1BH 2LH9A 2OBPA 1PDNC 3QYBA 5CPRB 2XAFA 4NBQA 4EGZA 1Y1VJ 3H9QA 1F43A 1ONVA 1PP7U 3PO3J 4GGGA 2NS0A 1KA8A 3O8HA 1WHUA 4G7ZF 1J75A 1ZAOA 2PX9A 2YU3A 1BR1A 3A0BC 1JHFA 4XLAA 4GFBA 1W7PD 1XDUA 1JUSA 2EQRA 1RESA 2PMUA 2KIUA 4MTEA 1UB9A 1Z77A 3BG9A 4IVNA 5ICFA 4I0AA 2OAZA 2Q1ZB 5J40A 3DV8A 1HW1A 3V7RA 1GHCA 1XMKA 3WU1B 4DGWB 1QHGA 2E35A 3NARA 1PUFB 2O3FA 4KISA 1P4WA 2E1NA 3IH2A 1TWGJ 3K2ZA 1Y56A 4HX8A 4A0YA 2C6YA 5F0CA 1LE8A 2IT0A 2EIMH 2F48A 4CYDA 3ERMA 2V9PA 3PNTA 4IXAA 5D6FA 1VQOI 5BOXA 2DXIA 2EB7A 3WTVC 3N05A 2A6HF 5CVVA 1BI3A 4RS8A 3I4MJ 2STTA 1R58A 4XKBA 2K4JA 3E5UA 2XB0X 5CVIA 4PFOA 3ZMUA 1WJAA 4ZZDA 4CDGA 2P6TA 1B9NA 3DFGA 1T0FC 3NWSA 4KN7X 3M1CA 3CMEI 1IZ1A 1MMSA 4QWQA 3BR0A 4V2FA 3TO9A 1YS6A 3QP6A 2VKDA 2GIVA 3ABKH 1ZG1A 2CG4A 3AG1H 3DTIA 2X48A 1D5VA 4CSWA 4CCNA 1FWZA 1K6YA 4XK4A 4E6KG 5B5EC 1JHHA 2R7QA 1R5ID 3HRSA 2DT7B 1XD7A 3SFZA 3TP3A 1EA3A 3KLNA 5FJ8J 4JX5A 1T8IA 1G3TA 1XTAA 4LMYA 1YW8A 2O0YA 2VODA 3GZ5A 2CW8A 1JKPC 2VOPA 1B9MA 4RGUA 3VOEA 3LA2A 2VQHA 1RKTA 2JPBA 4LFUA 2Y30A 2ECCA 4BJ6C 2GBYA 1R6RA 2FQ3A 4BQOA 5BMZA 4M73A 2ISYA 3FBIB 1T6SA 1WSUA 4AYBN 2ME0A 1T95A 2YU9J 1IN8A 4PCQA 4Y52J 2BVLA 2W00A 2DFIA 1AKHB 1N25A 5HLIA 4FX0A 2VASA 1Y6IA 2K5CA 1WJBA 2P7VB 3WGHA 2ZXIA 4DJAA 2XKOA 3SXYA 4S05A 4P5OA 2MD5A 3VEPA 2BHZA 3BPXA 2LK2A 3TEDA 3WTZA 4S04A 3CC4I 2M3AA 2V9VA 2W7NA 1Z3XA 2FUG2 2DMUA 5JLWA 1J0RA 5IP9J 3W2AA 4LJZF 4LLNA 1BIAA 3RPUD 3ZQGA 2ZCWA 1XS9A 5LGUA 3JRFA 4Y3OA 4BXXJ 2TDXA 4OMZA 4KIBA 1OCZH 4KN4X 1G8XA 2KRFA 1BJAA 5M3MJ 4N9IA 3SJMA 2LMDA 3WTXC 1EJ9A 2CV0A 4BHBA 3FX3A 2BOLA 2V1DA 4KUMA 2NNYA 4U87A 2R5ZA 3QOEA 1ZN2A 2XC7A 1LUJB 3R60A 3WGIA 1VTNC 2V1XA 2XAQA 4HPQA 4B48A 1IV6A 1BR2A 4FT8A 1K61A 1OR7C 2P7CB 1NTCA 3G1LA 1NK3P 3VSKA 4IQJA 3CCEI 3ZMVA 5DCMA 4KJZA 4LG0B 5FLVA 3BJ6A 3L7WA 1VQNI 5FKLA 3FXLA 3K6GA 2Z5UA 1XB4A 1J9IA 4BQNA 1SC7A 2LREA 4UB8C 5M5YJ 1FJLA 3MMYB 4X1EA 2CRGA 4YRVA 3R4KA 3RKXA 2R5YA 3ZQIA 4E7JA 1VQ8I 1ZLJA 1LDKB 1ULYA 4M3BA 2W1OA 1FEXA 3JRCA 1Z05A 1GXQA 3DBRB 4A3FJ 2QSHX 2EZKA 2ZC2A 2TCTA 1X2NA 2X1CA 3E3VA 3TO7A 5DYMA 1QRYA 3DLAA 2DW4A 4GCVA 3A0HC 3ECOA 3D5LA 5H6QA 4HX4A 1SFXA 4AYBA 4A6EA 3MQ0A 2GM4A 5EDNA 3V8KA 3ROUA 3P9KA 4NUBA 3S14J 2KT0A 3CMAI 3MZ8A 2BY3A 3HEFA 1VQPI 1HW2A 2PG4A 3GMEA 1BJZA 2OQRA 3ZN1A 2MLKA 3K7AJ 4PJJA 2D45A 3MZHA 3I55I 1CGPA 1FZPB 1A6QA 2K40A 3GTGJ 3E6MA 3DBHB 4MFEA 3WGGA 1FOXA 5TJJA 3WODF 4Y15A 1IN6A 4RB2C 3HOSA 4C2TA 3VYUB 3C2HA 2H8RA 4G6QA 1BC7C 2F5CA 3CMMA 3QU3A 4HA8A 1A36A 3J7ZI 4E7HA 4H4KC 3U1DA 3M8EA 2YX4A 3VODA 3A4CA 2J5PA 1E2XA 1OYWA 2JN6A 1C0WA 3KP6A 4MQ9F 5FGMA 4S0HB 4EATA 3GYHX 1T38A 1FC3A 4XR6A 5EEHA 1Q1VA 4MGRA 3GW2A 2K3PA 1YRNB 1P2FA 3CUQC 1UFMA 4L18B 2QQ8A 2NS8A 2PN6A 3K2AA 1W1WE 2QWWA 2Y2ZA 3P9IA 4B3XA 2FA5A 3K4CA 3BTIA 2PI0A 1A04A 3ZQCA 1ETKA 4ENJA 3CD6I 3CMYA 1DQUA 2LY2A 3SDBA 3WTYC 5AIPA 2HKXA 4BBRJ 1WGXA 5IPAA 4DZJA 3CC2I 1BI1A 4U7BA 3EUAA 2M34A 2NVYJ 2NVXJ 3KZZA 1O3RA 1SVLA 5L3GA 5EZHA 3J80K 4I98B 1RZ4A 1X58A 5LGTA 4CYCA 3I53A 2ADUA 1DGRM 5L3DA 2BY1A 2JRTA 4HNVA 5JLXA 1FP1D 3PIPF 2QZ8A 2A5WA 1VI0A 3WU0A 1MGTA 1LDDA 3NEUA 3DPUA 3AAFA 5DD4A 3SEZA 4F7ZA 3O8GA 1WJDA 3QPSA 1I3QJ 1SAUA 4L5JA 4WK8F 3OYNA 2FMYA 1HBXG 2LKSA 2FOWA 1JUMA 2RNJA 5FFZA 4M9ZA 4ZYHA 5HS8A 2XSDC 2LSOA 1FIPA 2LF7A 1JT6A 1SMYF 3BTJA 3ZQFA 1G2HA 4PDKA 4AC0A 5DM6F 3QQAA 3RKYA 1BM9A 2COMA 5FO5A 1LE8B 1WH7A 4JK1X 5BS6A 2JK3A 4FTHA 2K02A 2JVGA 3OV8A 5DS9A 4UNOA 4IRIA 4L0YB 2GA1A 3M07A 1I39A 1GV5A 2L7KA 5CQGA 3HKZN 4A3MJ 1XDSA 2OQGA 5FD5A 4E7ZA 2DK5A 2RV8A 2VQCA 2ESNA 1IN7A 3COAC 1N78A 5FRNA 3IAM2 3KEOA 1DP3A 3EYYA 2BY0A 1WQ2A 3GWZA 4E7KA 3H3UA 1IJWC 3GTPJ 2L54A 3J7AY 2QLZA 4XLEA 5ILSA 1LVAA 3MAJA 2E1CA 2EIJH 4IHXA 1J7KA 2NVQJ 4Y13A 3ZR8X 4A3JJ 3J81K 1WFXA 1PP8F 1KU9A 2E1OA 3L09A 1FBQA 5IYBJ 2DA2A 4F55A 3CLQA 1IAWA 1E17A 1U2WA 3DPTA 2HOSA 3OYIA 2A05A 3HXLA 5B3SH 3OIOA 3K4JA 3CESA 2L7ZA 1ON1A 1F1ZA 2CWEA 3X2QH 4F91B 4BGDA 1S9HA 3HJEA 1SD6A 2XGXA 2HKOA 4OAYA 2P81A 5DEQA 3BT9A 4Q4ZF 1OLTA 3BR1A 5B66C 5K5QA 4GYIA 1KONA 5A2QZ 5KAFC 4EMSA 1D8JA 4BJTA 4L9NA 2F5VA 3FXRA 2OA4A 2VE8A 2XVCA 2KJCA 2W84A 3H92A 1NH3A 3GFJA 2IA2A 4JOMA 4BL0B 1ZR4A 2KPMA 4PSWA 4M3DA 2FMLA 3FXJA 5C4XJ 3VDXA 4BQQA 1EH8A 5ICEA 2XRNA 2HQAA 1U78A 4OIRF 1YO5C 3ABLH 4CH7A 2VONA 5DDGA 1S7AA 2R7WA 2RVCA 4CCOA 2FNPA 2VN2A 2RQPA 3KP7A 1ZTRA 3K4KA 4ON0A 1X4OA 2K9QA 2CFOA 1VF9A 4DNCA 4A12A 1W4MA 2F5DA 4HNTA 2CQ7A 2X6XA 1LFUP 1UMQA 1FMVA 2CQQA 1DU6A 4JYKA 3WG7H 2R5ZB 5IP6A 1JGGA 4IO9F 1Y8QB 1T33A 4FASD 3OSFA 2VIXA 2X4HA 2COBA 5L3FA 4UHTA 1R49A 2HQ5A 3DLLF 3BPVA 1TW3A 2ESHA 3IL2A 1LFBA 5LHIA 2CFXA 2O9LA 2JQ7A 1AKHA 1D8KA 1ACIA 3U2RA 2Z99A 4HW0A 3CZ6A 2KQRA 3CCYA 3HG9A 1TW2A 1K4SA 5CYVA 5DCMB 2Z1DA 3VB2A 3B73A 3VWBA 1VQMI 5E1ZB 3H5RA 4ENKA 1MSFC 5ICCA 3TGNA 3I71A 5IT9Z 3H0DA 1J09A 2Z3YA 1Z21A 1P92A 2A07F 3ZP5A 3BC8A 5CJ9A 3EQLF 4NC6A 3F23A 1TQMA 3OYHA 2UWMA 5DD8A 1F36A 1T56A 3LSIA 2IP2A 2HYFA 3TO6A 3DEEA 4FE4A 3TW6A 3ZMTA 3GX4X 1OCCH 1IDYA 4KYWA 4IHWA 2CQKA 3CLOA 4RGSA 2JSPA 1SAXA 2DTRA 3MVPA 4G6DA 3DP7A 2DA4A 3Q3SA 2JA7J 1QO0D 4BH9A 4IHYA 5FB2A 1ZREA 4FE7A 5JVTA 1N77A 2P5KA 3WG9A 4FX4A 2LDUA 4L0ZB 4Z2YA 2VLAA 3ERED 1TNSA 2H1LA 3IRQA 4F92B 3ZMZA 3K0LA 1U0JA 3BJAA 3WHBA 1FYKA 3MKLA 1JT0A 1U9NA 2L2OA 4BE0A 1U5TC 3QU6A 4IQ4A 4AD9A 1FP2A 2DA5A 4DBRA 3BR5A 4GYGA 1POGA 4LG0A 3S8PA 2QF7A 5BNGA 4MFDA 4CGZA 1Y0NA 4D7NA 2Q8KA 1T0FA 3JAMK 4BJ5C 4RA2A 1XMXA 3HOZJ 1D0XA 3ZGKA 3HPHA 1QVUA 5J8CA 2NOJB 2BY2A 3J7AO 2HGCA 2F5EA 5M5WJ 4XLNF 3BDDA 2HTJA 4M3EA 3L00A 1R36A 3R6SA 1IN4A 1JJ6C 2E36A 4UV9A 4BU2A 4KA4A 2L5QA 4ZH4F 1Y0UA 4UUTA 3QWLA 2VUMJ 5CVRA 3EUHA 1SVOA 3JREA 3BR3A 3MFKA 2Y31A 1ETOA 2E5NA 3F72A 1S5LC 2NYXA 4V2GA 4O6JA 4HNUA 1SD4A 4AIDA 1KU7A 2Y75A 2CV2A 1I1GA 1AU7A 2XUBA 3OL3A 4I99C 1K6OA 1S7EA 3HSFA 5L3BA 3JR9A 3OIQA 2KDZA 1VQ4I 5K7HA 3Q5FA 3PFIA 5D8LB 2IGOA 4PJ0C 1FBSA 4U0WA 3LWFA 1FX7A 3OWTA 2HZTA 1AHDP 2KJBA 1MZBA 1FOYA 3E5QA 3QAHA 5E18F 2EV6A 2PMHA 4M9SA 2R92J 2QQBA 4OWRB 2M1BA 4B44A 3CJQB 2Z33A 2L0KA 2H1KA 3GTKJ 2FX0A 3RTRA 2KHMA 3JTGA 3W2WA 5HNHA 3JRAA 3BTCA 1K7AA 1R9TJ 4EJOA 3RYRA 2H6CA 2ZJPF 4IJAA 5LHGA 1ZK8A 3D5SC 2JSCA 3QODA 3HB9A 1OYIA 3MWMA 3Q0UA 2HPMA 1MJBA 2HOEA 1D0ZA 2M0MA 1M1EB 4KMUX 2H6BA 2XPVA 3HOVJ 2QQ9A 2D2WA 3DEWA 2ZSIB 4R1HA 1SFUA 3CF2A 3FDYA 2EFQA 1S6LA 3CCJI 4M71A 1MD0A 1ZARA 2BE5F 4WXCA 3ABMH 4UVAA 2CH0A 2BBYA 5HS9A 3HRTA 2BHYA 2EA4A 3PSFA 3C7JA 2IBDA 3FF5A 1WKMA 3ABUA 2KIFA 1IV8A 2V9KA 1OR7A 3PJRA 5EF6A 3IAS2 2EPFA 2DA7A 5TISC 2LVSA 4ANJA 2V6CA 1WI3A 3ASOH 3WE2A 1ENHA 2DTZA 3F8NA 1U5TB 2DMTA 4CICA 1Z7LA 1RNLA 3IKTA 2G0EA 3BG3A 3IUOA 4A93J 2YPRA 4O5VA 4BXFA 3M3YJ 1K79A 2Y48A 3S3OA 1U8BA 1QNTA 2L7MP 2P0WA 3S2DJ 2EWNA 2XAUA 1D0YA 1WI9A 2MW8A 4O3MA 3K9TA 3LMMA 1IN5A 4ESJA 1MBKA 5HDKA 1Z67A 1ZG3A 1DDNA 2XSJC 2DQLA 1WRJA 2GZWA 4CCMA 2B63J 2ZO4A 1YE9A 1HSTA 3M9AA 3SEQA 3T8RA 3OYJA 3MKYB 4C3JJ 1VNDA 2LP0A 2W48A 1XGOA 5FKNA 3LNQA 2HXIA 4EQQA 4RLQA 2ZSHB 4C3HJ 1WVRA 2ZMEC 5D5XB 3FXUA 4ENMA 1ITYA 1P7IA 3R0AA 2XPUA 3UNGC 1I27A 2ECBA 2E5ZA 2Q0OA 1YX5A 4XN0A 1XMAA 2CQNA 1WH5A 3K70D 1USSA 1TP4A 4MLOA 3OYLA 1LQ1A 2P5LC 2IS1A 2MGQA 4MEXF 3ZOBA 4A2UA 2VBZA 1V4RA 3CJRB 2K9LA 2E7XA 2NAZA 5LBQA 2M9HA 3R61A 4WXHA 4FQGA 5J1RA 3GF2A 3CP8A 3D5RC 2OUMA 4DOZA 3S1NJ 2KL4A 3KETA 3EUHC 4EJTA 4XSXF 5H20A 5LFAA 2MABA 2QENA 5D5VB 2VKVA 2AQFA 3FZVA 1ZRCA 4M74A 3CCLI 2XAGA 4Q47A 2E1MC 1DP7P 2B0LA 2QCOA 2RDPA 3CUQA 4N0BA 3LSRA 5D6EA 3ECHA 3VFZA 3IH4A 3ULQB 3FKJA 1S3JA 3S15J 3Q9SA 2M7AA 1D1CA 1X2MA 2DYSH 3FM5A 3VPRA 1CQTA 3BR2A 2HPIA 5E20A 4C3IJ 2LNBA 2LY1A 2X6WA 3CP2A 1W7PA 2DI3A 1R1UA 1K78A 2PJRB 4HSRA 3N4MA 4IHSA 1CF7A 3TOBA 2VT2A 4HZFA 4F3QA 1ZYRF 3HOUJ 4A3EJ 1X3ZB 3FXOA 3ISPA 2XAJA 1GT0C 3ZQQA 3G3ZA 5CVJA 2QYOA 2P5VA 4EVIA 1FOKA 4A3GJ 1R4MB 1EV7A 1J5YA 2TRTA 1XCBA 4CCLA 4OIQF 1HKTA 1YW7A 1BI2A 2XB5A 1RR7A 4RMNA 2GOXB 5E17F 3L2WA 2H94A 1IW7F 4ABZA 3HHHA 3FXKA 4P1WA 4P96A 2K9SA 3I58A 3KP4A 5J4VA 1F5TA 4GO1A 2EZLA 3DTEA 1TTYA 2I10A 4CA0A 1OQYA 5ICGA 3GTJJ 4ZTJA 1P7JA 2OU2A 3FK7A 3Q0VA 2WBMA 1VFCA 3S32A 4MEYF 1P4AA 1Z1DA 2DT5A 1R1VA 3GUDA 4BBSJ 5LEKA 2P4WA 3H9GA 5D4SA 1MJAA 1UHMA 4OAZA 4A0ZA 2CO5A 1ZR2A 3QRFF 2QBYA 1TWHJ 4HF0A 1BL0A 1H88C 3ZQHA 3HUGB 4I7HA 5DM7F 1MKMA 5F6FA 4K2EA 1R00A 2DDBA 2DQRA 4D0PA 5F1JA 3OYFA 4XONA 2OJED 1XSDA 3GTQJ 1XN7A 1HKQA 4AIJA 3J80Z 5J1YA 3AFHA 3FMSA 2FU4A 3MKZA 4XM3A 2IW5A 3H9JA 3S1RJ 3LSGA 1QPIA 4LIUA 3JRIA 3ZMDA 2A61A 2ZJRF 1ORKA 2WY8Q 1FTZA 2OZUA 1DPRA 2UV1A 3SQNA 2KP6A 5TGTA 1J59A 1V55H 3LSTA 5JVGF 4L9TA 2EINH 2R7DA 1RR8C 3CDHA 2GAUA 3V8JA 4R8HA 5FKMA 1APLC 4HF2A 4RAYA 2VQLA 1NG7A 2M0CA 3E7LA 3RYPA 5E79C 3W2VA 1BN5A 4PZJA 2NNNA 3F6OA 4CCKA 3L2CA 1F4KA 3BG7A 2L9SA 1WJEA 2DAOA 2VC1A 2V26A 3GFLA 4UB6C 1OYYA 2R7ZJ 2MA3A 1B72B 1P4XA 1O3SA 1K83J 2ID3A 5GPCA 1EKEA 2MLGA 3GEZA 5F04A 1HKSA 2O61A 2K9MA 3BZCA 1H0MA 4UUSA 3ML6A 4RAGA 1W0UA 2L9VA 1MDMB 3BTLA 3I59B 1TC3C 2QUFA 2XF5A 3OR2C 1LB2A 1SD5A 2ZBKA 4XKCA 2QM3A 2XGCA 2LR8A 2R7XA 2ZXJA 2FBIA 2KLOA 4Y33A 1U8RA 1FNNA 3FISA 4LB6B 3HPGA 1TL8A 5LGNA 1XCVA 2IGKA 5B1AH 2A68F 2XHKA 2L01A 3K1MA 2HQNA 2QEXI 2XGEA 2Z2SB 3J81Z 4ZTFA 2QVOA 5JFRA 2YSRA 4G7HF 4J19A 2G9WA 2YS9A 2Y9ZA 4UVBA 3LFKA 2E71A 2JA2A 5ILVA 3S17J 1S8NA 4XNFA 2BW3B 3LSJA 2ZNZA 1DGWY 2F4IA 2Y0SA 3IWZA 5DUIA 2PEXA 3A01B 4EM0B 2CSOA 3BJOA 3FM3A 2NVTJ 3PQJA 3E5XA 2JVHA 3CCSI 2R93J 3CO7C 4BACA 4KNYA 2HR3A 1OCRH 3OYEA 1HDDC 4G6TB 4DYCA 3HSRA 4B43A 2IRFG 3HOYJ 3OYAA 2OCEA 4I02A 4XLHA 4A6DA 4GXOA 1IRZA 2A3SA 2XKPA 3DPLC 4JQFA 4QSHA 2EZIA 3L1PA 2O6GE 2BGCA 1MBEA 3AG3H 4A3CJ 1DPUA 2K86A 1EF4A 1LNWA 2CUJA 2OC6A 3GTMJ 1X1AA 5F64A 3LAPA 3VYRB 5ERIA 4NC7A 1G6NA 1IGNA 2FNAA 1S72I 4A5NA 4ZYGA 3WTWC 1UCRA 3AL0C 5HDGA 2L02A 3P7NA 4QLCU 4E7SA 2IGMA 4BE2A 4RB0A 4HYEA 4L9JA 2IA0A 5ILUA 3TL4X 3ESWB 2O5RA 1R5GA 1LVKA 1T08B 3KCCA 1X3WB 1U5TA 3HM5A 3E6DA 2CJJA 4OINF 3BZ6A 3PUBA 1MMAA 3I0TA 3ZRGA 1REPC 3IH3A 1W0TA 1MW7A 3C1DA 3F22A 2N8GA 2ZJ2A 2O8XA 3FMQA 3LAJA 4PFPA 3GVAA 4A3LJ 1ODDA 3FXMA 5C44J 1QA6A 2VC0A 2KISA 3W6VA 2QKLB 4QPQA 3CCUI 2M2EA 3S3NA 2EFWA 1RUNA 3MD2A 2K7LA 3M1EA 1PVEA 3S1QJ 1Z9CA 2EZHA 2LC2A 3CUQB 3IC7A 1HOMA 5CQEA 5E1WA 5AONA 1SMTA 5GADJ 4B8XA 1G4DA 3C3WA 3JTHA 5BPDA 2NS7A 1V54H 5D4RA 1W5SA 3KZYA 1QGPA 3DQVC 4LGWA 3H36A 4XLCA 5GAHJ 1KQ8A 4OOIA 4BUPA 1W7PB 2M7BA 1K78B 4UV8A 2HVRA 1J2XA 1CF7B 1S29A 