2PFBA

Structure of oxidized ohrr from xanthamonas campestris
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
136
structure length
129
Chain Sequence
LLQLDNQLCFALYSANLAMHKLYRGLLKALDLTYPQYLVMLVLWETDERSVSEIGERLYLDSATLTPLLKRLQAAGLVTRTRVIIALTETGRALRSKAGAVPEQVFCASASSLDELRQLKQELEKLRSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator OhrR
publication title Structural Mechanism of Organic Hydroperoxide Induction of the Transcription Regulator OhrR.
pubmed doi rcsb
source organism Xanthomonas campestris
molecule tags Transcription regulator
total genus 41
structure length 129
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2pfbA00
3H3UA 3HSFA 4CYDA 4YIIA 2HKXA 3F6VA 2EFNA 1HQCA 2G7HA 2EFOA 3QRFF 2X0LA 2VBXA 4KNYA 1XGOA 4IHTA 4GO1A 4ETSA 1HSJA 1I5ZA 3DP7A 5D8KB 3V7CA 3T1BA 4L9VA 2MD5A 1W4MA 1KQ8A 4LMYA 3T8TA 4U7BA 3DEUA 2VT3A 3ECOA 4IPAA 3C3WA 2QWWA 1HBXG 2Q0OA 4ENKA 3CO7C 3ZMSA 3O2PE 2VE9A 2XVCA 1WKMA 3G73A 1FC3A 2VT2A 3U9GA 2JPBA 1QGPA 4KUMA 5DCFA 3BPXA 3W6JB 1O3QA 2M8EA 4P96A 2W57A 2P6TA 3IWFA 3V8KA 2FMYA 5CVVA 1FLIA 2G7UA 1ZG5A 4DQ2A 4N0BA 3T8RA 4M73A 1YYVA 2EFQA 2M1BA 4U7DA 4AIHA 1ZRFA 5ILVA 3GFJA 1O57A 2JT1A 2FQ3A 3R61A 1FSHA 4WF2A 3ISPA 3J81K 4MEXF 2MA3A 5F64A 3ELKA 2XAJA 4NQWA 2IA0A 1U3EM 2OZ6A 3VOEA 2VONA 1W7PA 1L0OC 1F4KA 5BS6A 4Q4ZF 3CUQA 3GWZA 2QBYA 4KICA 1U5TC 3FF5A 1R22A 5DCMA 1MD0A 1QZYA 1R36A 2RC4A 2Y0MA 2L02A 5E20A 2P7CB 1K7AA 3I54A 5H6RA 1YG2A 2STWA 2ETHA 3I53A 1R23A 1BI1A 1DDNA 2O8XA 3C1DA 2D2WA 1Z7UA 2FSWA 4I09A 1P92A 2CO5A 3K1PA 4EM0B 1IXCA 1XGSA 4AWXB 1H9TA 1U5TB 3T5XA 3M8EA 3TO6A 5HDNA 1S3JA 2UZKA 5ILSA 1IAWA 1JHHA 4Q5SF 2F5DA 1D8KA 2E7XA 1ULYA 4MTEA 3FM5A 4XRFA 2NYXA 2V1UA 2HQRA 4WXCA 1TW2A 1CGPA 4A5NA 1GXQA 1R58A 2JTVA 3ABUA 1MJBA 1UHWA 1FP1D 2ISYA 1QO0D 3GEZA 4CDGA 3RPQA 2VXZA 2ACJA 5E8GA 3KZZA 4G7OF 2ZCWA 2HWVA 2MH2A 1J59A 1BIBA 3TQNA 2HOEA 3HIFA 5ERIA 4OMYA 1XD7A 5AIQA 4HLXA 2L54A 4NHJA 2PN6A 1KU3A 1ZN2A 2BE5F 4WXDA 4EJVA 1IN8A 4LG0A 3F3XA 4M9ZA 1ZLJA 3HTUA 3JAMK 5L3DA 3K0LA 4XBFA 3VFZA 4G94A 3GFIA 1HKTA 1YLFA 4ESJA 2V1DA 1J2XA 2F5CA 2PMUA 1KYZA 1G3WA 3IRRA 4RGRA 3VODA 1DPUA 4CGZA 4ZZDA 2A69F 4P5OA 1HKSA 3IWZA 4OIPF 1EH8A 1SD4A 4N9IA 4P55A 4HF2A 3K9TA 3BZ6A 2NRAC 1ZGAA 5FLXK 3JSPA 2IA2A 3IL2A 3HSRA 2J5PA 2CG4A 2HGCA 4U0WA 2DFIA 4KT5C 4RB1A 3VEPA 1ZG1A 2VBZA 1OYIA 1BC8C 2BEOA 2FE3A 1B4AA 3FWEA 2VBYA 2A68F 4U88A 2FXAA 2K4JA 5BOXA 5FGMA 4LJZF 4KMFA 4UVCA 2L4AA 4A0ZA 4IJAA 1L3LA 4RS8A 2CW0F 1FYLA 2RDPA 4ZYEA 4HQMA 5D4RA 4PZJA 5D4SA 4G9YA 1DUXC 4A0YA 4QLCU 2EA2A 2IW5A 5HLGA 2ESNA 4ZYDA 1Z91A 5D8LB 2PEXA 2B0LA 3TGNA 3GXOA 3HRTA 3TOAA 5HDKA 2GA2A 4FX0A 2FNAA 3WU0A 2DQLA 2MH9A 3BJ6A 3HRSA 4EJWA 3KLNA 2XAHA 4HW0A 3PQKA 2OU2A 3TO7A 1QZZA 2M87A 4UNOA 4Q47A 1YS7A 1J9IA 1BOAA 1PUEE 3FMQA 4UVAA 5CVJA 1S29A 2YU3A 2P6SA 1HW1A 4M71A 1T98A 4WK8F 1V4RA 4FHTA 3K2ZA 5L3EA 3G3ZA 3ZMUA 5AONA 3RKXA 4UVBA 2QQ9A 4BXUA 5A2QK 1KQ0A 3PQJA 2UXXA 3GZ5A 1UB9A 1T2KA 1I27A 3KP5A 3H92A 1U2WA 2KIFA 4HA8A 3Q9VA 2E7WA 3E6BA 3L2CA 3BDDA 3L9FA 1BN5A 2BGCA 3NQOA 2MBFA 5F1RA 4CZZA 2Q8KA 3EYYA 3GF2A 2PMHA 1FOKA 3M1EA 3MEXA 2ZNYA 2HS5A 4H0EA 1OR7A 1W7PD 4A2UA 1QQIA 4O6JA 2DK8A 5DUIA 3P7NA 4GYGA 5HS7A 3IHUA 3M9AA 4PGHA 5LHIA 3F23A 2VN2A 3HTSB 4U0VA 2EV6A 3WTTC 1K6OA 2XUBA 4Y17A 2D1VA 2QENA 5HVQC 5L3CA 4F7ZA 4RGUA 4L9JA 3DF8A 1I1SA 1TTYA 2M5WA 2XIGA 4G7HF 4ENJA 3COAC 1W7PB 2IVMA 4UHTA 1GHCA 1KU9A 1YQAA 1C0WA 2HKOA 3CUQB 2NNYA 3F72A 5DCMB 3ZMTA 2FF4A 3KP6A 4HQEA 2IJLA 2LSOA 2P7VB 1F9NA 1OKRA 1O3SA 2IRFG 4YIFA 2DLLA 4UV9A 3V7RA 2VODA 2VOPA 2WV0A 1RI7A 4KIFA 3DXJF 4EM2A 2CWEA 1IXRC 2CQKA 4HX8A 1WRJA 4S04A 3MAJA 1RZ4A 5DD8A 1R5HA 1P2FA 2XASA 4JQFA 1FBSA 1XDSA 2EFWA 1SAXA 5ICCA 5DDGA 5J8CA 2PBIA 5L3FA 4JBAA 2ZKZA 1SFUA 1B9NA 4EVIA 2XROA 5FFZA 2V79A 4KN7X 3V8LA 5E1WA 3WTSC 4M9SA 1MKMA 4JK1X 5LGTA 3I4PA 1AOYA 3K1MA 3WE3A 5D6FA 2IP2A 4P9UA 3BP8A 4GGGA 1FYKA 3FMRA 4LLGF 4MGRA 3HHHA 4EJUA 1BBYA 3ULQB 1MJ9A 4MQ9F 4Y15A 4LG0B 1BIAA 1E2XA 4KN4X 1D3YA 3WTYC 3HHGA 4G8XA 3DV8A 2HFHA 2FMLA 2HR3A 2GIVA 4ENMA 2E1CA 3WODF 3KFWX 3TOBA 4YFKF 2GQQA 5IT9K 1R1UA 3E5XA 2KRFA 1EV7A 3K1NA 2TDXA 4ASNA 1BM9A 1ON1A 4EV0A 1YS6A 1JE8A 1OYWA 2L4MA 4FX4A 5ILUA 4LB5A 3JSOA 4WCGA 1TQIA 2P5KA 2O61A 5LRSA 2PLYA 1W5TA 3E5UA 5F6FA 3RYPA 5E18F 2HZTA 3GZ6A 2DPDA 4IRGA 1A04A 3REOA 3CO6C 2DTRA 4IRHA 4ZYHA 1XMKA 3GX4X 3GVAA 1JHFA 4BNCA 2P5LC 1FSEA 3FHZA 2YX4A 4KMUX 2FRHA 1R7JA 5CJ9A 4GYIA 2ZXJA 1R1VA 4KIGA 1U78A 2ZFWA 2O6GE 5DEQA 2F5EA 1KU7A 4EM1A 2QM3A 5IT9Z 1ON2A 2XAFA 3WTUC 3ZP5A 2DU9A 3BWGA 3I58A 2L3DA 3ABTA 2EB7A 3M7GA 1XN7A 2K86A 1Z05A 1REPC 1XMAA 2ZBKA 3SQNA 3ZQ7A 2Z5UA 4ESFA 3WGHA 1GXPA 3RKYA 3KZYA 5J6XA 2VOOA 4KYWA 4B09A 1TNSA 5JVTA 2K4BA 3L00A 4L9TA 2EWNA 1KA8A 3BROA 4OIOF 4I0BA 1HW2A 3MFKA 4M6YA 1KU2A 4G6DA 4LB6B 1X3UA 4MEYF 5KVRA 4OOIA 5ICFA 3E6CC 2QQBA 1LNWA 1D5VA 3ROUA 4BH9A 5K5QA 1Z9CA 1T38A 1G3SA 1YIOA 2P5VA 1RUNA 2M45A 1IXSB 3DQVC 4LGWA 2W85A 5FO5A 3DPTA 1BI3A 3WTWC 1UCRA 2KJBA 1XB4A 2OA4A 1MGTA 4BYYA 4MTDA 2W25A 1HSTA 4HF0A 1J5YA 2H09A 1OMIA 1B6AA 4L5IA 1ZRDA 5FD6A 2A6HF 2Y75A 5ICEA 1J7KA 2H6CA 1IZ1A 5EEHA 2VC1A 4GCVA 2PFBA 4UV8A 3JTGA 3ZN0A 3L09A 4AIJA 4MNUA 1IN6A 5JI6A 3MZHA 4BAYA 1MZBA 3MCZA 5L3GA 3B73A 4M9XA 4IHSA 1U8RA 2IPQX 1W5SA 3CJNA 3RYRA 2WWYA 3Q5FA 4EGZA 5JHUA 1S6LA 2FBKA 4BHBA 4LFUA 4LK1F 2LDUA 5DYMA 3R4KA 3K69A 5LEJA 2P8TA 3GUDA 2D45A 1XDUA 1T0FA 4EJTA 2ESHA 2QLZA 4EJOA 3WGIA 2PI0A 2RVCA 1FBUA 1TLHB 2VE8A 2R7FA 1KQ9A 1FBQA 5FD5A 4HYEA 4A6DA 1UHMA 2A3SA 3HYIA 3LA3A 2A07F 2A61A 1P4XA 1IRFA 5CLSA 4PCQA 3V8JA 2RNJA 1HW5A 3I5UA 5LHHA 1FYMA 4A6EA 4EGYA 2OBPA 3F8CA 2AXLA 4AD9A 4Z2YA 5D5WB 4OIRF 2NAZA 3Q9SA 3FMSA 4XSZF 3ZMVA 5D6EA 2MC3A 5BMZA 1IN7A 1CF7A 2FA5A 3QP6A 2YPRA 3V7SA 1TBXA 4NB5A 1R00A 1RIOH 1XCVA 2R3SA 2ELHA 4HF1A 3KE2A 5HDGA 2DT5A 1LDJA 1USSA 5TRDA 4IRIA 4WXHA 3LFKA 3N4MA 2JSCA 1S7OA 3R6SA 3I59B 1Z6TA 3SZTA 2OQGA 3ZN1A 3VB2A 3RTRA 4UUVA 1SFXA 5E17F 4HBLA 1TQMA 3W6KB 1OPCA 2GWRA 5D5XB 1UFMA 2DW4A 5K1YA 1YO5C 3RI4A 2CSOA 3LA2A 3N97A 4E70A 4L18B 2P4WA 2IA1A 1EH6A 5HLIA 5HS8A 2G9WA 3BJAA 1O3TA 1LJ9A 2OAZA 4LD5A 2DAOA 3LQQA 1B9MA 4AIKA 2CYYA 1Q1HA 1ZGJA 4I98B 3HRUA 4CO8A 4L9NA 5DD4A 3EYIA 1K79A 1FY7A 2QUFA 4ON0A 1O7FA 3LWFA 2Z99A 4G6QA 1T6SA 2OQRA 4B8XA 3CUOA 2GXGA 2MLGA 4KFCA 2KIMA 2Z3YA 2DK5A 2LF8A 3E6DA 2ADUA 1J0RA 3WE2A 1Y0UA 2LF7A 5LBQA 2HTJA 3D0SA 2JZYA 4N9HA 2DPUA 3OV8A 1NHAA 2O03A 5LLQA 3GLXA 1PDNC 3QU6A 2H6BA 3ML6A 2VBWA 3GO5A 2QQAA 1P4WA 3WG9A 3S2WA 3JTHA 4RGXA 3J80Z 4O5VA 4BHCA 2DI3A 4XSXF 1DP7P 4M6XA 1Z6RA 1QNTA 2F5FA 1J75A 1MDMA 3KEQA 2KIUA 2Z9OA 2XKOA 2LNBA 2GZWA 3RDIA 3SZPA 2Q2EA 4WX9A 1ZYRF 4HV5A 2LKPA 2ZMEA 1D8JA 5FFXA 5CVIA 1IRGA 4XLPF 3H3ZA 2ZO4A 4I2OA 3D5LA 3I59A 4WWCA 2EA4A 2RN7A 4RAZA 4S05A 3LAPA 1LDKB 3HUGA 5DUKA 1FZPB 1FP2A 2W84A 2DQRA 4CHUA 2V6CA 1BJAA 5J8FA 3EUHA 1FPQA 3F22A 2EK5A 4R8HA 4BQAA 3TDUC 5CYVA 3QAHA 1H0MA 2FBIA 3FZVA 1STZA 2EFPA 3E6MA 3ZMZA 3WGGA 1IN5A 4CXFA 3HSEA 2FBHA 3SXYA 2EJRA 1I1GA 2H94A 3GYHX 3TDZC 4YG2F 4O3MA 4HAMA 1LEAA 1IN4A 1JGSA 2QVOA 5ED4A 4IVNA 1YW9A 1SMYF 4XLNF 3MQ0A 1XSXA 1XGMA 4YFNF 4G7ZF 2UXNA 3R60A 1LB2A 2ZNZA 1TW3A 3DKWA 5JFRA 1USTA 3FXRA 5TJJA 3T0YA 4KDPA 2BYVE 4HX7A 3AAFA 3RPUA 5K5OA 2OZUA 3C7JA 2BV6A 4U0YA 3E5QA 2C6YA 4ZZLA 2UWMA 2CFXA 1BI2A 1FNNA 2ZJ2A 3JW4A 5E1ZB 3BPVA 4KA4A 1WSUA 2V1XA 5LGUA 4L5JA 1WI9A 2JPCA 4LLLA 3EETA 2KJCA 4AVPA 4GXOA 3SHFA 5LGNA 2A6EF 3I71A 1DPRA 4LK0F 3GFLA 1ZG3A 1T39A 5ICGA 3RKWA 1XSVA 1ODDA 3FXQA 4DNCA 5DV5A 3KEOA 4RB2C 4HOBA 3LAJA 3GFMA 5FB2A 5CVRA 3U2RA 2XRNA 4UXNA 4ENNA 2K7LA 4EQQA 1VTNC 2RGVA 3QOPA 2A5YB 5H20A 4QWQA 3J81Z 5BPIA 1PP7U 1KGSA 4A12A 2E1NA 4OINF 2BBYA 3MWMA 1CF7B 3F6OA 4LLNA 2H27A 3KETA 3RJPA 2MLKA 2Z33A 2NS0A 5BQTA 5HOOA 1B1BA 3IRQA 1BI0A 3IC7A 1TNTA 2W24A 5HLHA 4M74A 1R1TA 5CVUA 1ZAOA 1SD7A 2FEZA 3EDPA 3KP7A 3R0JA 3E97A 5LEKA 4L0YB 3P9KA 3GW2A 2M30A 2QZ8A 1G3TA 1SD5A 1FT9A 5EEGA 2OD5A 3KP4A 1KYWA 2X4HA 2XGXA 3KP2A 1LEBA 1HXDA 1YFHA 1B59A 3NRVA 4M72A 5K5RA 5KK1A 3C18A 3BOQA 1F5TA 3WU1B 3NEUA 3QPHA 1ZREA 4HV6A 1U6GA 5LHGA 3P9CA 4YFXF 2XAQA 3FM3A 3V4GA 5AIPA 2AS5F 3HOSA 5D5UB 3LA7A 3ZPLA 3O3KA 1LVAA 2NNNA 2HYGD 4R79A 4ZH4F 1HKQA 1G6NA 2O3FA 4OU0A 4I0AA 1SFEA 3F8BA 3MZYA 2GAUA 5HS9A 1U5TA 2YR2A 4HDVA 1AWCA 2HTSA 1ZARA 3JAMZ 1OYYA 1QPMA 3KCCA 3L7WA 1XCBA 1TQPA 3LSTA 4CICA 4ZYGA 4I02A 2HEOA 4I01A 3B02A 1K78B 3DFGA 4HX4A 2PJPA 2PG4A 1R5GA 5E8IA 2RV8A 4RGSA 3F8NA 1FWZA 2YSRA 2R7DA 4Y13A 1LDDA 6PAXA 3RIRA 1S7AA 4RAYA 3WTZA 4OIQF 3F8MA 2EV5A 4KIBA 1MDMB 5FLXZ 4HZFA 2F2EA 3I64A 1ONVA 4EMSA 3CTAA 3TKYA 3WTVC 4HLYA 1SD6A 5IT3A 2K02A 1XGNA 1G3YA 2VC0A 3I0TA 3M8FA 3QPTA 1JXSA 3FX3A 3F21A 3ERED 1ZLKA 4P9FA 2ZMEB 4PDKA 5JR3A 2QYOA 1G4DA 2FOKA 5L3BA 2EV0A 3KP3A 4HDUA 3HOTA 4PGGA 2STTA 1YW7A 3OOPA 1I6XA 1ZRCA 3WTXC 2YX7A 3ZMDA 4L0ZB 4MQVA 4RB0A 4RB3C 2RKHA 1FX7A 3QU3A 2PQ8A 3J80K 1F1ZA 3FXUA 4Q48A 2J5OA 3CDHA 4A0XA 1ZH5A 2K27A 3PFIA 1Z1DA 4FT8A 2GXBA 4IXAA 2XHKA 1IF1A 1SMTA 2CGPA 1ZHFA 2V9VA 3EQLF 2XAGA 3HRMA 1IUYA 2FNPA 2WTEA 4IF4A 5E1XA 2DO7A 1YTYA 5H6QA 2WC2A 2HYFA 3BJOA 4OMZA 2HDCA 3LQRA 2FU4A 5D5VB 1WQ2A 1RNLA 3E3VA 4A5MA 2GA1A 1EH7A 3CUQC 1BC7C 1MJAA 4MHGA 3BY6A 1LQ1A 3P9IA 1IW7F 1QBJA 3DPLC 3J7AO 4ESBA 3U1DA 1E17A 4BHPA 2HQNA 2ISZA 2XV4S 2IT0A 2Y48A 4R1HA 1S8NA 1P6RA 4K2EA 5A2QZ 1XSDA 5LRRA 3KLOA 1K78A 3F8FA 1YW8A 4TV7A 3CLOA 4D0PA 3R0AA 3IKTA 5BPDA 3SFZA 3QP5A 1GVJA 2D1HA 1PP8F 2QBYB 2JRTA 2L01A 2DBBA 1O3RA 1WWXA 1V3FA 2XKPA 1P4AA 1H9GA 2KKOA 3IKVA 2COMA 3O6BB 2RQPA 2O0YA 1RUOA 3ECHA 4I7HA 3TO9A 1O7LA
chains in the Genus database with same CATH superfamily
