2PFBA

Structure of oxidized ohrr from xanthamonas campestris
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
136
structure length
129
Chain Sequence
b'LLQLDNQLCFALYSANLAMHKLYRGLLKALDLTYPQYLVMLVLWETDERSVSEIGERLYLDSATLTPLLKRLQAAGLVTRTRVIIALTETGRALRSKAGAVPEQVFCASASSLDELRQLKQELEKLRSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator OhrR
publication title Structural Mechanism of Organic Hydroperoxide Induction of the Transcription Regulator OhrR.
pubmed doi rcsb
source organism Xanthomonas campestris
molecule tags Transcription regulator
total genus 41
structure length 129
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2pfbA00
4GXOA 3LA7A 3RKYA 3ZMSA 4AD9A 4KFCA 3E5QA 1MGTA 3I53A 2FMYA 2BGCA 1BIAA 4ENKA 2AXLA 4K2EA 2E1NA 3PFIA 2HKOA 3BOQA 4G9YA 5D8LB 4BHPA 2PJPA 1BI1A 3KP4A 1Y0UA 3OOPA 4WF2A 4OIOF 1RNLA 3S2WA 5D4SA 1RUNA 3J81K 1YS6A 3J7AO 2M87A 5CYVA 4O5VA 4PGGA 1XCVA 1S7AA 4I0AA 2VN2A 1EH7A 2A69F 4P5OA 2IP2A 2RC4A 2VONA 3F21A 4A6DA 5KVRA 1F5TA 5LHIA 1J5YA 5LGTA 4H0EA 2MH9A 2K02A 3LAJA 4UNOA 2G7UA 2EA2A 4L9VA 4A5NA 1LDJA 5ICGA 1FP1D 2ZO4A 1B9NA 1CGPA 4L9JA 5BQTA 4MTEA 1YS7A 2TDXA 1TNSA 4JQFA 2Q8KA 4ZYHA 2BYVE 2MH2A 3QPHA 1WSUA 3D5LA 2ELHA 1K78A 2O61A 3T1BA 2FMLA 2CO5A 5K1YA 2IA2A 3I59B 3Q9SA 3WE2A 1RZ4A 2HS5A 1SFXA 3RDIA 1XB4A 1KA8A 4N9HA 2K27A 3CO6C 2IVMA 3ZMTA 4MGRA 2EFQA 4WCGA 3MAJA 2XGXA 3Q9VA 3ZN0A 1T2KA 3LQQA 3WTXC 3P9KA 3WTVC 1XCBA 1HW5A 2WV0A 1IN8A 4RAYA 3FXRA 2A6EF 4P55A 2RKHA 2FF4A 2DW4A 1U5TB 2HR3A 4KDPA 4G7OF 2LKPA 5DD8A 5IT3A 3NEUA 4Q4ZF 3H3UA 3QPTA 4HQEA 2XROA 1FBQA 2ZXJA 4Q48A 1IXSB 4KMFA 1TW3A 2XKOA 1FWZA 2HOEA 2OD5A 2COMA 2UXXA 1TW2A 2AS5F 1YO5C 2NS0A 4E70A 2QQBA 2XUBA 2FBHA 3T5XA 4HF2A 2CSOA 1SMYF 5LHGA 4EQQA 1O57A 3GFMA 1FNNA 2ISYA 4YIFA 1JHFA 1FYKA 2QM3A 4GYGA 3IL2A 4UV9A 4O3MA 1J0RA 4A6EA 1XGNA 3PQJA 2RV8A 1IAWA 3RYPA 2YR2A 5E1WA 3KP5A 1W5TA 5FLXK 2HYGD 2P5LC 3WTZA 2WTEA 1XGSA 5L3BA 4M9XA 1XSDA 2PFBA 4RGSA 1XD7A 2QYOA 3SHFA 4NHJA 4Q5SF 1R58A 2K7LA 3O2PE 1ZG1A 2OZ6A 3AAFA 1FC3A 4QWQA 4IRHA 1ONVA 3HTUA 3L7WA 4XRFA 3GZ6A 2LNBA 1OYWA 2ACJA 2K4JA 1KQ9A 1GHCA 4OIPF 2E7XA 4BH9A 2M1BA 2EFOA 1O3QA 2DLLA 3ERED 3GXOA 4L5IA 4AVPA 5LGNA 3GF2A 3M9AA 4M71A 2OA4A 4BHCA 5JI6A 2X4HA 5E20A 5LHHA 1HSTA 2KIFA 3GYHX 3FM5A 2H09A 1STZA 1LJ9A 4ESBA 2VODA 2Q0OA 1BM9A 4HX7A 3I59A 1SD6A 3FWEA 4MTDA 2L02A 1BN5A 5AIQA 3ZP5A 3ZN1A 1IZ1A 3PQKA 1UCRA 2C6YA 1XGMA 1J7KA 1FX7A 4GGGA 2ESNA 1ZAOA 6PAXA 2HZTA 4HW0A 4HQMA 1R1VA 4WXDA 2A6HF 2VBWA 1U5TA 2HFHA 1TBXA 3DEUA 1NHAA 2L3DA 2EWNA 2QENA 2P6TA 5HDGA 4ESFA 1D3YA 2GXGA 2L54A 3WG9A 2V6CA 1SMTA 3M8EA 3ZMVA 3LFKA 1LDKB 5EEHA 3RI4A 3W6JB 2MC3A 3KFWX 2A68F 2ZNZA 2P6SA 4G6DA 1OR7A 3WE3A 5DCMB 4I0BA 2FA5A 2H27A 2PQ8A 3IC7A 1K79A 4PCQA 1MKMA 4EJUA 3KP3A 3O6BB 1FSHA 2K86A 1W7PB 4N0BA 2BE5F 3U1DA 3DPLC 4KIGA 4WXCA 1MJ9A 1HKTA 2QVOA 2PI0A 1XN7A 2YX4A 1IXRC 1MD0A 2YSRA 2GXBA 5ED4A 1FYMA 2J5OA 1FBUA 1FPQA 3JSPA 3K1MA 5LRRA 2NNNA 2DPDA 1KQ0A 4LG0B 4D0PA 1HKSA 5DEQA 3K9TA 2ZFWA 4WX9A 1IXCA 3DFGA 5AONA 3F6OA 2MA3A 2DI3A 1ZLJA 1LDDA 2MBFA 2L4AA 5FO5A 3GEZA 3F72A 3KP7A 4RB2C 1HXDA 3QAHA 3TQNA 2KJBA 5BPDA 5A2QK 3BJOA 2VXZA 4HOBA 5D5UB 2XAJA 4CO8A 4UUVA 4U88A 1YYVA 4PDKA 2UWMA 3E6BA 1TQIA 1I1GA 2VBXA 3KZYA 3DPTA 3SQNA 4LK1F 4G8XA 5LGUA 1I1SA 4AWXB 4L9NA 2O0YA 4UV8A 4LB5A 1IN6A 4WK8F 2D45A 2UXNA 4IPAA 2W85A 4M74A 4A0YA 3CLOA 1H0MA 5HS9A 4I7HA 1C0WA 2STTA 3ELKA 3LA3A 5HLHA 5JHUA 2NAZA 2LDUA 1Q1HA 2V79A 4I2OA 3E6DA 5FGMA 2MLGA 2XAQA 5TRDA 3CDHA 4FX4A 1U8RA 1UHMA 1YW7A 4YIIA 1UHWA 4EGYA 1O3SA 1JHHA 1ZRCA 5DCMA 3JSOA 1BBYA 3KZZA 3F22A 2G7HA 4ZH4F 3ECOA 3ZQ7A 1UB9A 2EV6A 5L3CA 4B8XA 1T6SA 3HSFA 2EJRA 4KMUX 5A2QZ 5K5RA 3N97A 3ML6A 1J59A 3ZMZA 4OIQF 3FM3A 1F9NA 4LJZF 1HSJA 1ZYRF 2BV6A 2DK5A 5DUKA 2Q2EA 4HZFA 5LEKA 2HWVA 1P4AA 5CVUA 3M8FA 3LAPA 4KIBA 2CG4A 4XBFA 2EFWA 2V9VA 5HS8A 1P4WA 1GVJA 1YG2A 3O3KA 1HQCA 4ZYEA 3SZPA 5J8CA 2DTRA 2E7WA 4OIRF 4DQ2A 1S8NA 1ZN2A 4IRIA 4L5JA 3R61A 1Z7UA 2FNPA 1BI3A 2O6GE 2OAZA 4ENJA 1ZG3A 2F2EA 4I01A 2E1CA 4HF1A 3WGGA 4IHSA 2GZWA 2H94A 5LRSA 3QRFF 3SFZA 3CO7C 2LSOA 1W7PD 4HX8A 3IRQA 1B1BA 3TOBA 3KEOA 1U2WA 4AIKA 2J5PA 1R1UA 1FT9A 4GYIA 2DK8A 5CVIA 2K4BA 3L00A 1ZHFA 3F8NA 1WKMA 2Z3YA 1ZGAA 3JTGA 4HX4A 1GXPA 2YX7A 1QO0D 3IWFA 3F8CA 3CJNA 2XAGA 1LQ1A 1QPMA 1T0FA 3FXUA 3R6SA 1XDUA 2FE3A 1P92A 2CGPA 3K1NA 3T0YA 3F23A 3DP7A 3BP8A 4KICA 2ADUA 2A3SA 4P9FA 4G6QA 4JBAA 3HRMA 1U5TC 3RKXA 1F4KA 3ZMDA 2FXAA 3LA2A 5ICFA 1Z6RA 1XMAA 4EJOA 4OMZA 3QU3A 2V1XA 4IHTA 2F5FA 2WC2A 3EYIA 3MFKA 2FSWA 3Q5FA 1YFHA 1I5ZA 3HTSB 1LEBA 1USSA 2HEOA 2QZ8A 3MEXA 3IRRA 1RIOH 1LVAA 2IRFG 1O7LA 1CF7B 4CHUA 2IW5A 3EUHA 4WWCA 4L0YB 4BHBA 3FZVA 3W6KB 1R00A 4RB0A 2L4MA 5D5VB 1S3JA 4Y13A 1ZH5A 1KYWA 3GO5A 2VT2A 3C1DA 3V8JA 2VOPA 3C3WA 2DQLA 2EFPA 3K1PA 4G7ZF 4EJWA 3BY6A 1FSEA 1KGSA 3C7JA 1REPC 5IT9K 4MQ9F 4UVCA 3RPQA 3I0TA 3CUQB 3SZTA 5LBQA 2VBYA 2IT0A 3I71A 1JGSA 4DNCA 5FFXA 2EFNA 1O3TA 1HW2A 3L2CA 1B4AA 3VOEA 3GFLA 2DO7A 4IXAA 3JW4A 4KNYA 2GIVA 1H9TA 1DPUA 1J2XA 3GVAA 5E18F 3TDUC 1D8JA 4I09A 4A0ZA 2HGCA 4U7DA 3U2RA 1KU2A 1T98A 2V1DA 2W25A 1LB2A 4KN7X 4ZZLA 2HDCA 4ZYGA 3HRUA 3BDDA 2FBKA 4BYYA 4CXFA 3G3ZA 4G7HF 1TLHB 3M7GA 3ZPLA 1KU3A 4KA4A 3K2ZA 1W5SA 1HBXG 5FD6A 2IA1A 4Z2YA 3ABUA 4GO1A 5LLQA 5D5XB 5IT9Z 1QNTA 2P7VB 2L01A 2DFIA 4UHTA 3REOA 4NQWA 1KYZA 2FRHA 2PMHA 5K5QA 1USTA 3TKYA 3FXQA 3V7CA 2HTSA 4HLXA 1CF7A 3KETA 1S6LA 4BAYA 3QOPA 2OZUA 3RPUA 2ZMEB 3QP6A 4CGZA 1SAXA 1WQ2A 5CJ9A 4NB5A 2QWWA 2KIMA 3I64A 1T38A 1HKQA 1IRGA 3ABTA 5DUIA 4P9UA 3GX4X 2XAFA 4AIJA 3HYIA 3ROUA 1PDNC 4HA8A 3R60A 1U3EM 2HKXA 3FF5A 4XLPF 3GFIA 2ISZA 1UFMA 3TDZC 3WU0A 1BC7C 1Z6TA 3VB2A 4CYDA 2XAHA 1ZRDA 2ZNYA 5BMZA 1QZYA 4XSXF 1FBSA 2Z99A 3NQOA 4R79A 1DP7P 3TOAA 2YPRA 1IN5A 1B59A 1G4DA 5ILVA 5JR3A 2GA2A 3F8FA 5TJJA 2NRAC 1FOKA 2WWYA 4MQVA 2NNYA 3WTYC 3G73A 2DT5A 1YW8A 2OU2A 2P4WA 3BJAA 4I98B 3V8KA 1RUOA 4N9IA 4ETSA 3LWFA 2M30A 5CVVA 3IKVA 4A12A 4HDUA 2JZYA 3FMQA 1Z1DA 3ULQB 1P6RA 5JFRA 2LF8A 1B9MA 3E97A 4U0VA 4M6XA 1RI7A 5ICEA 3WGHA 4LFUA 1P2FA 4G94A 3K69A 3FHZA 3TO6A 5JVTA 1XDSA 3M1EA 2M8EA 2DBBA 2ZBKA 2W84A 1U6GA 1YW9A 3GWZA 3C18A 4EM1A 3DXJF 4OINF 3MZHA 4R8HA 1YTYA 3MQ0A 1MZBA 4OMYA 5HLGA 1DPRA 4ZYDA 1MJAA 1SFUA 3LQRA 5DV5A 2EA4A 2HTJA 3KCCA 5D8KB 1LNWA 3R0AA 4P96A 2H6CA 3VODA 3DKWA 2ZJ2A 4ASNA 1O7FA 3VEPA 4EJVA 2JSCA 1FZPB 3HOSA 4U0WA 2BBYA 1R22A 3HSRA 4GCVA 2XHKA 2VC1A 3BROA 1R5HA 1W7PA 5F6FA 2NYXA 2XIGA 4M72A 3ECHA 4HV6A 4EM2A 2RQPA 4YFNF 2GWRA 2RN7A 5CVRA 2FBIA 3GLXA 3RYRA 2Y0MA 1PUEE 4KT5C 3B73A 1T39A 3FMRA 1G3TA 3TO7A 1BIBA 2F5EA 3GW2A 4YG2F 5E17F 5L3EA 2HYFA 1TNTA 2JTVA 2O3FA 1S29A 2XV4S 5K5OA 1G6NA 3BJ6A 4Y15A 3KLOA 4EV0A 4LG0A 4EM0B 4CZZA 5J8FA 4I02A 5HS7A 1EH6A 5CVJA 2FOKA 4L9TA 1IUYA 1EH8A 5AIPA 1XGOA 1QBJA 2KJCA 2DU9A 2W57A 1V3FA 5D6EA 3HHHA 4RB3C 3QU6A 3KP2A 5FFZA 3HOTA 4HLYA 1TTYA 3JTHA 4BXUA 5KK1A 1OYIA 2PEXA 1OKRA 4A5MA 2P5KA 3GFJA 2XVCA 2V1UA 3RKWA 3KE2A 2JRTA 3IKTA 3HHGA 3EETA 1KU7A 3WTUC 3COAC 4LGWA 4RS8A 3CUOA 3WTTC 4FHTA 1D8KA 2P8TA 2A5YB 1WI9A 4RGRA 1DUXC 2VC0A 2KKOA 4O6JA 1ZLKA 1LEAA 2QUFA 1ON1A 1BOAA 3V8LA 2FEZA 3ZMUA 5HVQC 1I6XA 5H20A 2MLKA 4QLCU 3B02A 2DAOA 1R5GA 2CWEA 4ESJA 2RVCA 1ZG5A 1X3UA 2O03A 4PZJA 4EGZA 1PP7U 3F8MA 3OV8A 3DQVC 1D5VA 1OPCA 1F1ZA 3RIRA 5EEGA 1G3WA 2ZCWA 2GQQA 2CW0F 3J81Z 3HIFA 4IJAA 1L3LA 2VBZA 1KQ8A 2HQNA 4ON0A 4LK0F 3N4MA 3P9IA 2R7FA 1DDNA 1OMIA 2FNAA 1Z9CA 1G3SA 4MNUA 5E8IA 3E5XA 3IHUA 4BQAA 3V4GA 2D1VA 3DV8A 2RGVA 1IW7F 2VE9A 1BJAA 4A2UA 5DD4A 4S04A 1E17A 4LB6B 4MEYF 5LEJA 3V7SA 5FD5A 2Z5UA 1I27A 3U9GA 4EMSA 5L3DA 4ZZDA 4U0YA 2QBYB 4FX0A 2EV0A 2Z33A 3R0JA 1R36A 3CUQC 4F7ZA 1JXSA 1S7OA 4PGHA 3IWZA 1WRJA 1R1TA 1QQIA 4KUMA 3WU1B 2UZKA 3H92A 3TO9A 2PN6A 1Z05A 3SXYA 5H6RA 5H6QA 2EV5A 3I58A 2B0LA 1G3YA 1L0OC 5F64A 3HUGA 5FB2A 2QLZA 2P5VA 1ZGJA 3F8BA 1YIOA 4LLNA 1FY7A 2QQ9A 1W4MA 2D2WA 3MWMA 2JPBA 2Y48A 1SD4A 3KP6A 1FP2A 2STWA 3EDPA 2CYYA 3D0SA 1SFEA 5L3GA 2BEOA 1XSXA 2F5CA 3DF8A 3BPXA 3TGNA 2D1HA 4RAZA 1HW1A 1IF1A 5BS6A 1BI2A 3HRTA 4CICA 4HBLA 2P7CB 1P4XA 1EV7A 4AIHA 1MDMB 2CQKA 4HV5A 4LMYA 5HOOA 3HRSA 2ZKZA 4XSZF 3GUDA 2G9WA 2YU3A 4EJTA 2Z9OA 5F1RA 3P7NA 2ETHA 2CFXA 2IA0A 1IN4A 2GAUA 4BNCA 5ILSA 1FYLA 4YFXF 3E6CC 4UVBA 1H9GA 5DYMA 2A07F 4IRGA 3MCZA 1O3RA 1MJBA 2OQRA 1IN7A 3FMSA 2A61A 1ZRFA 3V7RA 4ENNA 3VFZA 1ON2A 3L09A 1R23A 5FLXZ 4L18B 5ERIA 4A0XA 2VE8A 1J75A 1IRFA 2DQRA 1A04A 2R7DA 3BWGA 2VOOA 1U78A 1TQMA 3NRVA 1K7AA 3E6MA 2VT3A 5HDNA 1WWXA 3RJPA 3EQLF 1QGPA 1AOYA 3MZYA 1K6OA 3RTRA 2QQAA 4IVNA 2KIUA 4B09A 2RDPA 3E5UA 2PG4A 1BC8C 5D5WB 1XSVA 3P9CA 2LF7A 2Y75A 1YQAA 2QBYA 1FLIA 4M9ZA 4L0ZB 5HLIA 2EB7A 1SD7A 2PLYA 4M9SA 4M73A 3CUQA 2PMUA 3EYYA 3J80K 4TV7A 1SD5A 1OYYA 3GZ5A 4HYEA 5J6XA 1R7JA 1ULYA 4LD5A 2IPQX 4IF4A 4R1HA 3CTAA 1V4RA 4KN4X 3JAMK 4FT8A 2GA1A 1AWCA 5D4RA 5DDGA 2M5WA 4WXHA 4XLNF 4U7BA 3F3XA 5E1ZB 2RNJA 1QZZA 3HSEA 1BI0A 2HQRA 3L9FA 1GXQA 3WTWC 2FU4A 3BPVA 4RB1A 4LLGF 3KLNA 3KEQA 1ODDA 3FX3A 3F6VA 4HAMA 2MD5A 3H3ZA 4UXNA 4YFKF 2EK5A 3WODF 1J9IA 3T8TA 1MDMA 2W24A 2R3SA 2JPCA 4M6YA 5E8GA 1ZREA 2H6BA 4KYWA 4OU0A 3LSTA 1PP8F 2OBPA 4MHGA 1K78B 3E3VA 3I54A 2KRFA 5ICCA 3R4KA 1YLFA 4MEXF 2OQGA 4Y17A 2XASA 1Z91A 2XKPA 3I4PA 2O8XA 5D6FA 3T8RA 2PBIA 4LLLA 2IJLA 1E2XA 3WGIA 1TQPA 4HDVA 2F5DA 5ILUA 5DCFA 3J80Z 5L3FA 4UVAA 5BPIA 1VTNC 4Q47A 2JT1A 2XRNA 3JAMZ 4S05A 4CDGA 4EVIA 3ISPA 2ESHA 1B6AA 5CLSA 3WTSC 2M45A 1KU9A 4JK1X 1XMKA 4KIFA 1JE8A 4RGXA 2ZMEA 2X0LA 4OOIA 5BOXA 3K0LA 5HDKA 4RGUA 2FQ3A 3I5UA 2DPUA 1ZARA 4HF0A 3BZ6A 5E1XA 4ENMA 3QP5A
chains in the Genus database with same CATH superfamily
4B47A 1WVRA 1K6YA 4KJZA 4GXOA 3ZQIA 3LA7A 3RKYA 3ZMSA 4AD9A 4KFCA 2K9QA 3L2QA 2CW8A 3TP0A 2M3AA 4DOZA 3E5QA 1MGTA 2LY9A 3I53A 4IO9F 2FMYA 2BGCA 2FX0A 5CKTA 2K9LA 1BIAA 1OQYA 1S7EA 2MSYA 4ENKA 2AXLA 4XKWA 1WJBA 4K2EA 3FBNB 5B66C 2R5ZB 1OCOH 2E1NA 4M3BA 4M6VA 3PFIA 2H8WA 1RKWA 2CUJA 2HKOA 3BOQA 4G9YA 5D8LB 2UV1A 3K6GA 2DA4A 1RR7A 5IOYA 4BHPA 2PJPA 2CV1A 2QSGX 1BI1A 3KP4A 1I50J 1Y0UA 2BOLA 3OOPA 4WF2A 5FKOA 4OIOF 1RNLA 3S2WA 5LFAA 1X1CA 4QIWN 3SJMA 5D4SA 1RUNA 3J81K 1YS6A 3J7AO 1JJ8C 2LP0A 2DOAA 3BTJA 2M87A 3O8GA 5CYVA 4BQOA 4O5VA 2LREA 5M5YJ 4PGGA 5E3OA 1XCVA 1S7AA 3GCMA 4I0AA 2VN2A 1EH7A 2A69F 4P5OA 1NK3P 2IP2A 3JCUC 2RC4A 2VONA 3F21A 4A6DA 5KVRA 2R0QC 2PJRA 1YITI 2BHZA 1F5TA 5LHIA 3DBHB 1J5YA 5LGTA 4H0EA 2E2JJ 2MH9A 2K02A 3PL8A 2WBMA 3LAJA 1BR2A 2R4GA 4UNOA 2G7UA 2EA2A 4L9VA 4A5NA 3BTCA 1LDJA 1Z21A 2E71A 3PUBA 5ICGA 4XMYA 1JUSA 4BS9A 1TC3C 4IOAF 1HC8A 1FP1D 3DEWA 2ZO4A 1SVMA 1B9NA 1UMQA 1CGPA 4L9JA 5BQTA 1WJFA 4MTEA 1YS7A 4BDZA 2TDXA 1TNSA 4JQFA 2Q8KA 4ZYHA 4ZDPA 3F9KA 1BA5A 2BYVE 2MH2A 3QPHA 1WSUA 3D5LA 4HNTA 2ELHA 3H5AA 2L7MP 2AQEA 1K78A 2O61A 3T1BA 2FMLA 2CO5A 3ZQCA 1PUFB 5J1RA 3S3OA 4KISA 5K1YA 4BDYA 2VB6A 4ZYAA 3HBLA 2IA2A 3I59B 3Q9SA 2X1EA 3BR1A 1RZ4A 4FISA 3WE2A 4BJTA 2HS5A 3QWLA 4E7JA 3ZQHA 3MKYB 1SFXA 3RDIA 2HQAA 2ZXIA 1XB4A 2Z1DA 2VUMJ 1KA8A 4N9HA 4ZDOA 2K27A 1TT5B 2KMUA 2IVMA 2IGKA 3CO6C 4W1UA 3G1OA 3OYBA 4MIMA 3L2RA 4NC6A 3ZMTA 4MGRA 2NOJB 2EFQA 2ZJRF 4WCGA 3MAJA 2XGXA 3Q9VA 3ZN0A 1T2KA 2CW7A 3LQQA 3MMYB 3WTXC 3DLLF 3FIWA 1QHHD 3P9KA 3WTVC 1XCBA 1TZLA 3H9QA 1HW5A 5B5EC 2WV0A 1IN8A 4RAYA 3FXRA 2A6EF 4P55A 1N77A 2RKHA 1FIAA 2FF4A 2DW4A 1U5TB 3OYHA 2HR3A 4KDPA 3MKLA 4G7OF 2LKPA 2JN6A 5DD8A 1YX5A 4NC8A 4BUPA 4NQWB 5IT3A 4DJAA 2IBDA 3NEUA 2K40A 3CJRB 4Q4ZF 3OYMA 2KDZA 3H3UA 3QPTA 4HQEA 1XPXA 2H1KA 2XROA 2ECCA 1VNDA 2F4MB 1FBQA 2IXSA 2ZXJA 4Q48A 1IXSB 4KMFA 1TW3A 2XKOA 5HNFA 3U21A 1FWZA 3VSKA 2HOEA 1BOBA 2AHQA 2COMA 2OD5A 2UXXA 1TW2A 2AS5F 3OIPA 1YO5C 2NS0A 4E70A 2QQBA 