2WADA 1YTYA 4YFNF 4HRIA 2VXZA 5K5OA 4HLYA 3Q0WA 5FLXZ 1BA5A 3RJPA 1X1BA 4KITB 5LD2C 2DOEA 2GXGA 4IOCF 3PUFA 2LFBA 2XF6A 3FKIJ 1TQIA 2XF7A 3HGYA 2VBYA 2R7FA 2X1EA 5EJCA 3NWTA 1IRFA 4CUGA 3PM1A 3ELKA 2DOFA 2GXAA 3HZJA 3BOQA 1I6XA 1L0OC 1QZZA 5J47A 1RETA 1S7OA 2WY7Q 2XASA 5FRMA 4RDUA 3QPTA 3HL2A 4PJLA 4A3BJ 3GFIA 1ZGJA 3QPHA 3C2GA 1TWAJ 3V4GA 5D5WB 1LJ9A 2ELJA 5IT3A 3SFIA 4C2MJ 4XIDA 3A2KA 1ZGAA 2IJLA 4E7LA 2CW0F 2ME6A 4B4CA 3C2BA 5F1RA 4EV0A 1DUXC 2VPLA 3AL0B 1ERDA 3OIPA 1V5EA 2OF7A 1O3QA 1D1BA 2PJRA 2DBBA 4RB1A 1NK2P 2FF4A 3M7GA 3WTTC 4FHTA 4N9HA 1JKRC 2QBYB 2V1UA 4A3IJ 2A69F 2EFNA 3RKQA 3CCQI 1K4TA 3QOPA 2HS5A 3DF8A 1B4AA 2JUGA 4I6ZA 3ZPLA 1JE8A 2KIQA 1I50J 4LIVA 4IHTA 1TT0A 3CDLA 4ENNA 4J00A 3PFYA 1X3UA 1IG7A 2OV7A 2M4KA 3P5JA 4LK0F 5A2QK 2FBHA 5F0FA 4D7MA 2PFBA 1WJ5A 1OJLA 3CC7I 4KICA 2F4OB 2RC4A 1YX3A 5EZGA 2YUSA 5BPIA 2CW7A 5HS7A 2BXYA 4ZYDA 5GPAA 1FYLA 3OMYA 4LB5A 4AIHA 4B09A 3SZTA 3FWEA 1FT9A 4KIFA 3NAUA 3HTUA 3IKVA 4Z6YA 4WWCA 2FOKA 1IUYA 4KDPA 4Y4RA 2DU9A 1BC8C 2E2HJ 3FBNB 3GO5A 1BW6A 1QBJA 2RREA 2M5WA 4CHUA 3I54A 2XIGA 5IOZA 2MH2A 4PJMA 1KQ9A 2ZMEA 1FIAA 2V6EA 3G1OA 4P55A 3S16J 5J6XA 3G6EI 3HBLA 2ZFUA 1XSXA 2AO9A 2ICWG 4PSXA 2YX7A 3HUGA 4CZCA 2JPCA 4D9JA 4UUSB 1R1TA 2EV0A 3LA3A 4WCGA 1RRJA 1YJ9I 2HDWA 1T98A 3W3CA 3I64A 1X1PA 2DCEA 1OKRA 3U9GA 4XORA 2VKEA 3BG5A 4HV5A 2P6SA 4BYYA 3SDGA 2X9DA 4LD5A 1VQ6I 1ZRDA 2JJ7A 3K1NA 4CXFA 4M9XA 5E3OA 3DTKA 1V5GA 5L3EA 2WWYA 4I0BA 4KT6A 1MBJA 3WTUC 4HG2A 2AQEA 2M30A 2ZJQF 2LBFA 3MEXA 2LKXA 5AIQA 4M6YA 1B59A 1FLIA 2K3FA 1RI7A 1P9QC 2MG4A 3PIOF 3LL7A 2DA3A 2FE3A 2JRMA 1QQIA 1OMIA 2Z16A 2OD5A 2VKHA 2LD5A 1A6IA 1GDTA 3HHGA 4E7IA 1YG2A 3G73A 1ZG5A 2LF8A 1B72A 1YYVA 3FK6A 4F93B 1R4NB 3KP3A 5F08A 1IF1A 3GLLA 2GIZA 4I01A 4IX7A 2LY9A 1MMDA 1TZLA 1XGNA 2B9SA 1TWFJ 3OYDA 1A31A 2WV0A 4II2A 1MDMA 3I59A 3LSMA 1GV2A 3GBGA 1GVJA 3RZOJ 3CO6C 1X4PA 3RQIA 2X51A 3H0GJ 1T2KA 3S2WA 3JRDA 3Q9VA 1KQ0A 1X19A 1MBHA 1Z91A 2ZXWH 5F27A 1KGSA 2R7UA 4IEJA 2Z9OA 2HVQA 5C3EJ 5FFXA 3BQYA 2DA1A 2HOAA 2VL8A 5JHFA 2DPUA 2DYRH 4MIMA 5LLQA 1MSEC 3RQ4A 3ABTA 4HAMA 4EEFG 1O7LA 3M8JA 3L2RA 5E3LA 3DXJF 5K5RA 2NXNB 2G7UA 4OIPF 2BW3A 4ZZLA 5HLGA 1WCMJ 1Z7UA 1U6GA 2MSYA 1HSJA 2X1DA 3BCAA 2A5YB 3A01A 3LQRA 1LFPA 1FTTA 5KNLA 1XGSA 2EV5A 4JBAA 3CCRI 1AOYA 2OCCH 2X6YA 4ESBA 3CJNA 3CCVI 2IPQX 2BEOA 2UUZA 4BS9A 1TBXA 1O7FA 3CDIA 4YIIA 1Y8RB 3BG6A 2Y0MA 2HWVA 2HDDA 2GOMA 1BI0A 4KMFA 5KAIC 3TQNA 3U21A 2Q2EA 1JKQC 4EJWA 4X0GA 3CTAA 4B3AA 2MC3A 2BXZA 4AVPA 4WX9A 2WAQN 2VB6A 4RGRA 3GZNB 2XGDA 4I09A 4RM2A 5J3LA 3S2HJ 1TLHB 1PYVA 5K7FA 3DKWA 1MMNA 2HOTA 4BQAA 1BIBA 2E60A 2E7WA 2XROA 1SFOJ 1R22A 4BY7J 2O8KA 1MNDA 1G3YA 1HDPA 3SZGA 4A3DJ 9ANTA 1XSVA 2O03A 2WB1N 1HCRA 1TQPA 2RNGA 1PJRA 3GXOA 4MHGA 1YI2I 2BVMA 1TWCJ 4BHPA 2R7SA 2DDAA 2VE9A 1RPWA 4D5CA 5KCMA 3OSGA 3BZKA 2R0QC 3LFUA 2GLOA 1VQ7I 1H9TA 4D1QA 1BW5A 4HDVA 1OPCA 2M87A 1FYMA 4QIWN 3KIOA 2X6OA 1MBGA 4GRIA 1YITI 1MBFA 1IO2A 2RKHA 4YEJA 4XRSG 4NQWB 5EG0B 1D3YA 3OS2A 4E70A 4U0YA 2ZXHA 1UAAA 4EM2A 4HDUA 3MCZA 3K4BA 1UJ8A 3CF5F 1QHHD 4RGXA 2OZ6A 1OCOH 1HQCA 3ZMSA 3C18A 3AG4H 4JX6A 5FROA 3OS0A 2DMQA 1W36D 1MH3A 3I3LA 2VQGA 5K1YA 4EJVA 3HC7A 4LG3A 1ZH5A 2MFZA 4YIRX 2F5FA 3H5AA 4G94A 2IXSA 3LSPA 2CYYA 3JRHA 1B8IA 2VI6A 2W24A 4PGHA 1I5ZA 2XAHA 1XC5A 2ISZA 3D0SA 3KZIC 4WF2A 1U9OA 1V3FA 2HTSA 5HNFA 5DTDA 4U7DA 3F8FA 2J5OA 2W4SA 3GFMA 3DU5A 4L9VA 1OISA 2WA0A 6PAXA 1FSHA 3JSOA 2FQ4A 5IOYA 3JW4A 2VJ5A 2DLLA 4YIFA 2LLKA 4D5FA 1GXPA 2VBWA 1H9GA 3K4MA 3T1BA 1ON2A 5EEAA 5M3FJ 2DFFA 2QSFX 4BDZA 2IA1A 4G12A 2V1NA 1B6AA 3V42A 3NRVA 4XICA 1XPXA 4R79A 3RPQA 4EM1A 4DIQA 1MH4A 5IP7J 1IRGA 4ITVA 2BV6A 1YJWI 1SEUA 4AUXA 2CUZA 3T5XA 3ZCOA 1BR4A 2WAQA 1VQKI 1JUPA 1IC8A 5E3NA 2JZYA 2W57A 4YELA 5EGOA 2HEOA 1HA8A 1VZ0A 2GQQA 2DJIA 4U0VA 1G3WA 4II3A 3E6CC 3K1PA 2G7HA 3DEUA 1P6RA 1GLNA 2CQXA 2HYJA 3OY9A 1EH7A 1JXSA 4MO7A 3MN2A 4LK1F 2O7OA 4OMYA 3L9FA 3HIFA 3BCBA 2KRCA 2WB1A 1AA7A 2JWTA 2AS5F 3GTOJ 2Y0SN 2ZMEB 2AHQA 3BY6A 4QTRA 1JTXA 3F21A 3BR6A 3CUOA 4BEHB 4G9YA 3R0JA 4A0XA 3WTSC 3GZ6A 1O4XA 5EYRA 2PBIA 3ZXSA 1IDZA 2DFHA 1YQAA 3WHCA 2QA4I 3VSLA 5C4JJ 3LSHA 2Y9YA 3TKYA 4XRMA 2OPTA 1G3SA 4XKVA 3CJTB 2WV1A 4BKXA 1QU3A 3B02A 2HNHA 1SVMA 4BAYA 4G8XA 1DU0A 3S1MJ 3OOUA 5E8GA 3OYMA 3BQZA 1Y39A 1UG0A 4HQMA 2ID6A 1FBUA 1HC8A 3KP5A 2WAEA 2FRHA 2LBFB 4U88A 1MNEA 2IS6A 1JGSA 5GAEJ 3OYKA 3UKGA 2E1MB 4NB5A 5GP9A 3NQOA 4Q5SF 3EETA 1QPMA 2BYVE 4LITA 1BOBA 3SYTA 5CKTA 1YW9A 3ZQ7A 4IKFA 3IP4B 3TP0A 5DV5A 2JMWA 2PJPA 3RI4A 1ETVA 1SFKA 2E19A 4XMYA 4NDLA 3RPUA 5LEJA 4A3KJ 1Z0XA 2CMPA 2R7OA 4Q48A 4Y7NJ 3CCMI 4J01A 3EUKL 2F4MB 2KZGA 3OOPA 4ZC3A 3DWLE 3L2UA 2L3DA 2GA2A 2KDOA 1G59A 1HF0A 2D5VA 1ETWA 1BOAA 2ELKA 5F0HA 4UVCA 4C2UA 4A69C 3I5UA 4KIGA 3KFWX 1TNTA 3I56I 1SFEA 3GTLJ 4AM3A 3LQQA 1T39A 1XX5A 4XQFA 1FPQA 5E8IA 1UHSA 2H09A 2IGNA 2DT6A 2JA8J 3B6AA 4N4NB 2VPRA 2HYGD 3TW7A 1W5TA 3S3MA 3M4OJ 2FEZA 2VJIA 3AKZA 1AWCA 4UUVA 1WZ2A 4M6XA 2VXDA 3GCMA 3HOXJ 5HLTA 4BE1A 3OR1C 3F0CA 5HVQC 1YJNI 2XDVA 3K4LA 3IHUA 5KVRA 2FJ1A 3DU6A 3OS1A 2HZDA 4V19K 2KFDA 4RB3C 2L4MA 4ZYEA 3DKXA 3V8LA 2WAFA 2OTJI 3E1SA 4OIOF 4MQVA 2DFEA 4LLLA 1YS7A 1O3TA 1WWXA 1YOVB 3V7SA 4FCYA 2CS3A 3MZYA 1XGMA 3U1KA 3TMOA 2HVSA 2LOOA 3F8BA 4I2OA 3DKYA 5FLMJ 4B47A 2LYCA 4NNJA 4YFXF 3H1CA 3KPHA 3L2QA 3IV5A 2PQ8A 4JX4A 4IRHA 4CO8A 2EK5A 1FSEA 3HRMA 1USTA 5CVUA 1X1CA 3RIRA 5HDNA 5LHHA 3JRGA 2Q2EB 4M3FA 3A02A 1PUEE 4FISA 4ZDLA 3ZN0A 1Z6RA 2EFOA 5JHUA 1MJ9A 4HBLA 2E2IJ 4RAZA 4UY8I 2DOAA 3HTSB 3K70C 3SZPA 4IF4A 1ZQ3P 3G71I 2L9NA 3W6KB 1I3AA 2STWA 4MNUA 4C30A 4W1UA 2Y69H 4XLFA 1SANA 2HQRA 2ZFWA 3FHNA 3ZQLA 2VJJA 4DQ2A 4RLFA 5KK1A 1ZRFA 4BY1J 2JTVA 2GXBA 1LKXA 3L2VA 2K27A 4AVZA 2WC2A 3A1YA 2LG4A 3BWGA 1Q1HA 2JUCA 1BBYA 3H3VK 1YFHA 2DODA 2BZTA 3E6BA 2MC4A 1WPKA 4KFCA 2JT1A 2M45A 3LOCA 4XOTA 3RDIA 5LRSA 1GUUA 1ZKGA 4CZZA 3B6CA 1LEBA 5FD6A 2M4GA 1QZEA 3S93A 5IYCJ 2EJRA 1Z6TA 4BXUA 3RSNA 1GVDA 2DO7A 1Z3YA 2HFHA 1VQLI 1UHWA 1W36C 2ETHA 4QPOA 3W6JB 1ETQA 4L5IA 4W97A 2VJ4A 2RQQA 4BDYA 4HEA2 3OL4A 3P9CA 4M72A 5FKOA 3IWFA 4IHVA 4ZJZA 3FMRA 4P9FA 3A03A 2K4BA 5J8FA 5IYDJ 1HW5A 2DJNA 1JJ8C 4A5MA 2X0LA 5E1XA 3QP5A 2IS4A 3PL8A 5D8KB 1PUFA 3G1MA 5JI6A 3BLYA 2A6TA 3EYIA 5H6RA 1B8IB 1RKWA 4TV7A 2K85A 2ZNYA 5E3MA 2YR2A 3HGGA 2D1VA 2NRAC 2UXNA 2FD5A 5HODA 1LEAA 1OCTC 3O2PE 2MBFA 4HSTA 3T8TA 2KMUA 1F9NA 1NG6A 4IZZA 3HDDA 4H0EA 1D1AA 4OU0A 3T0YA 1NHAA 4RBOA 2CUFA 1RUOA 2XRLA 3QYFA 1H89C 2W82A 3F9KA 3PQKA 4DBQA 2DPDA 2IVMA 4N4OB 3QPLA 4DYQA 4XOPA 2F2EA 2RN7A 4X6AJ 3KEYA 4ZDOA 1WJCA 3KEQA 4F52A 4XBFA 3BROA 4NQWA 1FY7A 4C9YA 1D5YA 4PK4A 5EG0A 3JSPA 2X85A 4RAFA 4DW6A 2QSGX 3KX2A 4CCJA 1A5JA 5GTHC 2ZB9A 3WU2C 1RC9A 2AXLA 3PNYA 3N97A 2UZKA 2JA5J 2V4JC 4HLXA 5EGOB 3IRRA 2JA6J 3H35A 3JAMZ 1E3PA 3E0JB 3FXQA 3K4NA 2KRHA 2DA6A 4LLGF 4YFKF 3D1NI 4LOCA 1UELB 5FKKA 2DK8A 1SD7A 3KP2A 4BHCA 4XRSA 1R7JA 2VT3A 2MYSA 3HOWJ 1IXSB 4DYRA 3JCUC 1YHQI 4ESFA 4XN3A 1JKOC 2DN0A 5H2FC 3LSKA 3KYCB 1LPQA 3PO2J 4Y17A 1ZLKA 4HOBA 1N75A 1UZCA 5J4YA 4HF1A 2IAIA 3HKZA 1LDJA 3JRBA 2A6EF 3TDUC 2DMPA 2EA2A 3O6BB 1L3LA 2V79A 1KU3A 1KYZA 4XKWA 3RKWA 2IS2A 2I8DA 3E97A 4EJUA 4XL9A 5JR3A 3RCOA 4IL6C 4FETA 3TOAA 1JI8A 2M8EA 2PMZN 2EFPA 1A35A 1QZYA 2L9RA 2EIKH 4XSZF 2XV4S 5GAGJ 4M6VA 3H5NA 4XLPF 5TRDA 2R5YB 2DMNA 2EILH 4HX7A 4MTDA 2VOOA 1JTYA 4NHJA 1WJFA 3PSIA 3FHZA 1B1BA 4XRFA 4EGYA 1MIJA 4G7OF 3MKWB 3RZDJ 5GTIC 1V5FA 1X1DA 1R5HA 2QQAA 3AG2H 2KKOA 1H8AC 1HLVA 4ZYAA 1FOWA 5FLXK 1XG1A 2UXXA 5IY5H 2PLYA 2VBXA 1OFCX 3KYDB 4ETSA 2FBKA 4BEHA 1U3EM 2XPWA 2RAEA 5LRRA 3K10A 4YG2F 5EEGA 2OTLI 1STZA 1W5CC 2R4GA 4RM3A 1KZHA 2NVUB 1IXRC 3SHFA 3HSEA 4IRGA 1R23A 3H3ZA 4BNCA 5HOOA 2NOGA 5DUKA 2CGPA 5J1UA 1R71A 3F3XA 2W85A 2R7RA 2H8WA 1E0EA 2WTEA 1KYWA 2D1HA 4PUSA 2EH3A 1IRXA 3HYIA 2RGVA 4M3GA 3FIWA 4UXNA 2HXOA 2K9NA 2L4AA 4PGGA 1Y1WJ 3KE2A 2MH9A 5K7ZA 3TDZC 3F8MA 5HLHA 2ELHA 2GWRA 3V7CA 2CU7A 4ASNA 2ACJA 2B7EA 4IOAF 3OYCA
chains in the Genus database with same CATH topology
5CLSA 3EDPA 3WE3A 4HV6A 3I4PA 2H27A 5IT9K 1HXDA 3REOA 3HOTA 1EH6A 2FSWA 5DCFA 2P8TA 4P9UA 1YIOA 3GLXA 3F6VA 1I1SA 1YLFA 3F8CA 5D5UB 2KIMA 2FXAA 2LKPA 1ZHFA 4KT5C 1IXCA 5L3CA 5BQTA 3KLOA 4AIKA 2HDCA 4IPAA 1O57A 3K69A 5ED4A 3O3KA 2W25A 2R3SA 2ZKZA 3BP8A 1KU2A 4WXDA 4AWXB 1RIOH 4HQEA 3LA7A 3HRUA 3M8FA 1PDNC 2OBPA 2XAFA 4EGZA 1ONVA 1PP7U 4GGGA 2NS0A 1KA8A 1J75A 4G7ZF 1ZAOA 2YU3A 1JHFA 1W7PD 1XDUA 2PMUA 2KIUA 4MTEA 1UB9A 4IVNA 5ICFA 4I0AA 2OAZA 3DV8A 1HW1A 3V7RA 1GHCA 1XMKA 3WU1B 2O3FA 1P4WA 2E1NA 4HX8A 3K2ZA 4A0YA 2C6YA 2IT0A 4CYDA 4IXAA 5D6FA 5BOXA 2EB7A 3WTVC 5CVVA 2A6HF 1BI3A 4RS8A 2STTA 1R58A 2K4JA 3E5UA 5CVIA 3ZMUA 4ZZDA 4CDGA 2P6TA 1B9NA 3DFGA 4KN7X 1IZ1A 4QWQA 3TO9A 1YS6A 3QP6A 1ZG1A 2GIVA 2CG4A 1D5VA 1FWZA 1JHHA 3HRSA 1XD7A 3SFZA 3KLNA 1G3TA 4LMYA 1YW8A 2O0YA 2VODA 3GZ5A 2VOPA 1B9MA 4RGUA 3VOEA 3LA2A 2JPBA 4LFUA 2FQ3A 5BMZA 4M73A 2ISYA 1T6SA 1WSUA 1IN8A 4PCQA 2DFIA 5HLIA 4FX0A 2P7VB 3WGHA 2XKOA 3SXYA 4S05A 4P5OA 2MD5A 3VEPA 3BPXA 3WTZA 4S04A 2V9VA 1J0RA 4LJZF 4LLNA 1BIAA 2ZCWA 5LGUA 2TDXA 4OMZA 4KIBA 4KN4X 2KRFA 1BJAA 4N9IA 3WTXC 4BHBA 3FX3A 2V1DA 4KUMA 2NNYA 1ZN2A 3R60A 3WGIA 1VTNC 2V1XA 2XAQA 4FT8A 2P7CB 3ZMVA 5DCMA 4LG0B 3BJ6A 3L7WA 2Z5UA 1XB4A 1J9IA 3R4KA 3RKXA 1ZLJA 1LDKB 1ULYA 1Z05A 1GXQA 3E3VA 3TO7A 5DYMA 2DW4A 4GCVA 3ECOA 3D5LA 5H6QA 4HX4A 1SFXA 4A6EA 3MQ0A 3V8KA 3ROUA 3P9KA 1HW2A 2PG4A 2OQRA 3ZN1A 2MLKA 2D45A 3MZHA 1FZPB 1CGPA 3E6MA 3WGGA 5TJJA 3WODF 4Y15A 1IN6A 4RB2C 3HOSA 4G6QA 1BC7C 2F5CA 3QU3A 4HA8A 3U1DA 3M8EA 2YX4A 3VODA 2J5PA 1E2XA 1OYWA 1C0WA 3KP6A 4MQ9F 5FGMA 3GYHX 1T38A 1FC3A 5EEHA 4MGRA 3GW2A 1P2FA 3CUQC 1UFMA 4L18B 2PN6A 2QWWA 3P9IA 2FA5A 2PI0A 1A04A 4ENJA 3WTYC 5AIPA 2HKXA 1BI1A 4U7BA 3KZZA 1O3RA 5L3GA 3J80K 4I98B 1RZ4A 5LGTA 3I53A 2ADUA 5L3DA 2JRTA 1FP1D 2QZ8A 3WU0A 1MGTA 1LDDA 3NEUA 3AAFA 5DD4A 4F7ZA 4L5JA 4WK8F 2FMYA 1HBXG 2RNJA 5FFZA 5HS8A 4M9ZA 4ZYHA 2LSOA 2LF7A 1SMYF 4PDKA 3RKYA 1BM9A 2COMA 5FO5A 4JK1X 5BS6A 2K02A 3OV8A 4UNOA 4IRIA 4L0YB 2GA1A 1XDSA 2OQGA 5FD5A 2DK5A 2RV8A 2ESNA 1IN7A 3COAC 3KEOA 3EYYA 1WQ2A 3GWZA 3H3UA 2L54A 2QLZA 5ILSA 1LVAA 3MAJA 2E1CA 1J7KA 4Y13A 3J81K 1PP8F 1KU9A 3L09A 1FBQA 1IAWA 1E17A 1U2WA 3DPTA 1ON1A 1F1ZA 2CWEA 1SD6A 2XGXA 2HKOA 5DEQA 4Q4ZF 5K5QA 4GYIA 5A2QZ 4EMSA 1D8JA 4L9NA 3FXRA 2OA4A 2VE8A 2XVCA 2KJCA 2W84A 