3H3UA 2VI6A 3HSFA 4CYDA 4YIIA 2NVQJ 4GFBA 2HKXA 4PJLA 3F6VA 2NXNB 1AA7A 2VQLA 2EFNA 1HQCA 2BXYA 4ZJZA 2G7HA 2EFOA 1HF0A 2IEKA 4C3HJ 2ELJA 3QRFF 2ICWG 2X0LA 2OV7A 2VBXA 4KNYA 1XGOA 2M0MA 4IHTA 4W1UA 4GO1A 4PUSA 1BW6A 4ETSA 2F4IA 1HSJA 2BY1A 4XRMA 1I5ZA 1X1CA 3DP7A 5D8KB 3V7CA 3T1BA 2O5RA 2IS6A 4L9VA 3I4NJ 2MD5A 2OJED 3SEZA 1VQ4I 3BG7A 2BZTA 2KP6A 3CCRI 1X58A 4E7LA 1W4MA 1KQ8A 5KAIC 4BXXJ 4LMYA 3LSPA 4PJNA 3T8TA 1APLC 2NS7A 3F9KA 4M6VA 1IGNA 4XLCA 5GTIC 4U7BA 3DEUA 1QHHD 4XMYA 5KCMA 1V55H 2VT3A 3ECOA 4IPAA 2HPMA 2HU9A 3C3WA 2QWWA 4HSTA 2DA2A 3VPRA 3S3OA 2Q0OA 1HBXG 2E71A 4ENKA 3CO7C 3TW7A 3RQIA 3ZMSA 3O2PE 2DA5A 4HEA2 5EZHA 1DGRM 2VE9A 1K4TA 3JREA 4HRIA 4IO9F 2XVCA 1WKMA 3G73A 4CCLA 5FKKA 1FC3A 2VT2A 5JVGF 3U9GA 1MH3A 2ECBA 4BQNA 4ZTJA 5J40A 2JPBA 1QGPA 2E36A 4KUMA 5DCFA 3BPXA 3W6JB 1O3QA 2M8EA 4CCMA 4P96A 2KISA 2W57A 2BXZA 1K83J 2P6TA 4E4HA 2LH9A 3IWFA 3V8KA 3S15J 2FMYA 3UNGC 5KAFC 5CVVA 1FLIA 1S7EA 3PSFA 1PJRA 2G7UA 1ZG5A 4DQ2A 4N0BA 2X1CA 3T8RA 4BE2A 4M73A 3TBIA 5IP7J 3BQYA 1YYVA 2EFQA 2KPMA 2M1BA 3BZCA 4M3BA 5IYDJ 1Z77A 4U7DA 3I9V2 4X1EA 4AIHA 1ZRFA 5ILVA 1DQUA 3GFJA 2AXTC 1O57A 1FIAA 2JT1A 2FQ3A 1O4XA 3R61A 1E0EA 1FSHA 4WF2A 3ISPA 3J81K 2ZXIA 4MEXF 3OMYA 2PJRA 2MA3A 5F64A 3AG2H 1QZEA 3ELKA 2XAJA 2L7FP 4NQWA 1TP4A 2IA0A 1U3EM 4YEJA 2BVLA 2OZ6A 3LMMA 3VOEA 2VONA 1MBHA 4AM3A 1W7PA 5IP9J 2W00A 3FKIJ 1L0OC 1F4KA 3HPGA 3G1OA 5BS6A 4Q4ZF 3JRFA 3GBGA 3CUQA 3GWZA 1NTCA 1RESA 2QBYA 2BY0A 1U9NA 1U5TC 4KICA 3FF5A 1R22A 5DCMA 2D5VA 1MD0A 1QZYA 1R36A 2RC4A 1A5JA 2Y0MA 3FDYA 2L02A 1ORKA 5E20A 3SEQA 1DGWY 3U21A 2P7CB 1K7AA 4AVZA 3HBLA 3PNVA 3H5RA 3I54A 1M1EB 2GBYA 5H6RA 1YG2A 2STWA 2ETHA 1W36D 3I53A 1R23A 1BI1A 1DDNA 2O8XA 2VXDA 3Q3SA 1OISA 3HXLA 3C1DA 5DM6F 3BR3A 2D2WA 2WAFA 1Z7UA 4N4OB 2FSWA 3DLLF 4I09A 4IHXA 1P92A 2CO5A 3K1PA 1P9QC 1X2NA 4EM0B 1IXCA 1SVOA 3DPUA 1XGSA 4AWXB 1H9TA 1U5TB 3T5XA 3M8EA 1D0ZA 3TO6A 3S3MA 5HDNA 1S3JA 3OIOA 2UZKA 5ILSA 4NBQA 2RNGA 1IAWA 3OL3A 1LFPA 2BHYA 4IQ4A 4J19A 1JHHA 4Q5SF 2F5DA 1D8KA 4FETA 2BY3A 2E7XA 2VLAA 4HPQA 1QA6A 1ULYA 3SFIA 4E7JA 1MMSA 4MTEA 3FM5A 4XRFA 5FJ8J 4DBQA 2EZLA 3NWTA 2K9MA 1R5ID 2E1MC 2NYXA 3JRAA 2V1UA 3QYBA 1CQTA 2HQRA 4WXCA 1TW2A 3BR2A 1CGPA 4A5NA 1GXQA 2O7OA 1R58A 2JTVA 3ABUA 1MJBA 1UHWA 3K4LA 1FP1D 2ISYA 4E7SA 3CC4I 1QO0D 3GEZA 4CDGA 3RPQA 2VXZA 2ACJA 2Z1DA 5E8GA 3KZZA 4G7OF 2ZCWA 2V7FA 1FTTA 2HWVA 4KITB 2MH2A 1JTYA 3OR2C 1J59A 3K10A 1UJ8A 1BIBA 2HOEA 3A0HC 3BTCA 3HIFA 3TQNA 1N78A 5ERIA 1YIJI 5KHDA 4OMYA 4DYCA 1XD7A 5AIQA 2E60A 4HLXA 2L54A 1IJWC 4NHJA 4BKXA 1WZ2A 2PN6A 1TWCJ 2RQQA 1KU3A 1ZN2A 3JR9A 2X85A 4KT6A 2HOAA 2BE5F 5M3MJ 2E1MB 4NUBA 3DU5A 4WXDA 3CJQB 4EJVA 3LOCA 1IN8A 4LG0A 3OYKA 5M5XJ 3ZQHA 3F3XA 4M9ZA 1ZLJA 2CQXA 3JRDA 4Y52J 3HTUA 3GTJJ 4IL6C 4XICA 3JAMK 2R0QC 3PIPF 5L3DA 3K0LA 4DOZA 3M4OJ 4XBFA 3OYMA 4D5FA 2NOJB 1BW5A 3VFZA 3CCQI 2QKLB 1X3ZB 2O9LA 4G94A 3GFIA 1ZQ3P 2MG4A 1HKTA 2VB6A 4B44A 1YLFA 1JI8A 4ESJA 2KRCA 2R4GA 5GAEJ 2V1DA 1J2XA 2F5CA 3BR1A 5KNLA 2PMUA 1KYZA 2I8DA 3HG9A 2CMPA 2DMNA 1G3WA 2KMUA 3IRRA 5GP9A 1F36A 3LSKA 4RGRA 3VODA 1DPUA 3JRIA 1HOMA 1OR7C 4ZZDA 4CGZA 4ZDLA 1QVUA 2A69F 4P5OA 1HKSA 3IWZA 1PVEA 4OIPF 1EH8A 1SD4A 2R5ZB 1HC8A 4N9IA 2EQRA 2CUJA 1MW7A 4P55A 2KHMA 4Y33A 4BY7J 1UG0A 2R7XA 3ZXSA 2M2EA 2JA5J 4CSWA 4HF2A 3K9TA 2W82A 3BZ6A 2QQ8A 1ZGAA 2Y31A 4HSRA 2OCCH 3JSPA 2IA2A 4G12A 3OYJA 2HXOA 3IL2A 5FLXK 3HSRA 2J5PA 1VNDA 3TL4X 2CG4A 2HGCA 4U0WA 2DFIA 4KT5C 4II2A 2Y9YA 4RB1A 3VEPA 1ZG1A 2VBZA 3H35A 1OYIA 2OUMA 3QPLA 1BC8C 2BEOA 3K4JA 2DYRH 2NVUB 2FE3A 3BQZA 2X6OA 1B4AA 3FWEA 2VBYA 4BUPA 2A68F 2R7TA 2CFOA 4U88A 2FXAA 4A69C 5C4JJ 3HEFA 2LY1A 2ZJPF 1AHDP 2DN0A 3DCFA 2K4JA 5BOXA 5FGMA 3PNYA 1D5YA 2A6TA 4LJZF 4KMFA 4UVCA 2I10A 2L4AA 3MVPA 4A0ZA 4IJAA 1L3LA 4RS8A 2CW0F 2LKXA 1FYLA 2HOTA 1R4NB 2H1LA 2A05A 1E3HA 2R7QA 1GVDA 2RDPA 3KYLA 4ZYEA 1P7JA 4HQMA 2AHQA 5D4RA 4PZJA 1MMAA 2JUGA 3LFUA 5D4SA 4G9YA 1DUXC 4FE7A 4A0YA 4XKWA 4QLCU 3CMYA 3Q0VA 2EA2A 2IW5A 5HLGA 3QOEA 1BR2A 3EUKL 2ESNA 3JCUC 4ZYDA 3OYAA 3OYIA 1Z91A 3K4CA 3HJEA 3ONQA 5D8LB 4PJMA 2PEXA 4J01A 2B63J 1VI0A 2IAIA 1QRYA 2B0LA 5E3MA 1YJWI 3TGNA 4CCJA 3GXOA 1H89C 2V9PA 4J00A 3HRTA 3TOAA 5HDKA 2EILH 2Z16A 2V26A 2GA2A 4FX0A 1VQNI 2FNAA 4A3JJ 3WU0A 1UG2A 2DQLA 2MH9A 2W4SA 3KZIC 3BJ6A 3HRSA 3FXKA 4EJWA 2LC2A 3KLNA 2XAHA 4HW0A 3PQKA 2OU2A 3TO7A 1FOWA 3SDBA 2ZJQF 1DU0A 1FMWA 1QZZA 2M87A 4IZZA 3CF2A 4Q47A 1VQOI 4UNOA 1UZCA 1YS7A 1J9IA 2L9VA 1BOAA 1PUEE 3S1MJ 3FMQA 3H5AA 4XOTA 2L9NA 4OWRB 2CUZA 4UVAA 3RZOJ 4FE4A 5CVJA 1S29A 4BDYA 1IC8A 2YU3A 2GOXB 2P6SA 1HW1A 3FXLA 2VJJA 4M71A 2JRMA 1T98A 4WK8F 1V4RA 2VQGA 1MNDA 1TT5B 2XF5A 4FHTA 3IAS2 3K2ZA 1TZLA 4A3CJ 3S1RJ 5L3EA 4RDUA 3G3ZA 3S16J 3ZMUA 4Y4RA 1X1BA 4FCYA 5AONA 3RKXA 2QKMB 3OS0A 4UVBA 2QQ9A 4BXUA 4D7NA 1KQ0A 2FD5A 5A2QK 2XC7A 1IRXA 4IHYA 3FXJA 3PQJA 2K3PA 2UXXA 4ZTFA 2M7AA 3GZ5A 1UB9A 3VDXA 2DFEA 4BEHA 1ZKGA 2JQ7A 4BJTA 1T2KA 3GLLA 1VQKI 3GTKJ 1I27A 3D5RC 3KP5A 3HPHA 3CMEI 3H92A 1U2WA 2KIFA 4RA2A 1MSEC 2FUG2 3E1SA 4HA8A 3Q9VA 3OS2A 1RPWA 3W2WA 2QF7A 3D5SC 2E7WA 3EUAA 2R5ZA 3UKGA 1B72B 5LD2C 3E6BA 1QHGA 2E2IJ 5J1YA 3OYCA 3L2CA 1POGA 1NK3P 3BDDA 3L9FA 1BN5A 1D0XA 2BGCA 3AG4H 3BG6A 3HZJA 2EZHA 2GM4A 3NQOA 4E7IA 2MBFA 5CPRB 1RETA 5F1RA 4CZZA 2Q8KA 5EDNA 2LLKA 3H9GA 3EYYA 3GF2A 2XF6A 4LIVA 2EH3A 2PMHA 1FOKA 3M1EA 3MEXA 1IG7A 1Z21A 2ZNYA 1BJZA 2HS5A 2LYCA 4H0EA 3TMOA 1XMXA 1OR7A 1W7PD 4A2UA 3C2BA 1MMGA 2TRTA 1QQIA 1Y0NA 4O6JA 1K6YA 2DK8A 3IH4A 3OWTA 2ZSIB 4FASD 5DUIA 3P7NA 4GYGA 5HS7A 1U0JA 2DCEA 3IHUA 1SFOJ 3LNQA 3PM1A 5EGOA 4P1WA 3M9AA 4CUGA 4PGHA 5LHIA 1ETWA 2X6WA 3F23A 2VN2A 2B9SA 3HTSB 4U0VA 1VQPI 2EV6A 3WTTC 1YJNI 2V9KA 1K6OA 2XUBA 4Y17A 2ZFUA 3S1NJ 3H36A 2D1VA 2QENA 1MBGA 4C9YA 5HVQC 2M7BA 5L3CA 1W5CC 3CDLA 3FIWA 4F7ZA 4RGUA 4L9JA 3DF8A 1I1SA 3GTQJ 4NQWB 1TTYA 2M5WA 1K4SA 2XIGA 3WG7H 4G7HF 4ENJA 1FTZA 3COAC 4OAYA 1W7PB 2IVMA 4UHTA 1GHCA 2HI3A 1KU9A 1YQAA 1C0WA 3CUQB 2HKOA 2NNYA 2Z2SB 3F72A 5DCMB 3ZMTA 2FF4A 3A4CA 3KP6A 2NS8A 4HQEA 5M5WJ 2IJLA 3J7AY 2LSOA 2P7VB 1F9NA 1OKRA 2ELKA 1O3SA 4DBRA 2IRFG 4A3BJ 4YIFA 1JKPC 2DLLA 4UV9A 3V7RA 2VODA 3OYBA 2VOPA 4NC6A 2WV0A 1RI7A 2HVRA 3RQ4A 4JOMA 2P0WA 4KIFA 2F5VA 3DXJF 2DOFA 2KRHA 3W2VA 3JRHA 4EM2A 4C2TA 2CWEA 2X6YA 2DFHA 5FKOA 1IXRC 1WH5A 2CQKA 4HX8A 1WRJA 4C30A 3I3LA 2K85A 4S04A 5HNFA 1G59A 4CH7A 3MAJA 4F93B 2QSHX 2HDDA 1RZ4A 5DD8A 1R5HA 5E3OA 1P2FA 3MN2A 3L2VA 2H8RA 2XASA 4JQFA 5GTHC 4RLFA 1FBSA 1XDSA 2EFWA 1SAXA 5ICCA 5DDGA 2K9QA 5B66C 1EA3A 5J8CA 3W2AA 4AC0A 2PBIA 5L3FA 4FISA 3ZQGA 1BR4A 4JBAA 2M4GA 1HDPA 2ZKZA 2W48A 1SFUA 1B9NA 4DYRA 4EVIA 2QEXI 2IGKA 4KISA 2XROA 1B72A 5FFZA 1Y6IA 2V79A 4KN7X 3V8LA 2NVTJ 1GT0C 4HNUA 5E1WA 4DZPA 1X4OA 4GDFA 1WH7A 1HA8A 3WTSC 3HOVJ 4M9SA 4M3DA 1MKMA 4JK1X 1SVLA 5LGTA 3I4PA 1AOYA 3ERMA 3K1MA 3WE3A 2MFZA 2VJ4A 5D6FA 2IP2A 3KEYA 1RR8C 5IYBJ 4P9UA 3BP8A 1WGXA 3ZOBA 1I6HJ 3ZQLA 4GGGA 2MC4A 1FYKA 3FMRA 1XX5A 2COBA 4LLGF 4MGRA 1A6QA 3HHHA 1N25A 4EJUA 1BBYA 4QPQA 3ULQB 1MJ9A 3C2GA 4MQ9F 3VSLA 4X0GA 4Y15A 5F0CA 1N75A 4LG0B 1BIAA 1E2XA 2X1EA 4KN4X 1D3YA 2DFFA 2X6XA 3HHGA 4G8XA 3DV8A 3WTYC 1PYVA 2FMLA 2HFHA 1R9TJ 2HR3A 2GIVA 4ENMA 2E1CA 1YOVB 3WODF 1BR1A 3KFWX 3TOBA 4YFKF 2GQQA 1QU3A 5IT9K 1R1UA 3E5XA 1SVMA 2LOOA 1OCPA 1V5FA 2DJNA 2M34A 3NWSA 5HODA 5M5YJ 2A5WA 4BJ6C 2WB1A 1V5EA 2KRFA 4MFDA 3ASOH 1EV7A 3K1NA 1VZ0A 2TDXA 5HLTA 4ASNA 1BM9A 1ON1A 2LP0A 1MNEA 4C2UA 3PL8A 1I50J 4PFOA 3ZCOA 4EV0A 4XKCA 2XSJC 1OQYA 1YS6A 1JE8A 1OYWA 2L4MA 1NG7A 4FX4A 5ILUA 4ITVA 4II3A 4LB5A 5IOZA 4D1QA 3DBHB 2QSGX 3ZQFA 3CJTB 3HGGA 2XB0X 3L2UA 3JSOA 3VSKA 4PJJA 4WCGA 1TQIA 4EATA 2P5KA 2O61A 5LRSA 3IH2A 2PLYA 1W5TA 3A2KA 1IRZA 3E5UA 1MBEA 5F6FA 2EZKA 3RYPA 3CCYA 5E18F 1KONA 3DTIA 3S2DJ 1TWGJ 2HZTA 3GZ6A 3W3CA 2E19A 5C3EJ 2DPDA 4IRGA 3A03A 4IOAF 2Y0SN 1A04A 1T0FC 1YI2I 3REOA 3CO6C 5F0FA 2DTRA 4IRHA 5FLMJ 2VUMJ 4ZYHA 1XMKA 4NC7A 2CV2A 3JRCA 3GX4X 3GVAA 1JHFA 2OCEA 1GUUA 3HC7A 3JRGA 3H3VK 1LFUP 4BNCA 3H5NA 2P5LC 2KDZA 1FSEA 2YX4A 3FHZA 4KMUX 2FRHA 2IGOA 1R7JA 4JX4A 5CJ9A 5EJCA 4BY1J 2H1KA 2BW3A 4GYIA 2ZXJA 2O8KA 1R1VA 1VFCA 3OYGA 3I56I 1IV8A 4KIGA 1U78A 2ZXWH 3M3YJ 2ZFWA 2O6GE 5DEQA 2F5EA 1ETQA 5JLWA 5J3LA 1KU7A 4EM1A 2QM3A 5IT9Z 3H9JA 3H9QA 1ON2A 2WV1A 2XAFA 2MABA 3WTUC 3ZP5A 2DU9A 3BWGA 4IKFA 3Q0WA 1MBKA 2XF7A 2Y30A 3I58A 2MD0A 3PJRA 3G1MA 4BQQA 2L3DA 3ABTA 3JRBA 4XLFA 3VYSB 2EB7A 3M7GA 1XN7A 2MW8A 2K86A 1Z05A 3MD2A 4XLHA 1REPC 1XMAA 2ZBKA 3BT9A 1R71A 1MBFA 3SQNA 4YIRX 1J09A 3ZQ7A 2Z5UA 4B48A 4ESFA 1UELB 1RRJA 3WGHA 3CC2I 2JVHA 4XK4A 1GXPA 4A3KJ 2DMPA 3HOWJ 1MMNA 2DDAA 4XKVA 5DS9A 3RKYA 3KZYA 3ZR8X 5J6XA 2VOOA 4KYWA 4B09A 4DIQA 1TNSA 2DA6A 5JVTA 2K4BA 4RBOA 3L00A 4L9TA 4F52A 2EWNA 2R7SA 5B5EC 1KA8A 3BROA 3GTPJ 3OYLA 4OIOF 4I0BA 1HW2A 2Y2ZA 3MFKA 1JUSA 4M6YA 3L2WA 2PX9A 4LOCA 1ZR2A 1KU2A 4G6DA 4LB6B 1SFKA 1X3UA 4MEYF 5KVRA 4OOIA 5ICFA 3E6CC 2AO9A 2QQBA 1LNWA 1D5VA 3ROUA 4BH9A 5H2FC 2M4KA 5K5QA 1Z9CA 1T38A 1G3SA 1YIOA 2P5VA 2OF7A 4Z6YA 1RUNA 2CU7A 2M45A 1IXSB 3DQVC 3PUFA 4LGWA 3G71I 2W85A 1K61A 5FO5A 3DPTA 1BI3A 3WTWC 1LE8B 1UCRA 2KJBA 1XB4A 1JUMA 1WCMJ 2OA4A 3E0JB 4AYBA 1MGTA 4BEHB 4BYYA 4PFPA 1HDDC 1E3PA 4MTDA 2W25A 1VQMI 3IH3A 1HSTA 2CH0A 4HF0A 2M0CA 1J5YA 3DBLB 2H09A 3A01B 1OMIA 5K7ZA 1B6AA 4L5IA 3MKWB 1FOXA 1ZRDA 5FD6A 3CC7I 2A6HF 2Y75A 5ICEA 1J7KA 2H6CA 2B7EA 1IZ1A 5EEHA 2VC1A 4GCVA 4D5CA 5J1UA 2LVSA 2PFBA 4BBRJ 2DMTA 5BNGA 4UV8A 3BG9A 1Z3YA 3JTGA 3SZGA 3ZN0A 1BA5A 3L09A 4AIJA 2NVYJ 4MNUA 1ZGWA 1IN6A 5C4XJ 1SAUA 3A0BC 2R7UA 5JI6A 3MZHA 4BAYA 1MZBA 3MCZA 5L3GA 3B73A 3HOZJ 2KQRA 4E7HA 2K9NA 4M9XA 4IHSA 1U8RA 2IGNA 3FBIB 1ZELA 1TWHJ 2IPQX 4NC8A 2DA7A 2MGQA 1W5SA 3CJNA 1ITYA 3RYRA 1IDZA 2WWYA 3Q5FA 4EGZA 4RAFA 2ID3A 1YE9A 2CQNA 2DOEA 3IUOA 5JHUA 1S6LA 2E2JJ 2QCOA 2DA3A 2FBKA 4BHBA 2KFDA 4F92B 4LFUA 3CJRB 4LK1F 2LDUA 5DYMA 5EGOB 3R4KA 1ENHA 2BY2A 3K69A 5LEJA 2P8TA 3GUDA 2D45A 1WJCA 1XDUA 2CV0A 1T0FA 4EJTA 2ESHA 4PJ0C 4ANJA 2QLZA 4EJOA 3WGIA 4QIWN 3X2QH 2PI0A 2RVCA 1FBUA 1TLHB 2PMZA 2HOSA 3UR3C 4F55A 1RKTA 2VE8A 2R7FA 2VASA 1B8IB 4BE1A 1KQ9A 1S5LC 3S2HJ 1MSFC 1A35A 1FBQA 3H0GJ 5FD5A 3RZDJ 3VYRB 4HYEA 4A6DA 1ETVA 2IS2A 1UHMA 2A3SA 3HYIA 3LA3A 5JLXA 2A07F 2HYJA 3K2AA 2A61A 3MMYB 1VQ8I 1P4XA 1IRFA 5B1BH 1T08B 5CLSA 3W6VA 2VKVA 4PCQA 9ANTA 2JK3A 1T8IA 3V8JA 2CV1A 2XGDA 4B3XA 2RNJA 1HW5A 5J4VA 4BL0B 3I5UA 4JX5A 5LHHA 1V5GA 1FYMA 4UB8C 2CUFA 4A6EA 4EGYA 1KZHA 2OBPA 3KYCB 3F8CA 2AXLA 4AD9A 4Z2YA 5D5WB 2Y0SA 2NAZA 4OIRF 1YJ9I 2ZMEC 3Q9SA 3FMSA 2F6CA 4L5EA 2Y69H 4XSZF 3ZMVA 4CCNA 3AG3H 5D6EA 2MC3A 5BMZA 3CCEI 1JGGA 1IN7A 1CF7A 2FA5A 1MBJA 2FX0A 3QP6A 2YPRA 3V42A 3CCSI 2WB1N 5B3SH 2OPTA 4MFEA 1WFXA 2I5UA 3V7SA 2LG4A 2WY8Q 3S93A 2DDBA 1TBXA 3QPSA 4NB5A 4OAZA 1VQ5I 1R00A 1RIOH 1XCVA 2R3SA 3BTLA 2ELHA 1EF4A 3OSGA 4HF1A 3KE2A 5HDGA 4YELA 1LE8A 2R5YB 2Q2EB 2DT5A 1LDJA 1USSA 4V2GA 5TRDA 2E1OA 1FMVA 3EUHC 4RM3A 1SANA 4IRIA 4WXHA 3LFKA 2M8GX 3TP3A 2F4OB 4KJZA 4B4CA 3N4MA 1WJFA 2CS3A 2VKDA 3A01A 2LREA 1X3WB 2JSCA 1S7OA 1ZK8A 1SC7A 3R6SA 3WHCA 1HLVA 3I59B 1Z6TA 2K5CA 5F0HA 3SZTA 1T95A 2OQGA 3ZN1A 3VB2A 3RTRA 3SDGA 2R7RA 3OYFA 1SFXA 3GZNB 3HUGB 4UUVA 2M3AA 4HBLA 5E17F 1Z0XA 3ZRGA 1TQMA 3W6KB 2EINH 1OPCA 2GWRA 5D5XB 1UFMA 2DW4A 4DZJA 1OLTA 5K1YA 1YO5C 1I3QJ 2HNHA 5K7HA 3RI4A 2CSOA 4BE0A 3O8HA 1GDTA 5FLVA 3LA2A 3KIOA 3N97A 3C2HA 4XL9A 5F04A 4E70A 5B1AH 1Y39A 4L18B 1Y1VJ 2N8GA 2P4WA 2IA1A 3OYDA 1EH6A 5HLIA 5HS8A 2NRAC 5DM7F 3CCMI 2X48A 1Z3XA 2G9WA 4A3EJ 1MIJA 3BJAA 1O3TA 1WJ5A 1LJ9A 4F91B 4JP0A 2OAZA 1LKXA 1W0UA 3CD6I 4LIUA 4LD5A 2DAOA 2L2OA 1B9MA 3LQQA 4C3JJ 4AIKA 2CYYA 3BR5A 1OCTC 1Q1HA 1UHSA 1ZGJA 3KX2A 4I98B 2JA8J 3HRUA 4CO8A 5IOYA 1JKQC 3OL4A 4XOPA 4L9NA 4LITA 4H4KC 1TT0A 2V1NA 2WY7Q 3BR6A 1OCZH 5EF6A 4V2FA 5DD4A 3EYIA 2ME0A 1ERDA 1XC5A 2XB5A 2L5QA 5EZGA 1K79A 1FY7A 1U9OA 3K70C 2QUFA 4ON0A 2JN6A 1O7FA 3HKZA 3SJMA 3LWFA 2Z99A 2CRGA 4G6QA 3OYEA 1T6SA 2OQRA 4B8XA 3CUOA 1MH4A 1Z67A 2GXGA 2MLGA 3RKQA 1B8IA 4KFCA 2V4JC 1IV6A 3TW6A 3D1NI 1T33A 2KIMA 2WAQA 2Z3YA 2DK5A 2LF8A 2QSFX 3ABMH 2ADUA 1J0RA 3E6DA 3WE2A 1Y0UA 2XAUA 4UUSA 2CQQA 2LF7A 2LR8A 5LBQA 4B43A 2HQ5A 1S9HA 2HTJA 3D0SA 