2XUBA 2FBHA 3T5XA 4E7IA 2K5CA 4HF2A 5B1BH 1ERDA 3TL4X 1HDPA 2CSOA 2IGNA 5F0FA 3FK7A 2V7FA 1X4PA 1SMYF 1LFPA 4XLFA 1LE8B 5LHGA 2LC2A 4EQQA 2NOGA 2DN0A 1O57A 3GFMA 3HB9A 1FNNA 2ISYA 3X2QH 2MGQA 4YIFA 2V1NA 1JHFA 5TGTA 2R5ZA 5GPCA 2Y2ZA 4N4NB 1FYKA 2QM3A 4GYGA 2HXIA 3IL2A 2CUFA 2DDAA 3A03A 3OS1A 4UV9A 4O3MA 1J0RA 3IH3A 4A6EA 1XGNA 3PQJA 4I6ZA 2RV8A 5E3MA 1IAWA 3RYPA 2EINH 3A0BC 2B63J 2QKLB 2YR2A 2NS7A 3F0CA 1ETKA 5E1WA 3KP5A 3LNQA 5IP7J 1WI3A 1W5TA 5FLXK 4DGWB 2HYGD 3IP4B 2P5LC 1A6QA 3WTZA 2WTEA 4YELA 1XGSA 5L3BA 5GAGJ 4M9XA 3CQZJ 1XSDA 4BBSJ 2PFBA 4RGSA 3CCEI 1XD7A 2QYOA 3SHFA 4NHJA 2HVRA 1V5FA 2XPUA 4Q5SF 1R58A 2K7LA 1X58A 3O2PE 1ZG1A 3AL0B 2OZ6A 3AAFA 1FC3A 1A6IA 4QWQA 3OOUA 2PMZA 4IRHA 1ONVA 3HTUA 3L7WA 4XRFA 1AU7A 3TP3A 4F55A 3GZ6A 5KNLA 3CCRI 1JI8A 2K3FA 2LNBA 3PNVA 4C3JJ 2HOAA 2R7WA 1OYWA 4PJLA 3G71I 4J19A 2ACJA 1IUFA 2K4JA 4A3BJ 1KQ9A 2NVTJ 2JMWA 2OCCH 1R4NB 3RQIA 3IUOA 5EYRA 1OCRH 1GHCA 4OIPF 2I5UA 2E7XA 4BH9A 1IV6A 1MSEC 2M1BA 2EFOA 2DYRH 2HPIA 2WB1A 1ZK8A 3FXOA 1O3QA 3I9V2 2E1MB 2DLLA 3ERED 2LLKA 1SFKA 3GXOA 4L5IA 4AVPA 5LGNA 3GF2A 3M9AA 4M71A 3GMEA 2OA4A 2DA7A 1SVOA 4BHCA 5JI6A 2X4HA 4BY7J 2XC7A 5E20A 3MKWB 4LIUA 5LHHA 1HSTA 3JRHA 2KIFA 3GYHX 3FM5A 2H09A 1JT6A 1STZA 2IGOA 1LJ9A 4ESBA 4OWRB 2VODA 1S72I 3K70D 2Q0OA 1MNDA 3FXKA 3BR3A 1BM9A 1PUFA 4HX7A 1WJDA 5B1AH 3I59A 3C2BA 2LRDA 4BE2A 1SD6A 4BQQA 3FWEA 2M2EA 4PJ0C 2E36A 4MTDA 4A3DJ 2L02A 3LSGA 2HOTA 1BN5A 4JP0A 5AIQA 4BE0A 1BW6A 3ZN1A 3ZP5A 1IZ1A 1QZEA 2BY2A 3I4MJ 3PQKA 1UCRA 1ZGWA 2C6YA 1XGMA 1HF0A 1J7KA 2F4IA 2RQQA 2YUSA 3H1CA 1FX7A 1U9NA 2VASA 4GGGA 3CCVI 2ESNA 2DA6A 1ZAOA 4IX7A 6PAXA 2HZTA 2CUEA 1ETWA 4HW0A 4D9JA 4HQMA 1R1VA 4I76A 4WXDA 3W2WA 3I56I 2A6HF 2VBWA 1AKHB 4IHWA 4E7KA 1W36C 1U5TA 2HFHA 1TBXA 4YEJA 4PJNA 3DEUA 1NHAA 4PSWA 2IS2A 2L3DA 5HLTA 2CU7A 2EWNA 5KCMA 2QENA 2P6TA 5HDGA 4ESFA 1D3YA 2GXGA 3CMEI 2L54A 3WG9A 2V6CA 1SMTA 3M8EA 3ZMVA 5IOZA 3Q0UA 3LFKA 3VWBA 1LDKB 2NS8A 5IYCJ 2RREA 5EEHA 3RI4A 3FXLA 5M5XJ 3W6JB 4AVZA 3HOWJ 2MC3A 2L5QA 2DODA 3KFWX 2A68F 1SEUA 3A0HC 3UKGA 2Y9ZA 3H9GA 2ZNZA 4NBQA 4D5CA 2P6SA 3PJRA 3LSJA 2D5VA 2HVQA 4G6DA 1OR7A 1MBKA 3WE3A 3SYTA 1B8IB 3LSIA 5DCMB 2XAUA 4I0BA 2FA5A 3AKZA 4F52A 1LE8A 2H27A 2PQ8A 3IC7A 1K79A 4PCQA 1Y0NA 1MKMA 3W6VA 4EJUA 3KP3A 2DCEA 3O6BB 1FSHA 2R7XA 2K86A 3N05A 1W7PB 2I10A 1IDYA 1A35A 4N0BA 1G59A 3GTPJ 2E2IJ 3CMAI 1W5CC 2W82A 4IHVA 3VYUB 2BE5F 3U1DA 1Y39A 2Q2EB 3DPLC 4KIGA 3A4CA 5GAEJ 4WXCA 1MJ9A 1HKTA 4CCKA 2QVOA 4HRIA 2PI0A 1XN7A 2A6TA 2YX4A 4MFDA 3CC7I 2R92J 1JKQC 1IXRC 1MD0A 2YSRA 2GXBA 5ED4A 1FYMA 2J5OA 1FBUA 1FPQA 3JSPA 3K1MA 2XSJC 3K4JA 5LRRA 4HNUA 2RNGA 1BJZA 4X1EA 2CH0A 2DFEA 2NNNA 2DPDA 3FDYA 1KQ0A 2M7BA 4LG0B 4D0PA 1ENHA 3OL4A 1HKSA 5DEQA 3CCUI 3K9TA 5K7HA 2ZFWA 4WX9A 2B7EA 1IXCA 3DFGA 2MG4A 2ZXHA 4XN3A 2LG4A 3F6OA 4XN0A 5AONA 4B44A 3IH4A 2DXIA 2MA3A 2DI3A 1NG6A 1YOVB 4D7MA 3ZQLA 3S17J 1ZLJA 1LDDA 4E7HA 2JUCA 2MBFA 2L4AA 2JUGA 3SEQA 5FO5A 3GEZA 1JKRC 2KZGA 3F72A 3H3VK 1VQ7I 3KP7A 4RB2C 1HXDA 3QAHA 3S1NJ 4F92B 3TQNA 4Z6YA 2KJBA 1FTTA 3PO2J 5BPDA 5A2QK 1BR4A 3BJOA 4II2A 2VXZA 4HOBA 2LVSA 5D5UB 2XAJA 3FISA 4M3FA 4CO8A 1WH5A 4UUVA 5TISC 1VFCA 4GRIA 2MFZA 1A5JA 4U88A 1YYVA 2IAIA 4PDKA 5J3LA 2Y9YA 1VQ8I 1Y6IA 1JKPC 3JRBA 1A36A 2UWMA 2E35A 3S93A 3CF2A 3E6BA 1R5ID 1TQIA 3JRDA 4M3GA 1VQ4I 1X3ZB 1I1GA 2LKSA 2VBXA 2JWTA 2DOFA 3KZYA 4J01A 1JKOC 3DPTA 3SQNA 2AO9A 4LK1F 1T0FC 4L5EA 4G8XA 2WV1A 1IJWC 4C30A 5LGUA 1I1SA 4AWXB 4E7ZA 4FE4A 1GT0C 4L9NA 1OCCH 2O0YA 4UV8A 3W3CA 2F6CA 3L2VA 4LB5A 1IN6A 1EJ9A 2QSFX 2ZXWH 2BZTA 4WK8F 3OYIA 2D45A 2UXNA 2F5VA 3ABKH 4IPAA 2W85A 4M74A 3HPGA 1AKHA 3JR9A 2DMUA 3UR3C 4A0YA 2XB0X 2M7AA 4BJ6C 4DIQA 4ENMA 3CLOA 3FK6A 2JA5J 1H0MA 5HS9A 4I7HA 1C0WA 5EF6A 2STTA 3ELKA 1F43A 3A01B 3L2WA 2X1DA 3LA3A 5HLHA 5JHUA 2NAZA 1NG7A 2LDUA 5K7FA 4GFBA 1Q1HA 4BY1J 2V79A 1CQTA 3FKIJ 4I2OA 2IS4A 1G2HA 3E6DA 1FOXA 2GLOA 5FGMA 3S2DJ 2F48A 1JGGA 4Y52J 1IDZA 3S2HJ 2MLGA 4QSHA 2LD5A 4OAZA 3BR0A 3ZRGA 2MABA 2XAQA 3EUHC 3D1NI 5TRDA 3CDHA 1G8XA 4FX4A 1U8RA 1YE9A 3KYCB 1UHMA 4AYBN 1IRXA 4BJ5C 1AA7A 1YW7A 5HODA 1X1DA 4FCYA 3GTKJ 2XDVA 4YIIA 1UHWA 3OYAA 3DBLB 3S32A 3W2VA 3FBIB 3H35A 2R7RA 4EGYA 1YHQI 1O3SA 1B8IA 1JHHA 1ZRCA 3S15J 5DCMA 4A3CJ 3JSOA 1BBYA 3KZZA 3F22A 4AYBA 2G7HA 4ZH4F 3ECOA 3ZQ7A 1UB9A 3E0JB 5KHDA 1RKTA 2EV6A 4CUGA 5L3CA 1X2MA 3QQAA 4B8XA 4JX6A 1R49A 2IS1A 1T6SA 3HSFA 4DBQA 2Q1ZB 3K4MA 2EJRA 4KMUX 4ZTFA 5A2QZ 2JA8J 5K5RA 3N97A 3ML6A 1J59A 2L0KA 3LOCA 3ZMZA 3OYNA 2LTPA 3FM3A 4OIQF 1F9NA 3CMYA 2VPLA 3VPRA 4LJZF 5J47A 3BG9A 1HSJA 3MZ8A 4CCLA 4J00A 2TRTA 3KYLA 1ZYRF 2BV6A 2DK5A 5DUKA 2NVUB 2Q2EA 4HZFA 1FMVA 3MKZA 5LEKA 2HWVA 1JUPA 3K70C 3J7YJ 1P4AA 1W36D 5CVUA 3M8FA 3LAPA 4KIBA 2QF7A 1T8IA 4C9YA 2CG4A 4XBFA 2KP6A 2EFWA 3RZOJ 2V9VA 5HS8A 3OYFA 1Y8RB 3CLQA 1D0ZA 1P4WA 4CA0A 2VJ5A 5LD2C 1GVJA 3M3YJ 1YG2A 3HOUJ 2HZDA 3O3KA 3AFHA 1ETYA 1HQCA 1NTCA 3S16J 4UUSB 2VQHA 3IAM2 3SZPA 4ZYEA 5J8CA 2DTRA 3WU2C 2E7WA 4V19K 1W0UA 1F36A 1I3QJ 3BG6A 4OIRF 3GTMJ 4DQ2A 1S8NA 1ZN2A 4IRIA 4L5JA 1JTYA 3R61A 1K4TA 1Z7UA 2FNPA 1BI3A 5JVGF 4BACA 2O6GE 2HXOA 2OAZA 2ZC2A 3CCYA 3Q3SA 4II3A 4ENJA 1DU0A 1IG7A 1ZG3A 2F2EA 4I01A 2E1CA 4HF1A 3WGGA 3HUGB 4A3FJ 1EKEA 4IHSA 2GZWA 2H94A 2W7NA 2HDDA 4KT6A 3ZR8X 5LRSA 3L2UA 2VKHA 3QRFF 5F1JA 2A5WA 3ABLH 3Q0VA 1TWFJ 3SFZA 5GPAA 3CO7C 3OWTA 2LSOA 1SANA 2WAFA 1W7PD 4HX8A 1P7JA 3IRQA 1B1BA 3HPHA 3TOBA 3KEOA 1U2WA 2AQFA 4AIKA 3VDXA 2ZB9A 3HOXJ 2J5PA 2HDWA 1R1UA 1VF9A 2ELJA 3JRGA 1FIPA 1KONA 1FT9A 4XKVA 4GYIA 2I8DA 5FKMA 1QHGA 4BU2A 3OS0A 4C2TA 2O8KA 2DK8A 5CVIA 2K4BA 2JVHA 3L00A 1ZHFA 3F8NA 1WKMA 2P0WA 2Z3YA 1ZGAA 3JTGA 2XF5A 4HX4A 5J4YA 1MW7A 1GXPA 5J1YA 2YX7A 1QO0D 3IWFA 3GTQJ 3F8CA 3CJNA 1B72B 2XAGA 1LQ1A 2VI6A 1QPMA 5HNHA 1T0FA 3AG1H 3FXUA 1LFBA 3R6SA 3SEZA 1BW5A 1XDUA 2FE3A 1TT0A 1P92A 3HGYA 2CGPA 3NAUA 3K1NA 3M8JA 4HEA2 3T0YA 3F23A 1E0EA 2X48A 4M3DA 3L1PA 3DP7A 3BP8A 4KICA 2ADUA 2A3SA 3S1MJ 3HG9A 2HQ5A 4P9FA 2K9NA 4G6QA 1Q1VA 4JBAA 2ME6A 3HRMA 1U5TC 3RKXA 2LH9A 2XPWA 3ZMDA 2FXAA 1F4KA 3LA2A 2L7FP 3OYDA 5ICFA 3A01A 1Z6RA 1XMAA 3OIOA 3BR2A 4IL6C 5GAHJ 4XKCA 4EJOA 4OMZA 4LG3A 2DTZA 3GBGA 3QU3A 2V1XA 5M3FJ 3DKXA 2F5FA 2WC2A 4FQGA 3EYIA 4IHTA 3MFKA 2FSWA 2VJ4A 3Q5FA 1YFHA 1I5ZA 3AG2H 1NH3A 1MIJA 2OF7A 3HTSB 1LEBA 1USSA 2HEOA 1X3WB 4B1RA 1GLNA 2MC4A 2QZ8A 3MEXA 3IRRA 4AU7A 1RIOH 1LVAA 4XNFA 2IRFG 1O7LA 3BZCA 5F04A 2M9HA 1YRNA 1CF7B 3FHNA 4CHUA 2IW5A 3EUHA 4XRSA 3GTOJ 4WWCA 1GV2A 3S3MA 1Z0XA 3DEEA 4L0YB 3BZKA 3KPHA 4BHBA 1VQOI 3FZVA 4EEFG 1E3HA 1OR7C 3W6KB 1R00A 4RB0A 2L4MA 4FASD 5D5VB 1S3JA 2ICWG 2R7UA 4Y13A 1ZH5A 4MLOA 2VKDA 3HDDA 2FUG2 1HDDC 3BC8A 1UELB 1MH4A 4MO7A 1KYWA 3GO5A 4XLEA 1J09A 2VT2A 3PSFA 4RBOA 3C1DA 2EQRA 3V8JA 1YIJI 2ZSHB 2IS6A 4BE1A 2OV7A 3ABMH 1RR8C 5GTHC 1TWHJ 2VOPA 3C3WA 2DQLA 2EFPA 3GTGJ 2LOOA 3PO3J 3K1PA 4G7ZF 2DOEA 4EJWA 2M4KA 5EGOB 1Z77A 2DT6A 3BY6A 1FSEA 3K4NA 4PFOA 1KGSA 3C7JA 1REPC 1DGRM 5IT9K 4MQ9F 3P5JA 4E7SA 4UVCA 2EZKA 1X1BA 3RPQA 3I0TA 1Z3XA 3CUQB 4RLFA 2Z2SB 3SZTA 5LBQA 2VBYA 1N78A 2IT0A 3LMMA 2FOWA 2ZSIB 3I71A 1JGSA 5F27A 4RAGA 1KZHA 4DNCA 1ETXA 3KX2A 5F08A 4ANJA 4UUSA 3AL0C 1T56A 5FFXA 2DT7B 2DA5A 1P9QC 4XK4A 2NXNB 3WHCA 4B48A 2DMPA 3DCFA 2EFNA 3JRFA 1OJLA 1O3TA 1HW2A 1DGWY 3BLYA 4IQJA 3L2CA 3CP2A 3D5SC 1B4AA 3HGGA 3VOEA 5FKNA 1FTZA 4AM3A 3GFLA 3QYBA 4E6KG 2DO7A 3RCOA 5EEAA 1X1AA 2LFBA 3E7LA 4IXAA 1N25A 1MMDA 3C2HA 3JW4A 4KNYA 2GIVA 1H9TA 2E1MC 4JOMA 3H0DA 1DPUA 1TWCJ 1J2XA 2KIQA 5EG0B 3GVAA 3GTLJ 2M34A 3HKZN 5E18F 5KAIC 2F4OB 3BCBA 3TDUC 1D8JA 1LPQA 4FTHA 4I09A 2LBFB 3BQYA 4QPOA 3PSIA 4A0ZA 4F3QA 4I99C 2HGCA 4LITA 1SVLA 1OCPA 4U7DA 3U2RA 2VQCA 1DU6A 1KU2A 3KZIC 1T98A 2V1DA 2W25A 4HG2A 4U87A 5GTIC 3CP8A 1LB2A 4KN7X 1PYVA 4ZZLA 2HDCA 4ZYGA 2IGMA 1ORKA 3HRUA 2FQ4A 5BNGA 1ETQA 1T33A 1XX5A 3BDDA 1B72A 4NDLA 2FBKA 2L7KA 4BYYA 2FD5A 4CXFA 1VQ9I 3G3ZA 4G7HF 2AXTC 2QEXI 2DA3A 3OYKA 3ZCOA 1TLHB 3M7GA 3ZPLA 1WZ2A 1KU3A 4KA4A 3HC7A 3K2ZA 5H2FC 1W5SA 5C4JJ 1HBXG 1JTXA 5FD6A 3LSRA 2IA1A 4Z2YA 3QODA 3ABUA 4GO1A 5LLQA 2FJ1A 2M0CA 3LL7A 3ZOBA 2X6XA 5D5XB 5IP9J 1R9TJ 5IT9Z 1QNTA 3PIOF 2E19A 1UHSA 2P7VB 2L01A 4BBRJ 4NNJA 3NARA 2JRMA 1MH3A 3G4SI 2DFIA 4UHTA 2X1CA 2BW3B 3H0GJ 3REOA 2JVGA 1ETOA 2X9DA 5FRNA 2H1LA 4XRMA 4NQWA 1KYZA 3WG7H 1FJLA 3AG4H 3CESA 2FRHA 3SDGA 2PMHA 1LUJB 5K5QA 4C3HJ 1USTA 2BVLA 2X6WA 4LIVA 4YRVA 3PUFA 2CS3A 4A3JJ 3TKYA 4X0GA 4NUBA 3FXQA 2O7OA 3V7CA 2HTSA 2E5NA 3G2BA 4HLXA 2N8GA 1CF7A 2JA7J 4QTRA 2QA4I 3MN2A 3KETA 1QRYA 2HU9A 2KL4A 3OR1C 3CC2I 2M4GA 1S6LA 4BAYA 4H4KC 3QOPA 2OZUA 3RPUA 2ZMEB 2VPRA 1IO2A 3QP6A 2VKVA 4CGZA 2DMTA 1SAXA 1WQ2A 5CJ9A 2KLOA 4NB5A 1JJ6C 4B3AA 2QWWA 2KIMA 3I64A 1UJ8A 4HSRA 1T38A 4A3GJ 1AHDP 3H36A 5C4XJ 1HKQA 4S0HB 1IRGA 1MBJA 3ABTA 5DUIA 4P9UA 3GX4X 2XAFA 4IEJA 3LFUA 4AIJA 3HYIA 2G0EA 2BXZA 3ROUA 2EZHA 3DTIA 1PDNC 4A3EJ 4HA8A 1R6RA 3R60A 1U3EM 3A02A 4DW6A 2HKXA 1TWAJ 3FF5A 5EGOA 4XLPF 3GFIA 4C2MJ 2ISZA 4BL0B 2WADA 1XMXA 1UFMA 3TDZC 3WU0A 3VYRB 1BC7C 1Z6TA 3VB2A 4CYDA 2XAHA 1ZRDA 2ZNYA 4YIRX 5BMZA 1QZYA 2ECBA 3HJEA 2W00A 4XSXF 1FBSA 2Z99A 3NQOA 2LK2A 4R79A 1DP7P 3TOAA 2YPRA 1IN5A 1B59A 3D5RC 3JRIA 1G4DA 4MFEA 2QGUA 3MVPA 5ILVA 5JR3A 4AC0A 2GA2A 3F8FA 4CH7A 4DZJA 5TJJA 2OUMA 3IAS2 2GIZA 2HYJA 5FJ8J 2NRAC 2M0MA 2OTLI 1FOKA 1WJAA 2WWYA 4MQVA 5E79C 1IGNA 3RPUD 3FKJA 2NNYA 3NWSA 4A3IJ 4UUTA 4UB6C 3WTYC 5IPAA 3OR2C 3G73A 4UB8C 1OISA 2DT5A 3DTKA 2R7SA 1YW8A 2GOXB 1Z7LA 2A05A 2OU2A 3K2AA 2XSDC 2P4WA 4ZTJA 3BJAA 2XGEA 4RDUA 5EG0A 4I98B 3V8KA 1RUOA 4N9IA 4ETSA 3QOEA 3LWFA 2M30A 5CVVA 3BR5A 3IKVA 4A12A 2M8GX 2LBFA 4HDUA 2LMDA 4B43A 1MBFA 2JZYA 3FMQA 1Z1DA 3ULQB 1P6RA 5JFRA 2LF8A 1B9MA 3HL2A 1PJRA 3E97A 1UZCA 4U0VA 2V6EA 2UUZA 1D0XA 4M6XA 2WAQN 3O8HA 2CFOA 1S9HA 1RI7A 2DYSH 2QKMB 2X51A 2YU9J 2E1OA 2K85A 5ICEA 1YJWI 3WGHA 1MMSA 5IYDJ 4LFUA 1P2FA 2WAQA 3LSMA 4G94A 3K69A 3FHZA 1ZKGA 3CCLI 3TO6A 5JVTA 1XDSA 2HVSA 3M1EA 1SAUA 2M8EA 2DBBA 3DWLE 4BEHB 2ZBKA 2W84A 4IHXA 1U6GA 4ZC3A 1YW9A 3GWZA 1VQPI 4ABZA 1K83J 2HI3A 3C18A 2NVQJ 2X85A 5EDNA 4EM1A 4UY8I 3DXJF 3GZNB 4OINF 3MZHA 3JRCA 2ID6A 1WJ5A 3CCMI 4R8HA 5DM6F 3MQ0A 1YTYA 2EIMH 1MBGA 2XPVA 1MZBA 4OMYA 5HLGA 1DPRA 4ZYDA 2BW3A 1OCTC 3M4OJ 1D0YA 1MJAA 3J7AY 1SFUA 1VI0A 3LQRA 1W0TA 5DV5A 2EA4A 1ITYA 1XTAA 2HTJA 3KCCA 1NK2P 2B9SA 1VQLI 1OLTA 1X4OA 2DA1A 1LNWA 3R0AA 5D8KB 5IY5H 4P96A 3BR6A 4V2GA 2H6CA 3DBRB 3VODA 3BG7A 2MD0A 3DKWA 2ZJ2A 4ASNA 1O7FA 2MYSA 4DYQA 3VEPA 4EJVA 4HSTA 1WCMJ 2JSCA 1FZPB 1YI2I 3HOSA 4U0WA 4CCOA 2BBYA 2JK3A 4A3MJ 1R22A 3HSRA 5FLVA 3CC4I 1QU3A 4GCVA 2LKXA 2JQ7A 3SDBA 3K4BA 1MMGA 3A1YA 3EUAA 2XHKA 2CV0A 2XGCA 2VC1A 3BROA 2VQGA 3ZQQA 2Y30A 1ZR4A 2YS9A 1OCZH 5GP9A 1R5HA 1W7PA 3QYEA 4JYKA 4XR6A 3ZGKA 5F6FA 2NYXA 2XIGA 4M72A 3ECHA 4HV6A 4CZCA 4EM2A 4XQFA 2RQPA 4YFNF 1I6HJ 3H5NA 1U9OA 3DLAA 1YJNI 5KAFC 1YX3A 1ZELA 2GWRA 4BXFA 2RN7A 2O9LA 5CVRA 2FBIA 2L9RA 3GLXA 3RYRA 2Y0MA 4KITB 1PUEE 4KT5C 3B73A 1T39A 1GVDA 2KZVA 3FMRA 3TW7A 1G3TA 5EJCA 1RRJA 3TO7A 1BIBA 2L7ZA 4N4OB 2V26A 2F5EA 3GW2A 5JLXA 1WHUA 4YG2F 3FXMA 3IH2A 5E17F 1E3PA 5L3EA 1U0JA 2CMPA 2HYFA 2ZFUA 1TNTA 2JTVA 2O3FA 1S29A 2XV4S 4NC7A 5K7ZA 5K5OA 1G6NA 3BJ6A 3JREA 4Y15A 5FROA 3KLOA 1X19A 4B3XA 4EV0A 4LG0A 2Y31A 4EM0B 2JJ7A 4CZZA 5J8FA 5FLMJ 3BCAA 4RAFA 4I02A 4RM2A 1X2NA 5HS7A 1EH6A 3CCSI 5CVJA 2FOKA 4L9TA 1IUYA 3OSFA 1EH8A 1QVTA 1XGOA 5AIPA 4AIDA 1QBJA 2KJCA 4IHYA 2GOMA 2DU9A 2BVMA 3ZXSA 2W57A 1V3FA 5D6EA 4QPQA 3HHHA 4RB3C 3QU6A 3KP2A 5FFZA 4PJMA 3HOTA 2WAEA 4HLYA 3RQ4A 4ITVA 1TTYA 3JTHA 4E7LA 1VZ0A 4BXUA 5KK1A 3H5RA 1OYIA 2PEXA 4LOCA 1OKRA 1H8AC 3SZGA 3ERMA 4IOCF 2E2HJ 4A5MA 2P5KA 2V9KA 2CQQA 3GFJA 2XVCA 4DYRA 3RKWA 