3H92A 3GFJA 2IA2A 2FMLA 1EH8A 5ICEA 2XRNA 1U78A 4OIRF 1YO5C 2VONA 5DDGA 1S7AA 2RVCA 2FNPA 2VN2A 2RQPA 3KP7A 4ON0A 4DNCA 4A12A 1W4MA 2F5DA 5L3FA 2X4HA 4UHTA 3BPVA 1TW3A 2ESHA 3IL2A 5LHIA 2CFXA 1D8KA 3U2RA 2Z99A 4HW0A 1TW2A 5CYVA 5DCMB 3VB2A 3B73A 5E1ZB 4ENKA 5ICCA 3TGNA 3I71A 5IT9Z 2Z3YA 1P92A 2A07F 3ZP5A 5CJ9A 3EQLF 3F23A 1TQMA 2UWMA 5DD8A 3TO6A 2HYFA 2IP2A 3ZMTA 3GX4X 4KYWA 2CQKA 3CLOA 4RGSA 1SAXA 2DTRA 4G6DA 3DP7A 1QO0D 4BH9A 5FB2A 1ZREA 5JVTA 2P5KA 3WG9A 4FX4A 2LDUA 4L0ZB 4Z2YA 3ERED 1TNSA 3IRQA 3ZMZA 3K0LA 3BJAA 1FYKA 1U5TC 3QU6A 4AD9A 1FP2A 4GYGA 4LG0A 4CGZA 2Q8KA 1T0FA 3JAMK 5J8CA 3J7AO 2HGCA 2F5EA 4XLNF 3BDDA 2HTJA 3L00A 1R36A 3R6SA 1IN4A 4UV9A 4KA4A 4ZH4F 1Y0UA 5CVRA 3EUHA 3MFKA 3F72A 2NYXA 4O6JA 1SD4A 1KU7A 2Y75A 1I1GA 2XUBA 1K6OA 3HSFA 5L3BA 3Q5FA 3PFIA 5D8LB 1FBSA 4U0WA 3LWFA 1FX7A 2HZTA 2KJBA 1MZBA 3E5QA 3QAHA 5E18F 2EV6A 2PMHA 4M9SA 2QQBA 2M1BA 2Z33A 3RTRA 3JTGA 1K7AA 4EJOA 3RYRA 2H6CA 4IJAA 5LHGA 2JSCA 1OYIA 3MWMA 1MJBA 2HOEA 4KMUX 2H6BA 2QQ9A 2D2WA 4R1HA 1SFUA 2EFQA 1S6LA 4M71A 1MD0A 1ZARA 2BE5F 4WXCA 4UVAA 2BBYA 5HS9A 3HRTA 2EA4A 3C7JA 3FF5A 1WKMA 3ABUA 2KIFA 1OR7A 2V6CA 3WE2A 3F8NA 1U5TB 4CICA 1RNLA 3IKTA 2YPRA 4O5VA 1K79A 2Y48A 1QNTA 2EWNA 1WI9A 4O3MA 3K9TA 1IN5A 4ESJA 5HDKA 1ZG3A 1DDNA 2DQLA 1WRJA 2GZWA 2ZO4A 3M9AA 1HSTA 3T8RA 1XGOA 4EQQA 5D5XB 3FXUA 4ENMA 3R0AA 1I27A 2Q0OA 1XMAA 1USSA 1LQ1A 2P5LC 4MEXF 4A2UA 2VBZA 1V4RA 2E7XA 2NAZA 5LBQA 4WXHA 3R61A 3GF2A 3KETA 4EJTA 4XSXF 5H20A 2QENA 5D5VB 3FZVA 1ZRCA 4M74A 2XAGA 4Q47A 1DP7P 2B0LA 2RDPA 3CUQA 4N0BA 5D6EA 3ECHA 3VFZA 3ULQB 1S3JA 3Q9SA 3FM5A 5E20A 2LNBA 1W7PA 2DI3A 1R1UA 1K78A 3N4MA 4IHSA 1CF7A 3TOBA 2VT2A 4HZFA 1ZYRF 3ISPA 2XAJA 3G3ZA 5CVJA 2QYOA 2P5VA 4EVIA 1FOKA 1EV7A 1J5YA 1XCBA 4OIQF 1HKTA 1YW7A 1BI2A 5E17F 2H94A 1IW7F 3HHHA 4P96A 3I58A 3KP4A 1F5TA 4GO1A 1TTYA 5ICGA 2OU2A 4MEYF 1P4AA 1Z1DA 2DT5A 1R1VA 3GUDA 5LEKA 2P4WA 5D4SA 1MJAA 1UHMA 4A0ZA 2CO5A 3QRFF 2QBYA 4HF0A 4I7HA 1MKMA 5F6FA 4K2EA 1R00A 2DQRA 4D0PA 1XSDA 1XN7A 1HKQA 4AIJA 3J80Z 3FMSA 2FU4A 2IW5A 3ZMDA 2A61A 2OZUA 1DPRA 3SQNA 1J59A 3LSTA 4L9TA 2R7DA 3CDHA 2GAUA 3V8JA 4R8HA 4HF2A 4RAYA 3RYPA 1BN5A 4PZJA 3F6OA 2NNNA 3L2CA 1F4KA 2DAOA 2VC1A 3GFLA 1OYYA 2MA3A 1P4XA 1O3SA 2MLGA 3GEZA 2O61A 1HKSA 1H0MA 3ML6A 1MDMB 3I59B 2QUFA 1LB2A 1SD5A 2ZBKA 2QM3A 2ZXJA 2FBIA 1U8RA 1FNNA 4LB6B 5LGNA 1XCVA 2A68F 2XHKA 2L01A 3K1MA 2HQNA 3J81Z 2QVOA 5JFRA 2YSRA 4G7HF 2G9WA 4UVBA 3LFKA 5ILVA 1S8NA 2ZNZA 3IWZA 5DUIA 2PEXA 4EM0B 2CSOA 3BJOA 3FM3A 3PQJA 3E5XA 3CO7C 4KNYA 2HR3A 3HSRA 2IRFG 4I02A 4A6DA 4GXOA 2A3SA 2XKPA 3DPLC 4JQFA 2O6GE 2BGCA 1DPUA 2K86A 1LNWA 5F64A 3LAPA 5ERIA 1G6NA 2FNAA 4A5NA 4ZYGA 3WTWC 1UCRA 5HDGA 2L02A 3P7NA 4QLCU 4RB0A 4HYEA 4L9JA 2IA0A 5ILUA 1R5GA 3KCCA 1U5TA 3E6DA 4OINF 3BZ6A 3I0TA 1REPC 3F22A 3C1DA 2ZJ2A 2O8XA 3FMQA 3LAJA 3GVAA 1ODDA 2VC0A 2EFWA 1RUNA 2K7LA 3M1EA 1Z9CA 3CUQB 3IC7A 5E1WA 5AONA 1SMTA 4B8XA 1G4DA 3C3WA 3JTHA 5BPDA 5D4RA 1W5SA 3KZYA 1QGPA 3DQVC 4LGWA 1KQ8A 4OOIA 1W7PB 1K78B 4UV8A 1J2XA 1CF7B 1S29A 1YTYA 4YFNF 2VXZA 5K5OA 4HLYA 5FLXZ 3RJPA 2GXGA 1TQIA 2VBYA 2R7FA 1IRFA 3ELKA 1I6XA 3BOQA 1L0OC 1QZZA 1S7OA 2XASA 3QPTA 3GFIA 1ZGJA 3QPHA 3V4GA 5D5WB 1LJ9A 5IT3A 1ZGAA 2IJLA 2CW0F 5F1RA 1DUXC 4EV0A 1O3QA 2DBBA 4RB1A 2FF4A 3M7GA 3WTTC 4FHTA 4N9HA 2QBYB 2V1UA 2A69F 2EFNA 3QOPA 2HS5A 3DF8A 1B4AA 3ZPLA 1JE8A 4IHTA 4ENNA 1X3UA 4LK0F 5A2QK 2FBHA 2PFBA 4KICA 2RC4A 5BPIA 5HS7A 4ZYDA 1FYLA 4LB5A 4AIHA 4B09A 3SZTA 3FWEA 1FT9A 4KIFA 3HTUA 3IKVA 4WWCA 2FOKA 1IUYA 4KDPA 1BC8C 2DU9A 3GO5A 1QBJA 2M5WA 4CHUA 3I54A 2XIGA 2MH2A 1KQ9A 2ZMEA 4P55A 5J6XA 1XSXA 2YX7A 3HUGA 2JPCA 1R1TA 2EV0A 3LA3A 4WCGA 1T98A 3I64A 1OKRA 3U9GA 4HV5A 2P6SA 4BYYA 4LD5A 1ZRDA 3K1NA 4CXFA 4M9XA 5L3EA 2WWYA 4I0BA 3WTUC 2M30A 3MEXA 5AIQA 4M6YA 1B59A 1FLIA 1RI7A 2FE3A 1QQIA 1OMIA 2OD5A 3HHGA 1YG2A 3G73A 1ZG5A 2LF8A 1YYVA 3KP3A 1IF1A 4I01A 1XGNA 2WV0A 1MDMA 3I59A 1GVJA 3CO6C 1T2KA 3S2WA 3Q9VA 1KQ0A 1Z91A 1KGSA 2Z9OA 5FFXA 2DPUA 5LLQA 3ABTA 4HAMA 1O7LA 3DXJF 5K5RA 2G7UA 4OIPF 5HLGA 4ZZLA 1Z7UA 1U6GA 1HSJA 2A5YB 3LQRA 1XGSA 2EV5A 4JBAA 1AOYA 4ESBA 3CJNA 2IPQX 2BEOA 1TBXA 1O7FA 4YIIA 2Y0MA 2HWVA 1BI0A 4KMFA 3TQNA 2Q2EA 4EJWA 3CTAA 2MC3A 4AVPA 4WX9A 4RGRA 4I09A 1TLHB 3DKWA 4BQAA 1BIBA 2E7WA 2XROA 1R22A 1G3YA 1XSVA 2O03A 1TQPA 3GXOA 4MHGA 4BHPA 2VE9A 1H9TA 4HDVA 1OPCA 2M87A 1FYMA 2RKHA 1D3YA 4E70A 4U0YA 4EM2A 4HDUA 3MCZA 4RGXA 2OZ6A 1HQCA 3ZMSA 3C18A 5K1YA 4EJVA 1ZH5A 2F5FA 4G94A 2CYYA 2W24A 4PGHA 1I5ZA 2XAHA 2ISZA 3D0SA 4WF2A 2HTSA 1V3FA 4U7DA 3F8FA 2J5OA 3GFMA 4L9VA 6PAXA 1FSHA 3JSOA 3JW4A 2DLLA 4YIFA 1GXPA 2VBWA 1H9GA 3T1BA 1ON2A 2IA1A 1B6AA 3NRVA 4R79A 3RPQA 4EM1A 1IRGA 2BV6A 3T5XA 2JZYA 2W57A 2HEOA 2GQQA 4U0VA 1G3WA 3E6CC 3K1PA 2G7HA 3DEUA 1P6RA 1EH7A 1JXSA 4LK1F 4OMYA 3L9FA 3HIFA 2AS5F 2ZMEB 3BY6A 3F21A 3CUOA 4G9YA 3R0JA 4A0XA 3WTSC 3GZ6A 2PBIA 1YQAA 3TKYA 1G3SA 3B02A 4BAYA 4G8XA 5E8GA 4HQMA 1FBUA 3KP5A 2FRHA 4U88A 1JGSA 4NB5A 3NQOA 4Q5SF 3EETA 1QPMA 2BYVE 1YW9A 3ZQ7A 5DV5A 2PJPA 3RI4A 3RPUA 5LEJA 4Q48A 3OOPA 2L3DA 2GA2A 1BOAA 4UVCA 3I5UA 4KIGA 3KFWX 1TNTA 1SFEA 3LQQA 1T39A 1FPQA 5E8IA 2H09A 2HYGD 1W5TA 2FEZA 1AWCA 4UUVA 4M6XA 5HVQC 3IHUA 5KVRA 4RB3C 2L4MA 4ZYEA 3V8LA 4OIOF 4MQVA 4LLLA 1YS7A 1O3TA 1WWXA 3V7SA 3MZYA 1XGMA 3F8BA 4I2OA 4YFXF 2PQ8A 4IRHA 4CO8A 2EK5A 1FSEA 3HRMA 1USTA 5CVUA 5HDNA 3RIRA 5LHHA 1PUEE 3ZN0A 1Z6RA 2EFOA 5JHUA 1MJ9A 4HBLA 4RAZA 3HTSB 3SZPA 4IF4A 3W6KB 2STWA 4MNUA 2HQRA 2ZFWA 4DQ2A 5KK1A 1ZRFA 2JTVA 2GXBA 2K27A 2WC2A 3BWGA 1Q1HA 1BBYA 1YFHA 3E6BA 4KFCA 2JT1A 2M45A 3RDIA 5LRSA 4CZZA 1LEBA 5FD6A 2EJRA 1Z6TA 4BXUA 2DO7A 2HFHA 1UHWA 2ETHA 3W6JB 4L5IA 3P9CA 4M72A 3IWFA 3FMRA 4P9FA 2K4BA 5J8FA 1HW5A 4A5MA 2X0LA 5E1XA 3QP5A 5D8KB 5JI6A 3EYIA 5H6RA 4TV7A 2ZNYA 2YR2A 2D1VA 2NRAC 2UXNA 1LEAA 3O2PE 2MBFA 3T8TA 1F9NA 4H0EA 4OU0A 3T0YA 1NHAA 1RUOA 3PQKA 2DPDA 2IVMA 2F2EA 2RN7A 3KEQA 4XBFA 3BROA 4NQWA 1FY7A 3JSPA 2AXLA 3N97A 2UZKA 4HLXA 3IRRA 3JAMZ 3FXQA 4LLGF 4YFKF 2DK8A 1SD7A 3KP2A 4BHCA 1R7JA 2VT3A 1IXSB 4ESFA 4Y17A 1ZLKA 4HOBA 4HF1A 1LDJA 2A6EF 3TDUC 2EA2A 3O6BB 1L3LA 2V79A 1KU3A 1KYZA 3RKWA 3E97A 4EJUA 5JR3A 3TOAA 2M8EA 2EFPA 1QZYA 4XSZF 2XV4S 4XLPF 5TRDA 4HX7A 4MTDA 2VOOA 4NHJA 3FHZA 1B1BA 4XRFA 4EGYA 4G7OF 1R5HA 2QQAA 2KKOA 5FLXK 2UXXA 2PLYA 2VBXA 4ETSA 2FBKA 1U3EM 5LRRA 4YG2F 5EEGA 1STZA 3SHFA 1IXRC 3HSEA 4IRGA 1R23A 3H3ZA 4BNCA 5HOOA 5DUKA 2CGPA 3F3XA 2W85A 2WTEA 1KYWA 2D1HA 3HYIA 2RGVA 4UXNA 2L4AA 4PGGA 3KE2A 2MH9A 3TDZC 3F8MA 5HLHA 2ELHA 2GWRA 3V7CA 4ASNA 2ACJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CLS A;  3EDP A;  3WE3 A;  4HV6 A;  3I4P A;  2H27 A;  5IT9 K;  1HXD A;  3REO A;  3HOT A;  1EH6 A;  2FSW A;  5DCF A;  2P8T A;  4P9U A;  1YIO A;  3GLX A;  3F6V A;  1I1S A;  1YLF A;  3F8C A;  5D5U B;  2KIM A;  2FXA A;  2LKP A;  1ZHF A;  4KT5 C;  1IXC A;  5L3C A;  5BQT A;  3KLO A;  4AIK A;  2HDC A;  4IPA A;  1O57 A;  3K69 A;  5ED4 A;  3O3K A;  2W25 A;  2R3S A;  2ZKZ A;  3BP8 A;  1KU2 A;  4WXD A;  4AWX B;  1RIO H;  4HQE A;  3LA7 A;  3HRU A;  3M8F A;  1PDN C;  2OBP A;  2XAF A;  4EGZ A;  1ONV A;  1PP7 U;  4GGG A;  2NS0 A;  1KA8 A;  1J75 A;  4G7Z F;  1ZAO A;  2YU3 A;  1JHF A;  1W7P D;  1XDU A;  2PMU A;  2KIU A;  4MTE A;  1UB9 A;  4IVN A;  5ICF A;  4I0A A;  2OAZ A;  3DV8 A;  1HW1 A;  3V7R A;  1GHC A;  1XMK A;  3WU1 B;  2O3F A;  1P4W A;  2E1N A;  4HX8 A;  3K2Z A;  4A0Y A;  2C6Y A;  2IT0 A;  4CYD A;  4IXA A;  5D6F A;  5BOX A;  2EB7 A;  3WTV C;  5CVV A;  2A6H F;  1BI3 A;  4RS8 A;  2STT A;  1R58 A;  2K4J A;  3E5U A;  5CVI A;  3ZMU A;  4ZZD A;  4CDG A;  2P6T A;  1B9N A;  3DFG A;  4KN7 X;  1IZ1 A;  4QWQ A;  3TO9 A;  1YS6 A;  3QP6 A;  1ZG1 A;  2GIV A;  2CG4 A;  1D5V A;  1FWZ A;  1JHH A;  3HRS A;  1XD7 A;  3SFZ A;  3KLN A;  1G3T A;  4LMY A;  1YW8 A;  2O0Y A;  2VOD A;  3GZ5 A;  2VOP A;  1B9M A;  4RGU A;  3VOE A;  3LA2 A;  2JPB A;  4LFU A;  2FQ3 A;  5BMZ A;  4M73 A;  2ISY A;  1T6S A;  1WSU A;  1IN8 A;  4PCQ A;  2DFI A;  5HLI A;  4FX0 A;  2P7V B;  3WGH A;  2XKO A;  3SXY A;  4S05 A;  4P5O A;  2MD5 A;  3VEP A;  3BPX A;  3WTZ A;  4S04 A;  2V9V A;  1J0R A;  4LJZ F;  4LLN A;  1BIA A;  2ZCW A;  5LGU A;  2TDX A;  4OMZ A;  4KIB A;  4KN4 X;  2KRF A;  1BJA A;  4N9I A;  3WTX C;  4BHB A;  3FX3 A;  2V1D A;  4KUM A;  2NNY A;  1ZN2 A;  3R60 A;  3WGI A;  1VTN C;  2V1X A;  2XAQ A;  4FT8 A;  2P7C B;  3ZMV A;  5DCM A;  4LG0 B;  3BJ6 A;  3L7W A;  2Z5U A;  1XB4 A;  1J9I A;  3R4K A;  3RKX A;  1ZLJ A;  1LDK B;  1ULY A;  1Z05 A;  1GXQ A;  3E3V A;  3TO7 A;  5DYM A;  2DW4 A;  4GCV A;  3ECO A;  3D5L A;  5H6Q A;  4HX4 A;  1SFX A;  4A6E A;  3MQ0 A;  3V8K A;  3ROU A;  3P9K A;  1HW2 A;  2PG4 A;  2OQR A;  3ZN1 A;  2MLK A;  2D45 A;  3MZH A;  1FZP B;  1CGP A;  3E6M A;  3WGG A;  5TJJ A;  3WOD F;  4Y15 A;  1IN6 A;  4RB2 C;  3HOS A;  4G6Q A;  1BC7 C;  2F5C A;  3QU3 A;  4HA8 A;  3U1D A;  3M8E A;  2YX4 A;  3VOD A;  2J5P A;  1E2X A;  1OYW A;  1C0W A;  3KP6 A;  4MQ9 F;  5FGM A;  3GYH X;  1T38 A;  1FC3 A;  5EEH A;  4MGR A;  3GW2 A;  1P2F A;  3CUQ C;  1UFM A;  4L18 B;  2PN6 A;  2QWW A;  3P9I A;  2FA5 A;  2PI0 A;  1A04 A;  4ENJ A;  3WTY C;  5AIP A;  2HKX A;  1BI1 A;  4U7B A;  3KZZ A;  1O3R A;  5L3G A;  3J80 K;  4I98 B;  1RZ4 A;  5LGT A;  3I53 A;  2ADU A;  5L3D A;  2JRT A;  1FP1 D;  2QZ8 A;  3WU0 A;  1MGT A;  1LDD A;  3NEU A;  3AAF A;  5DD4 A;  4F7Z A;  4L5J A;  4WK8 F;  2FMY A;  1HBX G;  2RNJ A;  5FFZ A;  5HS8 A;  4M9Z A;  4ZYH A;  2LSO A;  2LF7 A;  1SMY F;  4PDK A;  3RKY A;  1BM9 A;  2COM A;  5FO5 A;  4JK1 X;  5BS6 A;  2K02 A;  3OV8 A;  4UNO A;  4IRI A;  4L0Y B;  2GA1 A;  1XDS A;  2OQG A;  5FD5 A;  2DK5 A;  2RV8 A;  2ESN A;  1IN7 A;  3COA C;  3KEO A;  3EYY A;  1WQ2 A;  3GWZ A;  3H3U A;  2L54 A;  2QLZ A;  5ILS A;  1LVA A;  3MAJ A;  2E1C A;  1J7K A;  4Y13 A;  3J81 K;  1PP8 F;  1KU9 A;  3L09 A;  1FBQ A;  1IAW A;  1E17 A;  1U2W A;  3DPT A;  1ON1 A;  1F1Z A;  2CWE A;  1SD6 A;  2XGX A;  2HKO A;  5DEQ A;  4Q4Z F;  5K5Q A;  4GYI A;  5A2Q Z;  4EMS A;  1D8J A;  4L9N A;  3FXR A;  2OA4 A;  2VE8 A;  2XVC A;  2KJC A;  2W84 A;  3H92 A;  3GFJ A;  2IA2 A;  2FML A;  1EH8 A;  5ICE A;  2XRN A;  1U78 A;  4OIR F;  1YO5 C;  2VON A;  5DDG A;  1S7A A;  2RVC A;  2FNP A;  2VN2 A;  2RQP A;  3KP7 A;  4ON0 A;  4DNC A;  4A12 A;  1W4M A;  2F5D A;  5L3F A;  2X4H A;  