2JZYA 4N9HA 2DPUA 3OV8A 3CMMA 3OY9A 1NHAA 3DEEA 4BACA 1YHQI 3S17J 2O03A 5LLQA 3DU6A 4I76A 3GLXA 2WAEA 4BJ5C 1PDNC 5M3FJ 3CDIA 5FRMA 2DTZA 3QU6A 2H6BA 3ML6A 2VBWA 5GAHJ 3GO5A 2MYSA 2IBDA 2QQAA 2R93J 1P4WA 3WG9A 3S2WA 3F0CA 1JTXA 2DA1A 3JTHA 4RGXA 1DU6A 1ETOA 4O5VA 3J80Z 2L7MP 4BHCA 3AFHA 1AU7A 2DI3A 4XSXF 1DP7P 4YRVA 2EIMH 1Z6RA 4M6XA 1QNTA 3OIPA 3P5JA 2DOAA 2F5FA 3M1CA 4ZYAA 2ZSHB 1J75A 1G2HA 3N05A 1Y56A 2BW3B 4D9JA 1MDMA 3KEQA 3J7ZI 2KIUA 3K4NA 2Z9OA 4XN0A 2DXIA 1BOBA 2XKOA 2LNBA 3ESWB 1TWAJ 4AYBN 5EG0A 2GZWA 3RDIA 2K3FA 3SZPA 3ZQQA 2VQHA 2CJJA 2Q2EA 2R5YA 4WX9A 1ZYRF 3B6CA 4HV5A 1R49A 3DWLE 2LKPA 3ASNH 4X6AJ 2ZMEA 5F08A 1D8JA 2P81A 5FFXA 5CVIA 3S8PA 1IRGA 5CKTA 4XLPF 4JX6A 3H3ZA 5E3LA 5IP6A 4CZCA 2ZO4A 4I2OA 3D5LA 3I59A 2F48A 4WWCA 2EA4A 4PSWA 2RN7A 4RAZA 4S05A 3HOUJ 3LAPA 2JVGA 1LDKB 3BG3A 5IY5H 4HNVA 3HUGA 5DUKA 4CCOA 1Y1WJ 1FP2A 1FZPB 2HVSA 2HXIA 2W84A 2DQRA 4UUTA 4CHUA 2V6CA 1BJAA 3S1QJ 5J8FA 3EUHA 4JYKA 2E35A 2KZGA 2DA4A 2R7VA 2KIQA 1FPQA 3ZQIA 3OYNA 3F22A 2EK5A 4R8HA 4BQAA 3TDUC 5CYVA 4A3GJ 3QAHA 1H0MA 5FROA 2FBIA 3FZVA 2LD5A 1STZA 2EFPA 1X1PA 3E6MA 2JSPA 2VKHA 2W7NA 3ZMZA 3WGGA 2LKSA 3VYUB 4M3FA 2GIZA 1FIPA 1IN5A 4CXFA 3HSEA 2FBHA 1EJ9A 3SXYA 5E79C 2EJRA 1I1GA 3GCMA 1WVRA 2H94A 2ZC2A 3GYHX 3TDZC 4YG2F 4O3MA 4HAMA 1LEAA 1BL0A 3ABLH 1IN4A 3MKYB 2PMZN 1JGSA 2QVOA 5ED4A 1JJ6C 4IVNA 4IEJA 1YW9A 1GV5A 1SMYF 3S32A 1LVKA 4S0HB 1RKWA 2LTPA 1D1BA 4XLNF 3MQ0A 3WHBA 2ME6A 1A6IA 1XSXA 1XGMA 1IO2A 2WADA 4YFNF 4CYCA 4G7ZF 3PO3J 2UXNA 3DLAA 4XIDA 5FKLA 3OOUA 1D0YA 3R60A 4XLEA 1LB2A 4ZDOA 3S3NA 2ZNZA 3BTJA 1TW3A 4CA0A 3DKWA 4UY8I 5JFRA 1JT0A 1USTA 3FXRA 2XDVA 5TJJA 3T0YA 4KDPA 2BYVE 4HX7A 2DODA 2JA7J 3AAFA 1LPQA 2L7ZA 3RPUA 4BGDA 5K5OA 2OZUA 3GTMJ 5K7FA 3C7JA 1UMQA 2BV6A 4U0YA 3LL7A 1S72I 1VQLI 1Z7LA 3E5QA 2C6YA 4ZZLA 2UWMA 4XRSA 2KLOA 2CFXA 1W1WE 1BI2A 1FNNA 4B1RA 1UAAA 2XSDC 2ZJ2A 3JW4A 5E1ZB 3BPVA 3CCJI 2RREA 5TISC 3BCAA 4KA4A 1R6RA 2JMWA 4XM3A 1NH3A 2BHZA 4NDLA 1WSUA 2TCTA 2HQAA 2V1XA 5LGUA 2DMUA 4L5JA 4A3FJ 3BZKA 1ETKA 3PUBA 2DJIA 1WI9A 2NOGA 2JPCA 3E7LA 3NARA 3HL2A 3ZQCA 4LLLA 3EETA 2KJCA 4AVPA 2HDWA 3GTGJ 4GXOA 3BC8A 3SHFA 3KPHA 4MIMA 2L7KA 5LGNA 2A6EF 2JA2A 4ZC3A 2HZDA 1W36C 3I71A 4EEFG 1JT6A 1DPRA 4LK0F 2YU9J 2CW7A 3FKJA 1WJAA 3GFLA 3CP2A 1I39A 1ZG3A 1I3AA 1OJLA 5FKNA 3PSIA 1T39A 1LUJB 5ICGA 3RKWA 2VQCA 3WU2C 1XSVA 3O8GA 5GPAA 2KL4A 1ODDA 2E5NA 3LSRA 4B47A 3FXQA 4DNCA 1Y8RB 4C2MJ 4IHWA 1NK2P 5DV5A 3KEOA 2R7OA 4RAGA 4M3GA 4RB2C 4HOBA 3LAJA 3GFMA 3K4MA 1Q1VA 4I6ZA 3FBNB 5FB2A 5CVRA 3U2RA 1AKHB 2XRNA 4BDZA 2IS4A 4UXNA 4ENNA 2K7LA 3M8JA 4EQQA 1VTNC 3BCBA 2RGVA 4XRSG 3KYDB 1QPIA 3QOPA 4HNTA 2XGCA 1DP3A 2A5YB 5H20A 4A3DJ 4QWQA 2UUZA 3DKYA 3J81Z 4GRIA 3CLQA 4E7KA 3BLYA 4A93J 3GMEA 5BPIA 1PP7U 4Y3OA 1KGSA 4A12A 2IXSA 1VQ9I 2QGUA 2E1NA 4OINF 2XGEA 2BBYA 2R7WA 3MWMA 4DYQA 2EIJH 1FEXA 1CF7B 3F6OA 3CCLI 3K4BA 4LLNA 3TP0A 2H27A 1YITI 3HDDA 3AKZA 4Y7NJ 3KETA 3RJPA 3HKZN 4XR6A 2MLKA 2NVXJ 2Z33A 1WJBA 2NS0A 5BQTA 5HOOA 1B1BA 3IRQA 1R4MB 1BI0A 3IC7A 1TNTA 2WAQN 2YS9A 2W24A 4IQJA 3K7AJ 5HLHA 2BOLA 4M74A 2Y9ZA 5GADJ 1ACIA 2G0EA 1R1TA 5CVUA 1ZAOA 2EPFA 1SD7A 4BBSJ 2FEZA 4AIDA 3EDPA 3KP7A 1TC3C 4E7ZA 3R0JA 3E97A 1X1DA 5LEKA 3CESA 4L0YB 3P9KA 3GW2A 2M30A 3MKZA 1OCOH 1VF9A 1NG6A 4XNFA 2V6EA 2QZ8A 3CF5F 2AQEA 1G3TA 4NNJA 1SD5A 1FT9A 5EEGA 4V19K 3PO2J 2IS1A 3EPZA 2OD5A 1PUFB 2KDOA 3KP4A 1FOYA 4G6TB 4DJAA 1KYWA 5FRNA 2X4HA 2XGXA 3KP2A 1LEBA 1YRNB 1HXDA 1YFHA 1B59A 1VQ7I 3Q0UA 1TWFJ 3NRVA 4M72A 2EZIA 5K5RA 3CZ6A 1GV2A 2DT7B 2E34A 2VJ5A 5KK1A 3C18A 2FQ4A 2LBFB 3BOQA 1F5TA 4PSXA 4LG3A 2EBIA 3NEUA 4PK4A 3QPHA 3WU1B 1ZREA 4HV6A 1U6GA 3IP4B 5LHGA 3P9CA 4YFXF 2XAQA 5JHFA 3FM3A 3V4GA 5AIPA 2AS5F 3HOSA 5D5UB 1JUPA 3LA7A 3ZPLA 4F3QA 4RMNA 3O3KA 2OTJI 1LVAA 3GTLJ 3A02A 4BU2A 2ECCA 2NNNA 2VIXA 2HYGD 3B6AA 4R79A 4ZH4F 4M3EA 1HKQA 1G6NA 2O3FA 3SYTA 4OU0A 3OR1C 5IYCJ 1JKOC 1XS9A 3HGYA 3M07A 4ZDPA 2LY2A 1VQ6I 3LSHA 4I0AA 1W0TA 2M9HA 2L9SA 1RR7A 1SFEA 2K40A 3F8BA 3MZYA 1XG1A 2GAUA 3L2QA 2FJ1A 2ZXHA 3CQZJ 1X4PA 1QVTA 2JUCA 5HS9A 5IPAA 1U5TA 1ETXA 4DW6A 3OYHA 2YR2A 3RCOA 4HDVA 4CCKA 4B3AA 1AWCA 3LSMA 1X2MA 2HTSA 3QQAA 1OCCH 5GAGJ 1ZARA 2XPWA 3JAMZ 1OYYA 4W97A 4UUSB 1F43A 1QPMA 3KCCA 3G2BA 3L7WA 5J47A 4A3IJ 2L9RA 1AKHA 4ABZA 5DTDA 3IAM2 3CCVI 1WJDA 5CQGA 1XCBA 1TQPA 3LSTA 4CICA 4ZYGA 4I02A 2ZJRF 2HEOA 1WJEA 4I01A 2LRDA 3K6GA 3PIOF 3B02A 3FXMA 3QWLA 2FOWA 2LK2A 3DFGA 1K78B 4AU7A 5EEAA 3RSNA 4MO7A 1WI3A 4QTRA 4HX4A 2PJPA 1EKEA 1D1CA 2PG4A 3PNTA 1R5GA 3FK7A 4HG2A 2LFBA 2OTLI 2VPRA 4IX7A 3BR0A 5E8IA 1JJ8C 3AL0C 2K9SA 1GLNA 2RV8A 3FHNA 3F8NA 1FWZA 3LSIA 4RGSA 2X9DA 1P7IA 1ETYA 2YSRA 2R7DA 3BTIA 4Y13A 1X1AA 1LDDA 5LFAA 3OSFA 2JWTA 6PAXA 2XRLA 1YX3A 3RIRA 2DMQA 5F1JA 1S7AA 4A3MJ 3L2RA 1ZR4A 5F27A 2GXAA 4RAYA 3WTZA 5C44J 4OIQF 3F8MA 2EV5A 4KIBA 3LSGA 3IV5A 3MZ8A 1MDMB 3VWBA 5FLXZ 4HZFA 2F2EA 2JA6J 3HOXJ 1U8BA 3I64A 3LSJA 1ONVA 3AG1H 5EYRA 1WHUA 4EMSA 3CTAA 3TKYA 3WTVC 1H8AC 1A36A 4QPOA 3S14J 4HLYA 1SD6A 2ZB9A 3QYEA 2L0KA 2GOMA 2CQ7A 2Q1ZB 3DBRB 5EG0B 5IT3A 2E2HJ 2K02A 1XTAA 1XGNA 3I55I 3DTEA 3VYTB 1G3YA 2VL8A 3J7YJ 3HOYJ 4XKBA 2VC0A 3I0TA 4C3IJ 2X1DA 3M8FA 5TGTA 4XQFA 3FK6A 3QPTA 1JXSA 2VKEA 3FX3A 3F21A 3ERED 3QODA 1ZLKA 4IOCF 4P9FA 2ZMEB 1N77A 3AL0B 3FXOA 1WPKA 2YUSA 4PDKA 5JR3A 2OC6A 2QYOA 4U87A 2LMDA 3GTOJ 1OFCX 4XN3A 1G4DA 1OCRH 3OIQA 2FOKA 5L3BA 5J1RA 2EV0A 3KP3A 4HDUA 1SEUA 1RC9A 4BXFA 4PGGA 3HOTA 1PUFA 3CP8A 2X51A 2STTA 1YW7A 4FQGA 3OOPA 1Y8QB 1I6XA 1ZRCA 3WTXC 3PFYA 2YX7A 3ZMDA 4L0ZB 4MQVA 1LFBA 4RB0A 2VPLA 4AUXA 4RB3C 1YRNA 2RKHA 4MLOA 3QYFA 1FX7A 3QU3A 1X19A 2PQ8A 3J80K 1F1ZA 3FXUA 2JJ7A 4Q48A 2J5OA 2LBFA 3CDHA 4A0XA 5J4YA 2R7ZJ 1ZH5A 2K27A 3PFIA 3HB9A 1Z1DA 2LY9A 1IUFA 1FJLA 2H8WA 3U1KA 1G8XA 4FT8A 2GXBA 1TL8A 4IXAA 2XHKA 3NAUA 4N4NB 3MKLA 1IF1A 1SMTA 2CGPA 1ZHFA 2V9VA 4E6KG 5HNHA 3H0DA 3L1PA 3FISA 1T56A 3HM5A 1E3OC 4RM2A 2MSYA 3DKXA 1MNMC 4I99C 4QSHA 3I4MJ 1JKRC 3EQLF 2XAGA 4RLQA 2R92J 3HRMA 3CCUI 2KZVA 1D1AA 1IUYA 2XPUA 2FNPA 3RPUD 3K70D 2WTEA 4IF4A 5E1XA 2DO7A 3ABKH 1YTYA 2IGMA 1H88C 5H6QA 5E3NA 5GPCA 2WC2A 2HYFA 3BJOA 4OMZA 3BG5A 1V54H 2HDCA 2CW8A 3LQRA 4IHVA 2E5ZA 2FU4A 5D5VB 1WQ2A 4XONA 1RNLA 3E3VA 3OS1A 3DEWA 1YX5A 4FTHA 3A1YA 1MMDA 2XPVA 2HVQA 3G4SI 3G1LA 3TEDA 4A3LJ 4XORA 5CQEA 4A5MA 2GA1A 1EH7A 3CUQC 1BC7C 1MJAA 4MHGA 3BY6A 4CYCB 1LQ1A 3P9IA 3H1CA 1IW7F 1QBJA 3DPLC 3J7AO 4ESBA 3DTKA 3U1DA 1E17A 2K9LA 4BHPA 2HQNA 1HCRA 2XV4S 2ISZA 2IT0A 2Y48A 4R1HA 1A31A 1S8NA 1P6RA 2WA0A 4K2EA 5A2QZ 1XSDA 5LRRA 3ZGKA 2QA4I 4D7MA 3KLOA 2PJRB 1K78A 3F8FA 1YW8A 2ID6A 1ZTRA 2DYSH 4TV7A 3CLOA 4D0PA 3R0AA 3IKTA 2W1OA 5BPDA 2F4MB 3QP5A 3SFZA 1GVJA 2GLOA 2D1HA 1PP8F 2QBYB 4BQOA 2BVMA 2JRTA 1XPXA 4DGWB 5FKMA 2EIKH 2UV1A 2L01A 3K4KA 2DBBA 2KT0A 2RAEA 1IDYA 2AQFA 3G6EI 1O3RA 2HPIA 1WWXA 1V3FA 2XKPA 1P4AA 3CMAI 2DT6A 2VJIA 1H9GA 2KKOA 4XLAA 3IKVA 2COMA 2WBMA 2CUEA 3O6BB 4BS9A 2RQPA 2O0YA 1RUOA 3ECHA 4I7HA 4UB6C 3TO9A 1O7LA
chains in the Genus database with same CATH topology
3H3UA 3HSFA 4CYDA 4YIIA 2HKXA 3F6VA 2EFNA 1HQCA 2G7HA 2EFOA 3QRFF 2X0LA 2VBXA 4KNYA 1XGOA 4IHTA 4GO1A 4ETSA 1HSJA 1I5ZA 3DP7A 5D8KB 3V7CA 3T1BA 4L9VA 2MD5A 1W4MA 1KQ8A 4LMYA 3T8TA 4U7BA 3DEUA 2VT3A 3ECOA 4IPAA 3C3WA 2QWWA 1HBXG 2Q0OA 4ENKA 3CO7C 3ZMSA 3O2PE 2VE9A 2XVCA 1WKMA 3G73A 1FC3A 2VT2A 3U9GA 2JPBA 1QGPA 4KUMA 5DCFA 3BPXA 3W6JB 1O3QA 2M8EA 4P96A 2W57A 2P6TA 3IWFA 3V8KA 2FMYA 5CVVA 1FLIA 2G7UA 1ZG5A 4DQ2A 4N0BA 3T8RA 4M73A 1YYVA 2EFQA 2M1BA 4U7DA 4AIHA 1ZRFA 5ILVA 3GFJA 1O57A 2JT1A 2FQ3A 3R61A 1FSHA 4WF2A 3ISPA 3J81K 4MEXF 2MA3A 5F64A 3ELKA 2XAJA 4NQWA 2IA0A 1U3EM 2OZ6A 3VOEA 2VONA 1W7PA 1L0OC 1F4KA 5BS6A 4Q4ZF 3CUQA 3GWZA 2QBYA 4KICA 1U5TC 3FF5A 1R22A 5DCMA 1MD0A 1QZYA 1R36A 2RC4A 2Y0MA 2L02A 5E20A 2P7CB 1K7AA 3I54A 5H6RA 1YG2A 2STWA 2ETHA 3I53A 1R23A 1BI1A 1DDNA 2O8XA 3C1DA 2D2WA 1Z7UA 2FSWA 4I09A 1P92A 2CO5A 3K1PA 4EM0B 1IXCA 1XGSA 4AWXB 1H9TA 1U5TB 3T5XA 3M8EA 3TO6A 5HDNA 1S3JA 2UZKA 5ILSA 1IAWA 1JHHA 4Q5SF 2F5DA 1D8KA 2E7XA 1ULYA 4MTEA 3FM5A 4XRFA 2NYXA 2V1UA 2HQRA 4WXCA 1TW2A 1CGPA 4A5NA 1GXQA 1R58A 2JTVA 3ABUA 1MJBA 1UHWA 1FP1D 2ISYA 1QO0D 3GEZA 4CDGA 3RPQA 2VXZA 2ACJA 5E8GA 3KZZA 4G7OF 2ZCWA 2HWVA 2MH2A 1J59A 1BIBA 3TQNA 2HOEA 3HIFA 5ERIA 4OMYA 1XD7A 5AIQA 4HLXA 2L54A 4NHJA 2PN6A 1KU3A 1ZN2A 2BE5F 4WXDA 4EJVA 1IN8A 4LG0A 3F3XA 4M9ZA 1ZLJA 3HTUA 3JAMK 5L3DA 3K0LA 4XBFA 3VFZA 4G94A 3GFIA 1HKTA 1YLFA 4ESJA 2V1DA 1J2XA 2F5CA 2PMUA 1KYZA 1G3WA 3IRRA 4RGRA 3VODA 1DPUA 4CGZA 4ZZDA 2A69F 4P5OA 1HKSA 3IWZA 4OIPF 1EH8A 1SD4A 4N9IA 4P55A 4HF2A 3K9TA 3BZ6A 2NRAC 1ZGAA 5FLXK 3JSPA 2IA2A 3IL2A 3HSRA 2J5PA 2CG4A 2HGCA 4U0WA 2DFIA 4KT5C 4RB1A 3VEPA 1ZG1A 2VBZA 1OYIA 1BC8C 2BEOA 2FE3A 1B4AA 3FWEA 2VBYA 2A68F 4U88A 2FXAA 2K4JA 5BOXA 5FGMA 4LJZF 4KMFA 4UVCA 2L4AA 4A0ZA 4IJAA 1L3LA 4RS8A 2CW0F 1FYLA 2RDPA 4ZYEA 4HQMA 5D4RA 4PZJA 5D4SA 4G9YA 1DUXC 4A0YA 4QLCU 2EA2A 2IW5A 5HLGA 2ESNA 4ZYDA 1Z91A 5D8LB 2PEXA 2B0LA 3TGNA 3GXOA 3HRTA 3TOAA 5HDKA 2GA2A 4FX0A 2FNAA 3WU0A 2DQLA 2MH9A 3BJ6A 3HRSA 4EJWA 3KLNA 2XAHA 4HW0A 3PQKA 2OU2A 3TO7A 1QZZA 2M87A 4UNOA 4Q47A 1YS7A 1J9IA 1BOAA 1PUEE 3FMQA 4UVAA 5CVJA 1S29A 2YU3A 2P6SA 1HW1A 4M71A 1T98A 4WK8F 1V4RA 4FHTA 3K2ZA 5L3EA 3G3ZA 3ZMUA 5AONA 3RKXA 4UVBA 2QQ9A 4BXUA 5A2QK 1KQ0A 3PQJA 2UXXA 3GZ5A 1UB9A 1T2KA 1I27A 3KP5A 3H92A 1U2WA 2KIFA 4HA8A 3Q9VA 2E7WA 3E6BA 3L2CA 3BDDA 3L9FA 1BN5A 2BGCA 3NQOA 2MBFA 5F1RA 4CZZA 2Q8KA 3EYYA 3GF2A 2PMHA 1FOKA 3M1EA 3MEXA 2ZNYA 2HS5A 4H0EA 1OR7A 1W7PD 4A2UA 1QQIA 4O6JA 2DK8A 5DUIA 3P7NA 4GYGA 5HS7A 3IHUA 3M9AA 4PGHA 5LHIA 3F23A 2VN2A 3HTSB 4U0VA 2EV6A 3WTTC 1K6OA 2XUBA 4Y17A 2D1VA 2QENA 5HVQC 5L3CA 4F7ZA 4RGUA 4L9JA 3DF8A 1I1SA 1TTYA 2M5WA 2XIGA 4G7HF 4ENJA 3COAC 1W7PB 2IVMA 4UHTA 1GHCA 1KU9A 1YQAA 1C0WA 2HKOA 3CUQB 2NNYA 3F72A 5DCMB 3ZMTA 2FF4A 3KP6A 4HQEA 2IJLA 2LSOA 2P7VB 1F9NA 1OKRA 1O3SA 2IRFG 4YIFA 2DLLA 4UV9A 3V7RA 2VODA 2VOPA 2WV0A 1RI7A 4KIFA 3DXJF 4EM2A 2CWEA 1IXRC 2CQKA 4HX8A 1WRJA 4S04A 3MAJA 1RZ4A 5DD8A 1R5HA 1P2FA 2XASA 4JQFA 1FBSA 1XDSA 2EFWA 1SAXA 5ICCA 5DDGA 5J8CA 2PBIA 5L3FA 4JBAA 2ZKZA 1SFUA 1B9NA 4EVIA 2XROA 5FFZA 2V79A 4KN7X 3V8LA 5E1WA 3WTSC 4M9SA 1MKMA 4JK1X 5LGTA 3I4PA 1AOYA 3K1MA 3WE3A 5D6FA 2IP2A 4P9UA 3BP8A 4GGGA 1FYKA 3FMRA 4LLGF 4MGRA 3HHHA 4EJUA 1BBYA 3ULQB 1MJ9A 4MQ9F 4Y15A 4LG0B 1BIAA 1E2XA 4KN4X 1D3YA 3WTYC 3HHGA 4G8XA 3DV8A 2HFHA 2FMLA 2HR3A 2GIVA 4ENMA 2E1CA 3WODF 3KFWX 3TOBA 4YFKF 2GQQA 5IT9K 1R1UA 3E5XA 2KRFA 1EV7A 3K1NA 2TDXA 4ASNA 1BM9A 1ON1A 4EV0A 1YS6A 1JE8A 1OYWA 2L4MA 4FX4A 5ILUA 4LB5A 3JSOA 4WCGA 1TQIA 2P5KA 2O61A 5LRSA 2PLYA 1W5TA 3E5UA 5F6FA 3RYPA 5E18F 2HZTA 3GZ6A 2DPDA 4IRGA 1A04A 3REOA 3CO6C 2DTRA 4IRHA 4ZYHA 1XMKA 3GX4X 3GVAA 1JHFA 4BNCA 2P5LC 1FSEA 3FHZA 2YX4A 4KMUX 2FRHA 1R7JA 5CJ9A 4GYIA 2ZXJA 1R1VA 4KIGA 1U78A 2ZFWA 2O6GE 5DEQA 2F5EA 1KU7A 4EM1A 2QM3A 5IT9Z 1ON2A 