2VLAA 2V1UA 2R7VA 3KE2A 2JRTA 3IKTA 3E1SA 3HHGA 3EETA 1KU7A 3WTUC 4W97A 2W4SA 3COAC 3U1KA 1JT0A 2ELKA 4LGWA 4V2FA 4RS8A 2OPTA 3SFIA 3CUOA 3WTTC 4FHTA 3OSGA 5FKKA 1RESA 1D8KA 2P8TA 2A5YB 1WI9A 1RC9A 4RGRA 1DUXC 1UG2A 2VC0A 2KKOA 1I39A 4O6JA 1ZLKA 1WFXA 1LEAA 3M07A 3KIOA 2QUFA 1ON1A 4D7NA 1BOAA 3V8LA 5IP6A 2FEZA 4XIDA 3ZMUA 5HVQC 1I6XA 5H20A 2MLKA 3ASNH 4IQ4A 4XOPA 4BEHA 2CV2A 3BT9A 4C2UA 4HPQA 4QLCU 1SC7A 3AG3H 3B02A 2DAOA 1R5GA 2CWEA 4ESJA 2JA6J 2RVCA 4XOTA 1ZG5A 4A69C 2VJIA 1X3UA 2DJNA 2O03A 1WH7A 1R4MB 2KRHA 4PZJA 4EGZA 1PP7U 1BR1A 2L2OA 3F8MA 4CCJA 2VKEA 1I3AA 1ZTRA 2R7QA 4DZPA 2ME0A 5EZHA 3TBIA 4CCNA 2KISA 3OV8A 3WHBA 1IV8A 3DQVC 1D5VA 1OPCA 1F1ZA 3RIRA 1GUUA 4Y4RA 3BG5A 3VYSB 5EEGA 2E34A 1G3WA 1XG1A 2ZCWA 2XF6A 5M5WJ 2GQQA 2CW0F 2ZJPF 2K9MA 3J81Z 3HIFA 3VSLA 4IJAA 1L3LA 1QPIA 1V5EA 2VBZA 1KQ8A 2HQNA 3OL3A 4ON0A 3CF5F 4LK0F 3OYJA 4F93B 3N4MA 1D1CA 3P9IA 2EH3A 2COBA 2R7FA 1DDNA 3BG3A 1OMIA 2FNAA 1Z9CA 1G3SA 3OYEA 4MNUA 5E8IA 5C44J 3I55I 3K4CA 3LSKA 4IKFA 3CD6I 3E5XA 2QSHX 3IHUA 4BQAA 3V4GA 4XORA 5J40A 2KFDA 3PIPF 2D1VA 3DV8A 2RGVA 1IW7F 2VE9A 1BJAA 4ZJZA 3C2GA 3DTEA 4A2UA 3W2AA 5DD4A 4S04A 4FE7A 1E17A 2DDBA 4LB6B 4MEYF 3ASOH 5LEJA 3V7SA 5FD5A 4XICA 1ZR2A 5B3SH 3S1RJ 2Z5UA 1I27A 5M3MJ 3U9GA 2WY7Q 4DYCA 3ONQA 4EMSA 4BXXJ 5L3DA 3DKYA 4ZZDA 1K4SA 4U0YA 1Z3YA 1MMAA 2BY3A 3QYFA 1O4XA 2QBYB 2OTJI 4FX0A 2EV0A 1ETVA 2Y0SN 1R36A 3R0JA 3CUQC 5DTDA 4F7ZA 2Z33A 1S7OA 2RAEA 1JXSA 4PGHA 1UAAA 3IWZA 3K4KA 1WRJA 1R1TA 1QQIA 4KUMA 5CPRB 3CZ6A 3WU1B 3RSNA 1FEXA 1X1PA 2Y0SA 2UZKA 1LVKA 1IRZA 4B4CA 3IV5A 1HA8A 3H92A 3TO9A 2PN6A 1Z05A 3SXYA 1DQUA 5H6RA 5H6QA 1IC8A 2EV5A 3OY9A 4PFPA 5DS9A 1E3OC 2L9VA 1WGXA 4PUSA 3I58A 2B0LA 2JA2A 1G3YA 4CYCB 1L0OC 2KQRA 2EIJH 5E3LA 5F64A 3HUGA 5FB2A 1A31A 4XL9A 2VJJA 2PMZN 2QLZA 2P5VA 1WPKA 1ZGJA 1HOMA 3K10A 3F8BA 1YIOA 4LLNA 1FY7A 2DJIA 2QQ9A 1W4MA 4RLQA 3V42A 2D2WA 2CRGA 3MWMA 1VQ5I 2JPBA 5FRMA 1PVEA 2Y48A 4XLHA 1SD4A 1N75A 3KP6A 1FP2A 2STWA 2X6YA 3EDPA 2CYYA 3I3LA 3D0SA 3PFYA 1SFEA 3A2KA 2WB1N 2XB5A 1WJCA 2LR8A 2XRLA 4Y7NJ 1TP4A 3HKZA 5L3GA 2BEOA 1XSXA 9ANTA 2CQNA 2VXDA 3HM5A 2F5CA 3DF8A 3BPXA 3CJQB 1Y1WJ 3TGNA 2D1HA 2ZJQF 1T08B 5DM7F 4RAZA 1HW1A 1IF1A 4A93J 4JX4A 2L9NA 5BS6A 1BI2A 1TWGJ 3HRTA 4CICA 4HBLA 2P7CB 4Y33A 1P4XA 1EV7A 4AIHA 5JHFA 1MDMB 2CQKA 4HV5A 4LMYA 5HOOA 3HRSA 2ZKZA 4BKXA 4XSZF 3GUDA 1V54H 4Y3OA 3I4NJ 2PX9A 1GV5A 1Z67A 3CMMA 2G9WA 2YU3A 4EJTA 3OIQA 5C3EJ 2Z9OA 5F1RA 1TL8A 1HLVA 4XLAA 3P7NA 1HCRA 3DU5A 2BY1A 3K4LA 2ETHA 1LFUP 1V5GA 2DMQA 2CFXA 2IA0A 3JRAA 1T95A 1IN4A 3QPLA 2GAUA 4BNCA 5ILSA 1FYLA 4M3EA 3CCQI 4YFXF 3E6CC 4PK4A 2DMNA 4IZZA 4UVBA 3PM1A 1H9GA 2HNHA 3B6AA 2EPFA 5DYMA 1MNEA 3S8PA 2A07F 3CCJI 4IRGA 3MCZA 1O3RA 2WA0A 1MJBA 3OMYA 4JX5A 5JLWA 2W48A 2OQRA 1IN7A 1MSFC 2EBIA 3FMSA 2EZIA 2A61A 3H9JA 5GADJ 1APLC 1ZRFA 2P81A 3V7RA 1Y8QB 3CDLA 3G1MA 2H8RA 2XGDA 4ENNA 1EA3A 3VFZA 2E60A 3B6CA 1ON2A 3TMOA 4EATA 1XS9A 3L09A 1R23A 5FLXZ 2BY0A 1MBEA 4D5FA 4L18B 5ERIA 2ID3A 4A0XA 4C3IJ 3TW6A 2X6OA 2VE8A 1J75A 1IRFA 2CUZA 3EPZA 3BWGA 2DQRA 1A04A 2K9SA 2OJED 2R7DA 3Q0WA 2V9PA 4RM3A 2VOOA 1D1AA 2ZMEC 1VQ6I 3OS2A 2R93J 4BGDA 4P1WA 3HOYJ 3RZDJ 1U78A 3J7ZI 2V4JC 1TQMA 3S14J 3NRVA 1K7AA 3E6MA 2QCOA 2VT3A 2VIXA 2VL8A 5HDNA 2R5YB 1WWXA 1EF4A 3RJPA 3EQLF 1QGPA 1AOYA 3MZYA 1K6OA 5FKLA 3RTRA 2QQAA 3HEFA 4IVNA 2KIUA 4B09A 1XC5A 2RDPA 2PG4A 3E5UA 3S3NA 4HNVA 1POGA 3MD2A 1VQMI 1QA6A 1BC8C 1MBHA 3TEDA 3LSPA 2R7ZJ 4E4HA 5D5WB 1XSVA 2DFHA 3P9CA 2IEKA 2LF7A 2R7OA 2Y75A 1YQAA 3GLLA 2QBYA 2QQ8A 4M9ZA 4RA2A 1FLIA 2GBYA 5HLIA 4FETA 4L0ZB 5J1UA 2LYCA 1UG0A 2EB7A 1SD7A 2PLYA 2O5RA 2KT0A 4M9SA 4M73A 3CUQA 2PMUA 3LSHA 2KDOA 2NVXJ 1VQKI 3OYCA 3EYYA 3J80K 4TV7A 2EILH 3HXLA 1LKXA 1SFOJ 2DA2A 1SD5A 1OYYA 3GZ5A 4HYEA 4X6AJ 5J6XA 1R7JA 1ULYA 2CJJA 1MNMC 3G1LA 4LD5A 2IPQX 4IF4A 2EIKH 2VQLA 4R1HA 4DBRA 4G6TB 3OYLA 3CTAA 1V4RA 4KN4X 3JAMK 4FT8A 2GA1A 1AWCA 3M1CA 3HOVJ 5D4RA 2NVYJ 4XM3A 4CYCA 5DDGA 4PSXA 2M5WA 1FMWA 1VQNI 1BL0A 2R7TA 4WXHA 4XLNF 3OYGA 3K7AJ 3HZJA 4U7BA 3F3XA 5E1ZB 1Y56A 2RNJA 3CDIA 3CJTB 4AUXA 1QZZA 3HSEA 1BI0A 2XF7A 2HQRA 4A3KJ 3L9FA 1GXQA 3ZQGA 2GXAA 3WTWC 2FU4A 3BPVA 3PNYA 2PJRB 4RB1A 3ESWB 4D1QA 4XONA 4LLGF 3KLNA 2OCEA 3EUKL 3KEQA 1ODDA 1V55H 3FX3A 4CCMA 2WY8Q 1W1WE 1ACIA 3F6VA 3KEYA 4HAMA 2KRCA 2MD5A 2LY1A 3H3ZA 2KHMA 4UXNA 4YFKF 2EK5A 4CSWA 3WODF 3DU6A 1J9IA 2BXYA 2HPMA 3T8TA 3BTIA 1MDMA 2W24A 3RKQA 2R3SA 5F0HA 2JPCA 5J4VA 4A3LJ 4M6YA 5E8GA 1U8BA 1ZREA 2H6BA 4KYWA 1M1EB 4RMNA 1H89C 4OU0A 2W1OA 3LSTA 1PP8F 2OBPA 4F91B 1QVUA 5EZGA 4XKBA 4MHGA 1K78B 1DP3A 3E3VA 3I54A 3DPUA 2KRFA 2JSPA 2L9SA 3VYTB 5ICCA 2GM4A 4PJJA 3R4KA 5IYBJ 1YLFA 3ZQFA 4MEXF 1H88C 2Z16A 2OQGA 4XLCA 4Y17A 2XASA 2CQ7A 1Z91A 1R71A 2XKPA 3I4PA 4XRSG 2O8XA 5D6FA 2MW8A 3T8RA 1ZQ3P 2PBIA 3G6EI 4LLLA 2IJLA 4OAYA 2LY2A 3HOZJ 1E2XA 3WGIA 1TQPA 2E5ZA 4HDVA 2F5DA 5ILUA 5DCFA 1FOWA 3J80Z 4ZDLA 5L3FA 1P7IA 4UVAA 1S5LC 5BPIA 1RPWA 1VTNC 3BTLA 4Q47A 2BHYA 2EZLA 3UNGC 3GTJJ 1D1BA 1Y1VJ 2KPMA 5CQGA 2JT1A 1FOYA 2Y69H 2XRNA 3JAMZ 5F0CA 2OC6A 1YJ9I 3S1QJ 4CDGA 4S05A 4BQNA 4EVIA 3ISPA 2ESHA 1B6AA 5CLSA 1RETA 2CQXA 3WTSC 4G12A 2M45A 1KU9A 2DFFA 2TCTA 4JK1X 1JUMA 1XMKA 1D5YA 1WJEA 4KIFA 1JE8A 4RGXA 2ZMEA 2X0LA 1OFCX 4GDFA 4OOIA 5BOXA 5CQEA 3NWTA 3K0LA 5HDKA 3QPSA 3FXJA 4RGUA 2FQ3A 2R5YA 1K61A 5E3NA 1GDTA 3I5UA 3PNTA 3KYDB 2DPUA 2K3PA 1MMNA 1ZARA 2HOSA 4HF0A 3BZ6A 5E1XA 1YRNB 3BQZA 3QP5A
chains in the Genus database with same CATH topology
4GXOA 3LA7A 3RKYA 3ZMSA 4AD9A 4KFCA 3E5QA 1MGTA 3I53A 2FMYA 2BGCA 1BIAA 4ENKA 2AXLA 4K2EA 2E1NA 3PFIA 2HKOA 3BOQA 4G9YA 5D8LB 4BHPA 2PJPA 1BI1A 3KP4A 1Y0UA 3OOPA 4WF2A 4OIOF 1RNLA 3S2WA 5D4SA 1RUNA 3J81K 1YS6A 3J7AO 2M87A 5CYVA 4O5VA 4PGGA 1XCVA 1S7AA 4I0AA 2VN2A 1EH7A 2A69F 4P5OA 2IP2A 2RC4A 2VONA 3F21A 4A6DA 5KVRA 1F5TA 5LHIA 1J5YA 5LGTA 4H0EA 2MH9A 2K02A 3LAJA 4UNOA 2G7UA 2EA2A 4L9VA 4A5NA 1LDJA 5ICGA 1FP1D 2ZO4A 1B9NA 1CGPA 4L9JA 5BQTA 4MTEA 1YS7A 2TDXA 1TNSA 4JQFA 2Q8KA 4ZYHA 2BYVE 2MH2A 3QPHA 1WSUA 3D5LA 2ELHA 1K78A 2O61A 3T1BA 2FMLA 2CO5A 5K1YA 2IA2A 3I59B 3Q9SA 3WE2A 1RZ4A 2HS5A 1SFXA 3RDIA 1XB4A 1KA8A 4N9HA 2K27A 3CO6C 2IVMA 3ZMTA 4MGRA 2EFQA 4WCGA 3MAJA 2XGXA 3Q9VA 3ZN0A 1T2KA 3LQQA 3WTXC 3P9KA 3WTVC 1XCBA 1HW5A 2WV0A 1IN8A 4RAYA 3FXRA 2A6EF 4P55A 2RKHA 2FF4A 2DW4A 1U5TB 2HR3A 4KDPA 4G7OF 2LKPA 5DD8A 5IT3A 3NEUA 4Q4ZF 3H3UA 3QPTA 4HQEA 2XROA 1FBQA 2ZXJA 4Q48A 1IXSB 4KMFA 1TW3A 2XKOA 1FWZA 2HOEA 2OD5A 2COMA 2UXXA 1TW2A 2AS5F 1YO5C 2NS0A 4E70A 2QQBA 2XUBA 2FBHA 3T5XA 4HF2A 2CSOA 1SMYF 5LHGA 4EQQA 1O57A 3GFMA 1FNNA 2ISYA 4YIFA 1JHFA 1FYKA 2QM3A 4GYGA 3IL2A 4UV9A 4O3MA 1J0RA 4A6EA 1XGNA 3PQJA 2RV8A 1IAWA 3RYPA 2YR2A 5E1WA 3KP5A 1W5TA 5FLXK 2HYGD 2P5LC 3WTZA 2WTEA 1XGSA 5L3BA 4M9XA 1XSDA 2PFBA 4RGSA 1XD7A 2QYOA 3SHFA 4NHJA 4Q5SF 1R58A 2K7LA 3O2PE 1ZG1A 2OZ6A 3AAFA 1FC3A 4QWQA 4IRHA 1ONVA 3HTUA 3L7WA 4XRFA 3GZ6A 2LNBA 1OYWA 2ACJA 2K4JA 1KQ9A 1GHCA 4OIPF 2E7XA 4BH9A 2M1BA 2EFOA 1O3QA 2DLLA 3ERED 3GXOA 4L5IA 4AVPA 5LGNA 3GF2A 3M9AA 4M71A 2OA4A 4BHCA 5JI6A 2X4HA 5E20A 5LHHA 1HSTA 2KIFA 3GYHX 3FM5A 2H09A 1STZA 1LJ9A 4ESBA 2VODA 2Q0OA 1BM9A 4HX7A 3I59A 1SD6A 3FWEA 4MTDA 2L02A 1BN5A 5AIQA 3ZP5A 3ZN1A 1IZ1A 3PQKA 1UCRA 2C6YA 1XGMA 1J7KA 1FX7A 4GGGA 2ESNA 1ZAOA 6PAXA 2HZTA 4HW0A 4HQMA 1R1VA 4WXDA 2A6HF 2VBWA 1U5TA 2HFHA 1TBXA 3DEUA 1NHAA 2L3DA 2EWNA 2QENA 2P6TA 5HDGA 4ESFA 1D3YA 2GXGA 2L54A 3WG9A 2V6CA 1SMTA 3M8EA 3ZMVA 3LFKA 1LDKB 5EEHA 3RI4A 3W6JB 2MC3A 3KFWX 2A68F 2ZNZA 2P6SA 4G6DA 1OR7A 3WE3A 5DCMB 4I0BA 2FA5A 2H27A 2PQ8A 3IC7A 1K79A 4PCQA 1MKMA 4EJUA 3KP3A 3O6BB 1FSHA 2K86A 1W7PB 4N0BA 2BE5F 3U1DA 3DPLC 4KIGA 4WXCA 1MJ9A 1HKTA 2QVOA 2PI0A 1XN7A 2YX4A 1IXRC 1MD0A 2YSRA 2GXBA 5ED4A 1FYMA 2J5OA 1FBUA 1FPQA 3JSPA 3K1MA 5LRRA 2NNNA 2DPDA 1KQ0A 4LG0B 4D0PA 1HKSA 5DEQA 3K9TA 2ZFWA 4WX9A 1IXCA 3DFGA 5AONA 3F6OA 2MA3A 2DI3A 1ZLJA 1LDDA 2MBFA 2L4AA 5FO5A 3GEZA 3F72A 3KP7A 4RB2C 1HXDA 3QAHA 3TQNA 2KJBA 5BPDA 5A2QK 3BJOA 2VXZA 4HOBA 5D5UB 2XAJA 4CO8A 4UUVA 4U88A 1YYVA 4PDKA 2UWMA 3E6BA 1TQIA 1I1GA 2VBXA 3KZYA 3DPTA 3SQNA 4LK1F 4G8XA 5LGUA 1I1SA 4AWXB 4L9NA 2O0YA 4UV8A 4LB5A 1IN6A 4WK8F 2D45A 2UXNA 4IPAA 2W85A 4M74A 4A0YA 3CLOA 1H0MA 5HS9A 4I7HA 1C0WA 2STTA 3ELKA 3LA3A 5HLHA 5JHUA 2NAZA 2LDUA 1Q1HA 2V79A 4I2OA 3E6DA 5FGMA 2MLGA 2XAQA 5TRDA 3CDHA 4FX4A 1U8RA 1UHMA 1YW7A 4YIIA 1UHWA 4EGYA 1O3SA 1JHHA 1ZRCA 5DCMA 3JSOA 1BBYA 3KZZA 3F22A 2G7HA 4ZH4F 3ECOA 3ZQ7A 1UB9A 2EV6A 5L3CA 4B8XA 1T6SA 3HSFA 2EJRA 4KMUX 5A2QZ 5K5RA 3N97A 3ML6A 1J59A 3ZMZA 4OIQF 3FM3A 1F9NA 4LJZF 1HSJA 1ZYRF 2BV6A 2DK5A 5DUKA 2Q2EA 4HZFA 5LEKA 2HWVA 1P4AA 5CVUA 3M8FA 3LAPA 4KIBA 2CG4A 4XBFA 2EFWA 2V9VA 5HS8A 1P4WA 1GVJA 1YG2A 3O3KA 1HQCA 4ZYEA 3SZPA 5J8CA 2DTRA 2E7WA 4OIRF 4DQ2A 1S8NA 1ZN2A 4IRIA 4L5JA 3R61A 1Z7UA 2FNPA 1BI3A 2O6GE 2OAZA 4ENJA 1ZG3A 2F2EA 4I01A 2E1CA 4HF1A 3WGGA 4IHSA 2GZWA 2H94A 5LRSA 3QRFF 3SFZA 3CO7C 2LSOA 1W7PD 4HX8A 3IRQA 1B1BA 3TOBA 3KEOA 1U2WA 4AIKA 2J5PA 1R1UA 1FT9A 4GYIA 2DK8A 5CVIA 2K4BA 3L00A 1ZHFA 3F8NA 1WKMA 2Z3YA 1ZGAA 3JTGA 4HX4A 1GXPA 2YX7A 1QO0D 3IWFA 3F8CA 3CJNA 2XAGA 1LQ1A 1QPMA 1T0FA 3FXUA 3R6SA 1XDUA 2FE3A 1P92A 2CGPA 3K1NA 3T0YA 3F23A 3DP7A 3BP8A 4KICA 2ADUA 2A3SA 4P9FA 4G6QA 4JBAA 3HRMA 1U5TC 3RKXA 1F4KA 3ZMDA 2FXAA 3LA2A 5ICFA 1Z6RA 1XMAA 4EJOA 4OMZA 3QU3A 2V1XA 4IHTA 2F5FA 2WC2A 3EYIA 3MFKA 2FSWA 3Q5FA 1YFHA 1I5ZA 3HTSB 1LEBA 1USSA 2HEOA 2QZ8A 3MEXA 3IRRA 1RIOH 1LVAA 2IRFG 1O7LA 1CF7B 4CHUA 2IW5A 3EUHA 4WWCA 4L0YB 4BHBA 3FZVA 3W6KB 1R00A 4RB0A 2L4MA 5D5VB 1S3JA 4Y13A 1ZH5A 1KYWA 3GO5A 2VT2A 3C1DA 3V8JA 2VOPA 3C3WA 2DQLA 2EFPA 3K1PA 4G7ZF 4EJWA 3BY6A 1FSEA 1KGSA 3C7JA 1REPC 5IT9K 4MQ9F 4UVCA 3RPQA 3I0TA 3CUQB 3SZTA 5LBQA 2VBYA 2IT0A 3I71A 1JGSA 4DNCA 5FFXA 2EFNA 1O3TA 1HW2A 3L2CA 1B4AA 3VOEA 3GFLA 2DO7A 4IXAA 3JW4A 4KNYA 2GIVA 1H9TA 1DPUA 1J2XA 3GVAA 5E18F 3TDUC 1D8JA 4I09A 4A0ZA 2HGCA 4U7DA 3U2RA 1KU2A 1T98A 2V1DA 2W25A 1LB2A 4KN7X 4ZZLA 2HDCA 4ZYGA 3HRUA 3BDDA 2FBKA 4BYYA 4CXFA 3G3ZA 4G7HF 1TLHB 3M7GA 3ZPLA 1KU3A 4KA4A 3K2ZA 1W5SA 1HBXG 5FD6A 2IA1A 4Z2YA 3ABUA 4GO1A 5LLQA 5D5XB 5IT9Z 1QNTA 2P7VB 2L01A 2DFIA 4UHTA 3REOA 4NQWA 1KYZA 2FRHA 2PMHA 5K5QA 1USTA 3TKYA 3FXQA 3V7CA 2HTSA 4HLXA 1CF7A 3KETA 1S6LA 4BAYA 3QOPA 2OZUA 3RPUA 2ZMEB 3QP6A 4CGZA 1SAXA 1WQ2A 5CJ9A 4NB5A 2QWWA 2KIMA 3I64A 1T38A 1HKQA 1IRGA 3ABTA 5DUIA 4P9UA 3GX4X 2XAFA 4AIJA 3HYIA 3ROUA 1PDNC 4HA8A 3R60A 1U3EM 2HKXA 3FF5A 4XLPF 3GFIA 2ISZA 1UFMA 3TDZC 3WU0A 1BC7C 1Z6TA 3VB2A 4CYDA 2XAHA 1ZRDA 2ZNYA 5BMZA 1QZYA 4XSXF 1FBSA 2Z99A 3NQOA 4R79A 1DP7P 3TOAA 2YPRA 1IN5A 1B59A 1G4DA 5ILVA 5JR3A 2GA2A 3F8FA 5TJJA 2NRAC 1FOKA 2WWYA 4MQVA 2NNYA 3WTYC 3G73A 2DT5A 1YW8A 2OU2A 2P4WA 3BJAA 4I98B 3V8KA 1RUOA 4N9IA 4ETSA 3LWFA 2M30A 5CVVA 3IKVA 4A12A 4HDUA 2JZYA 3FMQA 1Z1DA 3ULQB 1P6RA 5JFRA 2LF8A 1B9MA 3E97A 4U0VA 4M6XA 1RI7A 5ICEA 3WGHA 4LFUA 1P2FA 4G94A 3K69A 3FHZA 3TO6A 5JVTA 1XDSA 3M1EA 2M8EA 2DBBA 2ZBKA 2W84A 1U6GA 1YW9A 3GWZA 3C18A 4EM1A 3DXJF 4OINF 3MZHA 4R8HA 1YTYA 3MQ0A 1MZBA 4OMYA 5HLGA 1DPRA 4ZYDA 1MJAA 1SFUA 3LQRA 5DV5A 2EA4A 2HTJA 3KCCA 5D8KB 1LNWA 3R0AA 4P96A 2H6CA 3VODA 3DKWA 2ZJ2A 4ASNA 1O7FA 3VEPA 4EJVA 2JSCA 1FZPB 3HOSA 4U0WA 2BBYA 1R22A 3HSRA 4GCVA 2XHKA 2VC1A 3BROA 1R5HA 1W7PA 5F6FA 2NYXA 2XIGA 4M72A 3ECHA 4HV6A 4EM2A 2RQPA 4YFNF 2GWRA 2RN7A 5CVRA 2FBIA 3GLXA 3RYRA 2Y0MA 1PUEE 4KT5C 3B73A 1T39A 3FMRA 1G3TA 3TO7A 1BIBA 2F5EA 3GW2A 4YG2F 5E17F 5L3EA 2HYFA 1TNTA 2JTVA 2O3FA 1S29A 2XV4S 5K5OA 1G6NA 3BJ6A 4Y15A 3KLOA 4EV0A 4LG0A 4EM0B 4CZZA 5J8FA 4I02A 5HS7A 1EH6A 5CVJA 2FOKA 4L9TA 1IUYA 1EH8A 5AIPA 1XGOA 1QBJA 2KJCA 2DU9A 2W57A 1V3FA 5D6EA 3HHHA 4RB3C 