4UHT A;  3BPV A;  1TW3 A;  2ESH A;  3IL2 A;  5LHI A;  2CFX A;  1D8K A;  3U2R A;  2Z99 A;  4HW0 A;  1TW2 A;  5CYV A;  5DCM B;  3VB2 A;  3B73 A;  5E1Z B;  4ENK A;  5ICC A;  3TGN A;  3I71 A;  5IT9 Z;  2Z3Y A;  1P92 A;  2A07 F;  3ZP5 A;  5CJ9 A;  3EQL F;  3F23 A;  1TQM A;  2UWM A;  5DD8 A;  3TO6 A;  2HYF A;  2IP2 A;  3ZMT A;  3GX4 X;  4KYW A;  2CQK A;  3CLO A;  4RGS A;  1SAX A;  2DTR A;  4G6D A;  3DP7 A;  1QO0 D;  4BH9 A;  5FB2 A;  1ZRE A;  5JVT A;  2P5K A;  3WG9 A;  4FX4 A;  2LDU A;  4L0Z B;  4Z2Y A;  3ERE D;  1TNS A;  3IRQ A;  3ZMZ A;  3K0L A;  3BJA A;  1FYK A;  1U5T C;  3QU6 A;  4AD9 A;  1FP2 A;  4GYG A;  4LG0 A;  4CGZ A;  2Q8K A;  1T0F A;  3JAM K;  5J8C A;  3J7A O;  2HGC A;  2F5E A;  4XLN F;  3BDD A;  2HTJ A;  3L00 A;  1R36 A;  3R6S A;  1IN4 A;  4UV9 A;  4KA4 A;  4ZH4 F;  1Y0U A;  5CVR A;  3EUH A;  3MFK A;  3F72 A;  2NYX A;  4O6J A;  1SD4 A;  1KU7 A;  2Y75 A;  1I1G A;  2XUB A;  1K6O A;  3HSF A;  5L3B A;  3Q5F A;  3PFI A;  5D8L B;  1FBS A;  4U0W A;  3LWF A;  1FX7 A;  2HZT A;  2KJB A;  1MZB A;  3E5Q A;  3QAH A;  5E18 F;  2EV6 A;  2PMH A;  4M9S A;  2QQB A;  2M1B A;  2Z33 A;  3RTR A;  3JTG A;  1K7A A;  4EJO A;  3RYR A;  2H6C A;  4IJA A;  5LHG A;  2JSC A;  1OYI A;  3MWM A;  1MJB A;  2HOE A;  4KMU X;  2H6B A;  2QQ9 A;  2D2W A;  4R1H A;  1SFU A;  2EFQ A;  1S6L A;  4M71 A;  1MD0 A;  1ZAR A;  2BE5 F;  4WXC A;  4UVA A;  2BBY A;  5HS9 A;  3HRT A;  2EA4 A;  3C7J A;  3FF5 A;  1WKM A;  3ABU A;  2KIF A;  1OR7 A;  2V6C A;  3WE2 A;  3F8N A;  1U5T B;  4CIC A;  1RNL A;  3IKT A;  2YPR A;  4O5V A;  1K79 A;  2Y48 A;  1QNT A;  2EWN A;  1WI9 A;  4O3M A;  3K9T A;  1IN5 A;  4ESJ A;  5HDK A;  1ZG3 A;  1DDN A;  2DQL A;  1WRJ A;  2GZW A;  2ZO4 A;  3M9A A;  1HST A;  3T8R A;  1XGO A;  4EQQ A;  5D5X B;  3FXU A;  4ENM A;  3R0A A;  1I27 A;  2Q0O A;  1XMA A;  1USS A;  1LQ1 A;  2P5L C;  4MEX F;  4A2U A;  2VBZ A;  1V4R A;  2E7X A;  2NAZ A;  5LBQ A;  4WXH A;  3R61 A;  3GF2 A;  3KET A;  4EJT A;  4XSX F;  5H20 A;  2QEN A;  5D5V B;  3FZV A;  1ZRC A;  4M74 A;  2XAG A;  4Q47 A;  1DP7 P;  2B0L A;  2RDP A;  3CUQ A;  4N0B A;  5D6E A;  3ECH A;  3VFZ A;  3ULQ B;  1S3J A;  3Q9S A;  3FM5 A;  5E20 A;  2LNB A;  1W7P A;  2DI3 A;  1R1U A;  1K78 A;  3N4M A;  4IHS A;  1CF7 A;  3TOB A;  2VT2 A;  4HZF A;  1ZYR F;  3ISP A;  2XAJ A;  3G3Z A;  5CVJ A;  2QYO A;  2P5V A;  4EVI A;  1FOK A;  1EV7 A;  1J5Y A;  1XCB A;  4OIQ F;  1HKT A;  1YW7 A;  1BI2 A;  5E17 F;  2H94 A;  1IW7 F;  3HHH A;  4P96 A;  3I58 A;  3KP4 A;  1F5T A;  4GO1 A;  1TTY A;  5ICG A;  2OU2 A;  4MEY F;  1P4A A;  1Z1D A;  2DT5 A;  1R1V A;  3GUD A;  5LEK A;  2P4W A;  5D4S A;  1MJA A;  1UHM A;  4A0Z A;  2CO5 A;  3QRF F;  2QBY A;  4HF0 A;  4I7H A;  1MKM A;  5F6F A;  4K2E A;  1R00 A;  2DQR A;  4D0P A;  1XSD A;  1XN7 A;  1HKQ A;  4AIJ A;  3J80 Z;  3FMS A;  2FU4 A;  2IW5 A;  3ZMD A;  2A61 A;  2OZU A;  1DPR A;  3SQN A;  1J59 A;  3LST A;  4L9T A;  2R7D A;  3CDH A;  2GAU A;  3V8J A;  4R8H A;  4HF2 A;  4RAY A;  3RYP A;  1BN5 A;  4PZJ A;  3F6O A;  2NNN A;  3L2C A;  1F4K A;  2DAO A;  2VC1 A;  3GFL A;  1OYY A;  2MA3 A;  1P4X A;  1O3S A;  2MLG A;  3GEZ A;  2O61 A;  1HKS A;  1H0M A;  3ML6 A;  1MDM B;  3I59 B;  2QUF A;  1LB2 A;  1SD5 A;  2ZBK A;  2QM3 A;  2ZXJ A;  2FBI A;  1U8R A;  1FNN A;  4LB6 B;  5LGN A;  1XCV A;  2A68 F;  2XHK A;  2L01 A;  3K1M A;  2HQN A;  3J81 Z;  2QVO A;  5JFR A;  2YSR A;  4G7H F;  2G9W A;  4UVB A;  3LFK A;  5ILV A;  1S8N A;  2ZNZ A;  3IWZ A;  5DUI A;  2PEX A;  4EM0 B;  2CSO A;  3BJO A;  3FM3 A;  3PQJ A;  3E5X A;  3CO7 C;  4KNY A;  2HR3 A;  3HSR A;  2IRF G;  4I02 A;  4A6D A;  4GXO A;  2A3S A;  2XKP A;  3DPL C;  4JQF A;  2O6G E;  2BGC A;  1DPU A;  2K86 A;  1LNW A;  5F64 A;  3LAP A;  5ERI A;  1G6N A;  2FNA A;  4A5N A;  4ZYG A;  3WTW C;  1UCR A;  5HDG A;  2L02 A;  3P7N A;  4QLC U;  4RB0 A;  4HYE A;  4L9J A;  2IA0 A;  5ILU A;  1R5G A;  3KCC A;  1U5T A;  3E6D A;  4OIN F;  3BZ6 A;  3I0T A;  1REP C;  3F22 A;  3C1D A;  2ZJ2 A;  2O8X A;  3FMQ A;  3LAJ A;  3GVA A;  1ODD A;  2VC0 A;  2EFW A;  1RUN A;  2K7L A;  3M1E A;  1Z9C A;  3CUQ B;  3IC7 A;  5E1W A;  5AON A;  1SMT A;  4B8X A;  1G4D A;  3C3W A;  3JTH A;  5BPD A;  5D4R A;  1W5S A;  3KZY A;  1QGP A;  3DQV C;  4LGW A;  1KQ8 A;  4OOI A;  1W7P B;  1K78 B;  4UV8 A;  1J2X A;  1CF7 B;  1S29 A;  1YTY A;  4YFN F;  2VXZ A;  5K5O A;  4HLY A;  5FLX Z;  3RJP A;  2GXG A;  1TQI A;  2VBY A;  2R7F A;  1IRF A;  3ELK A;  1I6X A;  3BOQ A;  1L0O C;  1QZZ A;  1S7O A;  2XAS A;  3QPT A;  3GFI A;  1ZGJ A;  3QPH A;  3V4G A;  5D5W B;  1LJ9 A;  5IT3 A;  1ZGA A;  2IJL A;  2CW0 F;  5F1R A;  1DUX C;  4EV0 A;  1O3Q A;  2DBB A;  4RB1 A;  2FF4 A;  3M7G A;  3WTT C;  4FHT A;  4N9H A;  2QBY B;  2V1U A;  2A69 F;  2EFN A;  3QOP A;  2HS5 A;  3DF8 A;  1B4A A;  3ZPL A;  1JE8 A;  4IHT A;  4ENN A;  1X3U A;  4LK0 F;  5A2Q K;  2FBH A;  2PFB A;  4KIC A;  2RC4 A;  5BPI A;  5HS7 A;  4ZYD A;  1FYL A;  4LB5 A;  4AIH A;  4B09 A;  3SZT A;  3FWE A;  1FT9 A;  4KIF A;  3HTU A;  3IKV A;  4WWC A;  2FOK A;  1IUY A;  4KDP A;  1BC8 C;  2DU9 A;  3GO5 A;  1QBJ A;  2M5W A;  4CHU A;  3I54 A;  2XIG A;  2MH2 A;  1KQ9 A;  2ZME A;  4P55 A;  5J6X A;  1XSX A;  2YX7 A;  3HUG A;  2JPC A;  1R1T A;  2EV0 A;  3LA3 A;  4WCG A;  1T98 A;  3I64 A;  1OKR A;  3U9G A;  4HV5 A;  2P6S A;  4BYY A;  4LD5 A;  1ZRD A;  3K1N A;  4CXF A;  4M9X A;  5L3E A;  2WWY A;  4I0B A;  3WTU C;  2M30 A;  3MEX A;  5AIQ A;  4M6Y A;  1B59 A;  1FLI A;  1RI7 A;  2FE3 A;  1QQI A;  1OMI A;  2OD5 A;  3HHG A;  1YG2 A;  3G73 A;  1ZG5 A;  2LF8 A;  1YYV A;  3KP3 A;  1IF1 A;  4I01 A;  1XGN A;  2WV0 A;  1MDM A;  3I59 A;  1GVJ A;  3CO6 C;  1T2K A;  3S2W A;  3Q9V A;  1KQ0 A;  1Z91 A;  1KGS A;  2Z9O A;  5FFX A;  2DPU A;  5LLQ A;  3ABT A;  4HAM A;  1O7L A;  3DXJ F;  5K5R A;  2G7U A;  4OIP F;  5HLG A;  4ZZL A;  1Z7U A;  1U6G A;  1HSJ A;  2A5Y B;  3LQR A;  1XGS A;  2EV5 A;  4JBA A;  1AOY A;  4ESB A;  3CJN A;  2IPQ X;  2BEO A;  1TBX A;  1O7F A;  4YII A;  2Y0M A;  2HWV A;  1BI0 A;  4KMF A;  3TQN A;  2Q2E A;  4EJW A;  3CTA A;  2MC3 A;  4AVP A;  4WX9 A;  4RGR A;  4I09 A;  1TLH B;  3DKW A;  4BQA A;  1BIB A;  2E7W A;  2XRO A;  1R22 A;  1G3Y A;  1XSV A;  2O03 A;  1TQP A;  3GXO A;  4MHG A;  4BHP A;  2VE9 A;  1H9T A;  4HDV A;  1OPC A;  2M87 A;  1FYM A;  2RKH A;  1D3Y A;  4E70 A;  4U0Y A;  4EM2 A;  4HDU A;  3MCZ A;  4RGX A;  2OZ6 A;  1HQC A;  3ZMS A;  3C18 A;  5K1Y A;  4EJV A;  1ZH5 A;  2F5F A;  4G94 A;  2CYY A;  2W24 A;  4PGH A;  1I5Z A;  2XAH A;  2ISZ A;  3D0S A;  4WF2 A;  2HTS A;  1V3F A;  4U7D A;  3F8F A;  2J5O A;  3GFM A;  4L9V A;  6PAX A;  1FSH A;  3JSO A;  3JW4 A;  2DLL A;  4YIF A;  1GXP A;  2VBW A;  1H9G A;  3T1B A;  1ON2 A;  2IA1 A;  1B6A A;  3NRV A;  4R79 A;  3RPQ A;  4EM1 A;  1IRG A;  2BV6 A;  3T5X A;  2JZY A;  2W57 A;  2HEO A;  2GQQ A;  4U0V A;  1G3W A;  3E6C C;  3K1P A;  2G7H A;  3DEU A;  1P6R A;  1EH7 A;  1JXS A;  4LK1 F;  4OMY A;  3L9F A;  3HIF A;  2AS5 F;  2ZME B;  3BY6 A;  3F21 A;  3CUO A;  4G9Y A;  3R0J A;  4A0X A;  3WTS C;  3GZ6 A;  2PBI A;  1YQA A;  3TKY A;  1G3S A;  3B02 A;  4BAY A;  4G8X A;  5E8G A;  4HQM A;  1FBU A;  3KP5 A;  2FRH A;  4U88 A;  1JGS A;  4NB5 A;  3NQO A;  4Q5S F;  3EET A;  1QPM A;  2BYV E;  1YW9 A;  3ZQ7 A;  5DV5 A;  2PJP A;  3RI4 A;  3RPU A;  5LEJ A;  4Q48 A;  3OOP A;  2L3D A;  2GA2 A;  1BOA A;  4UVC A;  3I5U A;  4KIG A;  3KFW X;  1TNT A;  1SFE A;  3LQQ A;  1T39 A;  1FPQ A;  5E8I A;  2H09 A;  2HYG D;  1W5T A;  2FEZ A;  1AWC A;  4UUV A;  4M6X A;  5HVQ C;  3IHU A;  5KVR A;  4RB3 C;  2L4M A;  4ZYE A;  3V8L A;  4OIO F;  4MQV A;  4LLL A;  1YS7 A;  1O3T A;  1WWX A;  3V7S A;  3MZY A;  1XGM A;  3F8B A;  4I2O A;  4YFX F;  2PQ8 A;  4IRH A;  4CO8 A;  2EK5 A;  1FSE A;  3HRM A;  1UST A;  5CVU A;  5HDN A;  3RIR A;  5LHH A;  1PUE E;  3ZN0 A;  1Z6R A;  2EFO A;  5JHU A;  1MJ9 A;  4HBL A;  4RAZ A;  3HTS B;  3SZP A;  4IF4 A;  3W6K B;  2STW A;  4MNU A;  2HQR A;  2ZFW A;  4DQ2 A;  5KK1 A;  1ZRF A;  2JTV A;  2GXB A;  2K27 A;  2WC2 A;  3BWG A;  1Q1H A;  1BBY A;  1YFH A;  3E6B A;  4KFC A;  2JT1 A;  2M45 A;  3RDI A;  5LRS A;  4CZZ A;  1LEB A;  5FD6 A;  2EJR A;  1Z6T A;  4BXU A;  2DO7 A;  2HFH A;  1UHW A;  2ETH A;  3W6J B;  4L5I A;  3P9C A;  4M72 A;  3IWF A;  3FMR A;  4P9F A;  2K4B A;  5J8F A;  1HW5 A;  4A5M A;  2X0L A;  5E1X A;  3QP5 A;  5D8K B;  5JI6 A;  3EYI A;  5H6R A;  4TV7 A;  2ZNY A;  2YR2 A;  2D1V A;  2NRA C;  2UXN A;  1LEA A;  3O2P E;  2MBF A;  3T8T A;  1F9N A;  4H0E A;  4OU0 A;  3T0Y A;  1NHA A;  1RUO A;  3PQK A;  2DPD A;  2IVM A;  2F2E A;  2RN7 A;  3KEQ A;  4XBF A;  3BRO A;  4NQW A;  1FY7 A;  3JSP A;  2AXL A;  3N97 A;  2UZK A;  4HLX A;  3IRR A;  3JAM Z;  3FXQ A;  4LLG F;  4YFK F;  2DK8 A;  1SD7 A;  3KP2 A;  4BHC A;  1R7J A;  2VT3 A;  1IXS B;  4ESF A;  4Y17 A;  1ZLK A;  4HOB A;  4HF1 A;  1LDJ A;  2A6E F;  3TDU C;  2EA2 A;  3O6B B;  1L3L A;  2V79 A;  1KU3 A;  1KYZ A;  3RKW A;  3E97 A;  4EJU A;  5JR3 A;  3TOA A;  2M8E A;  2EFP A;  1QZY A;  4XSZ F;  2XV4 S;  4XLP F;  5TRD A;  4HX7 A;  4MTD A;  2VOO A;  4NHJ A;  3FHZ A;  1B1B A;  4XRF A;  4EGY A;  4G7O F;  1R5H A;  2QQA A;  2KKO A;  5FLX K;  2UXX A;  2PLY A;  2VBX A;  4ETS A;  2FBK A;  1U3E M;  5LRR A;  4YG2 F;  5EEG A;  1STZ A;  3SHF A;  1IXR C;  3HSE A;  4IRG A;  1R23 A;  3H3Z A;  4BNC A;  5HOO A;  5DUK A;  2CGP A;  3F3X A;  2W85 A;  2WTE A;  1KYW A;  2D1H A;  3HYI A;  2RGV A;  4UXN A;  2L4A A;  4PGG A;  3KE2 A;  2MH9 A;  3TDZ C;  3F8M A;  5HLH A;  2ELH A;  2GWR A;  3V7C A;  4ASN A;  2ACJ A; 
#chains in the Genus database with same CATH topology