2XAFA 3WTUC 3ZP5A 2DU9A 3BWGA 3I58A 2L3DA 3ABTA 2EB7A 3M7GA 1XN7A 2K86A 1Z05A 1REPC 1XMAA 2ZBKA 3SQNA 3ZQ7A 2Z5UA 4ESFA 3WGHA 1GXPA 3RKYA 3KZYA 5J6XA 2VOOA 4KYWA 4B09A 1TNSA 5JVTA 2K4BA 3L00A 4L9TA 2EWNA 1KA8A 3BROA 4OIOF 4I0BA 1HW2A 3MFKA 4M6YA 1KU2A 4G6DA 4LB6B 1X3UA 4MEYF 5KVRA 4OOIA 5ICFA 3E6CC 2QQBA 1LNWA 1D5VA 3ROUA 4BH9A 5K5QA 1Z9CA 1T38A 1G3SA 1YIOA 2P5VA 1RUNA 2M45A 1IXSB 3DQVC 4LGWA 2W85A 5FO5A 3DPTA 1BI3A 3WTWC 1UCRA 2KJBA 1XB4A 2OA4A 1MGTA 4BYYA 4MTDA 2W25A 1HSTA 4HF0A 1J5YA 2H09A 1OMIA 1B6AA 4L5IA 1ZRDA 5FD6A 2A6HF 2Y75A 5ICEA 1J7KA 2H6CA 1IZ1A 5EEHA 2VC1A 4GCVA 2PFBA 4UV8A 3JTGA 3ZN0A 3L09A 4AIJA 4MNUA 1IN6A 5JI6A 3MZHA 4BAYA 1MZBA 3MCZA 5L3GA 3B73A 4M9XA 4IHSA 1U8RA 2IPQX 1W5SA 3CJNA 3RYRA 2WWYA 3Q5FA 4EGZA 5JHUA 1S6LA 2FBKA 4BHBA 4LFUA 4LK1F 2LDUA 5DYMA 3R4KA 3K69A 5LEJA 2P8TA 3GUDA 2D45A 1XDUA 1T0FA 4EJTA 2ESHA 2QLZA 4EJOA 3WGIA 2PI0A 2RVCA 1FBUA 1TLHB 2VE8A 2R7FA 1KQ9A 1FBQA 5FD5A 4HYEA 4A6DA 1UHMA 2A3SA 3HYIA 3LA3A 2A07F 2A61A 1P4XA 1IRFA 5CLSA 4PCQA 3V8JA 2RNJA 1HW5A 3I5UA 5LHHA 1FYMA 4A6EA 4EGYA 2OBPA 3F8CA 2AXLA 4AD9A 4Z2YA 5D5WB 4OIRF 2NAZA 3Q9SA 3FMSA 4XSZF 3ZMVA 5D6EA 2MC3A 5BMZA 1IN7A 1CF7A 2FA5A 3QP6A 2YPRA 3V7SA 1TBXA 4NB5A 1R00A 1RIOH 1XCVA 2R3SA 2ELHA 4HF1A 3KE2A 5HDGA 2DT5A 1LDJA 1USSA 5TRDA 4IRIA 4WXHA 3LFKA 3N4MA 2JSCA 1S7OA 3R6SA 3I59B 1Z6TA 3SZTA 2OQGA 3ZN1A 3VB2A 3RTRA 4UUVA 1SFXA 5E17F 4HBLA 1TQMA 3W6KB 1OPCA 2GWRA 5D5XB 1UFMA 2DW4A 5K1YA 1YO5C 3RI4A 2CSOA 3LA2A 3N97A 4E70A 4L18B 2P4WA 2IA1A 1EH6A 5HLIA 5HS8A 2G9WA 3BJAA 1O3TA 1LJ9A 2OAZA 4LD5A 2DAOA 3LQQA 1B9MA 4AIKA 2CYYA 1Q1HA 1ZGJA 4I98B 3HRUA 4CO8A 4L9NA 5DD4A 3EYIA 1K79A 1FY7A 2QUFA 4ON0A 1O7FA 3LWFA 2Z99A 4G6QA 1T6SA 2OQRA 4B8XA 3CUOA 2GXGA 2MLGA 4KFCA 2KIMA 2Z3YA 2DK5A 2LF8A 3E6DA 2ADUA 1J0RA 3WE2A 1Y0UA 2LF7A 5LBQA 2HTJA 3D0SA 2JZYA 4N9HA 2DPUA 3OV8A 1NHAA 2O03A 5LLQA 3GLXA 1PDNC 3QU6A 2H6BA 3ML6A 2VBWA 3GO5A 2QQAA 1P4WA 3WG9A 3S2WA 3JTHA 4RGXA 3J80Z 4O5VA 4BHCA 2DI3A 4XSXF 1DP7P 4M6XA 1Z6RA 1QNTA 2F5FA 1J75A 1MDMA 3KEQA 2KIUA 2Z9OA 2XKOA 2LNBA 2GZWA 3RDIA 3SZPA 2Q2EA 4WX9A 1ZYRF 4HV5A 2LKPA 2ZMEA 1D8JA 5FFXA 5CVIA 1IRGA 4XLPF 3H3ZA 2ZO4A 4I2OA 3D5LA 3I59A 4WWCA 2EA4A 2RN7A 4RAZA 4S05A 3LAPA 1LDKB 3HUGA 5DUKA 1FZPB 1FP2A 2W84A 2DQRA 4CHUA 2V6CA 1BJAA 5J8FA 3EUHA 1FPQA 3F22A 2EK5A 4R8HA 4BQAA 3TDUC 5CYVA 3QAHA 1H0MA 2FBIA 3FZVA 1STZA 2EFPA 3E6MA 3ZMZA 3WGGA 1IN5A 4CXFA 3HSEA 2FBHA 3SXYA 2EJRA 1I1GA 2H94A 3GYHX 3TDZC 4YG2F 4O3MA 4HAMA 1LEAA 1IN4A 1JGSA 2QVOA 5ED4A 4IVNA 1YW9A 1SMYF 4XLNF 3MQ0A 1XSXA 1XGMA 4YFNF 4G7ZF 2UXNA 3R60A 1LB2A 2ZNZA 1TW3A 3DKWA 5JFRA 1USTA 3FXRA 5TJJA 3T0YA 4KDPA 2BYVE 4HX7A 3AAFA 3RPUA 5K5OA 2OZUA 3C7JA 2BV6A 4U0YA 3E5QA 2C6YA 4ZZLA 2UWMA 2CFXA 1BI2A 1FNNA 2ZJ2A 3JW4A 5E1ZB 3BPVA 4KA4A 1WSUA 2V1XA 5LGUA 4L5JA 1WI9A 2JPCA 4LLLA 3EETA 2KJCA 4AVPA 4GXOA 3SHFA 5LGNA 2A6EF 3I71A 1DPRA 4LK0F 3GFLA 1ZG3A 1T39A 5ICGA 3RKWA 1XSVA 1ODDA 3FXQA 4DNCA 5DV5A 3KEOA 4RB2C 4HOBA 3LAJA 3GFMA 5FB2A 5CVRA 3U2RA 2XRNA 4UXNA 4ENNA 2K7LA 4EQQA 1VTNC 2RGVA 3QOPA 2A5YB 5H20A 4QWQA 3J81Z 5BPIA 1PP7U 1KGSA 4A12A 2E1NA 4OINF 2BBYA 3MWMA 1CF7B 3F6OA 4LLNA 2H27A 3KETA 3RJPA 2MLKA 2Z33A 2NS0A 5BQTA 5HOOA 1B1BA 3IRQA 1BI0A 3IC7A 1TNTA 2W24A 5HLHA 4M74A 1R1TA 5CVUA 1ZAOA 1SD7A 2FEZA 3EDPA 3KP7A 3R0JA 3E97A 5LEKA 4L0YB 3P9KA 3GW2A 2M30A 2QZ8A 1G3TA 1SD5A 1FT9A 5EEGA 2OD5A 3KP4A 1KYWA 2X4HA 2XGXA 3KP2A 1LEBA 1HXDA 1YFHA 1B59A 3NRVA 4M72A 5K5RA 5KK1A 3C18A 3BOQA 1F5TA 3WU1B 3NEUA 3QPHA 1ZREA 4HV6A 1U6GA 5LHGA 3P9CA 4YFXF 2XAQA 3FM3A 3V4GA 5AIPA 2AS5F 3HOSA 5D5UB 3LA7A 3ZPLA 3O3KA 1LVAA 2NNNA 2HYGD 4R79A 4ZH4F 1HKQA 1G6NA 2O3FA 4OU0A 4I0AA 1SFEA 3F8BA 3MZYA 2GAUA 5HS9A 1U5TA 2YR2A 4HDVA 1AWCA 2HTSA 1ZARA 3JAMZ 1OYYA 1QPMA 3KCCA 3L7WA 1XCBA 1TQPA 3LSTA 4CICA 4ZYGA 4I02A 2HEOA 4I01A 3B02A 1K78B 3DFGA 4HX4A 2PJPA 2PG4A 1R5GA 5E8IA 2RV8A 4RGSA 3F8NA 1FWZA 2YSRA 2R7DA 4Y13A 1LDDA 6PAXA 3RIRA 1S7AA 4RAYA 3WTZA 4OIQF 3F8MA 2EV5A 4KIBA 1MDMB 5FLXZ 4HZFA 2F2EA 3I64A 1ONVA 4EMSA 3CTAA 3TKYA 3WTVC 4HLYA 1SD6A 5IT3A 2K02A 1XGNA 1G3YA 2VC0A 3I0TA 3M8FA 3QPTA 1JXSA 3FX3A 3F21A 3ERED 1ZLKA 4P9FA 2ZMEB 4PDKA 5JR3A 2QYOA 1G4DA 2FOKA 5L3BA 2EV0A 3KP3A 4HDUA 3HOTA 4PGGA 2STTA 1YW7A 3OOPA 1I6XA 1ZRCA 3WTXC 2YX7A 3ZMDA 4L0ZB 4MQVA 4RB0A 4RB3C 2RKHA 1FX7A 3QU3A 2PQ8A 3J80K 1F1ZA 3FXUA 4Q48A 2J5OA 3CDHA 4A0XA 1ZH5A 2K27A 3PFIA 1Z1DA 4FT8A 2GXBA 4IXAA 2XHKA 1IF1A 1SMTA 2CGPA 1ZHFA 2V9VA 3EQLF 2XAGA 3HRMA 1IUYA 2FNPA 2WTEA 4IF4A 5E1XA 2DO7A 1YTYA 5H6QA 2WC2A 2HYFA 3BJOA 4OMZA 2HDCA 3LQRA 2FU4A 5D5VB 1WQ2A 1RNLA 3E3VA 4A5MA 2GA1A 1EH7A 3CUQC 1BC7C 1MJAA 4MHGA 3BY6A 1LQ1A 3P9IA 1IW7F 1QBJA 3DPLC 3J7AO 4ESBA 3U1DA 1E17A 4BHPA 2HQNA 2ISZA 2XV4S 2IT0A 2Y48A 4R1HA 1S8NA 1P6RA 4K2EA 5A2QZ 1XSDA 5LRRA 3KLOA 1K78A 3F8FA 1YW8A 4TV7A 3CLOA 4D0PA 3R0AA 3IKTA 5BPDA 3SFZA 3QP5A 1GVJA 2D1HA 1PP8F 2QBYB 2JRTA 2L01A 2DBBA 1O3RA 1WWXA 1V3FA 2XKPA 1P4AA 1H9GA 2KKOA 3IKVA 2COMA 3O6BB 2RQPA 2O0YA 1RUOA 3ECHA 4I7HA 3TO9A 1O7LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H3U A;  3HSF A;  4CYD A;  4YII A;  2HKX A;  3F6V A;  2EFN A;  1HQC A;  2G7H A;  2EFO A;  3QRF F;  2X0L A;  2VBX A;  4KNY A;  1XGO A;  4IHT A;  4GO1 A;  4ETS A;  1HSJ A;  1I5Z A;  3DP7 A;  5D8K B;  3V7C A;  3T1B A;  4L9V A;  2MD5 A;  1W4M A;  1KQ8 A;  4LMY A;  3T8T A;  4U7B A;  3DEU A;  2VT3 A;  3ECO A;  4IPA A;  3C3W A;  2QWW A;  1HBX G;  2Q0O A;  4ENK A;  3CO7 C;  3ZMS A;  3O2P E;  2VE9 A;  2XVC A;  1WKM A;  3G73 A;  1FC3 A;  2VT2 A;  3U9G A;  2JPB A;  1QGP A;  4KUM A;  5DCF A;  3BPX A;  3W6J B;  1O3Q A;  2M8E A;  4P96 A;  2W57 A;  2P6T A;  3IWF A;  3V8K A;  2FMY A;  5CVV A;  1FLI A;  2G7U A;  1ZG5 A;  4DQ2 A;  4N0B A;  3T8R A;  4M73 A;  1YYV A;  2EFQ A;  2M1B A;  4U7D A;  4AIH A;  1ZRF A;  5ILV A;  3GFJ A;  1O57 A;  2JT1 A;  2FQ3 A;  3R61 A;  1FSH A;  4WF2 A;  3ISP A;  3J81 K;  4MEX F;  2MA3 A;  5F64 A;  3ELK A;  2XAJ A;  4NQW A;  2IA0 A;  1U3E M;  2OZ6 A;  3VOE A;  2VON A;  1W7P A;  1L0O C;  1F4K A;  5BS6 A;  4Q4Z F;  3CUQ A;  3GWZ A;  2QBY A;  4KIC A;  1U5T C;  3FF5 A;  1R22 A;  5DCM A;  1MD0 A;  1QZY A;  1R36 A;  2RC4 A;  2Y0M A;  2L02 A;  5E20 A;  2P7C B;  1K7A A;  3I54 A;  5H6R A;  1YG2 A;  2STW A;  2ETH A;  3I53 A;  1R23 A;  1BI1 A;  1DDN A;  2O8X A;  3C1D A;  2D2W A;  1Z7U A;  2FSW A;  4I09 A;  1P92 A;  2CO5 A;  3K1P A;  4EM0 B;  1IXC A;  1XGS A;  4AWX B;  1H9T A;  1U5T B;  3T5X A;  3M8E A;  3TO6 A;  5HDN A;  1S3J A;  2UZK A;  5ILS A;  1IAW A;  1JHH A;  4Q5S F;  2F5D A;  1D8K A;  2E7X A;  1ULY A;  4MTE A;  3FM5 A;  4XRF A;  2NYX A;  2V1U A;  2HQR A;  4WXC A;  1TW2 A;  1CGP A;  4A5N A;  1GXQ A;  1R58 A;  2JTV A;  3ABU A;  1MJB A;  1UHW A;  1FP1 D;  2ISY A;  1QO0 D;  3GEZ A;  4CDG A;  3RPQ A;  2VXZ A;  2ACJ A;  5E8G A;  3KZZ A;  4G7O F;  2ZCW A;  2HWV A;  2MH2 A;  1J59 A;  1BIB A;  3TQN A;  2HOE A;  3HIF A;  5ERI A;  4OMY A;  1XD7 A;  5AIQ A;  4HLX A;  2L54 A;  4NHJ A;  2PN6 A;  1KU3 A;  1ZN2 A;  2BE5 F;  4WXD A;  4EJV A;  1IN8 A;  4LG0 A;  3F3X A;  4M9Z A;  1ZLJ A;  3HTU A;  3JAM K;  5L3D A;  3K0L A;  4XBF A;  3VFZ A;  4G94 A;  3GFI A;  1HKT A;  1YLF A;  4ESJ A;  2V1D A;  1J2X A;  2F5C A;  2PMU A;  1KYZ A;  1G3W A;  3IRR A;  4RGR A;  3VOD A;  1DPU A;  4CGZ A;  4ZZD A;  2A69 F;  4P5O A;  1HKS A;  3IWZ A;  4OIP F;  1EH8 A;  1SD4 A;  4N9I A;  4P55 A;  4HF2 A;  3K9T A;  3BZ6 A;  2NRA C;  1ZGA A;  5FLX K;  3JSP A;  2IA2 A;  3IL2 A;  3HSR A;  2J5P A;  2CG4 A;  2HGC A;  4U0W A;  2DFI A;  4KT5 C;  4RB1 A;  3VEP A;  1ZG1 A;  2VBZ A;  1OYI A;  1BC8 C;  2BEO A;  2FE3 A;  1B4A A;  3FWE A;  2VBY A;  2A68 F;  4U88 A;  2FXA A;  2K4J A;  5BOX A;  5FGM A;  4LJZ F;  4KMF A;  4UVC A;  2L4A A;  4A0Z A;  4IJA A;  1L3L A;  4RS8 A;  2CW0 F;  1FYL A;  2RDP A;  4ZYE A;  4HQM A;  5D4R A;  4PZJ A;  5D4S A;  4G9Y A;  1DUX C;  4A0Y A;  4QLC U;  2EA2 A;  2IW5 A;  5HLG A;  2ESN A;  4ZYD A;  1Z91 A;  5D8L B;  2PEX A;  2B0L A;  3TGN A;  3GXO A;  3HRT A;  3TOA A;  5HDK A;  2GA2 A;  4FX0 A;  2FNA A;  3WU0 A;  2DQL A;  2MH9 A;  3BJ6 A;  3HRS A;  4EJW A;  3KLN A;  2XAH A;  4HW0 A;  3PQK A;  2OU2 A;  3TO7 A;  1QZZ A;  2M87 A;  4UNO A;  4Q47 A;  1YS7 A;  1J9I A;  1BOA A;  1PUE E;  3FMQ A;  4UVA A;  5CVJ A;  1S29 A;  2YU3 A;  2P6S A;  1HW1 A;  4M71 A;  1T98 A;  4WK8 F;  1V4R A;  4FHT A;  3K2Z A;  5L3E A;  3G3Z A;  3ZMU A;  5AON A;  3RKX A;  4UVB A;  2QQ9 A;  4BXU A;  5A2Q K;  1KQ0 A;  3PQJ A;  2UXX A;  3GZ5 A;  1UB9 A;  1T2K A;  1I27 A;  3KP5 A;  3H92 A;  1U2W A;  2KIF A;  4HA8 A;  3Q9V A;  2E7W A;  3E6B A;  3L2C A;  3BDD A;  3L9F A;  1BN5 A;  2BGC A;  3NQO A;  2MBF A;  5F1R A;  4CZZ A;  2Q8K A;  3EYY A;  3GF2 A;  2PMH A;  1FOK A;  3M1E A;  3MEX A;  2ZNY A;  2HS5 A;  4H0E A;  1OR7 A;  1W7P D;  4A2U A;  1QQI A;  4O6J A;  2DK8 A;  5DUI A;  3P7N A;  4GYG A;  5HS7 A;  3IHU A;  3M9A A;  4PGH A;  5LHI A;  3F23 A;  2VN2 A;  3HTS B;  4U0V A;  2EV6 A;  3WTT C;  1K6O A;  2XUB A;  4Y17 A;  2D1V A;  2QEN A;  5HVQ C;  5L3C A;  4F7Z A;  4RGU A;  4L9J A;  3DF8 A;  1I1S A;  1TTY A;  2M5W A;  2XIG A;  4G7H F;  4ENJ A;  3COA C;  1W7P B;  2IVM A;  4UHT A;  1GHC A;  1KU9 A;  1YQA A;  1C0W A;  2HKO A;  3CUQ B;  2NNY A;  3F72 A;  5DCM B;  3ZMT A;  2FF4 A;  3KP6 A;  4HQE A;  2IJL A;  2LSO A;  2P7V B;  1F9N A;  1OKR A;  1O3S A;  2IRF G;  4YIF A;  2DLL A;  4UV9 A;  3V7R A;  2VOD A;  2VOP A;  2WV0 A;  1RI7 A;  4KIF A;  3DXJ F;  4EM2 A;  2CWE A;  1IXR C;  2CQK A;  4HX8 A;  1WRJ A;  4S04 A;  3MAJ A;  1RZ4 A;  5DD8 A;  1R5H A;  1P2F A;  2XAS A;  4JQF A;  1FBS A;  1XDS A;  2EFW A;  1SAX A;  5ICC A;  5DDG A;  5J8C A;  2PBI A;  5L3F A;  4JBA A;  2ZKZ A;  1SFU A;  1B9N A;  4EVI A;  2XRO A;  5FFZ A;  2V79 A;  4KN7 X;  3V8L A;  5E1W A;  3WTS C;  4M9S A;  1MKM A;  4JK1 X;  5LGT A;  3I4P A;  1AOY A;  3K1M A;  3WE3 A;  5D6F A;  2IP2 A;  4P9U A;  3BP8 A;  4GGG A;  1FYK A;  3FMR A;  4LLG F;  4MGR A;  3HHH A;  4EJU A;  1BBY A;  3ULQ B;  1MJ9 A;  4MQ9 F;  4Y15 A;  4LG0 B;  1BIA A;  1E2X A;  4KN4 X;  1D3Y A;  3WTY C;  3HHG A;  4G8X A;  3DV8 A;  2HFH A;  2FML A;  2HR3 A;  2GIV A;  4ENM A;  2E1C A;  3WOD F;  3KFW X;  3TOB A;  4YFK F;  2GQQ A;  5IT9 K;  1R1U A;  3E5X A;  2KRF A;  1EV7 A;  3K1N A;  2TDX A;  4ASN A;  1BM9 A;  1ON1 A;  4EV0 A;  1YS6 A;  1JE8 A;  1OYW A;  2L4M A;  4FX4 A;  5ILU A;  4LB5 A;  3JSO A;  4WCG A;  1TQI A;  2P5K A;  2O61 A;  5LRS A;  2PLY A;  1W5T A;  3E5U A;  5F6F A;  3RYP A;  5E18 F;  2HZT A;  3GZ6 A;  2DPD A;  4IRG A;  1A04 A;  3REO A;  3CO6 C;  2DTR A;  4IRH A;  4ZYH A;  1XMK A;  3GX4 X;  3GVA A;  1JHF A;  4BNC A;  2P5L C;  1FSE A;  3FHZ A;  2YX4 A;  4KMU X;  2FRH A;  1R7J A;  5CJ9 A;  4GYI A;  2ZXJ A;  1R1V A;  4KIG A;  1U78 A;  2ZFW A;  2O6G E;  5DEQ A;  2F5E A;  1KU7 A;  4EM1 A;  2QM3 A;  5IT9 Z;  1ON2 A;  2XAF A;  3WTU