3QU6A 3KP2A 5FFZA 3HOTA 4HLYA 1TTYA 3JTHA 4BXUA 5KK1A 1OYIA 2PEXA 1OKRA 4A5MA 2P5KA 3GFJA 2XVCA 2V1UA 3RKWA 3KE2A 2JRTA 3IKTA 3HHGA 3EETA 1KU7A 3WTUC 3COAC 4LGWA 4RS8A 3CUOA 3WTTC 4FHTA 1D8KA 2P8TA 2A5YB 1WI9A 4RGRA 1DUXC 2VC0A 2KKOA 4O6JA 1ZLKA 1LEAA 2QUFA 1ON1A 1BOAA 3V8LA 2FEZA 3ZMUA 5HVQC 1I6XA 5H20A 2MLKA 4QLCU 3B02A 2DAOA 1R5GA 2CWEA 4ESJA 2RVCA 1ZG5A 1X3UA 2O03A 4PZJA 4EGZA 1PP7U 3F8MA 3OV8A 3DQVC 1D5VA 1OPCA 1F1ZA 3RIRA 5EEGA 1G3WA 2ZCWA 2GQQA 2CW0F 3J81Z 3HIFA 4IJAA 1L3LA 2VBZA 1KQ8A 2HQNA 4ON0A 4LK0F 3N4MA 3P9IA 2R7FA 1DDNA 1OMIA 2FNAA 1Z9CA 1G3SA 4MNUA 5E8IA 3E5XA 3IHUA 4BQAA 3V4GA 2D1VA 3DV8A 2RGVA 1IW7F 2VE9A 1BJAA 4A2UA 5DD4A 4S04A 1E17A 4LB6B 4MEYF 5LEJA 3V7SA 5FD5A 2Z5UA 1I27A 3U9GA 4EMSA 5L3DA 4ZZDA 4U0YA 2QBYB 4FX0A 2EV0A 2Z33A 3R0JA 1R36A 3CUQC 4F7ZA 1JXSA 1S7OA 4PGHA 3IWZA 1WRJA 1R1TA 1QQIA 4KUMA 3WU1B 2UZKA 3H92A 3TO9A 2PN6A 1Z05A 3SXYA 5H6RA 5H6QA 2EV5A 3I58A 2B0LA 1G3YA 1L0OC 5F64A 3HUGA 5FB2A 2QLZA 2P5VA 1ZGJA 3F8BA 1YIOA 4LLNA 1FY7A 2QQ9A 1W4MA 2D2WA 3MWMA 2JPBA 2Y48A 1SD4A 3KP6A 1FP2A 2STWA 3EDPA 2CYYA 3D0SA 1SFEA 5L3GA 2BEOA 1XSXA 2F5CA 3DF8A 3BPXA 3TGNA 2D1HA 4RAZA 1HW1A 1IF1A 5BS6A 1BI2A 3HRTA 4CICA 4HBLA 2P7CB 1P4XA 1EV7A 4AIHA 1MDMB 2CQKA 4HV5A 4LMYA 5HOOA 3HRSA 2ZKZA 4XSZF 3GUDA 2G9WA 2YU3A 4EJTA 2Z9OA 5F1RA 3P7NA 2ETHA 2CFXA 2IA0A 1IN4A 2GAUA 4BNCA 5ILSA 1FYLA 4YFXF 3E6CC 4UVBA 1H9GA 5DYMA 2A07F 4IRGA 3MCZA 1O3RA 1MJBA 2OQRA 1IN7A 3FMSA 2A61A 1ZRFA 3V7RA 4ENNA 3VFZA 1ON2A 3L09A 1R23A 5FLXZ 4L18B 5ERIA 4A0XA 2VE8A 1J75A 1IRFA 2DQRA 1A04A 2R7DA 3BWGA 2VOOA 1U78A 1TQMA 3NRVA 1K7AA 3E6MA 2VT3A 5HDNA 1WWXA 3RJPA 3EQLF 1QGPA 1AOYA 3MZYA 1K6OA 3RTRA 2QQAA 4IVNA 2KIUA 4B09A 2RDPA 3E5UA 2PG4A 1BC8C 5D5WB 1XSVA 3P9CA 2LF7A 2Y75A 1YQAA 2QBYA 1FLIA 4M9ZA 4L0ZB 5HLIA 2EB7A 1SD7A 2PLYA 4M9SA 4M73A 3CUQA 2PMUA 3EYYA 3J80K 4TV7A 1SD5A 1OYYA 3GZ5A 4HYEA 5J6XA 1R7JA 1ULYA 4LD5A 2IPQX 4IF4A 4R1HA 3CTAA 1V4RA 4KN4X 3JAMK 4FT8A 2GA1A 1AWCA 5D4RA 5DDGA 2M5WA 4WXHA 4XLNF 4U7BA 3F3XA 5E1ZB 2RNJA 1QZZA 3HSEA 1BI0A 2HQRA 3L9FA 1GXQA 3WTWC 2FU4A 3BPVA 4RB1A 4LLGF 3KLNA 3KEQA 1ODDA 3FX3A 3F6VA 4HAMA 2MD5A 3H3ZA 4UXNA 4YFKF 2EK5A 3WODF 1J9IA 3T8TA 1MDMA 2W24A 2R3SA 2JPCA 4M6YA 5E8GA 1ZREA 2H6BA 4KYWA 4OU0A 3LSTA 1PP8F 2OBPA 4MHGA 1K78B 3E3VA 3I54A 2KRFA 5ICCA 3R4KA 1YLFA 4MEXF 2OQGA 4Y17A 2XASA 1Z91A 2XKPA 3I4PA 2O8XA 5D6FA 3T8RA 2PBIA 4LLLA 2IJLA 1E2XA 3WGIA 1TQPA 4HDVA 2F5DA 5ILUA 5DCFA 3J80Z 5L3FA 4UVAA 5BPIA 1VTNC 4Q47A 2JT1A 2XRNA 3JAMZ 4S05A 4CDGA 4EVIA 3ISPA 2ESHA 1B6AA 5CLSA 3WTSC 2M45A 1KU9A 4JK1X 1XMKA 4KIFA 1JE8A 4RGXA 2ZMEA 2X0LA 4OOIA 5BOXA 3K0LA 5HDKA 4RGUA 2FQ3A 3I5UA 2DPUA 1ZARA 4HF0A 3BZ6A 5E1XA 4ENMA 3QP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GXO A;  3LA7 A;  3RKY A;  3ZMS A;  4AD9 A;  4KFC A;  3E5Q A;  1MGT A;  3I53 A;  2FMY A;  2BGC A;  1BIA A;  4ENK A;  2AXL A;  4K2E A;  2E1N A;  3PFI A;  2HKO A;  3BOQ A;  4G9Y A;  5D8L B;  4BHP A;  2PJP A;  1BI1 A;  3KP4 A;  1Y0U A;  3OOP A;  4WF2 A;  4OIO F;  1RNL A;  3S2W A;  5D4S A;  1RUN A;  3J81 K;  1YS6 A;  3J7A O;  2M87 A;  5CYV A;  4O5V A;  4PGG A;  1XCV A;  1S7A A;  4I0A A;  2VN2 A;  1EH7 A;  2A69 F;  4P5O A;  2IP2 A;  2RC4 A;  2VON A;  3F21 A;  4A6D A;  5KVR A;  1F5T A;  5LHI A;  1J5Y A;  5LGT A;  4H0E A;  2MH9 A;  2K02 A;  3LAJ A;  4UNO A;  2G7U A;  2EA2 A;  4L9V A;  4A5N A;  1LDJ A;  5ICG A;  1FP1 D;  2ZO4 A;  1B9N A;  1CGP A;  4L9J A;  5BQT A;  4MTE A;  1YS7 A;  2TDX A;  1TNS A;  4JQF A;  2Q8K A;  4ZYH A;  2BYV E;  2MH2 A;  3QPH A;  1WSU A;  3D5L A;  2ELH A;  1K78 A;  2O61 A;  3T1B A;  2FML A;  2CO5 A;  5K1Y A;  2IA2 A;  3I59 B;  3Q9S A;  3WE2 A;  1RZ4 A;  2HS5 A;  1SFX A;  3RDI A;  1XB4 A;  1KA8 A;  4N9H A;  2K27 A;  3CO6 C;  2IVM A;  3ZMT A;  4MGR A;  2EFQ A;  4WCG A;  3MAJ A;  2XGX A;  3Q9V A;  3ZN0 A;  1T2K A;  3LQQ A;  3WTX C;  3P9K A;  3WTV C;  1XCB A;  1HW5 A;  2WV0 A;  1IN8 A;  4RAY A;  3FXR A;  2A6E F;  4P55 A;  2RKH A;  2FF4 A;  2DW4 A;  1U5T B;  2HR3 A;  4KDP A;  4G7O F;  2LKP A;  5DD8 A;  5IT3 A;  3NEU A;  4Q4Z F;  3H3U A;  3QPT A;  4HQE A;  2XRO A;  1FBQ A;  2ZXJ A;  4Q48 A;  1IXS B;  4KMF A;  1TW3 A;  2XKO A;  1FWZ A;  2HOE A;  2OD5 A;  2COM A;  2UXX A;  1TW2 A;  2AS5 F;  1YO5 C;  2NS0 A;  4E70 A;  2QQB A;  2XUB A;  2FBH A;  3T5X A;  4HF2 A;  2CSO A;  1SMY F;  5LHG A;  4EQQ A;  1O57 A;  3GFM A;  1FNN A;  2ISY A;  4YIF A;  1JHF A;  1FYK A;  2QM3 A;  4GYG A;  3IL2 A;  4UV9 A;  4O3M A;  1J0R A;  4A6E A;  1XGN A;  3PQJ A;  2RV8 A;  1IAW A;  3RYP A;  2YR2 A;  5E1W A;  3KP5 A;  1W5T A;  5FLX K;  2HYG D;  2P5L C;  3WTZ A;  2WTE A;  1XGS A;  5L3B A;  4M9X A;  1XSD A;  2PFB A;  4RGS A;  1XD7 A;  2QYO A;  3SHF A;  4NHJ A;  4Q5S F;  1R58 A;  2K7L A;  3O2P E;  1ZG1 A;  2OZ6 A;  3AAF A;  1FC3 A;  4QWQ A;  4IRH A;  1ONV A;  3HTU A;  3L7W A;  4XRF A;  3GZ6 A;  2LNB A;  1OYW A;  2ACJ A;  2K4J A;  1KQ9 A;  1GHC A;  4OIP F;  2E7X A;  4BH9 A;  2M1B A;  2EFO A;  1O3Q A;  2DLL A;  3ERE D;  3GXO A;  4L5I A;  4AVP A;  5LGN A;  3GF2 A;  3M9A A;  4M71 A;  2OA4 A;  4BHC A;  5JI6 A;  2X4H A;  5E20 A;  5LHH A;  1HST A;  2KIF A;  3GYH X;  3FM5 A;  2H09 A;  1STZ A;  1LJ9 A;  4ESB A;  2VOD A;  2Q0O A;  1BM9 A;  4HX7 A;  3I59 A;  1SD6 A;  3FWE A;  4MTD A;  2L02 A;  1BN5 A;  5AIQ A;  3ZP5 A;  3ZN1 A;  1IZ1 A;  3PQK A;  1UCR A;  2C6Y A;  1XGM A;  1J7K A;  1FX7 A;  4GGG A;  2ESN A;  1ZAO A;  6PAX A;  2HZT A;  4HW0 A;  4HQM A;  1R1V A;  4WXD A;  2A6H F;  2VBW A;  1U5T A;  2HFH A;  1TBX A;  3DEU A;  1NHA A;  2L3D A;  2EWN A;  2QEN A;  2P6T A;  5HDG A;  4ESF A;  1D3Y A;  2GXG A;  2L54 A;  3WG9 A;  2V6C A;  1SMT A;  3M8E A;  3ZMV A;  3LFK A;  1LDK B;  5EEH A;  3RI4 A;  3W6J B;  2MC3 A;  3KFW X;  2A68 F;  2ZNZ A;  2P6S A;  4G6D A;  1OR7 A;  3WE3 A;  5DCM B;  4I0B A;  2FA5 A;  2H27 A;  2PQ8 A;  3IC7 A;  1K79 A;  4PCQ A;  1MKM A;  4EJU A;  3KP3 A;  3O6B B;  1FSH A;  2K86 A;  1W7P B;  4N0B A;  2BE5 F;  3U1D A;  3DPL C;  4KIG A;  4WXC A;  1MJ9 A;  1HKT A;  2QVO A;  2PI0 A;  1XN7 A;  2YX4 A;  1IXR C;  1MD0 A;  2YSR A;  2GXB A;  5ED4 A;  1FYM A;  2J5O A;  1FBU A;  1FPQ A;  3JSP A;  3K1M A;  5LRR A;  2NNN A;  2DPD A;  1KQ0 A;  4LG0 B;  4D0P A;  1HKS A;  5DEQ A;  3K9T A;  2ZFW A;  4WX9 A;  1IXC A;  3DFG A;  5AON A;  3F6O A;  2MA3 A;  2DI3 A;  1ZLJ A;  1LDD A;  2MBF A;  2L4A A;  5FO5 A;  3GEZ A;  3F72 A;  3KP7 A;  4RB2 C;  1HXD A;  3QAH A;  3TQN A;  2KJB A;  5BPD A;  5A2Q K;  3BJO A;  2VXZ A;  4HOB A;  5D5U B;  2XAJ A;  4CO8 A;  4UUV A;  4U88 A;  1YYV A;  4PDK A;  2UWM A;  3E6B A;  1TQI A;  1I1G A;  2VBX A;  3KZY A;  3DPT A;  3SQN A;  4LK1 F;  4G8X A;  5LGU A;  1I1S A;  4AWX B;  4L9N A;  2O0Y A;  4UV8 A;  4LB5 A;  1IN6 A;  4WK8 F;  2D45 A;  2UXN A;  4IPA A;  2W85 A;  4M74 A;  4A0Y A;  3CLO A;  1H0M A;  5HS9 A;  4I7H A;  1C0W A;  2STT A;  3ELK A;  3LA3 A;  5HLH A;  5JHU A;  2NAZ A;  2LDU A;  1Q1H A;  2V79 A;  4I2O A;  3E6D A;  5FGM A;  2MLG A;  2XAQ A;  5TRD A;  3CDH A;  4FX4 A;  1U8R A;  1UHM A;  1YW7 A;  4YII A;  1UHW A;  4EGY A;  1O3S A;  1JHH A;  1ZRC A;  5DCM A;  3JSO A;  1BBY A;  3KZZ A;  3F22 A;  2G7H A;  4ZH4 F;  3ECO A;  3ZQ7 A;  1UB9 A;  2EV6 A;  5L3C A;  4B8X A;  1T6S A;  3HSF A;  2EJR A;  4KMU X;  5A2Q Z;  5K5R A;  3N97 A;  3ML6 A;  1J59 A;  3ZMZ A;  4OIQ F;  3FM3 A;  1F9N A;  4LJZ F;  1HSJ A;  1ZYR F;  2BV6 A;  2DK5 A;  5DUK A;  2Q2E A;  4HZF A;  5LEK A;  2HWV A;  1P4A A;  5CVU A;  3M8F A;  3LAP A;  4KIB A;  2CG4 A;  4XBF A;  2EFW A;  2V9V A;  5HS8 A;  1P4W A;  1GVJ A;  1YG2 A;  3O3K A;  1HQC A;  4ZYE A;  3SZP A;  5J8C A;  2DTR A;  2E7W A;  4OIR F;  4DQ2 A;  1S8N A;  1ZN2 A;  4IRI A;  4L5J A;  3R61 A;  1Z7U A;  2FNP A;  1BI3 A;  2O6G E;  2OAZ A;  4ENJ A;  1ZG3 A;  2F2E A;  4I01 A;  2E1C A;  4HF1 A;  3WGG A;  4IHS A;  2GZW A;  2H94 A;  5LRS A;  3QRF F;  3SFZ A;  3CO7 C;  2LSO A;  1W7P D;  4HX8 A;  3IRQ A;  1B1B A;  3TOB A;  3KEO A;  1U2W A;  4AIK A;  2J5P A;  1R1U A;  1FT9 A;  4GYI A;  2DK8 A;  5CVI A;  2K4B A;  3L00 A;  1ZHF A;  3F8N A;  1WKM A;  2Z3Y A;  1ZGA A;  3JTG A;  4HX4 A;  1GXP A;  2YX7 A;  1QO0 D;  3IWF A;  3F8C A;  3CJN A;  2XAG A;  1LQ1 A;  1QPM A;  1T0F A;  3FXU A;  3R6S A;  1XDU A;  2FE3 A;  1P92 A;  2CGP A;  3K1N A;  3T0Y A;  3F23 A;  3DP7 A;  3BP8 A;  4KIC A;  2ADU A;  2A3S A;  4P9F A;  4G6Q A;  4JBA A;  3HRM A;  1U5T C;  3RKX A;  1F4K A;  3ZMD A;  2FXA A;  3LA2 A;  5ICF A;  1Z6R A;  1XMA A;  4EJO A;  4OMZ A;  3QU3 A;  2V1X A;  4IHT A;  2F5F A;  2WC2 A;  3EYI A;  3MFK A;  2FSW A;  3Q5F A;  1YFH A;  1I5Z A;  3HTS B;  1LEB A;  1USS A;  2HEO A;  2QZ8 A;  3MEX A;  3IRR A;  1RIO H;  1LVA A;  2IRF G;  1O7L A;  1CF7 B;  4CHU A;  2IW5 A;  3EUH A;  4WWC A;  4L0Y B;  4BHB A;  3FZV A;  3W6K B;  1R00 A;  4RB0 A;  2L4M A;  5D5V B;  1S3J A;  4Y13 A;  1ZH5 A;  1KYW A;  3GO5 A;  2VT2 A;  3C1D A;  3V8J A;  2VOP A;  3C3W A;  2DQL A;  2EFP A;  3K1P A;  4G7Z F;  4EJW A;  3BY6 A;  1FSE A;  1KGS A;  3C7J A;  1REP C;  5IT9 K;  4MQ9 F;  4UVC A;  3RPQ A;  3I0T A;  3CUQ B;  3SZT A;  5LBQ A;  2VBY A;  2IT0 A;  3I71 A;  1JGS A;  4DNC A;  5FFX A;  2EFN A;  1O3T A;  1HW2 A;  3L2C A;  1B4A A;  3VOE A;  3GFL A;  2DO7 A;  4IXA A;  3JW4 A;  4KNY A;  2GIV A;  1H9T A;  1DPU A;  1J2X A;  3GVA A;  5E18 F;  3TDU C;  1D8J A;  4I09 A;  4A0Z A;  2HGC A;  4U7D A;  3U2R A;  1KU2 A;  1T98 A;  2V1D A;  2W25 A;  1LB2 A;  4KN7 X;  4ZZL A;  2HDC A;  4ZYG A;  3HRU A;  3BDD A;  2FBK A;  4BYY A;  4CXF A;  3G3Z A;  4G7H F;  1TLH B;  3M7G A;  3ZPL A;  1KU3 A;  4KA4 A;  3K2Z A;  1W5S A;  1HBX G;  5FD6 A;  2IA1 A;  4Z2Y A;  3ABU A;  4GO1 A;  5LLQ A;  5D5X B;  5IT9 Z;  1QNT A;  2P7V B;  2L01 A;  2DFI A;  4UHT A;  3REO A;  4NQW A;  1KYZ A;  2FRH A;  2PMH A;  5K5Q A;  1UST A;  3TKY A;  3FXQ A;  3V7C A;  2HTS A;  4HLX A;  1CF7 A;  3KET A;  1S6L A;  4BAY A;  3QOP A;  2OZU A;  3RPU A;  2ZME B;  3QP6 A;  4CGZ A;  1SAX A;  1WQ2 A;  5CJ9 A;  4NB5 A;  2QWW A;  2KIM A;  3I64 A;  1T38 A;  1HKQ A;  1IRG A;  3ABT A;  5DUI A;  4P9U A;  3GX4 X;  2XAF A;  4AIJ A;  3HYI A;  3ROU A;  1PDN C;  4HA8 A;  3R60 A;  1U3E M;  2HKX A;  3FF5 A;  4XLP F;  3GFI A;  2ISZ A;  1UFM A;  3TDZ C;  3WU0 A;  1BC7 C;  1Z6T A;  3VB2 A;  4CYD A;  2XAH A;  1ZRD A;  2ZNY A;  5BMZ A;  1QZY A;  4XSX F;  1FBS A;  2Z99 A;  3NQO A;  4R79 A;  1DP7 P;  3TOA A;  2YPR A;  1IN5 A;  1B59 A;  1G4D A;  5ILV A;  5JR3 A;  2GA2 A;  3F8F A;  5TJJ A;  2NRA C;  1FOK A;  2WWY A;  4MQV A;  2NNY A;  3WTY C;  3G73 A;  2DT5 A;  1YW8 A;  2OU2 A;  2P4W A;  3BJA A;  4I98 B;  3V8K A;  1RUO A;  4N9I A;  4ETS A;  3LWF A;  2M30 A;  5CVV A;  3IKV A;  4A12 A;  4HDU A;  2JZY A;  3FMQ A;  1Z1D A;  3ULQ B;  1P6R A;  5JFR A;  2LF8 A;  1B9M A;  3E97 A;  4U0V A;  4M6X A;  1RI7 A;  5ICE A;  3WGH A;  4LFU A;  1P2F A;  4G94 A;  3K69 A;  3FHZ A;  3TO6 A;  5JVT A;  1XDS A;  3M1E A;  2M8E A;  2DBB A;  2ZBK A;  2W84 A;  1U6G A;  1YW9 A;  3GWZ A;  3C18 A;  4EM1 A;  3DXJ F;  4OIN F;  3MZH A;  4R8H A;  1YTY A;  3MQ0 A;  1MZB A;  4OMY A;  5HLG A;  1DPR A;  4ZYD A;  1MJA A;  1SFU A;  3LQR A;  5DV5 A;  2EA4 A;  2HTJ A;  3KCC A;  5D8K B;  1LNW A;  3R0A A;  4P96 A;  2H6C A;  3VOD A;  3DKW A;  2ZJ2 A;  4ASN A;  1O7F A;  3VEP A;  4EJV A;  2JSC A;  1FZP B;  3HOS A;  4U0W A;  2BBY A;  1R22 A;  3HSR A;  4GCV A;  2XHK A;  2VC1 A;  3BRO A;  1R5H A;  1W7P A;  5F6F A;  2NYX A;  2XIG A;  4M72 A;  3ECH A;  4HV6 A;  4EM2 A;  2RQP A;  4YFN F;  2GWR A;  2RN7 A;  5CVR A;  2FBI A;  3GLX A;  3RYR A;  2Y0M A;  1PUE E;  4KT5 C;  3B73 A;  1T39 A;  3FMR A;  1G3T A;  3TO7 A;  1BIB A;  2F5E A;  