 1VQ5 I;  2E34 A;  1QVT A;  1TT5 B;  5CLS A;  3EDP A;  3WE3 A;  3G4S I;  1MNM C;  4AU7 A;  3EPZ A;  4E4H A;  2QKM B;  4HV6 A;  3I4P A;  2H27 A;  1FMW A;  3UR3 C;  2IEK A;  3OYG A;  1HXD A;  1UG2 A;  3REO A;  2V7F A;  2HI3 A;  5IT9 K;  3HOT A;  1E3H A;  1MMG A;  4I76 A;  1EH6 A;  3G2B A;  2FSW A;  5M5X J;  5DCF A;  5KHD A;  3DBL B;  4JP0 A;  1ZEL A;  2L7F P;  2P8T A;  4P9U A;  2CUE A;  1YIO A;  3GLX A;  2LTP A;  3DCF A;  3F6V A;  1ETY A;  1I1S A;  1YLF A;  3F8C A;  5D5U B;  3TBI A;  2KIM A;  2FXA A;  2HU9 A;  2LKP A;  2R7T A;  2MD0 A;  4CYC B;  2EBI A;  1ZHF A;  4ZDP A;  2I5U A;  1YIJ I;  1E3O C;  4KT5 C;  1IUF A;  1ETX A;  1IXC A;  2F6C A;  2PMZ A;  5L3C A;  1ZGW A;  5BQT A;  3KLO A;  4AIK A;  2HDC A;  4IPA A;  2CV1 A;  1O57 A;  1OCP A;  3K69 A;  2R7V A;  5ED4 A;  3O3K A;  2W25 A;  2M8G X;  4L5E A;  2R3S A;  2LRD A;  2ZKZ A;  4B1R A;  3BP8 A;  3ONQ A;  1KU2 A;  3OYB A;  1I6H J;  4WXD A;  1YRN A;  4AWX B;  3CQZ J;  3VYS B;  4HQE A;  1RIO H;  2AXT C;  3J7Y J;  3KYL A;  4DZP A;  3LA7 A;  4NC8 A;  3HRU A;  4GDF A;  2E2J J;  3I4N J;  3M8F A;  3QYE A;  2QGU A;  4PJN A;  3VYT B;  2KZV A;  3ASN H;  1VQ9 I;  3I9V 2;  3PNV A;  5B1B H;  2LH9 A;  2OBP A;  1PDN C;  3QYB A;  5CPR B;  2XAF A;  4NBQ A;  4EGZ A;  1Y1V J;  3H9Q A;  1F43 A;  1ONV A;  1PP7 U;  3PO3 J;  4GGG A;  2NS0 A;  1KA8 A;  3O8H A;  1WHU A;  4G7Z F;  1J75 A;  1ZAO A;  2PX9 A;  2YU3 A;  1BR1 A;  3A0B C;  1JHF A;  4XLA A;  4GFB A;  1W7P D;  1XDU A;  1JUS A;  2EQR A;  1RES A;  2PMU A;  2KIU A;  4MTE A;  1UB9 A;  1Z77 A;  3BG9 A;  4IVN A;  5ICF A;  4I0A A;  2OAZ A;  2Q1Z B;  5J40 A;  3DV8 A;  1HW1 A;  3V7R A;  1GHC A;  1XMK A;  3WU1 B;  4DGW B;  1QHG A;  2E35 A;  3NAR A;  1PUF B;  2O3F A;  4KIS A;  1P4W A;  2E1N A;  3IH2 A;  1TWG J;  3K2Z A;  1Y56 A;  4HX8 A;  4A0Y A;  2C6Y A;  5F0C A;  1LE8 A;  2IT0 A;  2EIM H;  2F48 A;  4CYD A;  3ERM A;  2V9P A;  3PNT A;  4IXA A;  5D6F A;  1VQO I;  5BOX A;  2DXI A;  2EB7 A;  3WTV C;  3N05 A;  2A6H F;  5CVV A;  1BI3 A;  4RS8 A;  3I4M J;  2STT A;  1R58 A;  4XKB A;  2K4J A;  3E5U A;  2XB0 X;  5CVI A;  4PFO A;  3ZMU A;  1WJA A;  4ZZD A;  4CDG A;  2P6T A;  1B9N A;  3DFG A;  1T0F C;  3NWS A;  4KN7 X;  3M1C A;  3CME I;  1IZ1 A;  1MMS A;  4QWQ A;  3BR0 A;  4V2F A;  3TO9 A;  1YS6 A;  3QP6 A;  2VKD A;  2GIV A;  3ABK H;  1ZG1 A;  2CG4 A;  3AG1 H;  3DTI A;  2X48 A;  1D5V A;  4CSW A;  4CCN A;  1FWZ A;  1K6Y A;  4XK4 A;  4E6K G;  5B5E C;  1JHH A;  2R7Q A;  1R5I D;  3HRS A;  2DT7 B;  1XD7 A;  3SFZ A;  3TP3 A;  1EA3 A;  3KLN A;  5FJ8 J;  4JX5 A;  1T8I A;  1G3T A;  1XTA A;  4LMY A;  1YW8 A;  2O0Y A;  2VOD A;  3GZ5 A;  2CW8 A;  1JKP C;  2VOP A;  1B9M A;  4RGU A;  3VOE A;  3LA2 A;  2VQH A;  1RKT A;  2JPB A;  4LFU A;  2Y30 A;  2ECC A;  4BJ6 C;  2GBY A;  1R6R A;  2FQ3 A;  4BQO A;  5BMZ A;  4M73 A;  2ISY A;  3FBI B;  1T6S A;  1WSU A;  4AYB N;  2ME0 A;  1T95 A;  2YU9 J;  1IN8 A;  4PCQ A;  4Y52 J;  2BVL A;  2W00 A;  2DFI A;  1AKH B;  1N25 A;  5HLI A;  4FX0 A;  2VAS A;  1Y6I A;  2K5C A;  1WJB A;  2P7V B;  3WGH A;  2ZXI A;  4DJA A;  2XKO A;  3SXY A;  4S05 A;  4P5O A;  2MD5 A;  3VEP A;  2BHZ A;  3BPX A;  2LK2 A;  3TED A;  3WTZ A;  4S04 A;  3CC4 I;  2M3A A;  2V9V A;  2W7N A;  1Z3X A;  2FUG 2;  2DMU A;  5JLW A;  1J0R A;  5IP9 J;  3W2A A;  4LJZ F;  4LLN A;  1BIA A;  3RPU D;  3ZQG A;  2ZCW A;  1XS9 A;  5LGU A;  3JRF A;  4Y3O A;  4BXX J;  2TDX A;  4OMZ A;  4KIB A;  1OCZ H;  4KN4 X;  1G8X A;  2KRF A;  1BJA A;  5M3M J;  4N9I A;  3SJM A;  2LMD A;  3WTX C;  1EJ9 A;  2CV0 A;  4BHB A;  3FX3 A;  2BOL A;  2V1D A;  4KUM A;  2NNY A;  4U87 A;  2R5Z A;  3QOE A;  1ZN2 A;  2XC7 A;  1LUJ B;  3R60 A;  3WGI A;  1VTN C;  2V1X A;  2XAQ A;  4HPQ A;  4B48 A;  1IV6 A;  1BR2 A;  4FT8 A;  1K61 A;  1OR7 C;  2P7C B;  1NTC A;  3G1L A;  1NK3 P;  3VSK A;  4IQJ A;  3CCE I;  3ZMV A;  5DCM A;  4KJZ A;  4LG0 B;  5FLV A;  3BJ6 A;  3L7W A;  1VQN I;  5FKL A;  3FXL A;  3K6G A;  2Z5U A;  1XB4 A;  1J9I A;  4BQN A;  1SC7 A;  2LRE A;  4UB8 C;  5M5Y J;  1FJL A;  3MMY B;  4X1E A;  2CRG A;  4YRV A;  3R4K A;  3RKX A;  2R5Y A;  3ZQI A;  4E7J A;  1VQ8 I;  1ZLJ A;  1LDK B;  1ULY A;  4M3B A;  2W1O A;  1FEX A;  3JRC A;  1Z05 A;  1GXQ A;  3DBR B;  4A3F J;  2QSH X;  2EZK A;  2ZC2 A;  2TCT A;  1X2N A;  2X1C A;  3E3V A;  3TO7 A;  5DYM A;  1QRY A;  3DLA A;  2DW4 A;  4GCV A;  3A0H C;  3ECO A;  3D5L A;  5H6Q A;  4HX4 A;  1SFX A;  4AYB A;  4A6E A;  3MQ0 A;  2GM4 A;  5EDN A;  3V8K A;  3ROU A;  3P9K A;  4NUB A;  3S14 J;  2KT0 A;  3CMA I;  3MZ8 A;  2BY3 A;  3HEF A;  1VQP I;  1HW2 A;  2PG4 A;  3GME A;  1BJZ A;  2OQR A;  3ZN1 A;  2MLK A;  3K7A J;  4PJJ A;  2D45 A;  3MZH A;  3I55 I;  1CGP A;  1FZP B;  1A6Q A;  2K40 A;  3GTG J;  3E6M A;  3DBH B;  4MFE A;  3WGG A;  1FOX A;  5TJJ A;  3WOD F;  4Y15 A;  1IN6 A;  4RB2 C;  3HOS A;  4C2T A;  3VYU B;  3C2H A;  2H8R A;  4G6Q A;  1BC7 C;  2F5C A;  3CMM A;  3QU3 A;  4HA8 A;  1A36 A;  3J7Z I;  4E7H A;  4H4K C;  3U1D A;  3M8E A;  2YX4 A;  3VOD A;  3A4C A;  2J5P A;  1E2X A;  1OYW A;  2JN6 A;  1C0W A;  3KP6 A;  4MQ9 F;  5FGM A;  4S0H B;  4EAT A;  3GYH X;  1T38 A;  1FC3 A;  4XR6 A;  5EEH A;  1Q1V A;  4MGR A;  3GW2 A;  2K3P A;  1YRN B;  1P2F A;  3CUQ C;  1UFM A;  4L18 B;  2QQ8 A;  2NS8 A;  2PN6 A;  3K2A A;  1W1W E;  2QWW A;  2Y2Z A;  3P9I A;  4B3X A;  2FA5 A;  3K4C A;  3BTI A;  2PI0 A;  1A04 A;  3ZQC A;  1ETK A;  4ENJ A;  3CD6 I;  3CMY A;  1DQU A;  2LY2 A;  3SDB A;  3WTY C;  5AIP A;  2HKX A;  4BBR J;  1WGX A;  5IPA A;  4DZJ A;  3CC2 I;  1BI1 A;  4U7B A;  3EUA A;  2M34 A;  2NVY J;  2NVX J;  3KZZ A;  1O3R A;  1SVL A;  5L3G A;  5EZH A;  3J80 K;  4I98 B;  1RZ4 A;  1X58 A;  5LGT A;  4CYC A;  3I53 A;  2ADU A;  1DGR M;  5L3D A;  2BY1 A;  2JRT A;  4HNV A;  5JLX A;  1FP1 D;  3PIP F;  2QZ8 A;  2A5W A;  1VI0 A;  3WU0 A;  1MGT A;  1LDD A;  3NEU A;  3DPU A;  3AAF A;  5DD4 A;  3SEZ A;  4F7Z A;  3O8G A;  1WJD A;  3QPS A;  1I3Q J;  1SAU A;  4L5J A;  4WK8 F;  3OYN A;  2FMY A;  1HBX G;  2LKS A;  2FOW A;  1JUM A;  2RNJ A;  5FFZ A;  4M9Z A;  4ZYH A;  5HS8 A;  2XSD C;  2LSO A;  1FIP A;  2LF7 A;  1JT6 A;  1SMY F;  3BTJ A;  3ZQF A;  1G2H A;  4PDK A;  4AC0 A;  5DM6 F;  3QQA A;  3RKY A;  1BM9 A;  2COM A;  5FO5 A;  1LE8 B;  1WH7 A;  4JK1 X;  5BS6 A;  2JK3 A;  4FTH A;  2K02 A;  2JVG A;  3OV8 A;  5DS9 A;  4UNO A;  4IRI A;  4L0Y B;  2GA1 A;  3M07 A;  1I39 A;  1GV5 A;  2L7K A;  5CQG A;  3HKZ N;  4A3M J;  1XDS A;  2OQG A;  5FD5 A;  4E7Z A;  2DK5 A;  2RV8 A;  2VQC A;  2ESN A;  1IN7 A;  3COA C;  1N78 A;  5FRN A;  3IAM 2;  3KEO A;  1DP3 A;  3EYY A;  2BY0 A;  1WQ2 A;  3GWZ A;  4E7K A;  3H3U A;  1IJW C;  3GTP J;  2L54 A;  3J7A Y;  2QLZ A;  4XLE A;  5ILS A;  1LVA A;  3MAJ A;  2E1C A;  2EIJ H;  4IHX A;  1J7K A;  2NVQ J;  4Y13 A;  3ZR8 X;  4A3J J;  3J81 K;  1WFX A;  1PP8 F;  1KU9 A;  2E1O A;  3L09 A;  1FBQ A;  5IYB J;  2DA2 A;  4F55 A;  3CLQ A;  1IAW A;  1E17 A;  1U2W A;  3DPT A;  2HOS A;  3OYI A;  2A05 A;  3HXL A;  5B3S H;  3OIO A;  3K4J A;  3CES A;  2L7Z A;  1ON1 A;  1F1Z A;  2CWE A;  3X2Q H;  4F91 B;  4BGD A;  1S9H A;  3HJE A;  1SD6 A;  2XGX A;  2HKO A;  4OAY A;  2P81 A;  5DEQ A;  3BT9 A;  4Q4Z F;  1OLT A;  3BR1 A;  5B66 C;  5K5Q A;  4GYI A;  1KON A;  5A2Q Z;  5KAF C;  4EMS A;  1D8J A;  4BJT A;  4L9N A;  2F5V A;  3FXR A;  2OA4 A;  2VE8 A;  2XVC A;  2KJC A;  2W84 A;  3H92 A;  1NH3 A;  3GFJ A;  2IA2 A;  4JOM A;  4BL0 B;  1ZR4 A;  2KPM A;  4PSW A;  4M3D A;  2FML A;  3FXJ A;  5C4X J;  3VDX A;  4BQQ A;  1EH8 A;  5ICE A;  2XRN A;  2HQA A;  1U78 A;  4OIR F;  1YO5 C;  3ABL H;  4CH7 A;  2VON A;  5DDG A;  1S7A A;  2R7W A;  2RVC A;  4CCO A;  2FNP A;  2VN2 A;  2RQP A;  3KP7 A;  1ZTR A;  3K4K A;  4ON0 A;  1X4O A;  2K9Q A;  2CFO A;  1VF9 A;  4DNC A;  4A12 A;  1W4M A;  2F5D A;  4HNT A;  2CQ7 A;  2X6X A;  1LFU P;  1UMQ A;  1FMV A;  2CQQ A;  1DU6 A;  4JYK A;  3WG7 H;  2R5Z B;  5IP6 A;  1JGG A;  4IO9 F;  1Y8Q B;  1T33 A;  4FAS D;  3OSF A;  2VIX A;  2X4H A;  2COB A;  5L3F A;  4UHT A;  1R49 A;  2HQ5 A;  3DLL F;  3BPV A;  1TW3 A;  2ESH A;  3IL2 A;  1LFB A;  5LHI A;  2CFX A;  2O9L A;  2JQ7 A;  1AKH A;  1D8K A;  1ACI A;  3U2R A;  2Z99 A;  4HW0 A;  3CZ6 A;  2KQR A;  3CCY A;  3HG9 A;  1TW2 A;  1K4S A;  5CYV A;  5DCM B;  2Z1D A;  3VB2 A;  3B73 A;  3VWB A;  1VQM I;  5E1Z B;  3H5R A;  4ENK A;  1MSF C;  5ICC A;  3TGN A;  3I71 A;  5IT9 Z;  3H0D A;  1J09 A;  2Z3Y A;  1Z21 A;  1P92 A;  2A07 F;  3ZP5 A;  3BC8 A;  5CJ9 A;  3EQL F;  4NC6 A;  3F23 A;  1TQM A;  3OYH A;  2UWM A;  5DD8 A;  1F36 A;  1T56 A;  3LSI A;  2IP2 A;  2HYF A;  3TO6 A;  3DEE A;  4FE4 A;  3TW6 A;  3ZMT A;  3GX4 X;  1OCC H;  1IDY A;  4KYW A;  4IHW A;  2CQK A;  3CLO A;  4RGS A;  2JSP A;  1SAX A;  2DTR A;  3MVP A;  4G6D A;  3DP7 A;  2DA4 A;  3Q3S A;  2JA7 J;  1QO0 D;  4BH9 A;  4IHY A;  5FB2 A;  1ZRE A;  4FE7 A;  5JVT A;  1N77 A;  2P5K A;  3WG9 A;  4FX4 A;  2LDU A;  4L0Z B;  4Z2Y A;  2VLA A;  3ERE D;  1TNS A;  2H1L A;  3IRQ A;  4F92 B;  3ZMZ A;  3K0L A;  1U0J A;  3BJA A;  3WHB A;  1FYK A;  3MKL A;  1JT0 A;  1U9N A;  2L2O A;  4BE0 A;  1U5T C;  3QU6 A;  4IQ4 A;  4AD9 A;  1FP2 A;  2DA5 A;  4DBR A;  3BR5 A;  4GYG A;  1POG A;  4LG0 A;  3S8P A;  2QF7 A;  5BNG A;  4MFD A;  4CGZ A;  1Y0N A;  4D7N A;  2Q8K A;  1T0F A;  3JAM K;  4BJ5 C;  4RA2 A;  1XMX A;  3HOZ J;  1D0X A;  3ZGK A;  3HPH A;  1QVU A;  5J8C A;  2NOJ B;  2BY2 A;  3J7A O;  2HGC A;  2F5E A;  5M5W J;  4XLN F;  3BDD A;  2HTJ A;  4M3E A;  3L00 A;  1R36 A;  3R6S A;  1IN4 A;  1JJ6 C;  2E36 A;  4UV9 A;  4BU2 A;  4KA4 A;  2L5Q A;  4ZH4 F;  1Y0U A;  4UUT A;  3QWL A;  2VUM J;  5CVR A;  3EUH A;  1SVO A;  3JRE A;  3BR3 A;  3MFK A;  2Y31 A;  1ETO A;  2E5N A;  3F72 A;  1S5L C;  2NYX A;  4V2G A;  4O6J A;  4HNU A;  1SD4 A;  4AID A;  1KU7 A;  2Y75 A;  2CV2 A;  1I1G A;  1AU7 A;  2XUB A;  3OL3 A;  4I99 C;  1K6O A;  1S7E A;  3HSF A;  5L3B A;  3JR9 A;  3OIQ A;  2KDZ A;  1VQ4 I;  5K7H A;  3Q5F A;  3PFI A;  5D8L B;  2IGO A;  4PJ0 C;  1FBS A;  4U0W A;  3LWF A;  1FX7 A;  3OWT A;  2HZT A;  1AHD P;  2KJB A;  1MZB A;  1FOY A;  3E5Q A;  3QAH A;  5E18 F;  2EV6 A;  2PMH A;  4M9S A;  2R92 J;  2QQB A;  4OWR B;  2M1B A;  4B44 A;  3CJQ B;  2Z33 A;  2L0K A;  2H1K A;  3GTK J;  2FX0 A;  3RTR A;  2KHM A;  3JTG A;  3W2W A;  5HNH A;  3JRA A;  3BTC A;  1K7A A;  1R9T J;  4EJO A;  3RYR A;  2H6C A;  2ZJP F;  4IJA A;  5LHG A;  1ZK8 A;  3D5S C;  2JSC A;  3QOD A;  3HB9 A;  1OYI A;  3MWM A;  3Q0U A;  2HPM A;  1MJB A;  2HOE A;  1D0Z A;  2M0M A;  1M1E B;  4KMU X;  2H6B A;  2XPV A;  3HOV J;  2QQ9 A;  2D2W A;  3DEW A;  2ZSI B;  4R1H A;  1SFU A;  3CF2 A;  3FDY A;  2EFQ A;  1S6L A;  3CCJ I;  4M71 A;  1MD0 A;  1ZAR A;  2BE5 F;  4WXC A;  3ABM H;  4UVA A;  2CH0 A;  2BBY A;  5HS9 A;  3HRT A;  2BHY A;  2EA4 A;  3PSF A;  3C7J A;  2IBD A;  3FF5 A;  1WKM A;  3ABU A;  2KIF A;  1IV8 A;  2V9K A;  1OR7 A;  3PJR A;  5EF6 A;  3IAS 2;  2EPF A;  2DA7 A;  5TIS C;  2LVS A;  4ANJ A;  2V6C A;  1WI3 A;  3ASO H;  3WE2 A;  1ENH A;  2DTZ A;  3F8N A;  1U5T