C;  3ZP5 A;  2DU9 A;  3BWG A;  3I58 A;  2L3D A;  3ABT A;  2EB7 A;  3M7G A;  1XN7 A;  2K86 A;  1Z05 A;  1REP C;  1XMA A;  2ZBK A;  3SQN A;  3ZQ7 A;  2Z5U A;  4ESF A;  3WGH A;  1GXP A;  3RKY A;  3KZY A;  5J6X A;  2VOO A;  4KYW A;  4B09 A;  1TNS A;  5JVT A;  2K4B A;  3L00 A;  4L9T A;  2EWN A;  1KA8 A;  3BRO A;  4OIO F;  4I0B A;  1HW2 A;  3MFK A;  4M6Y A;  1KU2 A;  4G6D A;  4LB6 B;  1X3U A;  4MEY F;  5KVR A;  4OOI A;  5ICF A;  3E6C C;  2QQB A;  1LNW A;  1D5V A;  3ROU A;  4BH9 A;  5K5Q A;  1Z9C A;  1T38 A;  1G3S A;  1YIO A;  2P5V A;  1RUN A;  2M45 A;  1IXS B;  3DQV C;  4LGW A;  2W85 A;  5FO5 A;  3DPT A;  1BI3 A;  3WTW C;  1UCR A;  2KJB A;  1XB4 A;  2OA4 A;  1MGT A;  4BYY A;  4MTD A;  2W25 A;  1HST A;  4HF0 A;  1J5Y A;  2H09 A;  1OMI A;  1B6A A;  4L5I A;  1ZRD A;  5FD6 A;  2A6H F;  2Y75 A;  5ICE A;  1J7K A;  2H6C A;  1IZ1 A;  5EEH A;  2VC1 A;  4GCV A;  2PFB A;  4UV8 A;  3JTG A;  3ZN0 A;  3L09 A;  4AIJ A;  4MNU A;  1IN6 A;  5JI6 A;  3MZH A;  4BAY A;  1MZB A;  3MCZ A;  5L3G A;  3B73 A;  4M9X A;  4IHS A;  1U8R A;  2IPQ X;  1W5S A;  3CJN A;  3RYR A;  2WWY A;  3Q5F A;  4EGZ A;  5JHU A;  1S6L A;  2FBK A;  4BHB A;  4LFU A;  4LK1 F;  2LDU A;  5DYM A;  3R4K A;  3K69 A;  5LEJ A;  2P8T A;  3GUD A;  2D45 A;  1XDU A;  1T0F A;  4EJT A;  2ESH A;  2QLZ A;  4EJO A;  3WGI A;  2PI0 A;  2RVC A;  1FBU A;  1TLH B;  2VE8 A;  2R7F A;  1KQ9 A;  1FBQ A;  5FD5 A;  4HYE A;  4A6D A;  1UHM A;  2A3S A;  3HYI A;  3LA3 A;  2A07 F;  2A61 A;  1P4X A;  1IRF A;  5CLS A;  4PCQ A;  3V8J A;  2RNJ A;  1HW5 A;  3I5U A;  5LHH A;  1FYM A;  4A6E A;  4EGY A;  2OBP A;  3F8C A;  2AXL A;  4AD9 A;  4Z2Y A;  5D5W B;  4OIR F;  2NAZ A;  3Q9S A;  3FMS A;  4XSZ F;  3ZMV A;  5D6E A;  2MC3 A;  5BMZ A;  1IN7 A;  1CF7 A;  2FA5 A;  3QP6 A;  2YPR A;  3V7S A;  1TBX A;  4NB5 A;  1R00 A;  1RIO H;  1XCV A;  2R3S A;  2ELH A;  4HF1 A;  3KE2 A;  5HDG A;  2DT5 A;  1LDJ A;  1USS A;  5TRD A;  4IRI A;  4WXH A;  3LFK A;  3N4M A;  2JSC A;  1S7O A;  3R6S A;  3I59 B;  1Z6T A;  3SZT A;  2OQG A;  3ZN1 A;  3VB2 A;  3RTR A;  4UUV A;  1SFX A;  5E17 F;  4HBL A;  1TQM A;  3W6K B;  1OPC A;  2GWR A;  5D5X B;  1UFM A;  2DW4 A;  5K1Y A;  1YO5 C;  3RI4 A;  2CSO A;  3LA2 A;  3N97 A;  4E70 A;  4L18 B;  2P4W A;  2IA1 A;  1EH6 A;  5HLI A;  5HS8 A;  2G9W A;  3BJA A;  1O3T A;  1LJ9 A;  2OAZ A;  4LD5 A;  2DAO A;  3LQQ A;  1B9M A;  4AIK A;  2CYY A;  1Q1H A;  1ZGJ A;  4I98 B;  3HRU A;  4CO8 A;  4L9N A;  5DD4 A;  3EYI A;  1K79 A;  1FY7 A;  2QUF A;  4ON0 A;  1O7F A;  3LWF A;  2Z99 A;  4G6Q A;  1T6S A;  2OQR A;  4B8X A;  3CUO A;  2GXG A;  2MLG A;  4KFC A;  2KIM A;  2Z3Y A;  2DK5 A;  2LF8 A;  3E6D A;  2ADU A;  1J0R A;  3WE2 A;  1Y0U A;  2LF7 A;  5LBQ A;  2HTJ A;  3D0S A;  2JZY A;  4N9H A;  2DPU A;  3OV8 A;  1NHA A;  2O03 A;  5LLQ A;  3GLX A;  1PDN C;  3QU6 A;  2H6B A;  3ML6 A;  2VBW A;  3GO5 A;  2QQA A;  1P4W A;  3WG9 A;  3S2W A;  3JTH A;  4RGX A;  3J80 Z;  4O5V A;  4BHC A;  2DI3 A;  4XSX F;  1DP7 P;  4M6X A;  1Z6R A;  1QNT A;  2F5F A;  1J75 A;  1MDM A;  3KEQ A;  2KIU A;  2Z9O A;  2XKO A;  2LNB A;  2GZW A;  3RDI A;  3SZP A;  2Q2E A;  4WX9 A;  1ZYR F;  4HV5 A;  2LKP A;  2ZME A;  1D8J A;  5FFX A;  5CVI A;  1IRG A;  4XLP F;  3H3Z A;  2ZO4 A;  4I2O A;  3D5L A;  3I59 A;  4WWC A;  2EA4 A;  2RN7 A;  4RAZ A;  4S05 A;  3LAP A;  1LDK B;  3HUG A;  5DUK A;  1FZP B;  1FP2 A;  2W84 A;  2DQR A;  4CHU A;  2V6C A;  1BJA A;  5J8F A;  3EUH A;  1FPQ A;  3F22 A;  2EK5 A;  4R8H A;  4BQA A;  3TDU C;  5CYV A;  3QAH A;  1H0M A;  2FBI A;  3FZV A;  1STZ A;  2EFP A;  3E6M A;  3ZMZ A;  3WGG A;  1IN5 A;  4CXF A;  3HSE A;  2FBH A;  3SXY A;  2EJR A;  1I1G A;  2H94 A;  3GYH X;  3TDZ C;  4YG2 F;  4O3M A;  4HAM A;  1LEA A;  1IN4 A;  1JGS A;  2QVO A;  5ED4 A;  4IVN A;  1YW9 A;  1SMY F;  4XLN F;  3MQ0 A;  1XSX A;  1XGM A;  4YFN F;  4G7Z F;  2UXN A;  3R60 A;  1LB2 A;  2ZNZ A;  1TW3 A;  3DKW A;  5JFR A;  1UST A;  3FXR A;  5TJJ A;  3T0Y A;  4KDP A;  2BYV E;  4HX7 A;  3AAF A;  3RPU A;  5K5O A;  2OZU A;  3C7J A;  2BV6 A;  4U0Y A;  3E5Q A;  2C6Y A;  4ZZL A;  2UWM A;  2CFX A;  1BI2 A;  1FNN A;  2ZJ2 A;  3JW4 A;  5E1Z B;  3BPV A;  4KA4 A;  1WSU A;  2V1X A;  5LGU A;  4L5J A;  1WI9 A;  2JPC A;  4LLL A;  3EET A;  2KJC A;  4AVP A;  4GXO A;  3SHF A;  5LGN A;  2A6E F;  3I71 A;  1DPR A;  4LK0 F;  3GFL A;  1ZG3 A;  1T39 A;  5ICG A;  3RKW A;  1XSV A;  1ODD A;  3FXQ A;  4DNC A;  5DV5 A;  3KEO A;  4RB2 C;  4HOB A;  3LAJ A;  3GFM A;  5FB2 A;  5CVR A;  3U2R A;  2XRN A;  4UXN A;  4ENN A;  2K7L A;  4EQQ A;  1VTN C;  2RGV A;  3QOP A;  2A5Y B;  5H20 A;  4QWQ A;  3J81 Z;  5BPI A;  1PP7 U;  1KGS A;  4A12 A;  2E1N A;  4OIN F;  2BBY A;  3MWM A;  1CF7 B;  3F6O A;  4LLN A;  2H27 A;  3KET A;  3RJP A;  2MLK A;  2Z33 A;  2NS0 A;  5BQT A;  5HOO A;  1B1B A;  3IRQ A;  1BI0 A;  3IC7 A;  1TNT A;  2W24 A;  5HLH A;  4M74 A;  1R1T A;  5CVU A;  1ZAO A;  1SD7 A;  2FEZ A;  3EDP A;  3KP7 A;  3R0J A;  3E97 A;  5LEK A;  4L0Y B;  3P9K A;  3GW2 A;  2M30 A;  2QZ8 A;  1G3T A;  1SD5 A;  1FT9 A;  5EEG A;  2OD5 A;  3KP4 A;  1KYW A;  2X4H A;  2XGX A;  3KP2 A;  1LEB A;  1HXD A;  1YFH A;  1B59 A;  3NRV A;  4M72 A;  5K5R A;  5KK1 A;  3C18 A;  3BOQ A;  1F5T A;  3WU1 B;  3NEU A;  3QPH A;  1ZRE A;  4HV6 A;  1U6G A;  5LHG A;  3P9C A;  4YFX F;  2XAQ A;  3FM3 A;  3V4G A;  5AIP A;  2AS5 F;  3HOS A;  5D5U B;  3LA7 A;  3ZPL A;  3O3K A;  1LVA A;  2NNN A;  2HYG D;  4R79 A;  4ZH4 F;  1HKQ A;  1G6N A;  2O3F A;  4OU0 A;  4I0A A;  1SFE A;  3F8B A;  3MZY A;  2GAU A;  5HS9 A;  1U5T A;  2YR2 A;  4HDV A;  1AWC A;  2HTS A;  1ZAR A;  3JAM Z;  1OYY A;  1QPM A;  3KCC A;  3L7W A;  1XCB A;  1TQP A;  3LST A;  4CIC A;  4ZYG A;  4I02 A;  2HEO A;  4I01 A;  3B02 A;  1K78 B;  3DFG A;  4HX4 A;  2PJP A;  2PG4 A;  1R5G A;  5E8I A;  2RV8 A;  4RGS A;  3F8N A;  1FWZ A;  2YSR A;  2R7D A;  4Y13 A;  1LDD A;  6PAX A;  3RIR A;  1S7A A;  4RAY A;  3WTZ A;  4OIQ F;  3F8M A;  2EV5 A;  4KIB A;  1MDM B;  5FLX Z;  4HZF A;  2F2E A;  3I64 A;  1ONV A;  4EMS A;  3CTA A;  3TKY A;  3WTV C;  4HLY A;  1SD6 A;  5IT3 A;  2K02 A;  1XGN A;  1G3Y A;  2VC0 A;  3I0T A;  3M8F A;  3QPT A;  1JXS A;  3FX3 A;  3F21 A;  3ERE D;  1ZLK A;  4P9F A;  2ZME B;  4PDK A;  5JR3 A;  2QYO A;  1G4D A;  2FOK A;  5L3B A;  2EV0 A;  3KP3 A;  4HDU A;  3HOT A;  4PGG A;  2STT A;  1YW7 A;  3OOP A;  1I6X A;  1ZRC A;  3WTX C;  2YX7 A;  3ZMD A;  4L0Z B;  4MQV A;  4RB0 A;  4RB3 C;  2RKH A;  1FX7 A;  3QU3 A;  2PQ8 A;  3J80 K;  1F1Z A;  3FXU A;  4Q48 A;  2J5O A;  3CDH A;  4A0X A;  1ZH5 A;  2K27 A;  3PFI A;  1Z1D A;  4FT8 A;  2GXB A;  4IXA A;  2XHK A;  1IF1 A;  1SMT A;  2CGP A;  1ZHF A;  2V9V A;  3EQL F;  2XAG A;  3HRM A;  1IUY A;  2FNP A;  2WTE A;  4IF4 A;  5E1X A;  2DO7 A;  1YTY A;  5H6Q A;  2WC2 A;  2HYF A;  3BJO A;  4OMZ A;  2HDC A;  3LQR A;  2FU4 A;  5D5V B;  1WQ2 A;  1RNL A;  3E3V A;  4A5M A;  2GA1 A;  1EH7 A;  3CUQ C;  1BC7 C;  1MJA A;  4MHG A;  3BY6 A;  1LQ1 A;  3P9I A;  1IW7 F;  1QBJ A;  3DPL C;  3J7A O;  4ESB A;  3U1D A;  1E17 A;  4BHP A;  2HQN A;  2ISZ A;  2XV4 S;  2IT0 A;  2Y48 A;  4R1H A;  1S8N A;  1P6R A;  4K2E A;  5A2Q Z;  1XSD A;  5LRR A;  3KLO A;  1K78 A;  3F8F A;  1YW8 A;  4TV7 A;  3CLO A;  4D0P A;  3R0A A;  3IKT A;  5BPD A;  3SFZ A;  3QP5 A;  1GVJ A;  2D1H A;  1PP8 F;  2QBY B;  2JRT A;  2L01 A;  2DBB A;  1O3R A;  1WWX A;  1V3F A;  2XKP A;  1P4A A;  1H9G A;  2KKO A;  3IKV A;  2COM A;  3O6B B;  2RQP A;  2O0Y A;  1RUO A;  3ECH A;  4I7H A;  3TO9 A;  1O7L A; 
#chains in the Genus database with same CATH topology
 3H3U A;  2VI6 A;  3HSF A;  4CYD A;  4YII A;  2NVQ J;  4GFB A;  2HKX A;  4PJL A;  3F6V A;  2NXN B;  1AA7 A;  2VQL A;  2EFN A;  1HQC A;  2BXY A;  4ZJZ A;  2G7H A;  2EFO A;  1HF0 A;  2IEK A;  4C3H J;  2ELJ A;  3QRF F;  2ICW G;  2X0L A;  2OV7 A;  2VBX A;  4KNY A;  1XGO A;  2M0M A;  4IHT A;  4W1U A;  4GO1 A;  4PUS A;  1BW6 A;  4ETS A;  2F4I A;  1HSJ A;  2BY1 A;  4XRM A;  1I5Z A;  1X1C A;  3DP7 A;  5D8K B;  3V7C A;  3T1B A;  2O5R A;  2IS6 A;  4L9V A;  3I4N J;  2MD5 A;  2OJE D;  3SEZ A;  1VQ4 I;  3BG7 A;  2BZT A;  2KP6 A;  3CCR I;  1X58 A;  4E7L A;  1W4M A;  1KQ8 A;  5KAI C;  4BXX J;  4LMY A;  3LSP A;  4PJN A;  3T8T A;  1APL C;  2NS7 A;  3F9K A;  4M6V A;  1IGN A;  4XLC A;  5GTI C;  4U7B A;  3DEU A;  1QHH D;  4XMY A;  5KCM A;  1V55 H;  2VT3 A;  3ECO A;  4IPA A;  2HPM A;  2HU9 A;  3C3W A;  2QWW A;  4HST A;  2DA2 A;  3VPR A;  3S3O A;  2Q0O A;  1HBX G;  2E71 A;  4ENK A;  3CO7 C;  3TW7 A;  3RQI A;  3ZMS A;  3O2P E;  2DA5 A;  4HEA 2;  5EZH A;  1DGR M;  2VE9 A;  1K4T A;  3JRE A;  4HRI A;  4IO9 F;  2XVC A;  1WKM A;  3G73 A;  4CCL A;  5FKK A;  1FC3 A;  2VT2 A;  5JVG F;  3U9G A;  1MH3 A;  2ECB A;  4BQN A;  4ZTJ A;  5J40 A;  2JPB A;  1QGP A;  2E36 A;  4KUM A;  5DCF A;  3BPX A;  3W6J B;  1O3Q A;  2M8E A;  4CCM A;  4P96 A;  2KIS A;  2W57 A;  2BXZ A;  1K83 J;  2P6T A;  4E4H A;  2LH9 A;  3IWF A;  3V8K A;  3S15 J;  2FMY A;  3UNG C;  5KAF C;  5CVV A;  1FLI A;  1S7E A;  3PSF A;  1PJR A;  2G7U A;  1ZG5 A;  4DQ2 A;  4N0B A;  2X1C A;  3T8R A;  4BE2 A;  4M73 A;  3TBI A;  5IP7 J;  3BQY A;  1YYV A;  2EFQ A;  2KPM A;  2M1B A;  3BZC A;  4M3B A;  5IYD J;  1Z77 A;  4U7D A;  3I9V 2;  4X1E A;  4AIH A;  1ZRF A;  5ILV A;  1DQU A;  3GFJ A;  2AXT C;  1O57 A;  1FIA A;  2JT1 A;  2FQ3 A;  1O4X A;  3R61 A;  1E0E A;  1FSH A;  4WF2 A;  3ISP A;  3J81 K;  2ZXI A;  4MEX F;  3OMY A;  2PJR A;  2MA3 A;  5F64 A;  3AG2 H;  1QZE A;  3ELK A;  2XAJ A;  2L7F P;  4NQW A;  1TP4 A;  2IA0 A;  1U3E M;  4YEJ A;  2BVL A;  2OZ6 A;  3LMM A;  3VOE A;  2VON A;  1MBH A;  4AM3 A;  1W7P A;  5IP9 J;  2W00 A;  3FKI J;  1L0O C;  1F4K A;  3HPG A;  3G1O A;  5BS6 A;  4Q4Z F;  3JRF A;  3GBG A;  3CUQ A;  3GWZ A;  1NTC A;  1RES A;  2QBY A;  2BY0 A;  1U9N A;  1U5T C;  4KIC A;  3FF5 A;  1R22 A;  5DCM A;  2D5V A;  1MD0 A;  1QZY A;  1R36 A;  2RC4 A;  1A5J A;  2Y0M A;  3FDY A;  2L02 A;  1ORK A;  5E20 A;  3SEQ A;  1DGW Y;  3U21 A;  2P7C B;  1K7A A;  4AVZ A;  3HBL A;  3PNV A;  3H5R A;  3I54 A;  1M1E B;  2GBY A;  5H6R A;  1YG2 A;  2STW A;  2ETH A;  1W36 D;  3I53 A;  1R23 A;  1BI1 A;  1DDN A;  2O8X A;  2VXD A;  3Q3S A;  1OIS A;  3HXL A;  3C1D A;  5DM6 F;  3BR3 A;  2D2W A;  2WAF A;  1Z7U A;  4N4O B;  2FSW A;  3DLL F;  4I09 A;  4IHX A;  1P92 A;  2CO5 A;  3K1P A;  1P9Q C;  1X2N A;  4EM0 B;  1IXC A;  1SVO A;  3DPU A;  1XGS A;  4AWX B;  1H9T A;  1U5T B;  3T5X A;  3M8E A;  1D0Z A;  3TO6 A;  3S3M A;  5HDN A;  1S3J A;  3OIO A;  2UZK A;  5ILS A;  4NBQ A;  2RNG A;  1IAW A;  3OL3 A;  1LFP A;  2BHY A;  4IQ4 A;  4J19 A;  1JHH A;  4Q5S F;  2F5D A;  1D8K A;  4FET A;  2BY3 A;  2E7X A;  2VLA A;  4HPQ A;  1QA6 A;  1ULY A;  3SFI A;  4E7J A;  1MMS A;  4MTE A;  3FM5 A;  4XRF A;  5FJ8 J;  4DBQ A;  2EZL A;  3NWT A;  2K9M A;  1R5I D;  2E1M C;  2NYX A;  3JRA A;  2V1U