3GW2 A;  4YG2 F;  5E17 F;  5L3E A;  2HYF A;  1TNT A;  2JTV A;  2O3F A;  1S29 A;  2XV4 S;  5K5O A;  1G6N A;  3BJ6 A;  4Y15 A;  3KLO A;  4EV0 A;  4LG0 A;  4EM0 B;  4CZZ A;  5J8F A;  4I02 A;  5HS7 A;  1EH6 A;  5CVJ A;  2FOK A;  4L9T A;  1IUY A;  1EH8 A;  5AIP A;  1XGO A;  1QBJ A;  2KJC A;  2DU9 A;  2W57 A;  1V3F A;  5D6E A;  3HHH A;  4RB3 C;  3QU6 A;  3KP2 A;  5FFZ A;  3HOT A;  4HLY A;  1TTY A;  3JTH A;  4BXU A;  5KK1 A;  1OYI A;  2PEX A;  1OKR A;  4A5M A;  2P5K A;  3GFJ A;  2XVC A;  2V1U A;  3RKW A;  3KE2 A;  2JRT A;  3IKT A;  3HHG A;  3EET A;  1KU7 A;  3WTU C;  3COA C;  4LGW A;  4RS8 A;  3CUO A;  3WTT C;  4FHT A;  1D8K A;  2P8T A;  2A5Y B;  1WI9 A;  4RGR A;  1DUX C;  2VC0 A;  2KKO A;  4O6J A;  1ZLK A;  1LEA A;  2QUF A;  1ON1 A;  1BOA A;  3V8L A;  2FEZ A;  3ZMU A;  5HVQ C;  1I6X A;  5H20 A;  2MLK A;  4QLC U;  3B02 A;  2DAO A;  1R5G A;  2CWE A;  4ESJ A;  2RVC A;  1ZG5 A;  1X3U A;  2O03 A;  4PZJ A;  4EGZ A;  1PP7 U;  3F8M A;  3OV8 A;  3DQV C;  1D5V A;  1OPC A;  1F1Z A;  3RIR A;  5EEG A;  1G3W A;  2ZCW A;  2GQQ A;  2CW0 F;  3J81 Z;  3HIF A;  4IJA A;  1L3L A;  2VBZ A;  1KQ8 A;  2HQN A;  4ON0 A;  4LK0 F;  3N4M A;  3P9I A;  2R7F A;  1DDN A;  1OMI A;  2FNA A;  1Z9C A;  1G3S A;  4MNU A;  5E8I A;  3E5X A;  3IHU A;  4BQA A;  3V4G A;  2D1V A;  3DV8 A;  2RGV A;  1IW7 F;  2VE9 A;  1BJA A;  4A2U A;  5DD4 A;  4S04 A;  1E17 A;  4LB6 B;  4MEY F;  5LEJ A;  3V7S A;  5FD5 A;  2Z5U A;  1I27 A;  3U9G A;  4EMS A;  5L3D A;  4ZZD A;  4U0Y A;  2QBY B;  4FX0 A;  2EV0 A;  2Z33 A;  3R0J A;  1R36 A;  3CUQ C;  4F7Z A;  1JXS A;  1S7O A;  4PGH A;  3IWZ A;  1WRJ A;  1R1T A;  1QQI A;  4KUM A;  3WU1 B;  2UZK A;  3H92 A;  3TO9 A;  2PN6 A;  1Z05 A;  3SXY A;  5H6R A;  5H6Q A;  2EV5 A;  3I58 A;  2B0L A;  1G3Y A;  1L0O C;  5F64 A;  3HUG A;  5FB2 A;  2QLZ A;  2P5V A;  1ZGJ A;  3F8B A;  1YIO A;  4LLN A;  1FY7 A;  2QQ9 A;  1W4M A;  2D2W A;  3MWM A;  2JPB A;  2Y48 A;  1SD4 A;  3KP6 A;  1FP2 A;  2STW A;  3EDP A;  2CYY A;  3D0S A;  1SFE A;  5L3G A;  2BEO A;  1XSX A;  2F5C A;  3DF8 A;  3BPX A;  3TGN A;  2D1H A;  4RAZ A;  1HW1 A;  1IF1 A;  5BS6 A;  1BI2 A;  3HRT A;  4CIC A;  4HBL A;  2P7C B;  1P4X A;  1EV7 A;  4AIH A;  1MDM B;  2CQK A;  4HV5 A;  4LMY A;  5HOO A;  3HRS A;  2ZKZ A;  4XSZ F;  3GUD A;  2G9W A;  2YU3 A;  4EJT A;  2Z9O A;  5F1R A;  3P7N A;  2ETH A;  2CFX A;  2IA0 A;  1IN4 A;  2GAU A;  4BNC A;  5ILS A;  1FYL A;  4YFX F;  3E6C C;  4UVB A;  1H9G A;  5DYM A;  2A07 F;  4IRG A;  3MCZ A;  1O3R A;  1MJB A;  2OQR A;  1IN7 A;  3FMS A;  2A61 A;  1ZRF A;  3V7R A;  4ENN A;  3VFZ A;  1ON2 A;  3L09 A;  1R23 A;  5FLX Z;  4L18 B;  5ERI A;  4A0X A;  2VE8 A;  1J75 A;  1IRF A;  2DQR A;  1A04 A;  2R7D A;  3BWG A;  2VOO A;  1U78 A;  1TQM A;  3NRV A;  1K7A A;  3E6M A;  2VT3 A;  5HDN A;  1WWX A;  3RJP A;  3EQL F;  1QGP A;  1AOY A;  3MZY A;  1K6O A;  3RTR A;  2QQA A;  4IVN A;  2KIU A;  4B09 A;  2RDP A;  3E5U A;  2PG4 A;  1BC8 C;  5D5W B;  1XSV A;  3P9C A;  2LF7 A;  2Y75 A;  1YQA A;  2QBY A;  1FLI A;  4M9Z A;  4L0Z B;  5HLI A;  2EB7 A;  1SD7 A;  2PLY A;  4M9S A;  4M73 A;  3CUQ A;  2PMU A;  3EYY A;  3J80 K;  4TV7 A;  1SD5 A;  1OYY A;  3GZ5 A;  4HYE A;  5J6X A;  1R7J A;  1ULY A;  4LD5 A;  2IPQ X;  4IF4 A;  4R1H A;  3CTA A;  1V4R A;  4KN4 X;  3JAM K;  4FT8 A;  2GA1 A;  1AWC A;  5D4R A;  5DDG A;  2M5W A;  4WXH A;  4XLN F;  4U7B A;  3F3X A;  5E1Z B;  2RNJ A;  1QZZ A;  3HSE A;  1BI0 A;  2HQR A;  3L9F A;  1GXQ A;  3WTW C;  2FU4 A;  3BPV A;  4RB1 A;  4LLG F;  3KLN A;  3KEQ A;  1ODD A;  3FX3 A;  3F6V A;  4HAM A;  2MD5 A;  3H3Z A;  4UXN A;  4YFK F;  2EK5 A;  3WOD F;  1J9I A;  3T8T A;  1MDM A;  2W24 A;  2R3S A;  2JPC A;  4M6Y A;  5E8G A;  1ZRE A;  2H6B A;  4KYW A;  4OU0 A;  3LST A;  1PP8 F;  2OBP A;  4MHG A;  1K78 B;  3E3V A;  3I54 A;  2KRF A;  5ICC A;  3R4K A;  1YLF A;  4MEX F;  2OQG A;  4Y17 A;  2XAS A;  1Z91 A;  2XKP A;  3I4P A;  2O8X A;  5D6F A;  3T8R A;  2PBI A;  4LLL A;  2IJL A;  1E2X A;  3WGI A;  1TQP A;  4HDV A;  2F5D A;  5ILU A;  5DCF A;  3J80 Z;  5L3F A;  4UVA A;  5BPI A;  1VTN C;  4Q47 A;  2JT1 A;  2XRN A;  3JAM Z;  4S05 A;  4CDG A;  4EVI A;  3ISP A;  2ESH A;  1B6A A;  5CLS A;  3WTS C;  2M45 A;  1KU9 A;  4JK1 X;  1XMK A;  4KIF A;  1JE8 A;  4RGX A;  2ZME A;  2X0L A;  4OOI A;  5BOX A;  3K0L A;  5HDK A;  4RGU A;  2FQ3 A;  3I5U A;  2DPU A;  1ZAR A;  4HF0 A;  3BZ6 A;  5E1X A;  4ENM A;  3QP5 A; 
#chains in the Genus database with same CATH topology
 4B47 A;  1WVR A;  1K6Y A;  4KJZ A;  4GXO A;  3ZQI A;  3LA7 A;  3RKY A;  3ZMS A;  4AD9 A;  4KFC A;  2K9Q A;  3L2Q A;  2CW8 A;  3TP0 A;  2M3A A;  4DOZ A;  3E5Q A;  1MGT A;  2LY9 A;  3I53 A;  4IO9 F;  2FMY A;  2BGC A;  2FX0 A;  5CKT A;  2K9L A;  1BIA A;  1OQY A;  1S7E A;  2MSY A;  4ENK A;  2AXL A;  4XKW A;  1WJB A;  4K2E A;  3FBN B;  5B66 C;  2R5Z B;  1OCO H;  2E1N A;  4M3B A;  4M6V A;  3PFI A;  2H8W A;  1RKW A;  2CUJ A;  2HKO A;  3BOQ A;  4G9Y A;  5D8L B;  2UV1 A;  3K6G A;  2DA4 A;  1RR7 A;  5IOY A;  4BHP A;  2PJP A;  2CV1 A;  2QSG X;  1BI1 A;  3KP4 A;  1I50 J;  1Y0U A;  2BOL A;  3OOP A;  4WF2 A;  5FKO A;  4OIO F;  1RNL A;  3S2W A;  5LFA A;  1X1C A;  4QIW N;  3SJM A;  5D4S A;  1RUN A;  3J81 K;  1YS6 A;  3J7A O;  1JJ8 C;  2LP0 A;  2DOA A;  3BTJ A;  2M87 A;  3O8G A;  5CYV A;  4BQO A;  4O5V A;  2LRE A;  5M5Y J;  4PGG A;  5E3O A;  1XCV A;  1S7A A;  3GCM A;  4I0A A;  2VN2 A;  1EH7 A;  2A69 F;  4P5O A;  1NK3 P;  2IP2 A;  3JCU C;  2RC4 A;  2VON A;  3F21 A;  4A6D A;  5KVR A;  2R0Q C;  2PJR A;  1YIT I;  2BHZ A;  1F5T A;  5LHI A;  3DBH B;  1J5Y A;  5LGT A;  4H0E A;  2E2J J;  2MH9 A;  2K02 A;  3PL8 A;  2WBM A;  3LAJ A;  1BR2 A;  2R4G A;  4UNO A;  2G7U A;  2EA2 A;  4L9V A;  4A5N A;  3BTC A;  1LDJ A;  1Z21 A;  2E71 A;  3PUB A;  5ICG A;  4XMY A;  1JUS A;  4BS9 A;  1TC3 C;  4IOA F;  1HC8 A;  1FP1 D;  3DEW A;  2ZO4 A;  1SVM A;  1B9N A;  1UMQ A;  1CGP A;  4L9J A;  5BQT A;  1WJF A;  4MTE A;  1YS7 A;  4BDZ A;  2TDX A;  1TNS A;  4JQF A;  2Q8K A;  4ZYH A;  4ZDP A;  3F9K A;  1BA5 A;  2BYV E;  2MH2 A;  3QPH A;  1WSU A;  3D5L A;  4HNT A;  2ELH A;  3H5A A;  2L7M P;  2AQE A;  1K78 A;  2O61 A;  3T1B A;  2FML A;  2CO5 A;  3ZQC A;  1PUF B;  5J1R A;  3S3O A;  4KIS A;  5K1Y A;  4BDY A;  2VB6 A;  4ZYA A;  3HBL A;  2IA2 A;  3I59 B;  3Q9S A;  2X1E A;  3BR1 A;  1RZ4 A;  4FIS A;  3WE2 A;  4BJT A;  2HS5 A;  3QWL A;  4E7J A;  3ZQH A;  3MKY B;  1SFX A;  3RDI A;  2HQA A;  2ZXI A;  1XB4 A;  2Z1D A;  2VUM J;  1KA8 A;  4N9H A;  4ZDO A;  2K27 A;  1TT5 B;  2KMU A;  2IVM A;  2IGK A;  3CO6 C;  4W1U A;  3G1O A;  3OYB A;  4MIM A;  3L2R A;  4NC6 A;  3ZMT A;  4MGR A;  2NOJ B;  2EFQ A;  2ZJR F;  4WCG A;  3MAJ A;  2XGX A;  3Q9V A;  3ZN0 A;  1T2K A;  2CW7 A;  3LQQ A;  3MMY B;  3WTX C;  3DLL F;  3FIW A;  1QHH D;  3P9K A;  3WTV C;  1XCB A;  1TZL A;  3H9Q A;  1HW5 A;  5B5E C;  2WV0 A;  1IN8 A;  4RAY A;  3FXR A;  2A6E F;  4P55 A;  1N77 A;  2RKH A;  1FIA A;  2FF4 A;  2DW4 A;  1U5T B;  3OYH A;  2HR3 A;  4KDP A;  3MKL A;  4G7O F;  2LKP A;  2JN6 A;  5DD8 A;  1YX5 A;  4NC8 A;  4BUP A;  4NQW B;  5IT3 A;  4DJA A;  2IBD A;  3NEU A;  2K40 A;  3CJR B;  4Q4Z F;  3OYM A;  2KDZ A;  3H3U A;  3QPT A;  4HQE A;  1XPX A;  2H1K A;  2XRO A;  2ECC A;  1VND A;  2F4M B;  1FBQ A;  2IXS A;  2ZXJ A;  4Q48 A;  1IXS B;  4KMF A;  1TW3 A;  2XKO A;  5HNF A;  3U21 A;  1FWZ A;  3VSK A;  2HOE A;  1BOB A;  2AHQ A;  2COM A;  2OD5 A;  2UXX A;  1TW2 A;  2AS5 F;  3OIP A;  1YO5 C;  2NS0 A;  4E70 A;  2QQB A;  2XUB A;  2FBH A;  3T5X A;  4E7I A;  2K5C A;  4HF2 A;  5B1B H;  1ERD A;  3TL4 X;  1HDP A;  2CSO A;  2IGN A;  5F0F A;  3FK7 A;  2V7F A;  1X4P A;  1SMY F;  1LFP A;  4XLF A;  1LE8 B;  5LHG A;  2LC2 A;  4EQQ A;  2NOG A;  2DN0 A;  1O57 A;  3GFM A;  3HB9 A;  1FNN A;  2ISY A;  3X2Q H;  2MGQ A;  4YIF A;  2V1N A;  1JHF A;  5TGT A;  2R5Z A;  5GPC A;  2Y2Z A;  4N4N B;  1FYK A;  2QM3 A;  4GYG A;  2HXI A;  3IL2 A;  2CUF A;  2DDA A;  3A03 A;  3OS1 A;  4UV9 A;  4O3M A;  1J0R A;  3IH3 A;  4A6E A;  1XGN A;  3PQJ A;  4I6Z A;  2RV8 A;  5E3M A;  1IAW A;  3RYP A;  2EIN H;  3A0B C;  2B63 J;  2QKL B;  2YR2 A;  2NS7 A;  3F0C A;  1ETK A;  5E1W A;  3KP5 A;  3LNQ A;  5IP7 J;  1WI3 A;  1W5T A;  5FLX K;  4DGW B;  2HYG D;  3IP4 B;  2P5L C;  1A6Q A;  3WTZ A;  2WTE A;  4YEL A;  1XGS A;  5L3B A;  5GAG J;  4M9X A;  3CQZ J;  1XSD A;  4BBS J;  2PFB A;  4RGS A;  3CCE I;  1XD7 A;  2QYO A;  3SHF A;  4NHJ A;  2HVR A;  1V5F A;  2XPU A;  4Q5S F;  1R58 A;  2K7L A;  1X58 A;  3O2P E;  1ZG1 A;  3AL0 B;  2OZ6 A;  3AAF A;  1FC3 A;  1A6I A;  4QWQ A;  3OOU A;  2PMZ A;  4IRH A;  1ONV A;  3HTU A;  3L7W A;  4XRF A;  1AU7 A;  3TP3 A;  4F55 A;  3GZ6 A;  5KNL A;  3CCR I;  1JI8 A;  2K3F A;  2LNB A;  3PNV A;  4C3J J;  2HOA A;  2R7W A;  1OYW A;  4PJL A;  3G71 I;  4J19 A;  2ACJ A;  1IUF A;  2K4J A;  4A3B J;  1KQ9 A;  2NVT J;  2JMW A;  2OCC H;  1R4N B;  3RQI A;  3IUO A;  5EYR A;  1OCR H;  1GHC A;  4OIP F;  2I5U A;  2E7X A;  4BH9 A;  1IV6 A;  1MSE C;  2M1B A;  2EFO A;  2DYR H;  2HPI A;  2WB1 A;  1ZK8 A;  3FXO A;  1O3Q A;  3I9V 2;  2E1M B;  2DLL A;  3ERE D;  2LLK A;  1SFK A;  3GXO A;  4L5I A;  4AVP A;  5LGN A;  3GF2 A;  3M9A A;  4M71 A;  3GME A;  2OA4 A;  2DA7 A;  1SVO A;  4BHC A;  5JI6 A;  2X4H A;  4BY7 J;  2XC7 A;  5E20 A;  3MKW B;  4LIU A;  5LHH A;  1HST A;  3JRH A;  2KIF A;  3GYH X;  3FM5 A;  2H09 A;  1JT6 A;  1STZ A;  2IGO A;  1LJ9 A;  4ESB A;  4OWR B;  2VOD A;  1S72 I;  3K70 D;  2Q0O A;  1MND A;  3FXK A;  3BR3 A;  1BM9 A;  1PUF A;  4HX7 A;  1WJD A;  5B1A H;  3I59 A;  3C2B A;  2LRD A;  4BE2 A;  1SD6 A;  4BQQ A;  3FWE A;  2M2E A;  4PJ0 C;  2E36 A;  4MTD A;  4A3D J;  2L02 A;  3LSG A;  2HOT A;  1BN5 A;  4JP0 A;  5AIQ A;  4BE0 A;  1BW6 A;  3ZN1 A;  3ZP5 A;  1IZ1 A;  1QZE A;  2BY2 A;  3I4M J;  3PQK A;  1UCR A;  1ZGW A;  2C6Y A;  1XGM A;  1HF0 A;  1J7K A;  2F4I A;  2RQQ A;  2YUS A;  3H1C A;  1FX7 A;  1U9N A;  2VAS A;  4GGG A;  3CCV I;  2ESN A;  2DA6 A;  1ZAO A;  4IX7 A;  6PAX A;  2HZT A;  2CUE A;  1ETW A;  4HW0 A;  4D9J A;  4HQM A;  1R1V A;  4I76 A;  4WXD A;  3W2W A;  3I56 I;  2A6H F;  2VBW A;  1AKH B;  4IHW A;  4E7K A;  1W36 C;  1U5T A;  2HFH A;  1TBX A;  4YEJ A;  4PJN A;  3DEU A;  1NHA A;  4PSW A;  2IS2 A;  2L3D A;  5HLT A;  2CU7 A;  2EWN A;  5KCM A;  2QEN A;  2P6T A;  5HDG A;  4ESF A;  1D3Y A;  2GXG A;  3CME I;  2L54 A;  3WG9 A;  2V6C A;  1SMT A;  3M8E A;  3ZMV A;  5IOZ A;  3Q0U A;  3LFK A;  3VWB A;  1LDK B;  2NS8 A;  5IYC J;  2RRE A;  5EEH A;  3RI4 A;  3FXL A;  5M5X J;  3W6J B;  4AVZ A;  3HOW J;  2MC3 A;  2L5Q A;  2DOD A;  3KFW X;  2A68 F;  1SEU A;  3A0H C;  3UKG A;  2Y9Z A;  3H9G A;  2ZNZ A;  4NBQ A;  4D5C A;  2P6S A;  3PJR A;  3LSJ A;  2D5V A;  2HVQ A;  4G6D A;  1OR7 A;  1MBK A;  3WE3 A;  3SYT A;  1B8I B;  3LSI A;  5DCM B;  2XAU A;  4I0B A;  2FA5 A;  3AKZ A;  4F52 A;  1LE8 A;  2H27 A;  2PQ8 A;  3IC7 A;  1K79 A;  4PCQ A;  1Y0N A;  1MKM A;  3W6V A;  4EJU A;  3KP3 A;  2DCE A;  3O6B B;  1FSH A;  2R7X A;  2K86 A;  3N05 A;  1W7P B;  2I10 A;  1IDY A;  1A35 A;  4N0B A;  1G59 A;  3GTP J;  2E2I J;  3CMA I;  1W5C C;  2W82 A;  4IHV A;  3VYU B;  2BE5 F;  3U1D A;  1Y39 A;  2Q2E B;  3DPL C;  4KIG A;  3A4C A;  5GAE J;  4WXC A;  1MJ9 A;  1HKT A;  4CCK A;  2QVO A;  4HRI A;  2PI0 A;  1XN7 A;  2A6T A;  2YX4 A;  4MFD A;  3CC7 I;  2R92 J;  1JKQ C;  1IXR C;  1MD0 A;  2YSR A;  2GXB A;  5ED4 A;  1FYM A;  2J5O A;  1FBU A;  1FPQ A;  3JSP A;  3K1M A;  2XSJ C;  3K4J A;  5LRR A;  4HNU A;  2RNG A;  1BJZ A;  4X1E A;  2CH0 A;  2DFE A;  2NNN A;  2DPD A;  3FDY A;  1KQ0 A;  2M7B A;  4LG0 B;  4D0P A;  1ENH A;  