B;  2DMT A;  4CIC A;  1Z7L A;  1RNL A;  3IKT A;  2G0E A;  3BG3 A;  3IUO A;  4A93 J;  2YPR A;  4O5V A;  4BXF A;  3M3Y J;  1K79 A;  2Y48 A;  3S3O A;  1U8B A;  1QNT A;  2L7M P;  2P0W A;  3S2D J;  2EWN A;  2XAU A;  1D0Y A;  1WI9 A;  2MW8 A;  4O3M A;  3K9T A;  3LMM A;  1IN5 A;  4ESJ A;  1MBK A;  5HDK A;  1Z67 A;  1ZG3 A;  1DDN A;  2XSJ C;  2DQL A;  1WRJ A;  2GZW A;  4CCM A;  2B63 J;  2ZO4 A;  1YE9 A;  1HST A;  3M9A A;  3SEQ A;  3T8R A;  3OYJ A;  3MKY B;  4C3J J;  1VND A;  2LP0 A;  2W48 A;  1XGO A;  5FKN A;  3LNQ A;  2HXI A;  4EQQ A;  4RLQ A;  2ZSH B;  4C3H J;  1WVR A;  2ZME C;  5D5X B;  3FXU A;  4ENM A;  1ITY A;  1P7I A;  3R0A A;  2XPU A;  3UNG C;  1I27 A;  2ECB A;  2E5Z A;  2Q0O A;  1YX5 A;  4XN0 A;  1XMA A;  2CQN A;  1WH5 A;  3K70 D;  1USS A;  1TP4 A;  4MLO A;  3OYL A;  1LQ1 A;  2P5L C;  2IS1 A;  2MGQ A;  4MEX F;  3ZOB A;  4A2U A;  2VBZ A;  1V4R A;  3CJR B;  2K9L A;  2E7X A;  2NAZ A;  5LBQ A;  2M9H A;  3R61 A;  4WXH A;  4FQG A;  5J1R A;  3GF2 A;  3CP8 A;  3D5R C;  2OUM A;  4DOZ A;  3S1N J;  2KL4 A;  3KET A;  3EUH C;  4EJT A;  4XSX F;  5H20 A;  5LFA A;  2MAB A;  2QEN A;  5D5V B;  2VKV A;  2AQF A;  3FZV A;  1ZRC A;  4M74 A;  3CCL I;  2XAG A;  4Q47 A;  2E1M C;  1DP7 P;  2B0L A;  2QCO A;  2RDP A;  3CUQ A;  4N0B A;  3LSR A;  5D6E A;  3ECH A;  3VFZ A;  3IH4 A;  3ULQ B;  3FKJ A;  1S3J A;  3S15 J;  3Q9S A;  2M7A A;  1D1C A;  1X2M A;  2DYS H;  3FM5 A;  3VPR A;  1CQT A;  3BR2 A;  2HPI A;  5E20 A;  4C3I J;  2LNB A;  2LY1 A;  2X6W A;  3CP2 A;  1W7P A;  2DI3 A;  1R1U A;  1K78 A;  2PJR B;  4HSR A;  3N4M A;  4IHS A;  1CF7 A;  3TOB A;  2VT2 A;  4HZF A;  4F3Q A;  1ZYR F;  3HOU J;  4A3E J;  1X3Z B;  3FXO A;  3ISP A;  2XAJ A;  1GT0 C;  3ZQQ A;  3G3Z A;  5CVJ A;  2QYO A;  2P5V A;  4EVI A;  1FOK A;  4A3G J;  1R4M B;  1EV7 A;  1J5Y A;  2TRT A;  1XCB A;  4CCL A;  4OIQ F;  1HKT A;  1YW7 A;  1BI2 A;  2XB5 A;  1RR7 A;  4RMN A;  2GOX B;  5E17 F;  3L2W A;  2H94 A;  1IW7 F;  4ABZ A;  3HHH A;  3FXK A;  4P1W A;  4P96 A;  2K9S A;  3I58 A;  3KP4 A;  5J4V A;  1F5T A;  4GO1 A;  2EZL A;  3DTE A;  1TTY A;  2I10 A;  4CA0 A;  1OQY A;  5ICG A;  3GTJ J;  4ZTJ A;  1P7J A;  2OU2 A;  3FK7 A;  3Q0V A;  2WBM A;  1VFC A;  3S32 A;  4MEY F;  1P4A A;  1Z1D A;  2DT5 A;  1R1V A;  3GUD A;  4BBS J;  5LEK A;  2P4W A;  3H9G A;  5D4S A;  1MJA A;  1UHM A;  4OAZ A;  4A0Z A;  2CO5 A;  1ZR2 A;  3QRF F;  2QBY A;  1TWH J;  4HF0 A;  1BL0 A;  1H88 C;  3ZQH A;  3HUG B;  4I7H A;  5DM7 F;  1MKM A;  5F6F A;  4K2E A;  1R00 A;  2DDB A;  2DQR A;  4D0P A;  5F1J A;  3OYF A;  4XON A;  2OJE D;  1XSD A;  3GTQ J;  1XN7 A;  1HKQ A;  4AIJ A;  3J80 Z;  5J1Y A;  3AFH A;  3FMS A;  2FU4 A;  3MKZ A;  4XM3 A;  2IW5 A;  3H9J A;  3S1R J;  3LSG A;  1QPI A;  4LIU A;  3JRI A;  3ZMD A;  2A61 A;  2ZJR F;  1ORK A;  2WY8 Q;  1FTZ A;  2OZU A;  1DPR A;  2UV1 A;  3SQN A;  2KP6 A;  5TGT A;  1J59 A;  1V55 H;  3LST A;  5JVG F;  4L9T A;  2EIN H;  2R7D A;  1RR8 C;  3CDH A;  2GAU A;  3V8J A;  4R8H A;  5FKM A;  1APL C;  4HF2 A;  4RAY A;  2VQL A;  1NG7 A;  2M0C A;  3E7L A;  3RYP A;  5E79 C;  3W2V A;  1BN5 A;  4PZJ A;  2NNN A;  3F6O A;  4CCK A;  3L2C A;  1F4K A;  3BG7 A;  2L9S A;  1WJE A;  2DAO A;  2VC1 A;  2V26 A;  3GFL A;  4UB6 C;  1OYY A;  2R7Z J;  2MA3 A;  1B72 B;  1P4X A;  1O3S A;  1K83 J;  2ID3 A;  5GPC A;  1EKE A;  2MLG A;  3GEZ A;  5F04 A;  1HKS A;  2O61 A;  2K9M A;  3BZC A;  1H0M A;  4UUS A;  3ML6 A;  4RAG A;  1W0U A;  2L9V A;  1MDM B;  3BTL A;  3I59 B;  1TC3 C;  2QUF A;  2XF5 A;  3OR2 C;  1LB2 A;  1SD5 A;  2ZBK A;  4XKC A;  2QM3 A;  2XGC A;  2LR8 A;  2R7X A;  2ZXJ A;  2FBI A;  2KLO A;  4Y33 A;  1U8R A;  1FNN A;  3FIS A;  4LB6 B;  3HPG A;  1TL8 A;  5LGN A;  1XCV A;  2IGK A;  5B1A H;  2A68 F;  2XHK A;  2L01 A;  3K1M A;  2HQN A;  2QEX I;  2XGE A;  2Z2S B;  3J81 Z;  4ZTF A;  2QVO A;  5JFR A;  2YSR A;  4G7H F;  4J19 A;  2G9W A;  2YS9 A;  2Y9Z A;  4UVB A;  3LFK A;  2E71 A;  2JA2 A;  5ILV A;  3S17 J;  1S8N A;  4XNF A;  2BW3 B;  3LSJ A;  2ZNZ A;  1DGW Y;  2F4I A;  2Y0S A;  3IWZ A;  5DUI A;  2PEX A;  3A01 B;  4EM0 B;  2CSO A;  3BJO A;  3FM3 A;  2NVT J;  3PQJ A;  3E5X A;  2JVH A;  3CCS I;  2R93 J;  3CO7 C;  4BAC A;  4KNY A;  2HR3 A;  1OCR H;  3OYE A;  1HDD C;  4G6T B;  4DYC A;  3HSR A;  4B43 A;  2IRF G;  3HOY J;  3OYA A;  2OCE A;  4I02 A;  4XLH A;  4A6D A;  4GXO A;  1IRZ A;  2A3S A;  2XKP A;  3DPL C;  4JQF A;  4QSH A;  2EZI A;  3L1P A;  2O6G E;  2BGC A;  1MBE A;  3AG3 H;  4A3C J;  1DPU A;  2K86 A;  1EF4 A;  1LNW A;  2CUJ A;  2OC6 A;  3GTM J;  1X1A A;  5F64 A;  3LAP A;  3VYR B;  5ERI A;  4NC7 A;  1G6N A;  1IGN A;  2FNA A;  1S72 I;  4A5N A;  4ZYG A;  3WTW C;  1UCR A;  3AL0 C;  5HDG A;  2L02 A;  3P7N A;  4QLC U;  4E7S A;  2IGM A;  4BE2 A;  4RB0 A;  4HYE A;  4L9J A;  2IA0 A;  5ILU A;  3TL4 X;  3ESW B;  2O5R A;  1R5G A;  1LVK A;  1T08 B;  3KCC A;  1X3W B;  1U5T A;  3HM5 A;  3E6D A;  2CJJ A;  4OIN F;  3BZ6 A;  3PUB A;  1MMA A;  3I0T A;  3ZRG A;  1REP C;  3IH3 A;  1W0T A;  1MW7 A;  3C1D A;  3F22 A;  2N8G A;  2ZJ2 A;  2O8X A;  3FMQ A;  3LAJ A;  4PFP A;  3GVA A;  4A3L J;  1ODD A;  3FXM A;  5C44 J;  1QA6 A;  2VC0 A;  2KIS A;  3W6V A;  2QKL B;  4QPQ A;  3CCU I;  2M2E A;  3S3N A;  2EFW A;  1RUN A;  3MD2 A;  2K7L A;  3M1E A;  1PVE A;  3S1Q J;  1Z9C A;  2EZH A;  2LC2 A;  3CUQ B;  3IC7 A;  1HOM A;  5CQE A;  5E1W A;  5AON A;  1SMT A;  5GAD J;  4B8X A;  1G4D A;  3C3W A;  3JTH A;  5BPD A;  2NS7 A;  1V54 H;  5D4R A;  1W5S A;  3KZY A;  1QGP A;  3DQV C;  4LGW A;  3H36 A;  4XLC A;  5GAH J;  1KQ8 A;  4OOI A;  4BUP A;  1W7P B;  2M7B A;  1K78 B;  4UV8 A;  2HVR A;  1J2X A;  1CF7 B;  1S29 A;  2WAD A;  1YTY A;  4YFN F;  4HRI A;  2VXZ A;  5K5O A;  4HLY A;  3Q0W A;  5FLX Z;  1BA5 A;  3RJP A;  1X1B A;  4KIT B;  5LD2 C;  2DOE A;  2GXG A;  4IOC F;  3PUF A;  2LFB A;  2XF6 A;  3FKI J;  1TQI A;  2XF7 A;  3HGY A;  2VBY A;  2R7F A;  2X1E A;  5EJC A;  3NWT A;  1IRF A;  4CUG A;  3PM1 A;  3ELK A;  2DOF A;  2GXA A;  3HZJ A;  3BOQ A;  1I6X A;  1L0O C;  1QZZ A;  5J47 A;  1RET A;  1S7O A;  2WY7 Q;  2XAS A;  5FRM A;  4RDU A;  3QPT A;  3HL2 A;  4PJL A;  4A3B J;  3GFI A;  1ZGJ A;  3QPH A;  3C2G A;  1TWA J;  3V4G A;  5D5W B;  1LJ9 A;  2ELJ A;  5IT3 A;  3SFI A;  4C2M J;  4XID A;  3A2K A;  1ZGA A;  2IJL A;  4E7L A;  2CW0 F;  2ME6 A;  4B4C A;  3C2B A;  5F1R A;  4EV0 A;  1DUX C;  2VPL A;  3AL0 B;  1ERD A;  3OIP A;  1V5E A;  2OF7 A;  1O3Q A;  1D1B A;  2PJR A;  2DBB A;  4RB1 A;  1NK2 P;  2FF4 A;  3M7G A;  3WTT C;  4FHT A;  4N9H A;  1JKR C;  2QBY B;  2V1U A;  4A3I J;  2A69 F;  2EFN A;  3RKQ A;  3CCQ I;  1K4T A;  3QOP A;  2HS5 A;  3DF8 A;  1B4A A;  2JUG A;  4I6Z A;  3ZPL A;  1JE8 A;  2KIQ A;  1I50 J;  4LIV A;  4IHT A;  1TT0 A;  3CDL A;  4ENN A;  4J00 A;  3PFY A;  1X3U A;  1IG7 A;  2OV7 A;  2M4K A;  3P5J A;  4LK0 F;  5A2Q K;  2FBH A;  5F0F A;  4D7M A;  2PFB A;  1WJ5 A;  1OJL A;  3CC7 I;  4KIC A;  2F4O B;  2RC4 A;  1YX3 A;  5EZG A;  2YUS A;  5BPI A;  2CW7 A;  5HS7 A;  2BXY A;  4ZYD A;  5GPA A;  1FYL A;  3OMY A;  4LB5 A;  4AIH A;  4B09 A;  3SZT A;  3FWE A;  1FT9 A;  4KIF A;  3NAU A;  3HTU A;  3IKV A;  4Z6Y A;  4WWC A;  2FOK A;  1IUY A;  4KDP A;  4Y4R A;  2DU9 A;  1BC8 C;  2E2H J;  3FBN B;  3GO5 A;  1BW6 A;  1QBJ A;  2RRE A;  2M5W A;  4CHU A;  3I54 A;  2XIG A;  5IOZ A;  2MH2 A;  4PJM A;  1KQ9 A;  2ZME A;  1FIA A;  2V6E A;  3G1O A;  4P55 A;  3S16 J;  5J6X A;  3G6E I;  3HBL A;  2ZFU A;  1XSX A;  2AO9 A;  2ICW G;  4PSX A;  2YX7 A;  3HUG A;  4CZC A;  2JPC A;  4D9J A;  4UUS B;  1R1T A;  2EV0 A;  3LA3 A;  4WCG A;  1RRJ A;  1YJ9 I;  2HDW A;  1T98 A;  3W3C A;  3I64 A;  1X1P A;  2DCE A;  1OKR A;  3U9G A;  4XOR A;  2VKE A;  3BG5 A;  4HV5 A;  2P6S A;  4BYY A;  3SDG A;  2X9D A;  4LD5 A;  1VQ6 I;  1ZRD A;  2JJ7 A;  3K1N A;  4CXF A;  4M9X A;  5E3O A;  3DTK A;  1V5G A;  5L3E A;  2WWY A;  4I0B A;  4KT6 A;  1MBJ A;  3WTU C;  4HG2 A;  2AQE A;  2M30 A;  2ZJQ F;  2LBF A;  3MEX A;  2LKX A;  5AIQ A;  4M6Y A;  1B59 A;  1FLI A;  2K3F A;  1RI7 A;  1P9Q C;  2MG4 A;  3PIO F;  3LL7 A;  2DA3 A;  2FE3 A;  2JRM A;  1QQI A;  1OMI A;  2Z16 A;  2OD5 A;  2VKH A;  2LD5 A;  1A6I A;  1GDT A;  3HHG A;  4E7I A;  1YG2 A;  3G73 A;  1ZG5 A;  2LF8 A;  1B72 A;  1YYV A;  3FK6 A;  4F93 B;  1R4N B;  3KP3 A;  5F08 A;  1IF1 A;  3GLL A;  2GIZ A;  4I01 A;  4IX7 A;  2LY9 A;  1MMD A;  1TZL A;  1XGN A;  2B9S A;  1TWF J;  3OYD A;  1A31 A;  2WV0 A;  4II2 A;  1MDM A;  3I59 A;  3LSM A;  1GV2 A;  3GBG A;  1GVJ A;  3RZO J;  3CO6 C;  1X4P A;  3RQI A;  2X51 A;  3H0G J;  1T2K A;  3S2W A;  3JRD A;  3Q9V A;  1KQ0 A;  1X19 A;  1MBH A;  1Z91 A;  2ZXW H;  5F27 A;  1KGS A;  2R7U A;  4IEJ A;  2Z9O A;  2HVQ A;  5C3E J;  5FFX A;  3BQY A;  2DA1 A;  2HOA A;  2VL8 A;  5JHF A;  2DPU A;  2DYR H;  4MIM A;  5LLQ A;  1MSE C;  3RQ4 A;  3ABT A;  4HAM A;  4EEF G;  1O7L A;  3M8J A;  3L2R A;  5E3L A;  3DXJ F;  5K5R A;  2NXN B;  2G7U A;  4OIP F;  2BW3 A;  4ZZL A;  5HLG A;  1WCM J;  1Z7U A;  1U6G A;  2MSY A;  1HSJ A;  2X1D A;  3BCA A;  2A5Y B;  3A01 A;  3LQR A;  1LFP A;  1FTT A;  5KNL A;  1XGS A;  2EV5 A;  4JBA A;  3CCR I;  1AOY A;  2OCC H;  2X6Y A;  4ESB A;  3CJN A;  3CCV I;  2IPQ X;  2BEO A;  2UUZ A;  4BS9 A;  1TBX A;  1O7F A;  3CDI A;  4YII A;  1Y8R B;  3BG6 A;  2Y0M A;  2HWV A;  2HDD A;  2GOM A;  1BI0 A;  4KMF A;  5KAI C;  3TQN A;  3U21 A;  2Q2E A;  1JKQ C;  4EJW A;  4X0G A;  3CTA A;  4B3A A;  2MC3 A;  2BXZ A;  4AVP A;  4WX9 A;  2WAQ N;  2VB6 A;  4RGR A;  3GZN B;  2XGD A;  4I09 A;  4RM2 A;  5J3L A;  3S2H J;  1TLH B;  1PYV A;  5K7F A;  3DKW A;  1MMN A;  2HOT A;  4BQA A;  1BIB A;  2E60 A;  2E7W A;  2XRO A;  1SFO J;  1R22 A;  4BY7 J;  2O8K A;  1MND A;  1G3Y A;  1HDP A;  3SZG A;  4A3D J;  9ANT A;  1XSV A;  2O03 A;  2WB1 N;  1HCR A;  1TQP A;  2RNG A;  1PJR A;  3GXO A;  4MHG A;  1YI2 I;  2BVM A;  1TWC J;  4BHP A;  2R7S A;  2DDA A;  2VE9 A;  1RPW A;  4D5C A;  5KCM A;  3OSG A;  3BZK A;  2R0Q C;  3LFU A;  2GLO A;  1VQ7 I;  1H9T A;  4D1Q A;  1BW5 A;  4HDV A;  1OPC A;  2M87 A;  1FYM A;  4QIW N;  3KIO A;  2X6O A;  1MBG A;  4GRI A;  1YIT I;  1MBF A;  1IO2 A;  2RKH A;  4YEJ A;  4XRS G;  4NQW B;  5EG0 B;  1D3Y A;  3OS2 A;  4E70 A;  4U0Y A;  2ZXH A;  1UAA A;  4EM2 A;  4HDU A;  3MCZ A;  3K4B A;  1UJ8 A;  3CF5 F;  1QHH D;  4RGX A;  2OZ6 A;  1OCO H;  1HQC A;  