A;  3QYB A;  1CQT A;  2HQR A;  4WXC A;  1TW2 A;  3BR2 A;  1CGP A;  4A5N A;  1GXQ A;  2O7O A;  1R58 A;  2JTV A;  3ABU A;  1MJB A;  1UHW A;  3K4L A;  1FP1 D;  2ISY A;  4E7S A;  3CC4 I;  1QO0 D;  3GEZ A;  4CDG A;  3RPQ A;  2VXZ A;  2ACJ A;  2Z1D A;  5E8G A;  3KZZ A;  4G7O F;  2ZCW A;  2V7F A;  1FTT A;  2HWV A;  4KIT B;  2MH2 A;  1JTY A;  3OR2 C;  1J59 A;  3K10 A;  1UJ8 A;  1BIB A;  2HOE A;  3A0H C;  3BTC A;  3HIF A;  3TQN A;  1N78 A;  5ERI A;  1YIJ I;  5KHD A;  4OMY A;  4DYC A;  1XD7 A;  5AIQ A;  2E60 A;  4HLX A;  2L54 A;  1IJW C;  4NHJ A;  4BKX A;  1WZ2 A;  2PN6 A;  1TWC J;  2RQQ A;  1KU3 A;  1ZN2 A;  3JR9 A;  2X85 A;  4KT6 A;  2HOA A;  2BE5 F;  5M3M J;  2E1M B;  4NUB A;  3DU5 A;  4WXD A;  3CJQ B;  4EJV A;  3LOC A;  1IN8 A;  4LG0 A;  3OYK A;  5M5X J;  3ZQH A;  3F3X A;  4M9Z A;  1ZLJ A;  2CQX A;  3JRD A;  4Y52 J;  3HTU A;  3GTJ J;  4IL6 C;  4XIC A;  3JAM K;  2R0Q C;  3PIP F;  5L3D A;  3K0L A;  4DOZ A;  3M4O J;  4XBF A;  3OYM A;  4D5F A;  2NOJ B;  1BW5 A;  3VFZ A;  3CCQ I;  2QKL B;  1X3Z B;  2O9L A;  4G94 A;  3GFI A;  1ZQ3 P;  2MG4 A;  1HKT A;  2VB6 A;  4B44 A;  1YLF A;  1JI8 A;  4ESJ A;  2KRC A;  2R4G A;  5GAE J;  2V1D A;  1J2X A;  2F5C A;  3BR1 A;  5KNL A;  2PMU A;  1KYZ A;  2I8D A;  3HG9 A;  2CMP A;  2DMN A;  1G3W A;  2KMU A;  3IRR A;  5GP9 A;  1F36 A;  3LSK A;  4RGR A;  3VOD A;  1DPU A;  3JRI A;  1HOM A;  1OR7 C;  4ZZD A;  4CGZ A;  4ZDL A;  1QVU A;  2A69 F;  4P5O A;  1HKS A;  3IWZ A;  1PVE A;  4OIP F;  1EH8 A;  1SD4 A;  2R5Z B;  1HC8 A;  4N9I A;  2EQR A;  2CUJ A;  1MW7 A;  4P55 A;  2KHM A;  4Y33 A;  4BY7 J;  1UG0 A;  2R7X A;  3ZXS A;  2M2E A;  2JA5 J;  4CSW A;  4HF2 A;  3K9T A;  2W82 A;  3BZ6 A;  2QQ8 A;  1ZGA A;  2Y31 A;  4HSR A;  2OCC H;  3JSP A;  2IA2 A;  4G12 A;  3OYJ A;  2HXO A;  3IL2 A;  5FLX K;  3HSR A;  2J5P A;  1VND A;  3TL4 X;  2CG4 A;  2HGC A;  4U0W A;  2DFI A;  4KT5 C;  4II2 A;  2Y9Y A;  4RB1 A;  3VEP A;  1ZG1 A;  2VBZ A;  3H35 A;  1OYI A;  2OUM A;  3QPL A;  1BC8 C;  2BEO A;  3K4J A;  2DYR H;  2NVU B;  2FE3 A;  3BQZ A;  2X6O A;  1B4A A;  3FWE A;  2VBY A;  4BUP A;  2A68 F;  2R7T A;  2CFO A;  4U88 A;  2FXA A;  4A69 C;  5C4J J;  3HEF A;  2LY1 A;  2ZJP F;  1AHD P;  2DN0 A;  3DCF A;  2K4J A;  5BOX A;  5FGM A;  3PNY A;  1D5Y A;  2A6T A;  4LJZ F;  4KMF A;  4UVC A;  2I10 A;  2L4A A;  3MVP A;  4A0Z A;  4IJA A;  1L3L A;  4RS8 A;  2CW0 F;  2LKX A;  1FYL A;  2HOT A;  1R4N B;  2H1L A;  2A05 A;  1E3H A;  2R7Q A;  1GVD A;  2RDP A;  3KYL A;  4ZYE A;  1P7J A;  4HQM A;  2AHQ A;  5D4R A;  4PZJ A;  1MMA A;  2JUG A;  3LFU A;  5D4S A;  4G9Y A;  1DUX C;  4FE7 A;  4A0Y A;  4XKW A;  4QLC U;  3CMY A;  3Q0V A;  2EA2 A;  2IW5 A;  5HLG A;  3QOE A;  1BR2 A;  3EUK L;  2ESN A;  3JCU C;  4ZYD A;  3OYA A;  3OYI A;  1Z91 A;  3K4C A;  3HJE A;  3ONQ A;  5D8L B;  4PJM A;  2PEX A;  4J01 A;  2B63 J;  1VI0 A;  2IAI A;  1QRY A;  2B0L A;  5E3M A;  1YJW I;  3TGN A;  4CCJ A;  3GXO A;  1H89 C;  2V9P A;  4J00 A;  3HRT A;  3TOA A;  5HDK A;  2EIL H;  2Z16 A;  2V26 A;  2GA2 A;  4FX0 A;  1VQN I;  2FNA A;  4A3J J;  3WU0 A;  1UG2 A;  2DQL A;  2MH9 A;  2W4S A;  3KZI C;  3BJ6 A;  3HRS A;  3FXK A;  4EJW A;  2LC2 A;  3KLN A;  2XAH A;  4HW0 A;  3PQK A;  2OU2 A;  3TO7 A;  1FOW A;  3SDB A;  2ZJQ F;  1DU0 A;  1FMW A;  1QZZ A;  2M87 A;  4IZZ A;  3CF2 A;  4Q47 A;  1VQO I;  4UNO A;  1UZC A;  1YS7 A;  1J9I A;  2L9V A;  1BOA A;  1PUE E;  3S1M J;  3FMQ A;  3H5A A;  4XOT A;  2L9N A;  4OWR B;  2CUZ A;  4UVA A;  3RZO J;  4FE4 A;  5CVJ A;  1S29 A;  4BDY A;  1IC8 A;  2YU3 A;  2GOX B;  2P6S A;  1HW1 A;  3FXL A;  2VJJ A;  4M71 A;  2JRM A;  1T98 A;  4WK8 F;  1V4R A;  2VQG A;  1MND A;  1TT5 B;  2XF5 A;  4FHT A;  3IAS 2;  3K2Z A;  1TZL A;  4A3C J;  3S1R J;  5L3E A;  4RDU A;  3G3Z A;  3S16 J;  3ZMU A;  4Y4R A;  1X1B A;  4FCY A;  5AON A;  3RKX A;  2QKM B;  3OS0 A;  4UVB A;  2QQ9 A;  4BXU A;  4D7N A;  1KQ0 A;  2FD5 A;  5A2Q K;  2XC7 A;  1IRX A;  4IHY A;  3FXJ A;  3PQJ A;  2K3P A;  2UXX A;  4ZTF A;  2M7A A;  3GZ5 A;  1UB9 A;  3VDX A;  2DFE A;  4BEH A;  1ZKG A;  2JQ7 A;  4BJT A;  1T2K A;  3GLL A;  1VQK I;  3GTK J;  1I27 A;  3D5R C;  3KP5 A;  3HPH A;  3CME I;  3H92 A;  1U2W A;  2KIF A;  4RA2 A;  1MSE C;  2FUG 2;  3E1S A;  4HA8 A;  3Q9V A;  3OS2 A;  1RPW A;  3W2W A;  2QF7 A;  3D5S C;  2E7W A;  3EUA A;  2R5Z A;  3UKG A;  1B72 B;  5LD2 C;  3E6B A;  1QHG A;  2E2I J;  5J1Y A;  3OYC A;  3L2C A;  1POG A;  1NK3 P;  3BDD A;  3L9F A;  1BN5 A;  1D0X A;  2BGC A;  3AG4 H;  3BG6 A;  3HZJ A;  2EZH A;  2GM4 A;  3NQO A;  4E7I A;  2MBF A;  5CPR B;  1RET A;  5F1R A;  4CZZ A;  2Q8K A;  5EDN A;  2LLK A;  3H9G A;  3EYY A;  3GF2 A;  2XF6 A;  4LIV A;  2EH3 A;  2PMH A;  1FOK A;  3M1E A;  3MEX A;  1IG7 A;  1Z21 A;  2ZNY A;  1BJZ A;  2HS5 A;  2LYC A;  4H0E A;  3TMO A;  1XMX A;  1OR7 A;  1W7P D;  4A2U A;  3C2B A;  1MMG A;  2TRT A;  1QQI A;  1Y0N A;  4O6J A;  1K6Y A;  2DK8 A;  3IH4 A;  3OWT A;  2ZSI B;  4FAS D;  5DUI A;  3P7N A;  4GYG A;  5HS7 A;  1U0J A;  2DCE A;  3IHU A;  1SFO J;  3LNQ A;  3PM1 A;  5EGO A;  4P1W A;  3M9A A;  4CUG A;  4PGH A;  5LHI A;  1ETW A;  2X6W A;  3F23 A;  2VN2 A;  2B9S A;  3HTS B;  4U0V A;  1VQP I;  2EV6 A;  3WTT C;  1YJN I;  2V9K A;  1K6O A;  2XUB A;  4Y17 A;  2ZFU A;  3S1N J;  3H36 A;  2D1V A;  2QEN A;  1MBG A;  4C9Y A;  5HVQ C;  2M7B A;  5L3C A;  1W5C C;  3CDL A;  3FIW A;  4F7Z A;  4RGU A;  4L9J A;  3DF8 A;  1I1S A;  3GTQ J;  4NQW B;  1TTY A;  2M5W A;  1K4S A;  2XIG A;  3WG7 H;  4G7H F;  4ENJ A;  1FTZ A;  3COA C;  4OAY A;  1W7P B;  2IVM A;  4UHT A;  1GHC A;  2HI3 A;  1KU9 A;  1YQA A;  1C0W A;  3CUQ B;  2HKO A;  2NNY A;  2Z2S B;  3F72 A;  5DCM B;  3ZMT A;  2FF4 A;  3A4C A;  3KP6 A;  2NS8 A;  4HQE A;  5M5W J;  2IJL A;  3J7A Y;  2LSO A;  2P7V B;  1F9N A;  1OKR A;  2ELK A;  1O3S A;  4DBR A;  2IRF G;  4A3B J;  4YIF A;  1JKP C;  2DLL A;  4UV9 A;  3V7R A;  2VOD A;  3OYB A;  2VOP A;  4NC6 A;  2WV0 A;  1RI7 A;  2HVR A;  3RQ4 A;  4JOM A;  2P0W A;  4KIF A;  2F5V A;  3DXJ F;  2DOF A;  2KRH A;  3W2V A;  3JRH A;  4EM2 A;  4C2T A;  2CWE A;  2X6Y A;  2DFH A;  5FKO A;  1IXR C;  1WH5 A;  2CQK A;  4HX8 A;  1WRJ A;  4C30 A;  3I3L A;  2K85 A;  4S04 A;  5HNF A;  1G59 A;  4CH7 A;  3MAJ A;  4F93 B;  2QSH X;  2HDD A;  1RZ4 A;  5DD8 A;  1R5H A;  5E3O A;  1P2F A;  3MN2 A;  3L2V A;  2H8R A;  2XAS A;  4JQF A;  5GTH C;  4RLF A;  1FBS A;  1XDS A;  2EFW A;  1SAX A;  5ICC A;  5DDG A;  2K9Q A;  5B66 C;  1EA3 A;  5J8C A;  3W2A A;  4AC0 A;  2PBI A;  5L3F A;  4FIS A;  3ZQG A;  1BR4 A;  4JBA A;  2M4G A;  1HDP A;  2ZKZ A;  2W48 A;  1SFU A;  1B9N A;  4DYR A;  4EVI A;  2QEX I;  2IGK A;  4KIS A;  2XRO A;  1B72 A;  5FFZ A;  1Y6I A;  2V79 A;  4KN7 X;  3V8L A;  2NVT J;  1GT0 C;  4HNU A;  5E1W A;  4DZP A;  1X4O A;  4GDF A;  1WH7 A;  1HA8 A;  3WTS C;  3HOV J;  4M9S A;  4M3D A;  1MKM A;  4JK1 X;  1SVL A;  5LGT A;  3I4P A;  1AOY A;  3ERM A;  3K1M A;  3WE3 A;  2MFZ A;  2VJ4 A;  5D6F A;  2IP2 A;  3KEY A;  1RR8 C;  5IYB J;  4P9U A;  3BP8 A;  1WGX A;  3ZOB A;  1I6H J;  3ZQL A;  4GGG A;  2MC4 A;  1FYK A;  3FMR A;  1XX5 A;  2COB A;  4LLG F;  4MGR A;  1A6Q A;  3HHH A;  1N25 A;  4EJU A;  1BBY A;  4QPQ A;  3ULQ B;  1MJ9 A;  3C2G A;  4MQ9 F;  3VSL A;  4X0G A;  4Y15 A;  5F0C A;  1N75 A;  4LG0 B;  1BIA A;  1E2X A;  2X1E A;  4KN4 X;  1D3Y A;  2DFF A;  2X6X A;  3HHG A;  4G8X A;  3DV8 A;  3WTY C;  1PYV A;  2FML A;  2HFH A;  1R9T J;  2HR3 A;  2GIV A;  4ENM A;  2E1C A;  1YOV B;  3WOD F;  1BR1 A;  3KFW X;  3TOB A;  4YFK F;  2GQQ A;  1QU3 A;  5IT9 K;  1R1U A;  3E5X A;  1SVM A;  2LOO A;  1OCP A;  1V5F A;  2DJN A;  2M34 A;  3NWS A;  5HOD A;  5M5Y J;  2A5W A;  4BJ6 C;  2WB1 A;  1V5E A;  2KRF A;  4MFD A;  3ASO H;  1EV7 A;  3K1N A;  1VZ0 A;  2TDX A;  5HLT A;  4ASN A;  1BM9 A;  1ON1 A;  2LP0 A;  1MNE A;  4C2U A;  3PL8 A;  1I50 J;  4PFO A;  3ZCO A;  4EV0 A;  4XKC A;  2XSJ C;  1OQY A;  1YS6 A;  1JE8 A;  1OYW A;  2L4M A;  1NG7 A;  4FX4 A;  5ILU A;  4ITV A;  4II3 A;  4LB5 A;  5IOZ A;  4D1Q A;  3DBH B;  2QSG X;  3ZQF A;  3CJT B;  3HGG A;  2XB0 X;  3L2U A;  3JSO A;  3VSK A;  4PJJ A;  4WCG A;  1TQI A;  4EAT A;  2P5K A;  2O61 A;  5LRS A;  3IH2 A;  2PLY A;  1W5T A;  3A2K A;  1IRZ A;  3E5U A;  1MBE A;  5F6F A;  2EZK A;  3RYP A;  3CCY A;  5E18 F;  1KON A;  3DTI A;  3S2D J;  1TWG J;  2HZT A;  3GZ6 A;  3W3C A;  2E19 A;  5C3E J;  2DPD A;  4IRG A;  3A03 A;  4IOA F;  2Y0S N;  1A04 A;  1T0F C;  1YI2 I;  3REO A;  3CO6 C;  5F0F A;  2DTR A;  4IRH A;  5FLM J;  2VUM J;  4ZYH A;  1XMK A;  4NC7 A;  2CV2 A;  3JRC A;  3GX4 X;  3GVA A;  1JHF A;  2OCE A;  1GUU A;  3HC7 A;  3JRG A;  3H3V K;  1LFU P;  4BNC A;  3H5N A;  2P5L C;  2KDZ A;  1FSE A;  2YX4 A;  3FHZ A;  4KMU X;  2FRH A;  2IGO A;  1R7J A;  4JX4 A;  5CJ9 A;  5EJC A;  4BY1 J;  2H1K A;  2BW3 A;  4GYI A;  2ZXJ A;  2O8K A;  1R1V A;  1VFC A;  3OYG A;  3I56 I;  1IV8 A;  4KIG A;  1U78 A;  2ZXW H;  3M3Y J;  2ZFW A;  2O6G E;  5DEQ A;  2F5E A;  1ETQ A;  5JLW A;  5J3L A;  1KU7 A;  4EM1 A;  2QM3 A;  5IT9 Z;  3H9J A;  3H9Q A;  1ON2 A;  2WV1 A;  2XAF A;  2MAB A;  3WTU C;  3ZP5 A;  2DU9 A;  3BWG A;  4IKF A;  3Q0W A;  1MBK A;  2XF7 A;  2Y30 A;  3I58 A;  2MD0 A;  3PJR A;  3G1M A;  4BQQ A;  2L3D A;  3ABT A;  3JRB A;  4XLF A;  3VYS B;  2EB7 A;  3M7G A;  1XN7 A;  2MW8 A;  2K86 A;  1Z05 A;  3MD2 A;  4XLH A;  1REP C;  1XMA A;  2ZBK A;  3BT9 A;  1R71 A;  1MBF A;  3SQN A;  4YIR X;  1J09 A;  3ZQ7 A;  2Z5U A;  4B48 A;  4ESF A;  1UEL B;  1RRJ A;  3WGH A;  3CC2 I;  2JVH A;  4XK4 A;  1GXP A;  4A3K J;  2DMP A;  3HOW J;  1MMN A;  2DDA A;  4XKV A;  5DS9 A;  3RKY A;  3KZY A;  3ZR8 X;  5J6X A;  2VOO A;  4KYW A;  4B09 A;  4DIQ A;  1TNS A;  2DA6 A;  5JVT A;  2K4B A;  4RBO A;  3L00 A;  4L9T A;  4F52 A;  2EWN A;  2R7S A;  5B5E C;  1KA8 A;  3BRO A;  3GTP J;  3OYL A;  4OIO F;  4I0B A;  1HW2 A;  2Y2Z A;  3MFK A;  1JUS A;  4M6Y A;  3L2W A;  2PX9 A;  4LOC A;  1ZR2 A;  1KU2 A;  4G6D A;  4LB6 B;  1SFK A;  1X3U A;  4MEY F;  5KVR A;  4OOI A;  5ICF A;  3E6C C;  2AO9 A;  2QQB A;  1LNW A;  1D5V A;  3ROU A;  4BH9 A;  5H2F C;  2M4K A;  5K5Q A;  1Z9C A;  1T38 A;  1G3S A;  1YIO A;  2P5V A;  2OF7 A;  4Z6Y A;  1RUN A;  2CU7 A;  2M45 A;  1IXS B;  3DQV C;  3PUF A;  4LGW A;  3G71 I;  2W85 A;  1K61 A;  5FO5 A;  3DPT A;  1BI3 A;  3WTW C;  1LE8 B;  1UCR A;  2KJB A;  1XB4 A;  1JUM A;  1WCM J;  2OA4 A;  3E0J B;  4AYB A;  1MGT A;  4BEH B;  4BYY A;  4PFP A;  1HDD C;  1E3P A;  4MTD A;  2W25 A;  1VQM I;  3IH3 A;  1HST A;  2CH0 A;  4HF0 A;  2M0C A;  1J5Y A;  3DBL B;  2H09 A;  3A01 B;  1OMI A;  5K7Z A;  1B6A A;  4L5I A;  3MKW B;  1FOX A;  1ZRD A;  5FD6 A;  3CC7 I;  2A6H F;  2Y75 A;  5ICE A;  1J7K A;  2H6C A;  2B7E A;  1IZ1 A;  5EEH A;  2VC1 A;  4GCV A;  4D5C A;  5J1U A;  2LVS A;  2PFB A;  4BBR J;  2DMT A;  5BNG A;  4UV8 A;  3BG9 A;  1Z3Y A;  3JTG A;  3SZG A;  3ZN0 A;  