3OL4 A;  1HKS A;  5DEQ A;  3CCU I;  3K9T A;  5K7H A;  2ZFW A;  4WX9 A;  2B7E A;  1IXC A;  3DFG A;  2MG4 A;  2ZXH A;  4XN3 A;  2LG4 A;  3F6O A;  4XN0 A;  5AON A;  4B44 A;  3IH4 A;  2DXI A;  2MA3 A;  2DI3 A;  1NG6 A;  1YOV B;  4D7M A;  3ZQL A;  3S17 J;  1ZLJ A;  1LDD A;  4E7H A;  2JUC A;  2MBF A;  2L4A A;  2JUG A;  3SEQ A;  5FO5 A;  3GEZ A;  1JKR C;  2KZG A;  3F72 A;  3H3V K;  1VQ7 I;  3KP7 A;  4RB2 C;  1HXD A;  3QAH A;  3S1N J;  4F92 B;  3TQN A;  4Z6Y A;  2KJB A;  1FTT A;  3PO2 J;  5BPD A;  5A2Q K;  1BR4 A;  3BJO A;  4II2 A;  2VXZ A;  4HOB A;  2LVS A;  5D5U B;  2XAJ A;  3FIS A;  4M3F A;  4CO8 A;  1WH5 A;  4UUV A;  5TIS C;  1VFC A;  4GRI A;  2MFZ A;  1A5J A;  4U88 A;  1YYV A;  2IAI A;  4PDK A;  5J3L A;  2Y9Y A;  1VQ8 I;  1Y6I A;  1JKP C;  3JRB A;  1A36 A;  2UWM A;  2E35 A;  3S93 A;  3CF2 A;  3E6B A;  1R5I D;  1TQI A;  3JRD A;  4M3G A;  1VQ4 I;  1X3Z B;  1I1G A;  2LKS A;  2VBX A;  2JWT A;  2DOF A;  3KZY A;  4J01 A;  1JKO C;  3DPT A;  3SQN A;  2AO9 A;  4LK1 F;  1T0F C;  4L5E A;  4G8X A;  2WV1 A;  1IJW C;  4C30 A;  5LGU A;  1I1S A;  4AWX B;  4E7Z A;  4FE4 A;  1GT0 C;  4L9N A;  1OCC H;  2O0Y A;  4UV8 A;  3W3C A;  2F6C A;  3L2V A;  4LB5 A;  1IN6 A;  1EJ9 A;  2QSF X;  2ZXW H;  2BZT A;  4WK8 F;  3OYI A;  2D45 A;  2UXN A;  2F5V A;  3ABK H;  4IPA A;  2W85 A;  4M74 A;  3HPG A;  1AKH A;  3JR9 A;  2DMU A;  3UR3 C;  4A0Y A;  2XB0 X;  2M7A A;  4BJ6 C;  4DIQ A;  4ENM A;  3CLO A;  3FK6 A;  2JA5 J;  1H0M A;  5HS9 A;  4I7H A;  1C0W A;  5EF6 A;  2STT A;  3ELK A;  1F43 A;  3A01 B;  3L2W A;  2X1D A;  3LA3 A;  5HLH A;  5JHU A;  2NAZ A;  1NG7 A;  2LDU A;  5K7F A;  4GFB A;  1Q1H A;  4BY1 J;  2V79 A;  1CQT A;  3FKI J;  4I2O A;  2IS4 A;  1G2H A;  3E6D A;  1FOX A;  2GLO A;  5FGM A;  3S2D J;  2F48 A;  1JGG A;  4Y52 J;  1IDZ A;  3S2H J;  2MLG A;  4QSH A;  2LD5 A;  4OAZ A;  3BR0 A;  3ZRG A;  2MAB A;  2XAQ A;  3EUH C;  3D1N I;  5TRD A;  3CDH A;  1G8X A;  4FX4 A;  1U8R A;  1YE9 A;  3KYC B;  1UHM A;  4AYB N;  1IRX A;  4BJ5 C;  1AA7 A;  1YW7 A;  5HOD A;  1X1D A;  4FCY A;  3GTK J;  2XDV A;  4YII A;  1UHW A;  3OYA A;  3DBL B;  3S32 A;  3W2V A;  3FBI B;  3H35 A;  2R7R A;  4EGY A;  1YHQ I;  1O3S A;  1B8I A;  1JHH A;  1ZRC A;  3S15 J;  5DCM A;  4A3C J;  3JSO A;  1BBY A;  3KZZ A;  3F22 A;  4AYB A;  2G7H A;  4ZH4 F;  3ECO A;  3ZQ7 A;  1UB9 A;  3E0J B;  5KHD A;  1RKT A;  2EV6 A;  4CUG A;  5L3C A;  1X2M A;  3QQA A;  4B8X A;  4JX6 A;  1R49 A;  2IS1 A;  1T6S A;  3HSF A;  4DBQ A;  2Q1Z B;  3K4M A;  2EJR A;  4KMU X;  4ZTF A;  5A2Q Z;  2JA8 J;  5K5R A;  3N97 A;  3ML6 A;  1J59 A;  2L0K A;  3LOC A;  3ZMZ A;  3OYN A;  2LTP A;  3FM3 A;  4OIQ F;  1F9N A;  3CMY A;  2VPL A;  3VPR A;  4LJZ F;  5J47 A;  3BG9 A;  1HSJ A;  3MZ8 A;  4CCL A;  4J00 A;  2TRT A;  3KYL A;  1ZYR F;  2BV6 A;  2DK5 A;  5DUK A;  2NVU B;  2Q2E A;  4HZF A;  1FMV A;  3MKZ A;  5LEK A;  2HWV A;  1JUP A;  3K70 C;  3J7Y J;  1P4A A;  1W36 D;  5CVU A;  3M8F A;  3LAP A;  4KIB A;  2QF7 A;  1T8I A;  4C9Y A;  2CG4 A;  4XBF A;  2KP6 A;  2EFW A;  3RZO J;  2V9V A;  5HS8 A;  3OYF A;  1Y8R B;  3CLQ A;  1D0Z A;  1P4W A;  4CA0 A;  2VJ5 A;  5LD2 C;  1GVJ A;  3M3Y J;  1YG2 A;  3HOU J;  2HZD A;  3O3K A;  3AFH A;  1ETY A;  1HQC A;  1NTC A;  3S16 J;  4UUS B;  2VQH A;  3IAM 2;  3SZP A;  4ZYE A;  5J8C A;  2DTR A;  3WU2 C;  2E7W A;  4V19 K;  1W0U A;  1F36 A;  1I3Q J;  3BG6 A;  4OIR F;  3GTM J;  4DQ2 A;  1S8N A;  1ZN2 A;  4IRI A;  4L5J A;  1JTY A;  3R61 A;  1K4T A;  1Z7U A;  2FNP A;  1BI3 A;  5JVG F;  4BAC A;  2O6G E;  2HXO A;  2OAZ A;  2ZC2 A;  3CCY A;  3Q3S A;  4II3 A;  4ENJ A;  1DU0 A;  1IG7 A;  1ZG3 A;  2F2E A;  4I01 A;  2E1C A;  4HF1 A;  3WGG A;  3HUG B;  4A3F J;  1EKE A;  4IHS A;  2GZW A;  2H94 A;  2W7N A;  2HDD A;  4KT6 A;  3ZR8 X;  5LRS A;  3L2U A;  2VKH A;  3QRF F;  5F1J A;  2A5W A;  3ABL H;  3Q0V A;  1TWF J;  3SFZ A;  5GPA A;  3CO7 C;  3OWT A;  2LSO A;  1SAN A;  2WAF A;  1W7P D;  4HX8 A;  1P7J A;  3IRQ A;  1B1B A;  3HPH A;  3TOB A;  3KEO A;  1U2W A;  2AQF A;  4AIK A;  3VDX A;  2ZB9 A;  3HOX J;  2J5P A;  2HDW A;  1R1U A;  1VF9 A;  2ELJ A;  3JRG A;  1FIP A;  1KON A;  1FT9 A;  4XKV A;  4GYI A;  2I8D A;  5FKM A;  1QHG A;  4BU2 A;  3OS0 A;  4C2T A;  2O8K A;  2DK8 A;  5CVI A;  2K4B A;  2JVH A;  3L00 A;  1ZHF A;  3F8N A;  1WKM A;  2P0W A;  2Z3Y A;  1ZGA A;  3JTG A;  2XF5 A;  4HX4 A;  5J4Y A;  1MW7 A;  1GXP A;  5J1Y A;  2YX7 A;  1QO0 D;  3IWF A;  3GTQ J;  3F8C A;  3CJN A;  1B72 B;  2XAG A;  1LQ1 A;  2VI6 A;  1QPM A;  5HNH A;  1T0F A;  3AG1 H;  3FXU A;  1LFB A;  3R6S A;  3SEZ A;  1BW5 A;  1XDU A;  2FE3 A;  1TT0 A;  1P92 A;  3HGY A;  2CGP A;  3NAU A;  3K1N A;  3M8J A;  4HEA 2;  3T0Y A;  3F23 A;  1E0E A;  2X48 A;  4M3D A;  3L1P A;  3DP7 A;  3BP8 A;  4KIC A;  2ADU A;  2A3S A;  3S1M J;  3HG9 A;  2HQ5 A;  4P9F A;  2K9N A;  4G6Q A;  1Q1V A;  4JBA A;  2ME6 A;  3HRM A;  1U5T C;  3RKX A;  2LH9 A;  2XPW A;  3ZMD A;  2FXA A;  1F4K A;  3LA2 A;  2L7F P;  3OYD A;  5ICF A;  3A01 A;  1Z6R A;  1XMA A;  3OIO A;  3BR2 A;  4IL6 C;  5GAH J;  4XKC A;  4EJO A;  4OMZ A;  4LG3 A;  2DTZ A;  3GBG A;  3QU3 A;  2V1X A;  5M3F J;  3DKX A;  2F5F A;  2WC2 A;  4FQG A;  3EYI A;  4IHT A;  3MFK A;  2FSW A;  2VJ4 A;  3Q5F A;  1YFH A;  1I5Z A;  3AG2 H;  1NH3 A;  1MIJ A;  2OF7 A;  3HTS B;  1LEB A;  1USS A;  2HEO A;  1X3W B;  4B1R A;  1GLN A;  2MC4 A;  2QZ8 A;  3MEX A;  3IRR A;  4AU7 A;  1RIO H;  1LVA A;  4XNF A;  2IRF G;  1O7L A;  3BZC A;  5F04 A;  2M9H A;  1YRN A;  1CF7 B;  3FHN A;  4CHU A;  2IW5 A;  3EUH A;  4XRS A;  3GTO J;  4WWC A;  1GV2 A;  3S3M A;  1Z0X A;  3DEE A;  4L0Y B;  3BZK A;  3KPH A;  4BHB A;  1VQO I;  3FZV A;  4EEF G;  1E3H A;  1OR7 C;  3W6K B;  1R00 A;  4RB0 A;  2L4M A;  4FAS D;  5D5V B;  1S3J A;  2ICW G;  2R7U A;  4Y13 A;  1ZH5 A;  4MLO A;  2VKD A;  3HDD A;  2FUG 2;  1HDD C;  3BC8 A;  1UEL B;  1MH4 A;  4MO7 A;  1KYW A;  3GO5 A;  4XLE A;  1J09 A;  2VT2 A;  3PSF A;  4RBO A;  3C1D A;  2EQR A;  3V8J A;  1YIJ I;  2ZSH B;  2IS6 A;  4BE1 A;  2OV7 A;  3ABM H;  1RR8 C;  5GTH C;  1TWH J;  2VOP A;  3C3W A;  2DQL A;  2EFP A;  3GTG J;  2LOO A;  3PO3 J;  3K1P A;  4G7Z F;  2DOE A;  4EJW A;  2M4K A;  5EGO B;  1Z77 A;  2DT6 A;  3BY6 A;  1FSE A;  3K4N A;  4PFO A;  1KGS A;  3C7J A;  1REP C;  1DGR M;  5IT9 K;  4MQ9 F;  3P5J A;  4E7S A;  4UVC A;  2EZK A;  1X1B A;  3RPQ A;  3I0T A;  1Z3X A;  3CUQ B;  4RLF A;  2Z2S B;  3SZT A;  5LBQ A;  2VBY A;  1N78 A;  2IT0 A;  3LMM A;  2FOW A;  2ZSI B;  3I71 A;  1JGS A;  5F27 A;  4RAG A;  1KZH A;  4DNC A;  1ETX A;  3KX2 A;  5F08 A;  4ANJ A;  4UUS A;  3AL0 C;  1T56 A;  5FFX A;  2DT7 B;  2DA5 A;  1P9Q C;  4XK4 A;  2NXN B;  3WHC A;  4B48 A;  2DMP A;  3DCF A;  2EFN A;  3JRF A;  1OJL A;  1O3T A;  1HW2 A;  1DGW Y;  3BLY A;  4IQJ A;  3L2C A;  3CP2 A;  3D5S C;  1B4A A;  3HGG A;  3VOE A;  5FKN A;  1FTZ A;  4AM3 A;  3GFL A;  3QYB A;  4E6K G;  2DO7 A;  3RCO A;  5EEA A;  1X1A A;  2LFB A;  3E7L A;  4IXA A;  1N25 A;  1MMD A;  3C2H A;  3JW4 A;  4KNY A;  2GIV A;  1H9T A;  2E1M C;  4JOM A;  3H0D A;  1DPU A;  1TWC J;  1J2X A;  2KIQ A;  5EG0 B;  3GVA A;  3GTL J;  2M34 A;  3HKZ N;  5E18 F;  5KAI C;  2F4O B;  3BCB A;  3TDU C;  1D8J A;  1LPQ A;  4FTH A;  4I09 A;  2LBF B;  3BQY A;  4QPO A;  3PSI A;  4A0Z A;  4F3Q A;  4I99 C;  2HGC A;  4LIT A;  1SVL A;  1OCP A;  4U7D A;  3U2R A;  2VQC A;  1DU6 A;  1KU2 A;  3KZI C;  1T98 A;  2V1D A;  2W25 A;  4HG2 A;  4U87 A;  5GTI C;  3CP8 A;  1LB2 A;  4KN7 X;  1PYV A;  4ZZL A;  2HDC A;  4ZYG A;  2IGM A;  1ORK A;  3HRU A;  2FQ4 A;  5BNG A;  1ETQ A;  1T33 A;  1XX5 A;  3BDD A;  1B72 A;  4NDL A;  2FBK A;  2L7K A;  4BYY A;  2FD5 A;  4CXF A;  1VQ9 I;  3G3Z A;  4G7H F;  2AXT C;  2QEX I;  2DA3 A;  3OYK A;  3ZCO A;  1TLH B;  3M7G A;  3ZPL A;  1WZ2 A;  1KU3 A;  4KA4 A;  3HC7 A;  3K2Z A;  5H2F C;  1W5S A;  5C4J J;  1HBX G;  1JTX A;  5FD6 A;  3LSR A;  2IA1 A;  4Z2Y A;  3QOD A;  3ABU A;  4GO1 A;  5LLQ A;  2FJ1 A;  2M0C A;  3LL7 A;  3ZOB A;  2X6X A;  5D5X B;  5IP9 J;  1R9T J;  5IT9 Z;  1QNT A;  3PIO F;  2E19 A;  1UHS A;  2P7V B;  2L01 A;  4BBR J;  4NNJ A;  3NAR A;  2JRM A;  1MH3 A;  3G4S I;  2DFI A;  4UHT A;  2X1C A;  2BW3 B;  3H0G J;  3REO A;  2JVG A;  1ETO A;  2X9D A;  5FRN A;  2H1L A;  4XRM A;  4NQW A;  1KYZ A;  3WG7 H;  1FJL A;  3AG4 H;  3CES A;  2FRH A;  3SDG A;  2PMH A;  1LUJ B;  5K5Q A;  4C3H J;  1UST A;  2BVL A;  2X6W A;  4LIV A;  4YRV A;  3PUF A;  2CS3 A;  4A3J J;  3TKY A;  4X0G A;  4NUB A;  3FXQ A;  2O7O A;  3V7C A;  2HTS A;  2E5N A;  3G2B A;  4HLX A;  2N8G A;  1CF7 A;  2JA7 J;  4QTR A;  2QA4 I;  3MN2 A;  3KET A;  1QRY A;  2HU9 A;  2KL4 A;  3OR1 C;  3CC2 I;  2M4G A;  1S6L A;  4BAY A;  4H4K C;  3QOP A;  2OZU A;  3RPU A;  2ZME B;  2VPR A;  1IO2 A;  3QP6 A;  2VKV A;  4CGZ A;  2DMT A;  1SAX A;  1WQ2 A;  5CJ9 A;  2KLO A;  4NB5 A;  1JJ6 C;  4B3A A;  2QWW A;  2KIM A;  3I64 A;  1UJ8 A;  4HSR A;  1T38 A;  4A3G J;  1AHD P;  3H36 A;  5C4X J;  1HKQ A;  4S0H B;  1IRG A;  1MBJ A;  3ABT A;  5DUI A;  4P9U A;  3GX4 X;  2XAF A;  4IEJ A;  3LFU A;  4AIJ A;  3HYI A;  2G0E A;  2BXZ A;  3ROU A;  2EZH A;  3DTI A;  1PDN C;  4A3E J;  4HA8 A;  1R6R A;  3R60 A;  1U3E M;  3A02 A;  4DW6 A;  2HKX A;  1TWA J;  3FF5 A;  5EGO A;  4XLP F;  3GFI A;  4C2M J;  2ISZ A;  4BL0 B;  2WAD A;  1XMX A;  1UFM A;  3TDZ C;  3WU0 A;  3VYR B;  1BC7 C;  1Z6T A;  3VB2 A;  4CYD A;  2XAH A;  1ZRD A;  2ZNY A;  4YIR X;  5BMZ A;  1QZY A;  2ECB A;  3HJE A;  2W00 A;  4XSX F;  1FBS A;  2Z99 A;  3NQO A;  2LK2 A;  4R79 A;  1DP7 P;  3TOA A;  2YPR A;  1IN5 A;  1B59 A;  3D5R C;  3JRI A;  1G4D A;  4MFE A;  2QGU A;  3MVP A;  5ILV A;  5JR3 A;  4AC0 A;  2GA2 A;  3F8F A;  4CH7 A;  4DZJ A;  5TJJ A;  2OUM A;  3IAS 2;  2GIZ A;  2HYJ A;  5FJ8 J;  2NRA C;  2M0M A;  2OTL I;  1FOK A;  1WJA A;  2WWY A;  4MQV A;  5E79 C;  1IGN A;  3RPU D;  3FKJ A;  2NNY A;  3NWS A;  4A3I J;  4UUT A;  4UB6 C;  3WTY C;  5IPA A;  3OR2 C;  3G73 A;  4UB8 C;  1OIS A;  2DT5 A;  3DTK A;  2R7S A;  1YW8 A;  2GOX B;  1Z7L A;  2A05 A;  2OU2 A;  3K2A A;  2XSD C;  2P4W A;  4ZTJ A;  3BJA A;  2XGE A;  4RDU A;  5EG0 A;  4I98 B;  3V8K A;  1RUO A;  4N9I A;  4ETS A;  3QOE A;  3LWF A;  2M30 A;  5CVV A;  3BR5 A;  3IKV A;  4A12 A;  2M8G X;  2LBF A;  4HDU A;  2LMD A;  4B43 A;  1MBF A;  2JZY A;  3FMQ A;  1Z1D A;  3ULQ B;  1P6R A;  5JFR A;  2LF8 A;  1B9M A;  3HL2 A;  1PJR A;  3E97 A;  1UZC A;  4U0V A;  2V6E A;  2UUZ A;  1D0X A;  4M6X A;  2WAQ N;  3O8H A;  2CFO A;  1S9H A;  1RI7 A;  2DYS H;  2QKM B;  2X51 A;  2YU9 J;  2E1O A;  2K85 A;  5ICE A;  1YJW I;  3WGH A;  1MMS A;  5IYD J;  4LFU A;  1P2F A;  2WAQ A;  3LSM A;  4G94 A;  3K69 A;  3FHZ A;  1ZKG A;  3CCL I;  3TO6 A;  5JVT A;  1XDS A;  2HVS A;  3M1E A;  1SAU A;  2M8E A;  2DBB A;  3DWL E;  4BEH B;  2ZBK A;  2W84 A;  4IHX A;  1U6G A;  4ZC3 A;  1YW9 A;  3GWZ A;  1VQP I;  4ABZ A;  1K83 J;  2HI3 A;  3C18 A;  2NVQ J;  2X85 A;  5EDN A;  4EM1 A;  4UY8 I;  3DXJ F;  3GZN B;  4OIN F;  3MZH A;  3JRC A;  2ID6 A;  1WJ5 A;  3CCM I;  4R8H A;  5DM6 F;  3MQ0 A;  1YTY A;  2EIM H;  1MBG A;  2XPV A;  1MZB A;  4OMY A;  5HLG A;  1DPR A;  4ZYD A;  2BW3 A;  1OCT C;  3M4O J;  1D0Y A;  1MJA A;  3J7A Y;  1SFU A;  1VI0 A;  3LQR A;  1W0T A;  5DV5 A;  2EA4 A;  1ITY A;  1XTA A;  2HTJ A;  3KCC A;  1NK2 P;  2B9S A;  1VQL I;  1OLT A;  1X4O A;  2DA1 A;  1LNW A;  3R0A A;  5D8K B;  5IY5 H;  4P96 A;  3BR6 A;  4V2G A;  2H6C A;  3DBR B;  3VOD A;  3BG7 A;  2MD0 A;  3DKW A;  2ZJ2 A;  4ASN A;  1O7F A;  2MYS A;  4DYQ A;  3VEP A;  4EJV A;  4HST A;  1WCM J;  2JSC A;  1FZP B;  1YI2 I;  3HOS A;  4U0W A;  4CCO A;  2BBY A;  2JK3 A;  