3ZMS A;  3C18 A;  3AG4 H;  4JX6 A;  5FRO A;  3OS0 A;  2DMQ A;  1W36 D;  1MH3 A;  3I3L A;  2VQG A;  5K1Y A;  4EJV A;  3HC7 A;  4LG3 A;  1ZH5 A;  2MFZ A;  4YIR X;  2F5F A;  3H5A A;  4G94 A;  2IXS A;  3LSP A;  2CYY A;  3JRH A;  1B8I A;  2VI6 A;  2W24 A;  4PGH A;  1I5Z A;  2XAH A;  1XC5 A;  2ISZ A;  3D0S A;  3KZI C;  4WF2 A;  1U9O A;  1V3F A;  2HTS A;  5HNF A;  5DTD A;  4U7D A;  3F8F A;  2J5O A;  2W4S A;  3GFM A;  3DU5 A;  4L9V A;  1OIS A;  2WA0 A;  6PAX A;  1FSH A;  3JSO A;  2FQ4 A;  5IOY A;  3JW4 A;  2VJ5 A;  2DLL A;  4YIF A;  2LLK A;  4D5F A;  1GXP A;  2VBW A;  1H9G A;  3K4M A;  3T1B A;  1ON2 A;  5EEA A;  5M3F J;  2DFF A;  2QSF X;  4BDZ A;  2IA1 A;  4G12 A;  2V1N A;  1B6A A;  3V42 A;  3NRV A;  4XIC A;  1XPX A;  4R79 A;  3RPQ A;  4EM1 A;  4DIQ A;  1MH4 A;  5IP7 J;  1IRG A;  4ITV A;  2BV6 A;  1YJW I;  1SEU A;  4AUX A;  2CUZ A;  3T5X A;  3ZCO A;  1BR4 A;  2WAQ A;  1VQK I;  1JUP A;  1IC8 A;  5E3N A;  2JZY A;  2W57 A;  4YEL A;  5EGO A;  2HEO A;  1HA8 A;  1VZ0 A;  2GQQ A;  2DJI A;  4U0V A;  1G3W A;  4II3 A;  3E6C C;  3K1P A;  2G7H A;  3DEU A;  1P6R A;  1GLN A;  2CQX A;  2HYJ A;  3OY9 A;  1EH7 A;  1JXS A;  4MO7 A;  3MN2 A;  4LK1 F;  2O7O A;  4OMY A;  3L9F A;  3HIF A;  3BCB A;  2KRC A;  2WB1 A;  1AA7 A;  2JWT A;  2AS5 F;  3GTO J;  2Y0S N;  2ZME B;  2AHQ A;  3BY6 A;  4QTR A;  1JTX A;  3F21 A;  3BR6 A;  3CUO A;  4BEH B;  4G9Y A;  3R0J A;  4A0X A;  3WTS C;  3GZ6 A;  1O4X A;  5EYR A;  2PBI A;  3ZXS A;  1IDZ A;  2DFH A;  1YQA A;  3WHC A;  2QA4 I;  3VSL A;  5C4J J;  3LSH A;  2Y9Y A;  3TKY A;  4XRM A;  2OPT A;  1G3S A;  4XKV A;  3CJT B;  2WV1 A;  4BKX A;  1QU3 A;  3B02 A;  2HNH A;  1SVM A;  4BAY A;  4G8X A;  1DU0 A;  3S1M J;  3OOU A;  5E8G A;  3OYM A;  3BQZ A;  1Y39 A;  1UG0 A;  4HQM A;  2ID6 A;  1FBU A;  1HC8 A;  3KP5 A;  2WAE A;  2FRH A;  2LBF B;  4U88 A;  1MNE A;  2IS6 A;  1JGS A;  5GAE J;  3OYK A;  3UKG A;  2E1M B;  4NB5 A;  5GP9 A;  3NQO A;  4Q5S F;  3EET A;  1QPM A;  2BYV E;  4LIT A;  1BOB A;  3SYT A;  5CKT A;  1YW9 A;  3ZQ7 A;  4IKF A;  3IP4 B;  3TP0 A;  5DV5 A;  2JMW A;  2PJP A;  3RI4 A;  1ETV A;  1SFK A;  2E19 A;  4XMY A;  4NDL A;  3RPU A;  5LEJ A;  4A3K J;  1Z0X A;  2CMP A;  2R7O A;  4Q48 A;  4Y7N J;  3CCM I;  4J01 A;  3EUK L;  2F4M B;  2KZG A;  3OOP A;  4ZC3 A;  3DWL E;  3L2U A;  2L3D A;  2GA2 A;  2KDO A;  1G59 A;  1HF0 A;  2D5V A;  1ETW A;  1BOA A;  2ELK A;  5F0H A;  4UVC A;  4C2U A;  4A69 C;  3I5U A;  4KIG A;  3KFW X;  1TNT A;  3I56 I;  1SFE A;  3GTL J;  4AM3 A;  3LQQ A;  1T39 A;  1XX5 A;  4XQF A;  1FPQ A;  5E8I A;  1UHS A;  2H09 A;  2IGN A;  2DT6 A;  2JA8 J;  3B6A A;  4N4N B;  2VPR A;  2HYG D;  3TW7 A;  1W5T A;  3S3M A;  3M4O J;  2FEZ A;  2VJI A;  3AKZ A;  1AWC A;  4UUV A;  1WZ2 A;  4M6X A;  2VXD A;  3GCM A;  3HOX J;  5HLT A;  4BE1 A;  3OR1 C;  3F0C A;  5HVQ C;  1YJN I;  2XDV A;  3K4L A;  3IHU A;  5KVR A;  2FJ1 A;  3DU6 A;  3OS1 A;  2HZD A;  4V19 K;  2KFD A;  4RB3 C;  2L4M A;  4ZYE A;  3DKX A;  3V8L A;  2WAF A;  2OTJ I;  3E1S A;  4OIO F;  4MQV A;  2DFE A;  4LLL A;  1YS7 A;  1O3T A;  1WWX A;  1YOV B;  3V7S A;  4FCY A;  2CS3 A;  3MZY A;  1XGM A;  3U1K A;  3TMO A;  2HVS A;  2LOO A;  3F8B A;  4I2O A;  3DKY A;  5FLM J;  4B47 A;  2LYC A;  4NNJ A;  4YFX F;  3H1C A;  3KPH A;  3L2Q A;  3IV5 A;  2PQ8 A;  4JX4 A;  4IRH A;  4CO8 A;  2EK5 A;  1FSE A;  3HRM A;  1UST A;  5CVU A;  1X1C A;  3RIR A;  5HDN A;  5LHH A;  3JRG A;  2Q2E B;  4M3F A;  3A02 A;  1PUE E;  4FIS A;  4ZDL A;  3ZN0 A;  1Z6R A;  2EFO A;  5JHU A;  1MJ9 A;  4HBL A;  2E2I J;  4RAZ A;  4UY8 I;  2DOA A;  3HTS B;  3K70 C;  3SZP A;  4IF4 A;  1ZQ3 P;  3G71 I;  2L9N A;  3W6K B;  1I3A A;  2STW A;  4MNU A;  4C30 A;  4W1U A;  2Y69 H;  4XLF A;  1SAN A;  2HQR A;  2ZFW A;  3FHN A;  3ZQL A;  2VJJ A;  4DQ2 A;  4RLF A;  5KK1 A;  1ZRF A;  4BY1 J;  2JTV A;  2GXB A;  1LKX A;  3L2V A;  2K27 A;  4AVZ A;  2WC2 A;  3A1Y A;  2LG4 A;  3BWG A;  1Q1H A;  2JUC A;  1BBY A;  3H3V K;  1YFH A;  2DOD A;  2BZT A;  3E6B A;  2MC4 A;  1WPK A;  4KFC A;  2JT1 A;  2M45 A;  3LOC A;  4XOT A;  3RDI A;  5LRS A;  1GUU A;  1ZKG A;  4CZZ A;  3B6C A;  1LEB A;  5FD6 A;  2M4G A;  1QZE A;  3S93 A;  5IYC J;  2EJR A;  1Z6T A;  4BXU A;  3RSN A;  1GVD A;  2DO7 A;  1Z3Y A;  2HFH A;  1VQL I;  1UHW A;  1W36 C;  2ETH A;  4QPO A;  3W6J B;  1ETQ A;  4L5I A;  4W97 A;  2VJ4 A;  2RQQ A;  4BDY A;  4HEA 2;  3OL4 A;  3P9C A;  4M72 A;  5FKO A;  3IWF A;  4IHV A;  4ZJZ A;  3FMR A;  4P9F A;  3A03 A;  2K4B A;  5J8F A;  5IYD J;  1HW5 A;  2DJN A;  1JJ8 C;  4A5M A;  2X0L A;  5E1X A;  3QP5 A;  2IS4 A;  3PL8 A;  5D8K B;  1PUF A;  3G1M A;  5JI6 A;  3BLY A;  2A6T A;  3EYI A;  5H6R A;  1B8I B;  1RKW A;  4TV7 A;  2K85 A;  2ZNY A;  5E3M A;  2YR2 A;  3HGG A;  2D1V A;  2NRA C;  2UXN A;  2FD5 A;  5HOD A;  1LEA A;  1OCT C;  3O2P E;  2MBF A;  4HST A;  3T8T A;  2KMU A;  1F9N A;  1NG6 A;  4IZZ A;  3HDD A;  4H0E A;  1D1A A;  4OU0 A;  3T0Y A;  1NHA A;  4RBO A;  2CUF A;  1RUO A;  2XRL A;  3QYF A;  1H89 C;  2W82 A;  3F9K A;  3PQK A;  4DBQ A;  2DPD A;  2IVM A;  4N4O B;  3QPL A;  4DYQ A;  4XOP A;  2F2E A;  2RN7 A;  4X6A J;  3KEY A;  4ZDO A;  1WJC A;  3KEQ A;  4F52 A;  4XBF A;  3BRO A;  4NQW A;  1FY7 A;  4C9Y A;  1D5Y A;  4PK4 A;  5EG0 A;  3JSP A;  2X85 A;  4RAF A;  4DW6 A;  2QSG X;  3KX2 A;  4CCJ A;  1A5J A;  5GTH C;  2ZB9 A;  3WU2 C;  1RC9 A;  2AXL A;  3PNY A;  3N97 A;  2UZK A;  2JA5 J;  2V4J C;  4HLX A;  5EGO B;  3IRR A;  2JA6 J;  3H35 A;  3JAM Z;  1E3P A;  3E0J B;  3FXQ A;  3K4N A;  2KRH A;  2DA6 A;  4LLG F;  4YFK F;  3D1N I;  4LOC A;  1UEL B;  5FKK A;  2DK8 A;  1SD7 A;  3KP2 A;  4BHC A;  4XRS A;  1R7J A;  2VT3 A;  2MYS A;  3HOW J;  1IXS B;  4DYR A;  3JCU C;  1YHQ I;  4ESF A;  4XN3 A;  1JKO C;  2DN0 A;  5H2F C;  3LSK A;  3KYC B;  1LPQ A;  3PO2 J;  4Y17 A;  1ZLK A;  4HOB A;  1N75 A;  1UZC A;  5J4Y A;  4HF1 A;  2IAI A;  3HKZ A;  1LDJ A;  3JRB A;  2A6E F;  3TDU C;  2DMP A;  2EA2 A;  3O6B B;  1L3L A;  2V79 A;  1KU3 A;  1KYZ A;  4XKW A;  3RKW A;  2IS2 A;  2I8D A;  3E97 A;  4EJU A;  4XL9 A;  5JR3 A;  3RCO A;  4IL6 C;  4FET A;  3TOA A;  1JI8 A;  2M8E A;  2PMZ N;  2EFP A;  1A35 A;  1QZY A;  2L9R A;  2EIK H;  4XSZ F;  2XV4 S;  5GAG J;  4M6V A;  3H5N A;  4XLP F;  5TRD A;  2R5Y B;  2DMN A;  2EIL H;  4HX7 A;  4MTD A;  2VOO A;  1JTY A;  4NHJ A;  1WJF A;  3PSI A;  3FHZ A;  1B1B A;  4XRF A;  4EGY A;  1MIJ A;  4G7O F;  3MKW B;  3RZD J;  5GTI C;  1V5F A;  1X1D A;  1R5H A;  2QQA A;  3AG2 H;  2KKO A;  1H8A C;  1HLV A;  4ZYA A;  1FOW A;  5FLX K;  1XG1 A;  2UXX A;  5IY5 H;  2PLY A;  2VBX A;  1OFC X;  3KYD B;  4ETS A;  2FBK A;  4BEH A;  1U3E M;  2XPW A;  2RAE A;  5LRR A;  3K10 A;  4YG2 F;  5EEG A;  2OTL I;  1STZ A;  1W5C C;  2R4G A;  4RM3 A;  1KZH A;  2NVU B;  1IXR C;  3SHF A;  3HSE A;  4IRG A;  1R23 A;  3H3Z A;  4BNC A;  5HOO A;  2NOG A;  5DUK A;  2CGP A;  5J1U A;  1R71 A;  3F3X A;  2W85 A;  2R7R A;  2H8W A;  1E0E A;  2WTE A;  1KYW A;  2D1H A;  4PUS A;  2EH3 A;  1IRX A;  3HYI A;  2RGV A;  4M3G A;  3FIW A;  4UXN A;  2HXO A;  2K9N A;  2L4A A;  4PGG A;  1Y1W J;  3KE2 A;  2MH9 A;  5K7Z A;  3TDZ C;  3F8M A;  5HLH A;  2ELH A;  2GWR A;  3V7C A;  2CU7 A;  4ASN A;  2ACJ A;  2B7E A;  4IOA F;  3OYC A; 
#chains in the Genus database with same CATH homology
 5CLS A;  3EDP A;  3WE3 A;  4HV6 A;  3I4P A;  2H27 A;  5IT9 K;  1HXD A;  3REO A;  3HOT A;  1EH6 A;  2FSW A;  5DCF A;  2P8T A;  4P9U A;  1YIO A;  3GLX A;  3F6V A;  1I1S A;  1YLF A;  3F8C A;  5D5U B;  2KIM A;  2FXA A;  2LKP A;  1ZHF A;  4KT5 C;  1IXC A;  5L3C A;  5BQT A;  3KLO A;  4AIK A;  2HDC A;  4IPA A;  1O57 A;  3K69 A;  5ED4 A;  3O3K A;  2W25 A;  2R3S A;  2ZKZ A;  3BP8 A;  1KU2 A;  4WXD A;  4AWX B;  1RIO H;  4HQE A;  3LA7 A;  3HRU A;  3M8F A;  1PDN C;  2OBP A;  2XAF A;  4EGZ A;  1ONV A;  1PP7 U;  4GGG A;  2NS0 A;  1KA8 A;  1J75 A;  4G7Z F;  1ZAO A;  2YU3 A;  1JHF A;  1W7P D;  1XDU A;  2PMU A;  2KIU A;  4MTE A;  1UB9 A;  4IVN A;  5ICF A;  4I0A A;  2OAZ A;  3DV8 A;  1HW1 A;  3V7R A;  1GHC A;  1XMK A;  3WU1 B;  2O3F A;  1P4W A;  2E1N A;  4HX8 A;  3K2Z A;  4A0Y A;  2C6Y A;  2IT0 A;  4CYD A;  4IXA A;  5D6F A;  5BOX A;  2EB7 A;  3WTV C;  5CVV A;  2A6H F;  1BI3 A;  4RS8 A;  2STT A;  1R58 A;  2K4J A;  3E5U A;  5CVI A;  3ZMU A;  4ZZD A;  4CDG A;  2P6T A;  1B9N A;  3DFG A;  4KN7 X;  1IZ1 A;  4QWQ A;  3TO9 A;  1YS6 A;  3QP6 A;  1ZG1 A;  2GIV A;  2CG4 A;  1D5V A;  1FWZ A;  1JHH A;  3HRS A;  1XD7 A;  3SFZ A;  3KLN A;  1G3T A;  4LMY A;  1YW8 A;  2O0Y A;  2VOD A;  3GZ5 A;  2VOP A;  1B9M A;  4RGU A;  3VOE A;  3LA2 A;  2JPB A;  4LFU A;  2FQ3 A;  5BMZ A;  4M73 A;  2ISY A;  1T6S A;  1WSU A;  1IN8 A;  4PCQ A;  2DFI A;  5HLI A;  4FX0 A;  2P7V B;  3WGH A;  2XKO A;  3SXY A;  4S05 A;  4P5O A;  2MD5 A;  3VEP A;  3BPX A;  3WTZ A;  4S04 A;  2V9V A;  1J0R A;  4LJZ F;  4LLN A;  1BIA A;  2ZCW A;  5LGU A;  2TDX A;  4OMZ A;  4KIB A;  4KN4 X;  2KRF A;  1BJA A;  4N9I A;  3WTX C;  4BHB A;  3FX3 A;  2V1D A;  4KUM A;  2NNY A;  1ZN2 A;  3R60 A;  3WGI A;  1VTN C;  2V1X A;  2XAQ A;  4FT8 A;  2P7C B;  3ZMV A;  5DCM A;  4LG0 B;  3BJ6 A;  3L7W A;  2Z5U A;  1XB4 A;  1J9I A;  3R4K A;  3RKX A;  1ZLJ A;  1LDK B;  1ULY A;  1Z05 A;  1GXQ A;  3E3V A;  3TO7 A;  5DYM A;  2DW4 A;  4GCV A;  3ECO A;  3D5L A;  5H6Q A;  4HX4 A;  1SFX A;  4A6E A;  3MQ0 A;  3V8K A;  3ROU A;  3P9K A;  1HW2 A;  2PG4 A;  2OQR A;  3ZN1 A;  2MLK A;  2D45 A;  3MZH A;  1FZP B;  1CGP A;  3E6M A;  3WGG A;  5TJJ A;  3WOD F;  4Y15 A;  1IN6 A;  4RB2 C;  3HOS A;  4G6Q A;  1BC7 C;  2F5C A;  3QU3 A;  4HA8 A;  3U1D A;  3M8E A;  2YX4 A;  3VOD A;  2J5P A;  1E2X A;  1OYW A;  1C0W A;  3KP6 A;  4MQ9 F;  5FGM A;  3GYH X;  1T38 A;  1FC3 A;  5EEH A;  4MGR A;  3GW2 A;  1P2F A;  3CUQ C;  1UFM A;  4L18 B;  2PN6 A;  2QWW A;  3P9I A;  2FA5 A;  2PI0 A;  1A04 A;  4ENJ A;  3WTY C;  5AIP A;  2HKX A;  1BI1 A;  4U7B A;  3KZZ A;  1O3R A;  5L3G A;  3J80 K;  4I98 B;  1RZ4 A;  5LGT A;  3I53 A;  2ADU A;  5L3D A;  2JRT A;  1FP1 D;  2QZ8 A;  3WU0 A;  1MGT A;  1LDD A;  3NEU A;  3AAF A;  5DD4 A;  4F7Z A;  4L5J A;  4WK8 F;  2FMY A;  1HBX G;  2RNJ A;  5FFZ A;  5HS8 A;  4M9Z A;  4ZYH A;  2LSO A;  2LF7 A;  1SMY F;  4PDK A;  3RKY A;  1BM9 A;  2COM A;  5FO5 A;  4JK1 X;  5BS6 A;  2K02 A;  3OV8 A;  4UNO A;  4IRI A;  4L0Y B;  2GA1 A;  1XDS