1BA5 A;  3L09 A;  4AIJ A;  2NVY J;  4MNU A;  1ZGW A;  1IN6 A;  5C4X J;  1SAU A;  3A0B C;  2R7U A;  5JI6 A;  3MZH A;  4BAY A;  1MZB A;  3MCZ A;  5L3G A;  3B73 A;  3HOZ J;  2KQR A;  4E7H A;  2K9N A;  4M9X A;  4IHS A;  1U8R A;  2IGN A;  3FBI B;  1ZEL A;  1TWH J;  2IPQ X;  4NC8 A;  2DA7 A;  2MGQ A;  1W5S A;  3CJN A;  1ITY A;  3RYR A;  1IDZ A;  2WWY A;  3Q5F A;  4EGZ A;  4RAF A;  2ID3 A;  1YE9 A;  2CQN A;  2DOE A;  3IUO A;  5JHU A;  1S6L A;  2E2J J;  2QCO A;  2DA3 A;  2FBK A;  4BHB A;  2KFD A;  4F92 B;  4LFU A;  3CJR B;  4LK1 F;  2LDU A;  5DYM A;  5EGO B;  3R4K A;  1ENH A;  2BY2 A;  3K69 A;  5LEJ A;  2P8T A;  3GUD A;  2D45 A;  1WJC A;  1XDU A;  2CV0 A;  1T0F A;  4EJT A;  2ESH A;  4PJ0 C;  4ANJ A;  2QLZ A;  4EJO A;  3WGI A;  4QIW N;  3X2Q H;  2PI0 A;  2RVC A;  1FBU A;  1TLH B;  2PMZ A;  2HOS A;  3UR3 C;  4F55 A;  1RKT A;  2VE8 A;  2R7F A;  2VAS A;  1B8I B;  4BE1 A;  1KQ9 A;  1S5L C;  3S2H J;  1MSF C;  1A35 A;  1FBQ A;  3H0G J;  5FD5 A;  3RZD J;  3VYR B;  4HYE A;  4A6D A;  1ETV A;  2IS2 A;  1UHM A;  2A3S A;  3HYI A;  3LA3 A;  5JLX A;  2A07 F;  2HYJ A;  3K2A A;  2A61 A;  3MMY B;  1VQ8 I;  1P4X A;  1IRF A;  5B1B H;  1T08 B;  5CLS A;  3W6V A;  2VKV A;  4PCQ A;  9ANT A;  2JK3 A;  1T8I A;  3V8J A;  2CV1 A;  2XGD A;  4B3X A;  2RNJ A;  1HW5 A;  5J4V A;  4BL0 B;  3I5U A;  4JX5 A;  5LHH A;  1V5G A;  1FYM A;  4UB8 C;  2CUF A;  4A6E A;  4EGY A;  1KZH A;  2OBP A;  3KYC B;  3F8C A;  2AXL A;  4AD9 A;  4Z2Y A;  5D5W B;  2Y0S A;  2NAZ A;  4OIR F;  1YJ9 I;  2ZME C;  3Q9S A;  3FMS A;  2F6C A;  4L5E A;  2Y69 H;  4XSZ F;  3ZMV A;  4CCN A;  3AG3 H;  5D6E A;  2MC3 A;  5BMZ A;  3CCE I;  1JGG A;  1IN7 A;  1CF7 A;  2FA5 A;  1MBJ A;  2FX0 A;  3QP6 A;  2YPR A;  3V42 A;  3CCS I;  2WB1 N;  5B3S H;  2OPT A;  4MFE A;  1WFX A;  2I5U A;  3V7S A;  2LG4 A;  2WY8 Q;  3S93 A;  2DDB A;  1TBX A;  3QPS A;  4NB5 A;  4OAZ A;  1VQ5 I;  1R00 A;  1RIO H;  1XCV A;  2R3S A;  3BTL A;  2ELH A;  1EF4 A;  3OSG A;  4HF1 A;  3KE2 A;  5HDG A;  4YEL A;  1LE8 A;  2R5Y B;  2Q2E B;  2DT5 A;  1LDJ A;  1USS A;  4V2G A;  5TRD A;  2E1O A;  1FMV A;  3EUH C;  4RM3 A;  1SAN A;  4IRI A;  4WXH A;  3LFK A;  2M8G X;  3TP3 A;  2F4O B;  4KJZ A;  4B4C A;  3N4M A;  1WJF A;  2CS3 A;  2VKD A;  3A01 A;  2LRE A;  1X3W B;  2JSC A;  1S7O A;  1ZK8 A;  1SC7 A;  3R6S A;  3WHC A;  1HLV A;  3I59 B;  1Z6T A;  2K5C A;  5F0H A;  3SZT A;  1T95 A;  2OQG A;  3ZN1 A;  3VB2 A;  3RTR A;  3SDG A;  2R7R A;  3OYF A;  1SFX A;  3GZN B;  3HUG B;  4UUV A;  2M3A A;  4HBL A;  5E17 F;  1Z0X A;  3ZRG A;  1TQM A;  3W6K B;  2EIN H;  1OPC A;  2GWR A;  5D5X B;  1UFM A;  2DW4 A;  4DZJ A;  1OLT A;  5K1Y A;  1YO5 C;  1I3Q J;  2HNH A;  5K7H A;  3RI4 A;  2CSO A;  4BE0 A;  3O8H A;  1GDT A;  5FLV A;  3LA2 A;  3KIO A;  3N97 A;  3C2H A;  4XL9 A;  5F04 A;  4E70 A;  5B1A H;  1Y39 A;  4L18 B;  1Y1V J;  2N8G A;  2P4W A;  2IA1 A;  3OYD A;  1EH6 A;  5HLI A;  5HS8 A;  2NRA C;  5DM7 F;  3CCM I;  2X48 A;  1Z3X A;  2G9W A;  4A3E J;  1MIJ A;  3BJA A;  1O3T A;  1WJ5 A;  1LJ9 A;  4F91 B;  4JP0 A;  2OAZ A;  1LKX A;  1W0U A;  3CD6 I;  4LIU A;  4LD5 A;  2DAO A;  2L2O A;  1B9M A;  3LQQ A;  4C3J J;  4AIK A;  2CYY A;  3BR5 A;  1OCT C;  1Q1H A;  1UHS A;  1ZGJ A;  3KX2 A;  4I98 B;  2JA8 J;  3HRU A;  4CO8 A;  5IOY A;  1JKQ C;  3OL4 A;  4XOP A;  4L9N A;  4LIT A;  4H4K C;  1TT0 A;  2V1N A;  2WY7 Q;  3BR6 A;  1OCZ H;  5EF6 A;  4V2F A;  5DD4 A;  3EYI A;  2ME0 A;  1ERD A;  1XC5 A;  2XB5 A;  2L5Q A;  5EZG A;  1K79 A;  1FY7 A;  1U9O A;  3K70 C;  2QUF A;  4ON0 A;  2JN6 A;  1O7F A;  3HKZ A;  3SJM A;  3LWF A;  2Z99 A;  2CRG A;  4G6Q A;  3OYE A;  1T6S A;  2OQR A;  4B8X A;  3CUO A;  1MH4 A;  1Z67 A;  2GXG A;  2MLG A;  3RKQ A;  1B8I A;  4KFC A;  2V4J C;  1IV6 A;  3TW6 A;  3D1N I;  1T33 A;  2KIM A;  2WAQ A;  2Z3Y A;  2DK5 A;  2LF8 A;  2QSF X;  3ABM H;  2ADU A;  1J0R A;  3E6D A;  3WE2 A;  1Y0U A;  2XAU A;  4UUS A;  2CQQ A;  2LF7 A;  2LR8 A;  5LBQ A;  4B43 A;  2HQ5 A;  1S9H A;  2HTJ A;  3D0S A;  2JZY A;  4N9H A;  2DPU A;  3OV8 A;  3CMM A;  3OY9 A;  1NHA A;  3DEE A;  4BAC A;  1YHQ I;  3S17 J;  2O03 A;  5LLQ A;  3DU6 A;  4I76 A;  3GLX A;  2WAE A;  4BJ5 C;  1PDN C;  5M3F J;  3CDI A;  5FRM A;  2DTZ A;  3QU6 A;  2H6B A;  3ML6 A;  2VBW A;  5GAH J;  3GO5 A;  2MYS A;  2IBD A;  2QQA A;  2R93 J;  1P4W A;  3WG9 A;  3S2W A;  3F0C A;  1JTX A;  2DA1 A;  3JTH A;  4RGX A;  1DU6 A;  1ETO A;  4O5V A;  3J80 Z;  2L7M P;  4BHC A;  3AFH A;  1AU7 A;  2DI3 A;  4XSX F;  1DP7 P;  4YRV A;  2EIM H;  1Z6R A;  4M6X A;  1QNT A;  3OIP A;  3P5J A;  2DOA A;  2F5F A;  3M1C A;  4ZYA A;  2ZSH B;  1J75 A;  1G2H A;  3N05 A;  1Y56 A;  2BW3 B;  4D9J A;  1MDM A;  3KEQ A;  3J7Z I;  2KIU A;  3K4N A;  2Z9O A;  4XN0 A;  2DXI A;  1BOB A;  2XKO A;  2LNB A;  3ESW B;  1TWA J;  4AYB N;  5EG0 A;  2GZW A;  3RDI A;  2K3F A;  3SZP A;  3ZQQ A;  2VQH A;  2CJJ A;  2Q2E A;  2R5Y A;  4WX9 A;  1ZYR F;  3B6C A;  4HV5 A;  1R49 A;  3DWL E;  2LKP A;  3ASN H;  4X6A J;  2ZME A;  5F08 A;  1D8J A;  2P81 A;  5FFX A;  5CVI A;  3S8P A;  1IRG A;  5CKT A;  4XLP F;  4JX6 A;  3H3Z A;  5E3L A;  5IP6 A;  4CZC A;  2ZO4 A;  4I2O A;  3D5L A;  3I59 A;  2F48 A;  4WWC A;  2EA4 A;  4PSW A;  2RN7 A;  4RAZ A;  4S05 A;  3HOU J;  3LAP A;  2JVG A;  1LDK B;  3BG3 A;  5IY5 H;  4HNV A;  3HUG A;  5DUK A;  4CCO A;  1Y1W J;  1FP2 A;  1FZP B;  2HVS A;  2HXI A;  2W84 A;  2DQR A;  4UUT A;  4CHU A;  2V6C A;  1BJA A;  3S1Q J;  5J8F A;  3EUH A;  4JYK A;  2E35 A;  2KZG A;  2DA4 A;  2R7V A;  2KIQ A;  1FPQ A;  3ZQI A;  3OYN A;  3F22 A;  2EK5 A;  4R8H A;  4BQA A;  3TDU C;  5CYV A;  4A3G J;  3QAH A;  1H0M A;  5FRO A;  2FBI A;  3FZV A;  2LD5 A;  1STZ A;  2EFP A;  1X1P A;  3E6M A;  2JSP A;  2VKH A;  2W7N A;  3ZMZ A;  3WGG A;  2LKS A;  3VYU B;  4M3F A;  2GIZ A;  1FIP A;  1IN5 A;  4CXF A;  3HSE A;  2FBH A;  1EJ9 A;  3SXY A;  5E79 C;  2EJR A;  1I1G A;  3GCM A;  1WVR A;  2H94 A;  2ZC2 A;  3GYH X;  3TDZ C;  4YG2 F;  4O3M A;  4HAM A;  1LEA A;  1BL0 A;  3ABL H;  1IN4 A;  3MKY B;  2PMZ N;  1JGS A;  2QVO A;  5ED4 A;  1JJ6 C;  4IVN A;  4IEJ A;  1YW9 A;  1GV5 A;  1SMY F;  3S32 A;  1LVK A;  4S0H B;  1RKW A;  2LTP A;  1D1B A;  4XLN F;  3MQ0 A;  3WHB A;  2ME6 A;  1A6I A;  1XSX A;  1XGM A;  1IO2 A;  2WAD A;  4YFN F;  4CYC A;  4G7Z F;  3PO3 J;  2UXN A;  3DLA A;  4XID A;  5FKL A;  3OOU A;  1D0Y A;  3R60 A;  4XLE A;  1LB2 A;  4ZDO A;  3S3N A;  2ZNZ A;  3BTJ A;  1TW3 A;  4CA0 A;  3DKW A;  4UY8 I;  5JFR A;  1JT0 A;  1UST A;  3FXR A;  2XDV A;  5TJJ A;  3T0Y A;  4KDP A;  2BYV E;  4HX7 A;  2DOD A;  2JA7 J;  3AAF A;  1LPQ A;  2L7Z A;  3RPU A;  4BGD A;  5K5O A;  2OZU A;  3GTM J;  5K7F A;  3C7J A;  1UMQ A;  2BV6 A;  4U0Y A;  3LL7 A;  1S72 I;  1VQL I;  1Z7L A;  3E5Q A;  2C6Y A;  4ZZL A;  2UWM A;  4XRS A;  2KLO A;  2CFX A;  1W1W E;  1BI2 A;  1FNN A;  4B1R A;  1UAA A;  2XSD C;  2ZJ2 A;  3JW4 A;  5E1Z B;  3BPV A;  3CCJ I;  2RRE A;  5TIS C;  3BCA A;  4KA4 A;  1R6R A;  2JMW A;  4XM3 A;  1NH3 A;  2BHZ A;  4NDL A;  1WSU A;  2TCT A;  2HQA A;  2V1X A;  5LGU A;  2DMU A;  4L5J A;  4A3F J;  3BZK A;  1ETK A;  3PUB A;  2DJI A;  1WI9 A;  2NOG A;  2JPC A;  3E7L A;  3NAR A;  3HL2 A;  3ZQC A;  4LLL A;  3EET A;  2KJC A;  4AVP A;  2HDW A;  3GTG J;  4GXO A;  3BC8 A;  3SHF A;  3KPH A;  4MIM A;  2L7K A;  5LGN A;  2A6E F;  2JA2 A;  4ZC3 A;  2HZD A;  1W36 C;  3I71 A;  4EEF G;  1JT6 A;  1DPR A;  4LK0 F;  2YU9 J;  2CW7 A;  3FKJ A;  1WJA A;  3GFL A;  3CP2 A;  1I39 A;  1ZG3 A;  1I3A A;  1OJL A;  5FKN A;  3PSI A;  1T39 A;  1LUJ B;  5ICG A;  3RKW A;  2VQC A;  3WU2 C;  1XSV A;  3O8G A;  5GPA A;  2KL4 A;  1ODD A;  2E5N A;  3LSR A;  4B47 A;  3FXQ A;  4DNC A;  1Y8R B;  4C2M J;  4IHW A;  1NK2 P;  5DV5 A;  3KEO A;  2R7O A;  4RAG A;  4M3G A;  4RB2 C;  4HOB A;  3LAJ A;  3GFM A;  3K4M A;  1Q1V A;  4I6Z A;  3FBN B;  5FB2 A;  5CVR A;  3U2R A;  1AKH B;  2XRN A;  4BDZ A;  2IS4 A;  4UXN A;  4ENN A;  2K7L A;  3M8J A;  4EQQ A;  1VTN C;  3BCB A;  2RGV A;  4XRS G;  3KYD B;  1QPI A;  3QOP A;  4HNT A;  2XGC A;  1DP3 A;  2A5Y B;  5H20 A;  4A3D J;  4QWQ A;  2UUZ A;  3DKY A;  3J81 Z;  4GRI A;  3CLQ A;  4E7K A;  3BLY A;  4A93 J;  3GME A;  5BPI A;  1PP7 U;  4Y3O A;  1KGS A;  4A12 A;  2IXS A;  1VQ9 I;  2QGU A;  2E1N A;  4OIN F;  2XGE A;  2BBY A;  2R7W A;  3MWM A;  4DYQ A;  2EIJ H;  1FEX A;  1CF7 B;  3F6O A;  3CCL I;  3K4B A;  4LLN A;  3TP0 A;  2H27 A;  1YIT I;  3HDD A;  3AKZ A;  4Y7N J;  3KET A;  3RJP A;  3HKZ N;  4XR6 A;  2MLK A;  2NVX J;  2Z33 A;  1WJB A;  2NS0 A;  5BQT A;  5HOO A;  1B1B A;  3IRQ A;  1R4M B;  1BI0 A;  3IC7 A;  1TNT A;  2WAQ N;  2YS9 A;  2W24 A;  4IQJ A;  3K7A J;  5HLH A;  2BOL A;  4M74 A;  2Y9Z A;  5GAD J;  1ACI A;  2G0E A;  1R1T A;  5CVU A;  1ZAO A;  2EPF A;  1SD7 A;  4BBS J;  2FEZ A;  4AID A;  3EDP A;  3KP7 A;  1TC3 C;  4E7Z A;  3R0J A;  3E97 A;  1X1D A;  5LEK A;  3CES A;  4L0Y B;  3P9K A;  3GW2 A;  2M30 A;  3MKZ A;  1OCO H;  1VF9 A;  1NG6 A;  4XNF A;  2V6E A;  2QZ8 A;  3CF5 F;  2AQE A;  1G3T A;  4NNJ A;  1SD5 A;  1FT9 A;  5EEG A;  4V19 K;  3PO2 J;  2IS1 A;  3EPZ A;  2OD5 A;  1PUF B;  2KDO A;  3KP4 A;  1FOY A;  4G6T B;  4DJA A;  1KYW A;  5FRN A;  2X4H A;  2XGX A;  3KP2 A;  1LEB A;  1YRN B;  1HXD A;  1YFH A;  1B59 A;  1VQ7 I;  3Q0U A;  1TWF J;  3NRV A;  4M72 A;  2EZI A;  5K5R A;  3CZ6 A;  1GV2 A;  2DT7 B;  2E34 A;  2VJ5 A;  5KK1 A;  3C18 A;  2FQ4 A;  2LBF B;  3BOQ A;  1F5T A;  4PSX A;  4LG3 A;  2EBI A;  3NEU A;  4PK4 A;  3QPH A;  3WU1 B;  1ZRE A;  4HV6 A;  1U6G A;  3IP4 B;  5LHG A;  3P9C A;  4YFX F;  2XAQ A;  5JHF A;  3FM3 A;  3V4G A;  5AIP A;  2AS5 F;  3HOS A;  5D5U B;  1JUP A;  3LA7 A;  3ZPL A;  4F3Q A;  4RMN A;  3O3K A;  2OTJ I;  1LVA A;  3GTL J;  3A02 A;  4BU2 A;  2ECC A;  2NNN A;  2VIX A;  2HYG D;  3B6A A;  4R79 A;  4ZH4 F;  4M3E A;  1HKQ A;  1G6N A;  2O3F A;  3SYT A;  4OU0 A;  3OR1 C;  5IYC J;  1JKO C;  1XS9 A;  3HGY A;  3M07 A;  4ZDP A;  2LY2 A;  1VQ6 I;  3LSH A;  4I0A A;  1W0T A;  2M9H A;  2L9S A;  1RR7 A;  1SFE A;  2K40 A;  3F8B A;  3MZY A;  1XG1 A;  2GAU A;  3L2Q A;  2FJ1 A;  2ZXH A;  3CQZ J;  1X4P A;  1QVT A;  2JUC A;  5HS9 A;  5IPA A;  1U5T A;  1ETX A;  4DW6 A;  3OYH A;  2YR2 A;  3RCO A;  4HDV A;  4CCK A;  4B3A A;  1AWC A;  3LSM A;  1X2M A;  2HTS A;  3QQA A;  1OCC H;  5GAG J;  1ZAR A;  2XPW A;  3JAM Z;  1OYY A;  4W97 A;  4UUS B;  1F43 A;  1QPM A;  3KCC A;  3G2B A;  3L7W A;  5J47 A;  4A3I J;  2L9R A;  1AKH A;  4ABZ A;  5DTD A;  3IAM 2;  3CCV I;  1WJD A;  5CQG A;  1XCB A;  1TQP A;  3LST A;  4CIC A;  4ZYG A;  4I02 A;  2ZJR F;  2HEO A;  1WJE A;  4I01 A;  2LRD A;  3K6G A;  3PIO F;  3B02 A;  3FXM A;  3QWL A;  2FOW A;  2LK2 A;  3DFG A;  1K78 B;  4AU7 A;  5EEA A;  3RSN A;  4MO7 A;  1WI3 A;  4QTR A;  4HX4 A;  2PJP A;  1EKE A;  1D1C A;  2PG4 A;  3PNT A;  1R5G A;  3FK7 A;  4HG2 A;  2LFB A;  2OTL I;  2VPR A;  4IX7 