4A3M J;  1R22 A;  3HSR A;  5FLV A;  3CC4 I;  1QU3 A;  4GCV A;  2LKX A;  2JQ7 A;  3SDB A;  3K4B A;  1MMG A;  3A1Y A;  3EUA A;  2XHK A;  2CV0 A;  2XGC A;  2VC1 A;  3BRO A;  2VQG A;  3ZQQ A;  2Y30 A;  1ZR4 A;  2YS9 A;  1OCZ H;  5GP9 A;  1R5H A;  1W7P A;  3QYE A;  4JYK A;  4XR6 A;  3ZGK A;  5F6F A;  2NYX A;  2XIG A;  4M72 A;  3ECH A;  4HV6 A;  4CZC A;  4EM2 A;  4XQF A;  2RQP A;  4YFN F;  1I6H J;  3H5N A;  1U9O A;  3DLA A;  1YJN I;  5KAF C;  1YX3 A;  1ZEL A;  2GWR A;  4BXF A;  2RN7 A;  2O9L A;  5CVR A;  2FBI A;  2L9R A;  3GLX A;  3RYR A;  2Y0M A;  4KIT B;  1PUE E;  4KT5 C;  3B73 A;  1T39 A;  1GVD A;  2KZV A;  3FMR A;  3TW7 A;  1G3T A;  5EJC A;  1RRJ A;  3TO7 A;  1BIB A;  2L7Z A;  4N4O B;  2V26 A;  2F5E A;  3GW2 A;  5JLX A;  1WHU A;  4YG2 F;  3FXM A;  3IH2 A;  5E17 F;  1E3P A;  5L3E A;  1U0J A;  2CMP A;  2HYF A;  2ZFU A;  1TNT A;  2JTV A;  2O3F A;  1S29 A;  2XV4 S;  4NC7 A;  5K7Z A;  5K5O A;  1G6N A;  3BJ6 A;  3JRE A;  4Y15 A;  5FRO A;  3KLO A;  1X19 A;  4B3X A;  4EV0 A;  4LG0 A;  2Y31 A;  4EM0 B;  2JJ7 A;  4CZZ A;  5J8F A;  5FLM J;  3BCA A;  4RAF A;  4I02 A;  4RM2 A;  1X2N A;  5HS7 A;  1EH6 A;  3CCS I;  5CVJ A;  2FOK A;  4L9T A;  1IUY A;  3OSF A;  1EH8 A;  1QVT A;  1XGO A;  5AIP A;  4AID A;  1QBJ A;  2KJC A;  4IHY A;  2GOM A;  2DU9 A;  2BVM A;  3ZXS A;  2W57 A;  1V3F A;  5D6E A;  4QPQ A;  3HHH A;  4RB3 C;  3QU6 A;  3KP2 A;  5FFZ A;  4PJM A;  3HOT A;  2WAE A;  4HLY A;  3RQ4 A;  4ITV A;  1TTY A;  3JTH A;  4E7L A;  1VZ0 A;  4BXU A;  5KK1 A;  3H5R A;  1OYI A;  2PEX A;  4LOC A;  1OKR A;  1H8A C;  3SZG A;  3ERM A;  4IOC F;  2E2H J;  4A5M A;  2P5K A;  2V9K A;  2CQQ A;  3GFJ A;  2XVC A;  4DYR A;  3RKW A;  2VLA A;  2V1U A;  2R7V A;  3KE2 A;  2JRT A;  3IKT A;  3E1S A;  3HHG A;  3EET A;  1KU7 A;  3WTU C;  4W97 A;  2W4S A;  3COA C;  3U1K A;  1JT0 A;  2ELK A;  4LGW A;  4V2F A;  4RS8 A;  2OPT A;  3SFI A;  3CUO A;  3WTT C;  4FHT A;  3OSG A;  5FKK A;  1RES A;  1D8K A;  2P8T A;  2A5Y B;  1WI9 A;  1RC9 A;  4RGR A;  1DUX C;  1UG2 A;  2VC0 A;  2KKO A;  1I39 A;  4O6J A;  1ZLK A;  1WFX A;  1LEA A;  3M07 A;  3KIO A;  2QUF A;  1ON1 A;  4D7N A;  1BOA A;  3V8L A;  5IP6 A;  2FEZ A;  4XID A;  3ZMU A;  5HVQ C;  1I6X A;  5H20 A;  2MLK A;  3ASN H;  4IQ4 A;  4XOP A;  4BEH A;  2CV2 A;  3BT9 A;  4C2U A;  4HPQ A;  4QLC U;  1SC7 A;  3AG3 H;  3B02 A;  2DAO A;  1R5G A;  2CWE A;  4ESJ A;  2JA6 J;  2RVC A;  4XOT A;  1ZG5 A;  4A69 C;  2VJI A;  1X3U A;  2DJN A;  2O03 A;  1WH7 A;  1R4M B;  2KRH A;  4PZJ A;  4EGZ A;  1PP7 U;  1BR1 A;  2L2O A;  3F8M A;  4CCJ A;  2VKE A;  1I3A A;  1ZTR A;  2R7Q A;  4DZP A;  2ME0 A;  5EZH A;  3TBI A;  4CCN A;  2KIS A;  3OV8 A;  3WHB A;  1IV8 A;  3DQV C;  1D5V A;  1OPC A;  1F1Z A;  3RIR A;  1GUU A;  4Y4R A;  3BG5 A;  3VYS B;  5EEG A;  2E34 A;  1G3W A;  1XG1 A;  2ZCW A;  2XF6 A;  5M5W J;  2GQQ A;  2CW0 F;  2ZJP F;  2K9M A;  3J81 Z;  3HIF A;  3VSL A;  4IJA A;  1L3L A;  1QPI A;  1V5E A;  2VBZ A;  1KQ8 A;  2HQN A;  3OL3 A;  4ON0 A;  3CF5 F;  4LK0 F;  3OYJ A;  4F93 B;  3N4M A;  1D1C A;  3P9I A;  2EH3 A;  2COB A;  2R7F A;  1DDN A;  3BG3 A;  1OMI A;  2FNA A;  1Z9C A;  1G3S A;  3OYE A;  4MNU A;  5E8I A;  5C44 J;  3I55 I;  3K4C A;  3LSK A;  4IKF A;  3CD6 I;  3E5X A;  2QSH X;  3IHU A;  4BQA A;  3V4G A;  4XOR A;  5J40 A;  2KFD A;  3PIP F;  2D1V A;  3DV8 A;  2RGV A;  1IW7 F;  2VE9 A;  1BJA A;  4ZJZ A;  3C2G A;  3DTE A;  4A2U A;  3W2A A;  5DD4 A;  4S04 A;  4FE7 A;  1E17 A;  2DDB A;  4LB6 B;  4MEY F;  3ASO H;  5LEJ A;  3V7S A;  5FD5 A;  4XIC A;  1ZR2 A;  5B3S H;  3S1R J;  2Z5U A;  1I27 A;  5M3M J;  3U9G A;  2WY7 Q;  4DYC A;  3ONQ A;  4EMS A;  4BXX J;  5L3D A;  3DKY A;  4ZZD A;  1K4S A;  4U0Y A;  1Z3Y A;  1MMA A;  2BY3 A;  3QYF A;  1O4X A;  2QBY B;  2OTJ I;  4FX0 A;  2EV0 A;  1ETV A;  2Y0S N;  1R36 A;  3R0J A;  3CUQ C;  5DTD A;  4F7Z A;  2Z33 A;  1S7O A;  2RAE A;  1JXS A;  4PGH A;  1UAA A;  3IWZ A;  3K4K A;  1WRJ A;  1R1T A;  1QQI A;  4KUM A;  5CPR B;  3CZ6 A;  3WU1 B;  3RSN A;  1FEX A;  1X1P A;  2Y0S A;  2UZK A;  1LVK A;  1IRZ A;  4B4C A;  3IV5 A;  1HA8 A;  3H92 A;  3TO9 A;  2PN6 A;  1Z05 A;  3SXY A;  1DQU A;  5H6R A;  5H6Q A;  1IC8 A;  2EV5 A;  3OY9 A;  4PFP A;  5DS9 A;  1E3O C;  2L9V A;  1WGX A;  4PUS A;  3I58 A;  2B0L A;  2JA2 A;  1G3Y A;  4CYC B;  1L0O C;  2KQR A;  2EIJ H;  5E3L A;  5F64 A;  3HUG A;  5FB2 A;  1A31 A;  4XL9 A;  2VJJ A;  2PMZ N;  2QLZ A;  2P5V A;  1WPK A;  1ZGJ A;  1HOM A;  3K10 A;  3F8B A;  1YIO A;  4LLN A;  1FY7 A;  2DJI A;  2QQ9 A;  1W4M A;  4RLQ A;  3V42 A;  2D2W A;  2CRG A;  3MWM A;  1VQ5 I;  2JPB A;  5FRM A;  1PVE A;  2Y48 A;  4XLH A;  1SD4 A;  1N75 A;  3KP6 A;  1FP2 A;  2STW A;  2X6Y A;  3EDP A;  2CYY A;  3I3L A;  3D0S A;  3PFY A;  1SFE A;  3A2K A;  2WB1 N;  2XB5 A;  1WJC A;  2LR8 A;  2XRL A;  4Y7N J;  1TP4 A;  3HKZ A;  5L3G A;  2BEO A;  1XSX A;  9ANT A;  2CQN A;  2VXD A;  3HM5 A;  2F5C A;  3DF8 A;  3BPX A;  3CJQ B;  1Y1W J;  3TGN A;  2D1H A;  2ZJQ F;  1T08 B;  5DM7 F;  4RAZ A;  1HW1 A;  1IF1 A;  4A93 J;  4JX4 A;  2L9N A;  5BS6 A;  1BI2 A;  1TWG J;  3HRT A;  4CIC A;  4HBL A;  2P7C B;  4Y33 A;  1P4X A;  1EV7 A;  4AIH A;  5JHF A;  1MDM B;  2CQK A;  4HV5 A;  4LMY A;  5HOO A;  3HRS A;  2ZKZ A;  4BKX A;  4XSZ F;  3GUD A;  1V54 H;  4Y3O A;  3I4N J;  2PX9 A;  1GV5 A;  1Z67 A;  3CMM A;  2G9W A;  2YU3 A;  4EJT A;  3OIQ A;  5C3E J;  2Z9O A;  5F1R A;  1TL8 A;  1HLV A;  4XLA A;  3P7N A;  1HCR A;  3DU5 A;  2BY1 A;  3K4L A;  2ETH A;  1LFU P;  1V5G A;  2DMQ A;  2CFX A;  2IA0 A;  3JRA A;  1T95 A;  1IN4 A;  3QPL A;  2GAU A;  4BNC A;  5ILS A;  1FYL A;  4M3E A;  3CCQ I;  4YFX F;  3E6C C;  4PK4 A;  2DMN A;  4IZZ A;  4UVB A;  3PM1 A;  1H9G A;  2HNH A;  3B6A A;  2EPF A;  5DYM A;  1MNE A;  3S8P A;  2A07 F;  3CCJ I;  4IRG A;  3MCZ A;  1O3R A;  2WA0 A;  1MJB A;  3OMY A;  4JX5 A;  5JLW A;  2W48 A;  2OQR A;  1IN7 A;  1MSF C;  2EBI A;  3FMS A;  2EZI A;  2A61 A;  3H9J A;  5GAD J;  1APL C;  1ZRF A;  2P81 A;  3V7R A;  1Y8Q B;  3CDL A;  3G1M A;  2H8R A;  2XGD A;  4ENN A;  1EA3 A;  3VFZ A;  2E60 A;  3B6C A;  1ON2 A;  3TMO A;  4EAT A;  1XS9 A;  3L09 A;  1R23 A;  5FLX Z;  2BY0 A;  1MBE A;  4D5F A;  4L18 B;  5ERI A;  2ID3 A;  4A0X A;  4C3I J;  3TW6 A;  2X6O A;  2VE8 A;  1J75 A;  1IRF A;  2CUZ A;  3EPZ A;  3BWG A;  2DQR A;  1A04 A;  2K9S A;  2OJE D;  2R7D A;  3Q0W A;  2V9P A;  4RM3 A;  2VOO A;  1D1A A;  2ZME C;  1VQ6 I;  3OS2 A;  2R93 J;  4BGD A;  4P1W A;  3HOY J;  3RZD J;  1U78 A;  3J7Z I;  2V4J C;  1TQM A;  3S14 J;  3NRV A;  1K7A A;  3E6M A;  2QCO A;  2VT3 A;  2VIX A;  2VL8 A;  5HDN A;  2R5Y B;  1WWX A;  1EF4 A;  3RJP A;  3EQL F;  1QGP A;  1AOY A;  3MZY A;  1K6O A;  5FKL A;  3RTR A;  2QQA A;  3HEF A;  4IVN A;  2KIU A;  4B09 A;  1XC5 A;  2RDP A;  2PG4 A;  3E5U A;  3S3N A;  4HNV A;  1POG A;  3MD2 A;  1VQM I;  1QA6 A;  1BC8 C;  1MBH A;  3TED A;  3LSP A;  2R7Z J;  4E4H A;  5D5W B;  1XSV A;  2DFH A;  3P9C A;  2IEK A;  2LF7 A;  2R7O A;  2Y75 A;  1YQA A;  3GLL A;  2QBY A;  2QQ8 A;  4M9Z A;  4RA2 A;  1FLI A;  2GBY A;  5HLI A;  4FET A;  4L0Z B;  5J1U A;  2LYC A;  1UG0 A;  2EB7 A;  1SD7 A;  2PLY A;  2O5R A;  2KT0 A;  4M9S A;  4M73 A;  3CUQ A;  2PMU A;  3LSH A;  2KDO A;  2NVX J;  1VQK I;  3OYC A;  3EYY A;  3J80 K;  4TV7 A;  2EIL H;  3HXL A;  1LKX A;  1SFO J;  2DA2 A;  1SD5 A;  1OYY A;  3GZ5 A;  4HYE A;  4X6A J;  5J6X A;  1R7J A;  1ULY A;  2CJJ A;  1MNM C;  3G1L A;  4LD5 A;  2IPQ X;  4IF4 A;  2EIK H;  2VQL A;  4R1H A;  4DBR A;  4G6T B;  3OYL A;  3CTA A;  1V4R A;  4KN4 X;  3JAM K;  4FT8 A;  2GA1 A;  1AWC A;  3M1C A;  3HOV J;  5D4R A;  2NVY J;  4XM3 A;  4CYC A;  5DDG A;  4PSX A;  2M5W A;  1FMW A;  1VQN I;  1BL0 A;  2R7T A;  4WXH A;  4XLN F;  3OYG A;  3K7A J;  3HZJ A;  4U7B A;  3F3X A;  5E1Z B;  1Y56 A;  2RNJ A;  3CDI A;  3CJT B;  4AUX A;  1QZZ A;  3HSE A;  1BI0 A;  2XF7 A;  2HQR A;  4A3K J;  3L9F A;  1GXQ A;  3ZQG A;  2GXA A;  3WTW C;  2FU4 A;  3BPV A;  3PNY A;  2PJR B;  4RB1 A;  3ESW B;  4D1Q A;  4XON A;  4LLG F;  3KLN A;  2OCE A;  3EUK L;  3KEQ A;  1ODD A;  1V55 H;  3FX3 A;  4CCM A;  2WY8 Q;  1W1W E;  1ACI A;  3F6V A;  3KEY A;  4HAM A;  2KRC A;  2MD5 A;  2LY1 A;  3H3Z A;  2KHM A;  4UXN A;  4YFK F;  2EK5 A;  4CSW A;  3WOD F;  3DU6 A;  1J9I A;  2BXY A;  2HPM A;  3T8T A;  3BTI A;  1MDM A;  2W24 A;  3RKQ A;  2R3S A;  5F0H A;  2JPC A;  5J4V A;  4A3L J;  4M6Y A;  5E8G A;  1U8B A;  1ZRE A;  2H6B A;  4KYW A;  1M1E B;  4RMN A;  1H89 C;  4OU0 A;  2W1O A;  3LST A;  1PP8 F;  2OBP A;  4F91 B;  1QVU A;  5EZG A;  4XKB A;  4MHG A;  1K78 B;  1DP3 A;  3E3V A;  3I54 A;  3DPU A;  2KRF A;  2JSP A;  2L9S A;  3VYT B;  5ICC A;  2GM4 A;  4PJJ A;  3R4K A;  5IYB J;  1YLF A;  3ZQF A;  4MEX F;  1H88 C;  2Z16 A;  2OQG A;  4XLC A;  4Y17 A;  2XAS A;  2CQ7 A;  1Z91 A;  1R71 A;  2XKP A;  3I4P A;  4XRS G;  2O8X A;  5D6F A;  2MW8 A;  3T8R A;  1ZQ3 P;  2PBI A;  3G6E I;  4LLL A;  2IJL A;  4OAY A;  2LY2 A;  3HOZ J;  1E2X A;  3WGI A;  1TQP A;  2E5Z A;  4HDV A;  2F5D A;  5ILU A;  5DCF A;  1FOW A;  3J80 Z;  4ZDL A;  5L3F A;  1P7I A;  4UVA A;  1S5L C;  5BPI A;  1RPW A;  1VTN C;  3BTL A;  4Q47 A;  2BHY A;  2EZL A;  3UNG C;  3GTJ J;  1D1B A;  1Y1V J;  2KPM A;  5CQG A;  2JT1 A;  1FOY A;  2Y69 H;  2XRN A;  3JAM Z;  5F0C A;  2OC6 A;  1YJ9 I;  3S1Q J;  4CDG A;  4S05 A;  4BQN A;  4EVI A;  3ISP A;  2ESH A;  1B6A A;  5CLS A;  1RET A;  2CQX A;  3WTS C;  4G12 A;  2M45 A;  1KU9 A;  2DFF A;  2TCT A;  4JK1 X;  1JUM A;  1XMK A;  1D5Y A;  1WJE A;  4KIF A;  1JE8 A;  4RGX A;  2ZME A;  2X0L A;  1OFC X;  4GDF A;  4OOI A;  5BOX A;  5CQE A;  3NWT A;  3K0L A;  5HDK A;  3QPS A;  3FXJ A;  4RGU A;  2FQ3 A;  2R5Y A;  1K61 A;  5E3N A;  1GDT A;  3I5U A;  3PNT A;  3KYD B;  2DPU A;  2K3P A;  1MMN A;  1ZAR A;  2HOS A;  4HF0 A;  3BZ6 A;  5E1X A;  1YRN B;  3BQZ A;  3QP5 A; 
#chains in the Genus database with same CATH homology