A;  2OQG A;  5FD5 A;  2DK5 A;  2RV8 A;  2ESN A;  1IN7 A;  3COA C;  3KEO A;  3EYY A;  1WQ2 A;  3GWZ A;  3H3U A;  2L54 A;  2QLZ A;  5ILS A;  1LVA A;  3MAJ A;  2E1C A;  1J7K A;  4Y13 A;  3J81 K;  1PP8 F;  1KU9 A;  3L09 A;  1FBQ A;  1IAW A;  1E17 A;  1U2W A;  3DPT A;  1ON1 A;  1F1Z A;  2CWE A;  1SD6 A;  2XGX A;  2HKO A;  5DEQ A;  4Q4Z F;  5K5Q A;  4GYI A;  5A2Q Z;  4EMS A;  1D8J A;  4L9N A;  3FXR A;  2OA4 A;  2VE8 A;  2XVC A;  2KJC A;  2W84 A;  3H92 A;  3GFJ A;  2IA2 A;  2FML A;  1EH8 A;  5ICE A;  2XRN A;  1U78 A;  4OIR F;  1YO5 C;  2VON A;  5DDG A;  1S7A A;  2RVC A;  2FNP A;  2VN2 A;  2RQP A;  3KP7 A;  4ON0 A;  4DNC A;  4A12 A;  1W4M A;  2F5D A;  5L3F A;  2X4H A;  4UHT A;  3BPV A;  1TW3 A;  2ESH A;  3IL2 A;  5LHI A;  2CFX A;  1D8K A;  3U2R A;  2Z99 A;  4HW0 A;  1TW2 A;  5CYV A;  5DCM B;  3VB2 A;  3B73 A;  5E1Z B;  4ENK A;  5ICC A;  3TGN A;  3I71 A;  5IT9 Z;  2Z3Y A;  1P92 A;  2A07 F;  3ZP5 A;  5CJ9 A;  3EQL F;  3F23 A;  1TQM A;  2UWM A;  5DD8 A;  3TO6 A;  2HYF A;  2IP2 A;  3ZMT A;  3GX4 X;  4KYW A;  2CQK A;  3CLO A;  4RGS A;  1SAX A;  2DTR A;  4G6D A;  3DP7 A;  1QO0 D;  4BH9 A;  5FB2 A;  1ZRE A;  5JVT A;  2P5K A;  3WG9 A;  4FX4 A;  2LDU A;  4L0Z B;  4Z2Y A;  3ERE D;  1TNS A;  3IRQ A;  3ZMZ A;  3K0L A;  3BJA A;  1FYK A;  1U5T C;  3QU6 A;  4AD9 A;  1FP2 A;  4GYG A;  4LG0 A;  4CGZ A;  2Q8K A;  1T0F A;  3JAM K;  5J8C A;  3J7A O;  2HGC A;  2F5E A;  4XLN F;  3BDD A;  2HTJ A;  3L00 A;  1R36 A;  3R6S A;  1IN4 A;  4UV9 A;  4KA4 A;  4ZH4 F;  1Y0U A;  5CVR A;  3EUH A;  3MFK A;  3F72 A;  2NYX A;  4O6J A;  1SD4 A;  1KU7 A;  2Y75 A;  1I1G A;  2XUB A;  1K6O A;  3HSF A;  5L3B A;  3Q5F A;  3PFI A;  5D8L B;  1FBS A;  4U0W A;  3LWF A;  1FX7 A;  2HZT A;  2KJB A;  1MZB A;  3E5Q A;  3QAH A;  5E18 F;  2EV6 A;  2PMH A;  4M9S A;  2QQB A;  2M1B A;  2Z33 A;  3RTR A;  3JTG A;  1K7A A;  4EJO A;  3RYR A;  2H6C A;  4IJA A;  5LHG A;  2JSC A;  1OYI A;  3MWM A;  1MJB A;  2HOE A;  4KMU X;  2H6B A;  2QQ9 A;  2D2W A;  4R1H A;  1SFU A;  2EFQ A;  1S6L A;  4M71 A;  1MD0 A;  1ZAR A;  2BE5 F;  4WXC A;  4UVA A;  2BBY A;  5HS9 A;  3HRT A;  2EA4 A;  3C7J A;  3FF5 A;  1WKM A;  3ABU A;  2KIF A;  1OR7 A;  2V6C A;  3WE2 A;  3F8N A;  1U5T B;  4CIC A;  1RNL A;  3IKT A;  2YPR A;  4O5V A;  1K79 A;  2Y48 A;  1QNT A;  2EWN A;  1WI9 A;  4O3M A;  3K9T A;  1IN5 A;  4ESJ A;  5HDK A;  1ZG3 A;  1DDN A;  2DQL A;  1WRJ A;  2GZW A;  2ZO4 A;  3M9A A;  1HST A;  3T8R A;  1XGO A;  4EQQ A;  5D5X B;  3FXU A;  4ENM A;  3R0A A;  1I27 A;  2Q0O A;  1XMA A;  1USS A;  1LQ1 A;  2P5L C;  4MEX F;  4A2U A;  2VBZ A;  1V4R A;  2E7X A;  2NAZ A;  5LBQ A;  4WXH A;  3R61 A;  3GF2 A;  3KET A;  4EJT A;  4XSX F;  5H20 A;  2QEN A;  5D5V B;  3FZV A;  1ZRC A;  4M74 A;  2XAG A;  4Q47 A;  1DP7 P;  2B0L A;  2RDP A;  3CUQ A;  4N0B A;  5D6E A;  3ECH A;  3VFZ A;  3ULQ B;  1S3J A;  3Q9S A;  3FM5 A;  5E20 A;  2LNB A;  1W7P A;  2DI3 A;  1R1U A;  1K78 A;  3N4M A;  4IHS A;  1CF7 A;  3TOB A;  2VT2 A;  4HZF A;  1ZYR F;  3ISP A;  2XAJ A;  3G3Z A;  5CVJ A;  2QYO A;  2P5V A;  4EVI A;  1FOK A;  1EV7 A;  1J5Y A;  1XCB A;  4OIQ F;  1HKT A;  1YW7 A;  1BI2 A;  5E17 F;  2H94 A;  1IW7 F;  3HHH A;  4P96 A;  3I58 A;  3KP4 A;  1F5T A;  4GO1 A;  1TTY A;  5ICG A;  2OU2 A;  4MEY F;  1P4A A;  1Z1D A;  2DT5 A;  1R1V A;  3GUD A;  5LEK A;  2P4W A;  5D4S A;  1MJA A;  1UHM A;  4A0Z A;  2CO5 A;  3QRF F;  2QBY A;  4HF0 A;  4I7H A;  1MKM A;  5F6F A;  4K2E A;  1R00 A;  2DQR A;  4D0P A;  1XSD A;  1XN7 A;  1HKQ A;  4AIJ A;  3J80 Z;  3FMS A;  2FU4 A;  2IW5 A;  3ZMD A;  2A61 A;  2OZU A;  1DPR A;  3SQN A;  1J59 A;  3LST A;  4L9T A;  2R7D A;  3CDH A;  2GAU A;  3V8J A;  4R8H A;  4HF2 A;  4RAY A;  3RYP A;  1BN5 A;  4PZJ A;  3F6O A;  2NNN A;  3L2C A;  1F4K A;  2DAO A;  2VC1 A;  3GFL A;  1OYY A;  2MA3 A;  1P4X A;  1O3S A;  2MLG A;  3GEZ A;  2O61 A;  1HKS A;  1H0M A;  3ML6 A;  1MDM B;  3I59 B;  2QUF A;  1LB2 A;  1SD5 A;  2ZBK A;  2QM3 A;  2ZXJ A;  2FBI A;  1U8R A;  1FNN A;  4LB6 B;  5LGN A;  1XCV A;  2A68 F;  2XHK A;  2L01 A;  3K1M A;  2HQN A;  3J81 Z;  2QVO A;  5JFR A;  2YSR A;  4G7H F;  2G9W A;  4UVB A;  3LFK A;  5ILV A;  1S8N A;  2ZNZ A;  3IWZ A;  5DUI A;  2PEX A;  4EM0 B;  2CSO A;  3BJO A;  3FM3 A;  3PQJ A;  3E5X A;  3CO7 C;  4KNY A;  2HR3 A;  3HSR A;  2IRF G;  4I02 A;  4A6D A;  4GXO A;  2A3S A;  2XKP A;  3DPL C;  4JQF A;  2O6G E;  2BGC A;  1DPU A;  2K86 A;  1LNW A;  5F64 A;  3LAP A;  5ERI A;  1G6N A;  2FNA A;  4A5N A;  4ZYG A;  3WTW C;  1UCR A;  5HDG A;  2L02 A;  3P7N A;  4QLC U;  4RB0 A;  4HYE A;  4L9J A;  2IA0 A;  5ILU A;  1R5G A;  3KCC A;  1U5T A;  3E6D A;  4OIN F;  3BZ6 A;  3I0T A;  1REP C;  3F22 A;  3C1D A;  2ZJ2 A;  2O8X A;  3FMQ A;  3LAJ A;  3GVA A;  1ODD A;  2VC0 A;  2EFW A;  1RUN A;  2K7L A;  3M1E A;  1Z9C A;  3CUQ B;  3IC7 A;  5E1W A;  5AON A;  1SMT A;  4B8X A;  1G4D A;  3C3W A;  3JTH A;  5BPD A;  5D4R A;  1W5S A;  3KZY A;  1QGP A;  3DQV C;  4LGW A;  1KQ8 A;  4OOI A;  1W7P B;  1K78 B;  4UV8 A;  1J2X A;  1CF7 B;  1S29 A;  1YTY A;  4YFN F;  2VXZ A;  5K5O A;  4HLY A;  5FLX Z;  3RJP A;  2GXG A;  1TQI A;  2VBY A;  2R7F A;  1IRF A;  3ELK A;  1I6X A;  3BOQ A;  1L0O C;  1QZZ A;  1S7O A;  2XAS A;  3QPT A;  3GFI A;  1ZGJ A;  3QPH A;  3V4G A;  5D5W B;  1LJ9 A;  5IT3 A;  1ZGA A;  2IJL A;  2CW0 F;  5F1R A;  1DUX C;  4EV0 A;  1O3Q A;  2DBB A;  4RB1 A;  2FF4 A;  3M7G A;  3WTT C;  4FHT A;  4N9H A;  2QBY B;  2V1U A;  2A69 F;  2EFN A;  3QOP A;  2HS5 A;  3DF8 A;  1B4A A;  3ZPL A;  1JE8 A;  4IHT A;  4ENN A;  1X3U A;  4LK0 F;  5A2Q K;  2FBH A;  2PFB A;  4KIC A;  2RC4 A;  5BPI A;  5HS7 A;  4ZYD A;  1FYL A;  4LB5 A;  4AIH A;  4B09 A;  3SZT A;  3FWE A;  1FT9 A;  4KIF A;  3HTU A;  3IKV A;  4WWC A;  2FOK A;  1IUY A;  4KDP A;  1BC8 C;  2DU9 A;  3GO5 A;  1QBJ A;  2M5W A;  4CHU A;  3I54 A;  2XIG A;  2MH2 A;  1KQ9 A;  2ZME A;  4P55 A;  5J6X A;  1XSX A;  2YX7 A;  3HUG A;  2JPC A;  1R1T A;  2EV0 A;  3LA3 A;  4WCG A;  1T98 A;  3I64 A;  1OKR A;  3U9G A;  4HV5 A;  2P6S A;  4BYY A;  4LD5 A;  1ZRD A;  3K1N A;  4CXF A;  4M9X A;  5L3E A;  2WWY A;  4I0B A;  3WTU C;  2M30 A;  3MEX A;  5AIQ A;  4M6Y A;  1B59 A;  1FLI A;  1RI7 A;  2FE3 A;  1QQI A;  1OMI A;  2OD5 A;  3HHG A;  1YG2 A;  3G73 A;  1ZG5 A;  2LF8 A;  1YYV A;  3KP3 A;  1IF1 A;  4I01 A;  1XGN A;  2WV0 A;  1MDM A;  3I59 A;  1GVJ A;  3CO6 C;  1T2K A;  3S2W A;  3Q9V A;  1KQ0 A;  1Z91 A;  1KGS A;  2Z9O A;  5FFX A;  2DPU A;  5LLQ A;  3ABT A;  4HAM A;  1O7L A;  3DXJ F;  5K5R A;  2G7U A;  4OIP F;  5HLG A;  4ZZL A;  1Z7U A;  1U6G A;  1HSJ A;  2A5Y B;  3LQR A;  1XGS A;  2EV5 A;  4JBA A;  1AOY A;  4ESB A;  3CJN A;  2IPQ X;  2BEO A;  1TBX A;  1O7F A;  4YII A;  2Y0M A;  2HWV A;  1BI0 A;  4KMF A;  3TQN A;  2Q2E A;  4EJW A;  3CTA A;  2MC3 A;  4AVP A;  4WX9 A;  4RGR A;  4I09 A;  1TLH B;  3DKW A;  4BQA A;  1BIB A;  2E7W A;  2XRO A;  1R22 A;  1G3Y A;  1XSV A;  2O03 A;  1TQP A;  3GXO A;  4MHG A;  4BHP A;  2VE9 A;  1H9T A;  4HDV A;  1OPC A;  2M87 A;  1FYM A;  2RKH A;  1D3Y A;  4E70 A;  4U0Y A;  4EM2 A;  4HDU A;  3MCZ A;  4RGX A;  2OZ6 A;  1HQC A;  3ZMS A;  3C18 A;  5K1Y A;  4EJV A;  1ZH5 A;  2F5F A;  4G94 A;  2CYY A;  2W24 A;  4PGH A;  1I5Z A;  2XAH A;  2ISZ A;  3D0S A;  4WF2 A;  2HTS A;  1V3F A;  4U7D A;  3F8F A;  2J5O A;  3GFM A;  4L9V A;  6PAX A;  1FSH A;  3JSO A;  3JW4 A;  2DLL A;  4YIF A;  1GXP A;  2VBW A;  1H9G A;  3T1B A;  1ON2 A;  2IA1 A;  1B6A A;  3NRV A;  4R79 A;  3RPQ A;  4EM1 A;  1IRG A;  2BV6 A;  3T5X A;  2JZY A;  2W57 A;  2HEO A;  2GQQ A;  4U0V A;  1G3W A;  3E6C C;  3K1P A;  2G7H A;  3DEU A;  1P6R A;  1EH7 A;  1JXS A;  4LK1 F;  4OMY A;  3L9F A;  3HIF A;  2AS5 F;  2ZME B;  3BY6 A;  3F21 A;  3CUO A;  4G9Y A;  3R0J A;  4A0X A;  3WTS C;  3GZ6 A;  2PBI A;  1YQA A;  3TKY A;  1G3S A;  3B02 A;  4BAY A;  4G8X A;  5E8G A;  4HQM A;  1FBU A;  3KP5 A;  2FRH A;  4U88 A;  1JGS A;  4NB5 A;  3NQO A;  4Q5S F;  3EET A;  1QPM A;  2BYV E;  1YW9 A;  3ZQ7 A;  5DV5 A;  2PJP A;  3RI4 A;  3RPU A;  5LEJ A;  4Q48 A;  3OOP A;  2L3D A;  2GA2 A;  1BOA A;  4UVC A;  3I5U A;  4KIG A;  3KFW X;  1TNT A;  1SFE A;  3LQQ A;  1T39 A;  1FPQ A;  5E8I A;  2H09 A;  2HYG D;  1W5T A;  2FEZ A;  1AWC A;  4UUV A;  4M6X A;  5HVQ C;  3IHU A;  5KVR A;  4RB3 C;  2L4M A;  4ZYE A;  3V8L A;  4OIO F;  4MQV A;  4LLL A;  1YS7 A;  1O3T A;  1WWX A;  3V7S A;  3MZY A;  1XGM A;  3F8B A;  4I2O A;  4YFX F;  2PQ8 A;  4IRH A;  4CO8 A;  2EK5 A;  1FSE A;  3HRM A;  1UST A;  5CVU A;  5HDN A;  3RIR A;  5LHH A;  1PUE E;  3ZN0 A;  1Z6R A;  2EFO A;  5JHU A;  1MJ9 A;  4HBL A;  4RAZ A;  3HTS B;  3SZP A;  4IF4 A;  3W6K B;  2STW A;  4MNU A;  2HQR A;  2ZFW A;  4DQ2 A;  5KK1 A;  1ZRF A;  2JTV A;  2GXB A;  2K27 A;  2WC2 A;  3BWG A;  1Q1H A;  1BBY A;  1YFH A;  3E6B A;  4KFC A;  2JT1 A;  2M45 A;  3RDI A;  5LRS A;  4CZZ A;  1LEB A;  5FD6 A;  2EJR A;  1Z6T A;  4BXU A;  2DO7 A;  2HFH A;  1UHW A;  2ETH A;  3W6J B;  4L5I A;  3P9C A;  4M72 A;  3IWF A;  3FMR A;  4P9F A;  2K4B A;  5J8F A;  1HW5 A;  4A5M A;  2X0L A;  5E1X A;  3QP5 A;  5D8K B;  5JI6 A;  3EYI A;  5H6R A;  4TV7 A;  2ZNY A;  2YR2 A;  2D1V A;  2NRA C;  2UXN A;  1LEA A;  3O2P E;  2MBF A;  3T8T A;  1F9N A;  4H0E A;  4OU0 A;  3T0Y A;  1NHA A;  1RUO A;  3PQK A;  2DPD A;  2IVM A;  2F2E A;  2RN7 A;  3KEQ A;  4XBF A;  3BRO A;  4NQW A;  1FY7 A;  3JSP A;  2AXL A;  3N97 A;  2UZK A;  4HLX A;  3IRR A;  3JAM Z;  3FXQ A;  4LLG F;  4YFK F;  2DK8 A;  1SD7 A;  3KP2 A;  4BHC A;  1R7J A;  2VT3 A;  1IXS B;  4ESF A;  4Y17 A;  1ZLK A;  4HOB A;  4HF1 A;  1LDJ A;  2A6E F;  3TDU C;  2EA2 A;  3O6B B;  1L3L A;  2V79 A;  1KU3 A;  1KYZ A;  3RKW A;  3E97 A;  4EJU A;  5JR3 A;  3TOA A;  2M8E A;  2EFP A;  1QZY A;  4XSZ F;  2XV4 S;  4XLP F;  5TRD A;  4HX7 A;  4MTD A;  2VOO A;  4NHJ A;  3FHZ A;  1B1B A;  4XRF A;  4EGY A;  4G7O F;  1R5H A;  2QQA A;  2KKO A;  5FLX K;  2UXX A;  2PLY A;  2VBX A;  4ETS A;  2FBK A;  1U3E M;  5LRR A;  4YG2 F;  5EEG A;  1STZ A;  3SHF A;  1IXR C;  3HSE A;  4IRG A;  1R23 A;  3H3Z A;  4BNC A;  5HOO A;  5DUK A;  2CGP A;  3F3X A;  2W85 A;  2WTE A;  1KYW A;  2D1H A;  3HYI A;  2RGV A;  4UXN A;  2L4A A;  4PGG A;  3KE2 A;  2MH9 A;  3TDZ C;  3F8M A;  5HLH A;  2ELH A;  2GWR A;  3V7C A;  4ASN A;  2ACJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...