 4GXO A;  3LA7 A;  3RKY A;  3ZMS A;  4AD9 A;  4KFC A;  3E5Q A;  1MGT A;  3I53 A;  2FMY A;  2BGC A;  1BIA A;  4ENK A;  2AXL A;  4K2E A;  2E1N A;  3PFI A;  2HKO A;  3BOQ A;  4G9Y A;  5D8L B;  4BHP A;  2PJP A;  1BI1 A;  3KP4 A;  1Y0U A;  3OOP A;  4WF2 A;  4OIO F;  1RNL A;  3S2W A;  5D4S A;  1RUN A;  3J81 K;  1YS6 A;  3J7A O;  2M87 A;  5CYV A;  4O5V A;  4PGG A;  1XCV A;  1S7A A;  4I0A A;  2VN2 A;  1EH7 A;  2A69 F;  4P5O A;  2IP2 A;  2RC4 A;  2VON A;  3F21 A;  4A6D A;  5KVR A;  1F5T A;  5LHI A;  1J5Y A;  5LGT A;  4H0E A;  2MH9 A;  2K02 A;  3LAJ A;  4UNO A;  2G7U A;  2EA2 A;  4L9V A;  4A5N A;  1LDJ A;  5ICG A;  1FP1 D;  2ZO4 A;  1B9N A;  1CGP A;  4L9J A;  5BQT A;  4MTE A;  1YS7 A;  2TDX A;  1TNS A;  4JQF A;  2Q8K A;  4ZYH A;  2BYV E;  2MH2 A;  3QPH A;  1WSU A;  3D5L A;  2ELH A;  1K78 A;  2O61 A;  3T1B A;  2FML A;  2CO5 A;  5K1Y A;  2IA2 A;  3I59 B;  3Q9S A;  3WE2 A;  1RZ4 A;  2HS5 A;  1SFX A;  3RDI A;  1XB4 A;  1KA8 A;  4N9H A;  2K27 A;  3CO6 C;  2IVM A;  3ZMT A;  4MGR A;  2EFQ A;  4WCG A;  3MAJ A;  2XGX A;  3Q9V A;  3ZN0 A;  1T2K A;  3LQQ A;  3WTX C;  3P9K A;  3WTV C;  1XCB A;  1HW5 A;  2WV0 A;  1IN8 A;  4RAY A;  3FXR A;  2A6E F;  4P55 A;  2RKH A;  2FF4 A;  2DW4 A;  1U5T B;  2HR3 A;  4KDP A;  4G7O F;  2LKP A;  5DD8 A;  5IT3 A;  3NEU A;  4Q4Z F;  3H3U A;  3QPT A;  4HQE A;  2XRO A;  1FBQ A;  2ZXJ A;  4Q48 A;  1IXS B;  4KMF A;  1TW3 A;  2XKO A;  1FWZ A;  2HOE A;  2OD5 A;  2COM A;  2UXX A;  1TW2 A;  2AS5 F;  1YO5 C;  2NS0 A;  4E70 A;  2QQB A;  2XUB A;  2FBH A;  3T5X A;  4HF2 A;  2CSO A;  1SMY F;  5LHG A;  4EQQ A;  1O57 A;  3GFM A;  1FNN A;  2ISY A;  4YIF A;  1JHF A;  1FYK A;  2QM3 A;  4GYG A;  3IL2 A;  4UV9 A;  4O3M A;  1J0R A;  4A6E A;  1XGN A;  3PQJ A;  2RV8 A;  1IAW A;  3RYP A;  2YR2 A;  5E1W A;  3KP5 A;  1W5T A;  5FLX K;  2HYG D;  2P5L C;  3WTZ A;  2WTE A;  1XGS A;  5L3B A;  4M9X A;  1XSD A;  2PFB A;  4RGS A;  1XD7 A;  2QYO A;  3SHF A;  4NHJ A;  4Q5S F;  1R58 A;  2K7L A;  3O2P E;  1ZG1 A;  2OZ6 A;  3AAF A;  1FC3 A;  4QWQ A;  4IRH A;  1ONV A;  3HTU A;  3L7W A;  4XRF A;  3GZ6 A;  2LNB A;  1OYW A;  2ACJ A;  2K4J A;  1KQ9 A;  1GHC A;  4OIP F;  2E7X A;  4BH9 A;  2M1B A;  2EFO A;  1O3Q A;  2DLL A;  3ERE D;  3GXO A;  4L5I A;  4AVP A;  5LGN A;  3GF2 A;  3M9A A;  4M71 A;  2OA4 A;  4BHC A;  5JI6 A;  2X4H A;  5E20 A;  5LHH A;  1HST A;  2KIF A;  3GYH X;  3FM5 A;  2H09 A;  1STZ A;  1LJ9 A;  4ESB A;  2VOD A;  2Q0O A;  1BM9 A;  4HX7 A;  3I59 A;  1SD6 A;  3FWE A;  4MTD A;  2L02 A;  1BN5 A;  5AIQ A;  3ZP5 A;  3ZN1 A;  1IZ1 A;  3PQK A;  1UCR A;  2C6Y A;  1XGM A;  1J7K A;  1FX7 A;  4GGG A;  2ESN A;  1ZAO A;  6PAX A;  2HZT A;  4HW0 A;  4HQM A;  1R1V A;  4WXD A;  2A6H F;  2VBW A;  1U5T A;  2HFH A;  1TBX A;  3DEU A;  1NHA A;  2L3D A;  2EWN A;  2QEN A;  2P6T A;  5HDG A;  4ESF A;  1D3Y A;  2GXG A;  2L54 A;  3WG9 A;  2V6C A;  1SMT A;  3M8E A;  3ZMV A;  3LFK A;  1LDK B;  5EEH A;  3RI4 A;  3W6J B;  2MC3 A;  3KFW X;  2A68 F;  2ZNZ A;  2P6S A;  4G6D A;  1OR7 A;  3WE3 A;  5DCM B;  4I0B A;  2FA5 A;  2H27 A;  2PQ8 A;  3IC7 A;  1K79 A;  4PCQ A;  1MKM A;  4EJU A;  3KP3 A;  3O6B B;  1FSH A;  2K86 A;  1W7P B;  4N0B A;  2BE5 F;  3U1D A;  3DPL C;  4KIG A;  4WXC A;  1MJ9 A;  1HKT A;  2QVO A;  2PI0 A;  1XN7 A;  2YX4 A;  1IXR C;  1MD0 A;  2YSR A;  2GXB A;  5ED4 A;  1FYM A;  2J5O A;  1FBU A;  1FPQ A;  3JSP A;  3K1M A;  5LRR A;  2NNN A;  2DPD A;  1KQ0 A;  4LG0 B;  4D0P A;  1HKS A;  5DEQ A;  3K9T A;  2ZFW A;  4WX9 A;  1IXC A;  3DFG A;  5AON A;  3F6O A;  2MA3 A;  2DI3 A;  1ZLJ A;  1LDD A;  2MBF A;  2L4A A;  5FO5 A;  3GEZ A;  3F72 A;  3KP7 A;  4RB2 C;  1HXD A;  3QAH A;  3TQN A;  2KJB A;  5BPD A;  5A2Q K;  3BJO A;  2VXZ A;  4HOB A;  5D5U B;  2XAJ A;  4CO8 A;  4UUV A;  4U88 A;  1YYV A;  4PDK A;  2UWM A;  3E6B A;  1TQI A;  1I1G A;  2VBX A;  3KZY A;  3DPT A;  3SQN A;  4LK1 F;  4G8X A;  5LGU A;  1I1S A;  4AWX B;  4L9N A;  2O0Y A;  4UV8 A;  4LB5 A;  1IN6 A;  4WK8 F;  2D45 A;  2UXN A;  4IPA A;  2W85 A;  4M74 A;  4A0Y A;  3CLO A;  1H0M A;  5HS9 A;  4I7H A;  1C0W A;  2STT A;  3ELK A;  3LA3 A;  5HLH A;  5JHU A;  2NAZ A;  2LDU A;  1Q1H A;  2V79 A;  4I2O A;  3E6D A;  5FGM A;  2MLG A;  2XAQ A;  5TRD A;  3CDH A;  4FX4 A;  1U8R A;  1UHM A;  1YW7 A;  4YII A;  1UHW A;  4EGY A;  1O3S A;  1JHH A;  1ZRC A;  5DCM A;  3JSO A;  1BBY A;  3KZZ A;  3F22 A;  2G7H A;  4ZH4 F;  3ECO A;  3ZQ7 A;  1UB9 A;  2EV6 A;  5L3C A;  4B8X A;  1T6S A;  3HSF A;  2EJR A;  4KMU X;  5A2Q Z;  5K5R A;  3N97 A;  3ML6 A;  1J59 A;  3ZMZ A;  4OIQ F;  3FM3 A;  1F9N A;  4LJZ F;  1HSJ A;  1ZYR F;  2BV6 A;  2DK5 A;  5DUK A;  2Q2E A;  4HZF A;  5LEK A;  2HWV A;  1P4A A;  5CVU A;  3M8F A;  3LAP A;  4KIB A;  2CG4 A;  4XBF A;  2EFW A;  2V9V A;  5HS8 A;  1P4W A;  1GVJ A;  1YG2 A;  3O3K A;  1HQC A;  4ZYE A;  3SZP A;  5J8C A;  2DTR A;  2E7W A;  4OIR F;  4DQ2 A;  1S8N A;  1ZN2 A;  4IRI A;  4L5J A;  3R61 A;  1Z7U A;  2FNP A;  1BI3 A;  2O6G E;  2OAZ A;  4ENJ A;  1ZG3 A;  2F2E A;  4I01 A;  2E1C A;  4HF1 A;  3WGG A;  4IHS A;  2GZW A;  2H94 A;  5LRS A;  3QRF F;  3SFZ A;  3CO7 C;  2LSO A;  1W7P D;  4HX8 A;  3IRQ A;  1B1B A;  3TOB A;  3KEO A;  1U2W A;  4AIK A;  2J5P A;  1R1U A;  1FT9 A;  4GYI A;  2DK8 A;  5CVI A;  2K4B A;  3L00 A;  1ZHF A;  3F8N A;  1WKM A;  2Z3Y A;  1ZGA A;  3JTG A;  4HX4 A;  1GXP A;  2YX7 A;  1QO0 D;  3IWF A;  3F8C A;  3CJN A;  2XAG A;  1LQ1 A;  1QPM A;  1T0F A;  3FXU A;  3R6S A;  1XDU A;  2FE3 A;  1P92 A;  2CGP A;  3K1N A;  3T0Y A;  3F23 A;  3DP7 A;  3BP8 A;  4KIC A;  2ADU A;  2A3S A;  4P9F A;  4G6Q A;  4JBA A;  3HRM A;  1U5T C;  3RKX A;  1F4K A;  3ZMD A;  2FXA A;  3LA2 A;  5ICF A;  1Z6R A;  1XMA A;  4EJO A;  4OMZ A;  3QU3 A;  2V1X A;  4IHT A;  2F5F A;  2WC2 A;  3EYI A;  3MFK A;  2FSW A;  3Q5F A;  1YFH A;  1I5Z A;  3HTS B;  1LEB A;  1USS A;  2HEO A;  2QZ8 A;  3MEX A;  3IRR A;  1RIO H;  1LVA A;  2IRF G;  1O7L A;  1CF7 B;  4CHU A;  2IW5 A;  3EUH A;  4WWC A;  4L0Y B;  4BHB A;  3FZV A;  3W6K B;  1R00 A;  4RB0 A;  2L4M A;  5D5V B;  1S3J A;  4Y13 A;  1ZH5 A;  1KYW A;  3GO5 A;  2VT2 A;  3C1D A;  3V8J A;  2VOP A;  3C3W A;  2DQL A;  2EFP A;  3K1P A;  4G7Z F;  4EJW A;  3BY6 A;  1FSE A;  1KGS A;  3C7J A;  1REP C;  5IT9 K;  4MQ9 F;  4UVC A;  3RPQ A;  3I0T A;  3CUQ B;  3SZT A;  5LBQ A;  2VBY A;  2IT0 A;  3I71 A;  1JGS A;  4DNC A;  5FFX A;  2EFN A;  1O3T A;  1HW2 A;  3L2C A;  1B4A A;  3VOE A;  3GFL A;  2DO7 A;  4IXA A;  3JW4 A;  4KNY A;  2GIV A;  1H9T A;  1DPU A;  1J2X A;  3GVA A;  5E18 F;  3TDU C;  1D8J A;  4I09 A;  4A0Z A;  2HGC A;  4U7D A;  3U2R A;  1KU2 A;  1T98 A;  2V1D A;  2W25 A;  1LB2 A;  4KN7 X;  4ZZL A;  2HDC A;  4ZYG A;  3HRU A;  3BDD A;  2FBK A;  4BYY A;  4CXF A;  3G3Z A;  4G7H F;  1TLH B;  3M7G A;  3ZPL A;  1KU3 A;  4KA4 A;  3K2Z A;  1W5S A;  1HBX G;  5FD6 A;  2IA1 A;  4Z2Y A;  3ABU A;  4GO1 A;  5LLQ A;  5D5X B;  5IT9 Z;  1QNT A;  2P7V B;  2L01 A;  2DFI A;  4UHT A;  3REO A;  4NQW A;  1KYZ A;  2FRH A;  2PMH A;  5K5Q A;  1UST A;  3TKY A;  3FXQ A;  3V7C A;  2HTS A;  4HLX A;  1CF7 A;  3KET A;  1S6L A;  4BAY A;  3QOP A;  2OZU A;  3RPU A;  2ZME B;  3QP6 A;  4CGZ A;  1SAX A;  1WQ2 A;  5CJ9 A;  4NB5 A;  2QWW A;  2KIM A;  3I64 A;  1T38 A;  1HKQ A;  1IRG A;  3ABT A;  5DUI A;  4P9U A;  3GX4 X;  2XAF A;  4AIJ A;  3HYI A;  3ROU A;  1PDN C;  4HA8 A;  3R60 A;  1U3E M;  2HKX A;  3FF5 A;  4XLP F;  3GFI A;  2ISZ A;  1UFM A;  3TDZ C;  3WU0 A;  1BC7 C;  1Z6T A;  3VB2 A;  4CYD A;  2XAH A;  1ZRD A;  2ZNY A;  5BMZ A;  1QZY A;  4XSX F;  1FBS A;  2Z99 A;  3NQO A;  4R79 A;  1DP7 P;  3TOA A;  2YPR A;  1IN5 A;  1B59 A;  1G4D A;  5ILV A;  5JR3 A;  2GA2 A;  3F8F A;  5TJJ A;  2NRA C;  1FOK A;  2WWY A;  4MQV A;  2NNY A;  3WTY C;  3G73 A;  2DT5 A;  1YW8 A;  2OU2 A;  2P4W A;  3BJA A;  4I98 B;  3V8K A;  1RUO A;  4N9I A;  4ETS A;  3LWF A;  2M30 A;  5CVV A;  3IKV A;  4A12 A;  4HDU A;  2JZY A;  3FMQ A;  1Z1D A;  3ULQ B;  1P6R A;  5JFR A;  2LF8 A;  1B9M A;  3E97 A;  4U0V A;  4M6X A;  1RI7 A;  5ICE A;  3WGH A;  4LFU A;  1P2F A;  4G94 A;  3K69 A;  3FHZ A;  3TO6 A;  5JVT A;  1XDS A;  3M1E A;  2M8E A;  2DBB A;  2ZBK A;  2W84 A;  1U6G A;  1YW9 A;  3GWZ A;  3C18 A;  4EM1 A;  3DXJ F;  4OIN F;  3MZH A;  4R8H A;  1YTY A;  3MQ0 A;  1MZB A;  4OMY A;  5HLG A;  1DPR A;  4ZYD A;  1MJA A;  1SFU A;  3LQR A;  5DV5 A;  2EA4 A;  2HTJ A;  3KCC A;  5D8K B;  1LNW A;  3R0A A;  4P96 A;  2H6C A;  3VOD A;  3DKW A;  2ZJ2 A;  4ASN A;  1O7F A;  3VEP A;  4EJV A;  2JSC A;  1FZP B;  3HOS A;  4U0W A;  2BBY A;  1R22 A;  3HSR A;  4GCV A;  2XHK A;  2VC1 A;  3BRO A;  1R5H A;  1W7P A;  5F6F A;  2NYX A;  2XIG A;  4M72 A;  3ECH A;  4HV6 A;  4EM2 A;  2RQP A;  4YFN F;  2GWR A;  2RN7 A;  5CVR A;  2FBI A;  3GLX A;  3RYR A;  2Y0M A;  1PUE E;  4KT5 C;  3B73 A;  1T39 A;  3FMR A;  1G3T A;  3TO7 A;  1BIB A;  2F5E A;  3GW2 A;  4YG2 F;  5E17 F;  5L3E A;  2HYF A;  1TNT A;  2JTV A;  2O3F A;  1S29 A;  2XV4 S;  5K5O A;  1G6N A;  3BJ6 A;  4Y15 A;  3KLO A;  4EV0 A;  4LG0 A;  4EM0 B;  4CZZ A;  5J8F A;  4I02 A;  5HS7 A;  1EH6 A;  5CVJ A;  2FOK A;  4L9T A;  1IUY A;  1EH8 A;  5AIP A;  1XGO A;  1QBJ A;  2KJC A;  2DU9 A;  2W57 A;  1V3F A;  5D6E A;  3HHH A;  4RB3 C;  3QU6 A;  3KP2 A;  5FFZ A;  3HOT A;  4HLY A;  1TTY A;  3JTH A;  4BXU A;  5KK1 A;  1OYI A;  2PEX A;  1OKR A;  4A5M A;  2P5K A;  3GFJ A;  2XVC A;  2V1U A;  3RKW A;  3KE2 A;  2JRT A;  3IKT A;  3HHG A;  3EET A;  1KU7 A;  3WTU C;  3COA C;  4LGW A;  4RS8 A;  3CUO A;  3WTT C;  4FHT A;  1D8K A;  2P8T A;  2A5Y B;  1WI9 A;  4RGR A;  1DUX C;  2VC0 A;  2KKO A;  4O6J A;  1ZLK A;  1LEA A;  2QUF A;  1ON1 A;  1BOA A;  3V8L A;  2FEZ A;  3ZMU A;  5HVQ C;  1I6X A;  5H20 A;  2MLK A;  4QLC U;  3B02 A;  2DAO A;  1R5G A;  2CWE A;  4ESJ A;  2RVC A;  1ZG5 A;  1X3U A;  2O03 A;  4PZJ A;  4EGZ A;  1PP7 U;  3F8M A;  3OV8 A;  3DQV C;  1D5V A;  1OPC A;  1F1Z A;  3RIR A;  5EEG A;  1G3W A;  2ZCW A;  2GQQ A;  2CW0 F;  3J81 Z;  3HIF A;  4IJA A;  1L3L A;  2VBZ A;  1KQ8 A;  2HQN A;  4ON0 A;  4LK0 F;  3N4M A;  3P9I A;  2R7F A;  1DDN A;  1OMI A;  2FNA A;  1Z9C A;  1G3S A;  4MNU A;  5E8I A;  3E5X A;  3IHU A;  4BQA A;  3V4G A;  2D1V A;  3DV8 A;  2RGV A;  1IW7 F;  2VE9 A;  1BJA A;  4A2U A;  5DD4 A;  4S04 A;  1E17 A;  4LB6 B;  4MEY F;  5LEJ A;  3V7S A;  5FD5 A;  2Z5U A;  1I27 A;  3U9G A;  4EMS A;  5L3D A;  4ZZD A;  4U0Y A;  2QBY B;  4FX0 A;  2EV0 A;  2Z33 A;  3R0J A;  1R36 A;  3CUQ C;  4F7Z A;  1JXS A;  1S7O A;  4PGH A;  3IWZ A;  1WRJ A;  1R1T A;  1QQI A;  4KUM A;  3WU1 B;  2UZK A;  3H92 A;  3TO9 A;  2PN6 A;  1Z05 A;  3SXY A;  5H6R A;  5H6Q A;  2EV5 A;  3I58 A;  2B0L A;  1G3Y A;  1L0O C;  5F64 A;  3HUG A;  5FB2 A;  2QLZ A;  2P5V A;  1ZGJ A;  3F8B A;  1YIO A;  4LLN A;  1FY7 A;  2QQ9 A;  1W4M A;  2D2W A;  3MWM A;  2JPB A;  2Y48 A;  1SD4 A;  3KP6 A;  1FP2 A;  2STW A;  3EDP A;  2CYY A;  3D0S A;  1SFE A;  5L3G A;  2BEO A;  1XSX A;  2F5C A;  3DF8 A;  3BPX A;  3TGN A;  2D1H A;  4RAZ A;  1HW1 A;  1IF1 A;  5BS6 A;  1BI2 A;  3HRT A;  4CIC A;  4HBL A;  2P7C B;  1P4X A;  1EV7 A;  4AIH A;  1MDM B;  2CQK A;  4HV5 A;  4LMY A;  5HOO A;  3HRS A;  2ZKZ A;  4XSZ F;  3GUD A;  2G9W A;  2YU3 A;  4EJT A;  2Z9O A;  5F1R A;  3P7N A;  2ETH A;  2CFX A;  2IA0 A;  1IN4 A;  2GAU A;  4BNC A;  5ILS A;  1FYL A;  4YFX F;  3E6C C;  4UVB A;  1H9G A;  5DYM A;  2A07 F;  4IRG A;  3MCZ A;  1O3R A;  1MJB A;  2OQR A;  1IN7 A;  3FMS A;  2A61 A;  1ZRF A;  3V7R A;  4ENN A;  3VFZ A;  1ON2 A;  3L09 A;  1R23 A;  5FLX Z;  4L18 B;  5ERI A;  4A0X A;  2VE8 A;  1J75 A;  1IRF A;  2DQR A;  1A04 A;  2R7D A;  3BWG A;  2VOO A;  1U78 A;  1TQM A;  3NRV A;  1K7A A;  3E6M A;  2VT3 A;  5HDN A;  1WWX A;  3RJP A;  3EQL F;  1QGP A;  1AOY A;  3MZY A;  1K6O A;  3RTR A;  2QQA A;  4IVN A;  2KIU A;  4B09 A;  2RDP A;  3E5U A;  2PG4 A;  1BC8 C;  5D5W B;  1XSV A;  3P9C A;  2LF7 A;  2Y75 A;  1YQA A;  2QBY A;  1FLI A;  4M9Z A;  4L0Z B;  5HLI A;  2EB7 A;  1SD7 A;  2PLY A;  4M9S A;  4M73 A;  3CUQ A;  2PMU A;  3EYY A;  3J80 K;  4TV7 A;  1SD5 A;  1OYY A;  3GZ5 A;  4HYE A;  5J6X A;  1R7J A;  1ULY A;  4LD5 A;  2IPQ X;  4IF4 A;  4R1H A;  3CTA A;  1V4R A;  4KN4 X;  3JAM K;  4FT8 A;  2GA1 A;  1AWC A;  5D4R A;  5DDG A;  2M5W A;  4WXH A;  4XLN F;  4U7B A;  3F3X A;  5E1Z B;  2RNJ A;  1QZZ A;  3HSE A;  1BI0 A;  2HQR A;  3L9F A;  1GXQ A;  3WTW C;  2FU4 A;  3BPV A;  4RB1 A;  4LLG F;  3KLN A;  3KEQ A;  1ODD A;  3FX3 A;  3F6V A;  4HAM A;  2MD5 A;  3H3Z A;  4UXN A;  4YFK F;  2EK5 A;  3WOD F;  1J9I A;  3T8T A;  1MDM A;  2W24 A;  2R3S A;  2JPC A;  4M6Y A;  5E8G A;  1ZRE A;  2H6B A;  4KYW A;  4OU0 A;  3LST A;  1PP8 F;  2OBP A;  4MHG A;  1K78 B;  3E3V A;  3I54 A;  2KRF A;  5ICC A;  3R4K A;  1YLF A;  4MEX F;  2OQG A;  4Y17 A;  2XAS A;  1Z91 A;  2XKP A;  3I4P A;  2O8X A;  5D6F A;  3T8R A;  2PBI A;  4LLL A;  2IJL A;  1E2X A;  3WGI A;  1TQP A;  4HDV A;  2F5D A;  5ILU A;  5DCF A;  3J80 Z;  5L3F A;  4UVA A;  5BPI A;  1VTN C;  4Q47 A;  2JT1 A;  2XRN A;  3JAM Z;  4S05 A;  4CDG A;  4EVI A;  3ISP A;  2ESH A;  1B6A A;  5CLS A;  3WTS C;  2M45 A;  1KU9 A;  4JK1 X;  1XMK A;  4KIF A;  1JE8 A;  4RGX A;  2ZME A;  2X0L A;  4OOI A;  5BOX A;  3K0L A;  5HDK A;  4RGU A;  2FQ3 A;  3I5U A;  2DPU A;  1ZAR A;  4HF0 A;  3BZ6 A;  5E1X A;  4ENM A;  3QP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...