A;  3BR0 A;  5E8I A;  1JJ8 C;  3AL0 C;  2K9S A;  1GLN A;  2RV8 A;  3FHN A;  3F8N A;  1FWZ A;  3LSI A;  4RGS A;  2X9D A;  1P7I A;  1ETY A;  2YSR A;  2R7D A;  3BTI A;  4Y13 A;  1X1A A;  1LDD A;  5LFA A;  3OSF A;  2JWT A;  6PAX A;  2XRL A;  1YX3 A;  3RIR A;  2DMQ A;  5F1J A;  1S7A A;  4A3M J;  3L2R A;  1ZR4 A;  5F27 A;  2GXA A;  4RAY A;  3WTZ A;  5C44 J;  4OIQ F;  3F8M A;  2EV5 A;  4KIB A;  3LSG A;  3IV5 A;  3MZ8 A;  1MDM B;  3VWB A;  5FLX Z;  4HZF A;  2F2E A;  2JA6 J;  3HOX J;  1U8B A;  3I64 A;  3LSJ A;  1ONV A;  3AG1 H;  5EYR A;  1WHU A;  4EMS A;  3CTA A;  3TKY A;  3WTV C;  1H8A C;  1A36 A;  4QPO A;  3S14 J;  4HLY A;  1SD6 A;  2ZB9 A;  3QYE A;  2L0K A;  2GOM A;  2CQ7 A;  2Q1Z B;  3DBR B;  5EG0 B;  5IT3 A;  2E2H J;  2K02 A;  1XTA A;  1XGN A;  3I55 I;  3DTE A;  3VYT B;  1G3Y A;  2VL8 A;  3J7Y J;  3HOY J;  4XKB A;  2VC0 A;  3I0T A;  4C3I J;  2X1D A;  3M8F A;  5TGT A;  4XQF A;  3FK6 A;  3QPT A;  1JXS A;  2VKE A;  3FX3 A;  3F21 A;  3ERE D;  3QOD A;  1ZLK A;  4IOC F;  4P9F A;  2ZME B;  1N77 A;  3AL0 B;  3FXO A;  1WPK A;  2YUS A;  4PDK A;  5JR3 A;  2OC6 A;  2QYO A;  4U87 A;  2LMD A;  3GTO J;  1OFC X;  4XN3 A;  1G4D A;  1OCR H;  3OIQ A;  2FOK A;  5L3B A;  5J1R A;  2EV0 A;  3KP3 A;  4HDU A;  1SEU A;  1RC9 A;  4BXF A;  4PGG A;  3HOT A;  1PUF A;  3CP8 A;  2X51 A;  2STT A;  1YW7 A;  4FQG A;  3OOP A;  1Y8Q B;  1I6X A;  1ZRC A;  3WTX C;  3PFY A;  2YX7 A;  3ZMD A;  4L0Z B;  4MQV A;  1LFB A;  4RB0 A;  2VPL A;  4AUX A;  4RB3 C;  1YRN A;  2RKH A;  4MLO A;  3QYF A;  1FX7 A;  3QU3 A;  1X19 A;  2PQ8 A;  3J80 K;  1F1Z A;  3FXU A;  2JJ7 A;  4Q48 A;  2J5O A;  2LBF A;  3CDH A;  4A0X A;  5J4Y A;  2R7Z J;  1ZH5 A;  2K27 A;  3PFI A;  3HB9 A;  1Z1D A;  2LY9 A;  1IUF A;  1FJL A;  2H8W A;  3U1K A;  1G8X A;  4FT8 A;  2GXB A;  1TL8 A;  4IXA A;  2XHK A;  3NAU A;  4N4N B;  3MKL A;  1IF1 A;  1SMT A;  2CGP A;  1ZHF A;  2V9V A;  4E6K G;  5HNH A;  3H0D A;  3L1P A;  3FIS A;  1T56 A;  3HM5 A;  1E3O C;  4RM2 A;  2MSY A;  3DKX A;  1MNM C;  4I99 C;  4QSH A;  3I4M J;  1JKR C;  3EQL F;  2XAG A;  4RLQ A;  2R92 J;  3HRM A;  3CCU I;  2KZV A;  1D1A A;  1IUY A;  2XPU A;  2FNP A;  3RPU D;  3K70 D;  2WTE A;  4IF4 A;  5E1X A;  2DO7 A;  3ABK H;  1YTY A;  2IGM A;  1H88 C;  5H6Q A;  5E3N A;  5GPC A;  2WC2 A;  2HYF A;  3BJO A;  4OMZ A;  3BG5 A;  1V54 H;  2HDC A;  2CW8 A;  3LQR A;  4IHV A;  2E5Z A;  2FU4 A;  5D5V B;  1WQ2 A;  4XON A;  1RNL A;  3E3V A;  3OS1 A;  3DEW A;  1YX5 A;  4FTH A;  3A1Y A;  1MMD A;  2XPV A;  2HVQ A;  3G4S I;  3G1L A;  3TED A;  4A3L J;  4XOR A;  5CQE A;  4A5M A;  2GA1 A;  1EH7 A;  3CUQ C;  1BC7 C;  1MJA A;  4MHG A;  3BY6 A;  4CYC B;  1LQ1 A;  3P9I A;  3H1C A;  1IW7 F;  1QBJ A;  3DPL C;  3J7A O;  4ESB A;  3DTK A;  3U1D A;  1E17 A;  2K9L A;  4BHP A;  2HQN A;  1HCR A;  2XV4 S;  2ISZ A;  2IT0 A;  2Y48 A;  4R1H A;  1A31 A;  1S8N A;  1P6R A;  2WA0 A;  4K2E A;  5A2Q Z;  1XSD A;  5LRR A;  3ZGK A;  2QA4 I;  4D7M A;  3KLO A;  2PJR B;  1K78 A;  3F8F A;  1YW8 A;  2ID6 A;  1ZTR A;  2DYS H;  4TV7 A;  3CLO A;  4D0P A;  3R0A A;  3IKT A;  2W1O A;  5BPD A;  2F4M B;  3QP5 A;  3SFZ A;  1GVJ A;  2GLO A;  2D1H A;  1PP8 F;  2QBY B;  4BQO A;  2BVM A;  2JRT A;  1XPX A;  4DGW B;  5FKM A;  2EIK H;  2UV1 A;  2L01 A;  3K4K A;  2DBB A;  2KT0 A;  2RAE A;  1IDY A;  2AQF A;  3G6E I;  1O3R A;  2HPI A;  1WWX A;  1V3F A;  2XKP A;  1P4A A;  3CMA I;  2DT6 A;  2VJI A;  1H9G A;  2KKO A;  4XLA A;  3IKV A;  2COM A;  2WBM A;  2CUE A;  3O6B B;  4BS9 A;  2RQP A;  2O0Y A;  1RUO A;  3ECH A;  4I7H A;  4UB6 C;  3TO9 A;  1O7L A; 
#chains in the Genus database with same CATH homology
 3H3U A;  3HSF A;  4CYD A;  4YII A;  2HKX A;  3F6V A;  2EFN A;  1HQC A;  2G7H A;  2EFO A;  3QRF F;  2X0L A;  2VBX A;  4KNY A;  1XGO A;  4IHT A;  4GO1 A;  4ETS A;  1HSJ A;  1I5Z A;  3DP7 A;  5D8K B;  3V7C A;  3T1B A;  4L9V A;  2MD5 A;  1W4M A;  1KQ8 A;  4LMY A;  3T8T A;  4U7B A;  3DEU A;  2VT3 A;  3ECO A;  4IPA A;  3C3W A;  2QWW A;  1HBX G;  2Q0O A;  4ENK A;  3CO7 C;  3ZMS A;  3O2P E;  2VE9 A;  2XVC A;  1WKM A;  3G73 A;  1FC3 A;  2VT2 A;  3U9G A;  2JPB A;  1QGP A;  4KUM A;  5DCF A;  3BPX A;  3W6J B;  1O3Q A;  2M8E A;  4P96 A;  2W57 A;  2P6T A;  3IWF A;  3V8K A;  2FMY A;  5CVV A;  1FLI A;  2G7U A;  1ZG5 A;  4DQ2 A;  4N0B A;  3T8R A;  4M73 A;  1YYV A;  2EFQ A;  2M1B A;  4U7D A;  4AIH A;  1ZRF A;  5ILV A;  3GFJ A;  1O57 A;  2JT1 A;  2FQ3 A;  3R61 A;  1FSH A;  4WF2 A;  3ISP A;  3J81 K;  4MEX F;  2MA3 A;  5F64 A;  3ELK A;  2XAJ A;  4NQW A;  2IA0 A;  1U3E M;  2OZ6 A;  3VOE A;  2VON A;  1W7P A;  1L0O C;  1F4K A;  5BS6 A;  4Q4Z F;  3CUQ A;  3GWZ A;  2QBY A;  4KIC A;  1U5T C;  3FF5 A;  1R22 A;  5DCM A;  1MD0 A;  1QZY A;  1R36 A;  2RC4 A;  2Y0M A;  2L02 A;  5E20 A;  2P7C B;  1K7A A;  3I54 A;  5H6R A;  1YG2 A;  2STW A;  2ETH A;  3I53 A;  1R23 A;  1BI1 A;  1DDN A;  2O8X A;  3C1D A;  2D2W A;  1Z7U A;  2FSW A;  4I09 A;  1P92 A;  2CO5 A;  3K1P A;  4EM0 B;  1IXC A;  1XGS A;  4AWX B;  1H9T A;  1U5T B;  3T5X A;  3M8E A;  3TO6 A;  5HDN A;  1S3J A;  2UZK A;  5ILS A;  1IAW A;  1JHH A;  4Q5S F;  2F5D A;  1D8K A;  2E7X A;  1ULY A;  4MTE A;  3FM5 A;  4XRF A;  2NYX A;  2V1U A;  2HQR A;  4WXC A;  1TW2 A;  1CGP A;  4A5N A;  1GXQ A;  1R58 A;  2JTV A;  3ABU A;  1MJB A;  1UHW A;  1FP1 D;  2ISY A;  1QO0 D;  3GEZ A;  4CDG A;  3RPQ A;  2VXZ A;  2ACJ A;  5E8G A;  3KZZ A;  4G7O F;  2ZCW A;  2HWV A;  2MH2 A;  1J59 A;  1BIB A;  3TQN A;  2HOE A;  3HIF A;  5ERI A;  4OMY A;  1XD7 A;  5AIQ A;  4HLX A;  2L54 A;  4NHJ A;  2PN6 A;  1KU3 A;  1ZN2 A;  2BE5 F;  4WXD A;  4EJV A;  1IN8 A;  4LG0 A;  3F3X A;  4M9Z A;  1ZLJ A;  3HTU A;  3JAM K;  5L3D A;  3K0L A;  4XBF A;  3VFZ A;  4G94 A;  3GFI A;  1HKT A;  1YLF A;  4ESJ A;  2V1D A;  1J2X A;  2F5C A;  2PMU A;  1KYZ A;  1G3W A;  3IRR A;  4RGR A;  3VOD A;  1DPU A;  4CGZ A;  4ZZD A;  2A69 F;  4P5O A;  1HKS A;  3IWZ A;  4OIP F;  1EH8 A;  1SD4 A;  4N9I A;  4P55 A;  4HF2 A;  3K9T A;  3BZ6 A;  2NRA C;  1ZGA A;  5FLX K;  3JSP A;  2IA2 A;  3IL2 A;  3HSR A;  2J5P A;  2CG4 A;  2HGC A;  4U0W A;  2DFI A;  4KT5 C;  4RB1 A;  3VEP A;  1ZG1 A;  2VBZ A;  1OYI A;  1BC8 C;  2BEO A;  2FE3 A;  1B4A A;  3FWE A;  2VBY A;  2A68 F;  4U88 A;  2FXA A;  2K4J A;  5BOX A;  5FGM A;  4LJZ F;  4KMF A;  4UVC A;  2L4A A;  4A0Z A;  4IJA A;  1L3L A;  4RS8 A;  2CW0 F;  1FYL A;  2RDP A;  4ZYE A;  4HQM A;  5D4R A;  4PZJ A;  5D4S A;  4G9Y A;  1DUX C;  4A0Y A;  4QLC U;  2EA2 A;  2IW5 A;  5HLG A;  2ESN A;  4ZYD A;  1Z91 A;  5D8L B;  2PEX A;  2B0L A;  3TGN A;  3GXO A;  3HRT A;  3TOA A;  5HDK A;  2GA2 A;  4FX0 A;  2FNA A;  3WU0 A;  2DQL A;  2MH9 A;  3BJ6 A;  3HRS A;  4EJW A;  3KLN A;  2XAH A;  4HW0 A;  3PQK A;  2OU2 A;  3TO7 A;  1QZZ A;  2M87 A;  4UNO A;  4Q47 A;  1YS7 A;  1J9I A;  1BOA A;  1PUE E;  3FMQ A;  4UVA A;  5CVJ A;  1S29 A;  2YU3 A;  2P6S A;  1HW1 A;  4M71 A;  1T98 A;  4WK8 F;  1V4R A;  4FHT A;  3K2Z A;  5L3E A;  3G3Z A;  3ZMU A;  5AON A;  3RKX A;  4UVB A;  2QQ9 A;  4BXU A;  5A2Q K;  1KQ0 A;  3PQJ A;  2UXX A;  3GZ5 A;  1UB9 A;  1T2K A;  1I27 A;  3KP5 A;  3H92 A;  1U2W A;  2KIF A;  4HA8 A;  3Q9V A;  2E7W A;  3E6B A;  3L2C A;  3BDD A;  3L9F A;  1BN5 A;  2BGC A;  3NQO A;  2MBF A;  5F1R A;  4CZZ A;  2Q8K A;  3EYY A;  3GF2 A;  2PMH A;  1FOK A;  3M1E A;  3MEX A;  2ZNY A;  2HS5 A;  4H0E A;  1OR7 A;  1W7P D;  4A2U A;  1QQI A;  4O6J A;  2DK8 A;  5DUI A;  3P7N A;  4GYG A;  5HS7 A;  3IHU A;  3M9A A;  4PGH A;  5LHI A;  3F23 A;  2VN2 A;  3HTS B;  4U0V A;  2EV6 A;  3WTT C;  1K6O A;  2XUB A;  4Y17 A;  2D1V A;  2QEN A;  5HVQ C;  5L3C A;  4F7Z A;  4RGU A;  4L9J A;  3DF8 A;  1I1S A;  1TTY A;  2M5W A;  2XIG A;  4G7H F;  4ENJ A;  3COA C;  1W7P B;  2IVM A;  4UHT A;  1GHC A;  1KU9 A;  1YQA A;  1C0W A;  2HKO A;  3CUQ B;  2NNY A;  3F72 A;  5DCM B;  3ZMT A;  2FF4 A;  3KP6 A;  4HQE A;  2IJL A;  2LSO A;  2P7V B;  1F9N A;  1OKR A;  1O3S A;  2IRF G;  4YIF A;  2DLL A;  4UV9 A;  3V7R A;  2VOD A;  2VOP A;  2WV0 A;  1RI7 A;  4KIF A;  3DXJ F;  4EM2 A;  2CWE A;  1IXR C;  2CQK A;  4HX8 A;  1WRJ A;  4S04 A;  3MAJ A;  1RZ4 A;  5DD8 A;  1R5H A;  1P2F A;  2XAS A;  4JQF A;  1FBS A;  1XDS A;  2EFW A;  1SAX A;  5ICC A;  5DDG A;  5J8C A;  2PBI A;  5L3F A;  4JBA A;  2ZKZ A;  1SFU A;  1B9N A;  4EVI A;  2XRO A;  5FFZ A;  2V79 A;  4KN7 X;  3V8L A;  5E1W A;  3WTS C;  4M9S A;  1MKM A;  4JK1 X;  5LGT A;  3I4P A;  1AOY A;  3K1M A;  3WE3 A;  5D6F A;  2IP2 A;  4P9U A;  3BP8 A;  4GGG A;  1FYK A;  3FMR A;  4LLG F;  4MGR A;  3HHH A;  4EJU A;  1BBY A;  3ULQ B;  1MJ9 A;  4MQ9 F;  4Y15 A;  4LG0 B;  1BIA A;  1E2X A;  4KN4 X;  1D3Y A;  3WTY C;  3HHG A;  4G8X A;  3DV8 A;  2HFH A;  2FML A;  2HR3 A;  2GIV A;  4ENM A;  2E1C A;  3WOD F;  3KFW X;  3TOB A;  4YFK F;  2GQQ A;  5IT9 K;  1R1U A;  3E5X A;  2KRF A;  1EV7 A;  3K1N A;  2TDX A;  4ASN A;  1BM9 A;  1ON1 A;  4EV0 A;  1YS6 A;  1JE8 A;  1OYW A;  2L4M A;  4FX4 A;  5ILU A;  4LB5 A;  3JSO A;  4WCG A;  1TQI A;  2P5K A;  2O61 A;  5LRS A;  2PLY A;  1W5T A;  3E5U A;  5F6F A;  3RYP A;  5E18 F;  2HZT A;  3GZ6 A;  2DPD A;  4IRG A;  1A04 A;  3REO A;  3CO6 C;  2DTR A;  4IRH A;  4ZYH A;  1XMK A;  3GX4 X;  3GVA A;  1JHF A;  4BNC A;  2P5L C;  1FSE A;  3FHZ A;  2YX4 A;  4KMU X;  2FRH A;  1R7J A;  5CJ9 A;  4GYI A;  2ZXJ A;  1R1V A;  4KIG A;  1U78 A;  2ZFW A;  2O6G E;  5DEQ A;  2F5E A;  1KU7 A;  4EM1 A;  2QM3 A;  5IT9 Z;  1ON2 A;  2XAF A;  3WTU C;  3ZP5 A;  2DU9 A;  3BWG A;  3I58 A;  2L3D A;  3ABT A;  2EB7 A;  3M7G A;  1XN7 A;  2K86 A;  1Z05 A;  1REP C;  1XMA A;  2ZBK A;  3SQN A;  3ZQ7 A;  2Z5U A;  4ESF A;  3WGH A;  1GXP A;  3RKY A;  3KZY A;  5J6X A;  2VOO A;  4KYW A;  4B09 A;  1TNS A;  5JVT A;  2K4B A;  3L00 A;  4L9T A;  2EWN A;  1KA8 A;  3BRO A;  4OIO F;  4I0B A;  1HW2 A;  3MFK A;  4M6Y A;  1KU2 A;  4G6D A;  4LB6 B;  1X3U A;  4MEY F;  5KVR A;  4OOI A;  5ICF A;  3E6C C;  2QQB A;  1LNW A;  1D5V A;  3ROU A;  4BH9 A;  5K5Q A;  1Z9C A;  1T38 A;  1G3S A;  1YIO A;  2P5V A;  1RUN A;  2M45 A;  1IXS B;  3DQV C;  4LGW A;  2W85 A;  5FO5 A;  3DPT A;  1BI3 A;  3WTW C;  1UCR A;  2KJB A;  1XB4 A;  2OA4 A;  1MGT A;  4BYY A;  4MTD A;  2W25 A;  1HST A;  4HF0 A;  1J5Y A;  2H09 A;  1OMI A;  1B6A A;  4L5I A;  1ZRD A;  5FD6 A;  2A6H F;  2Y75 A;  5ICE A;  1J7K A;  2H6C A;  1IZ1 A;  5EEH A;  2VC1 A;  4GCV A;  2PFB A;  4UV8 A;  3JTG A;  3ZN0 A;  3L09 A;  4AIJ A;  4MNU A;  1IN6 A;  5JI6 A;  3MZH A;  4BAY A;  1MZB A;  3MCZ A;  5L3G A;  3B73 A;  4M9X A;  4IHS A;  1U8R A;  2IPQ X;  1W5S A;  3CJN A;  3RYR A;  2WWY A;  3Q5F A;  4EGZ A;  5JHU A;  1S6L A;  2FBK A;  4BHB A;  4LFU A;  4LK1 F;  2LDU A;  5DYM A;  3R4K A;  3K69 A;  5LEJ A;  2P8T A;  3GUD A;  2D45 A;  1XDU A;  1T0F A;  4EJT A;  2ESH A;  2QLZ A;  4EJO A;  3WGI A;  2PI0 A;  2RVC A;  1FBU A;  1TLH B;  2VE8 A;  2R7F A;  1KQ9 A;  1FBQ A;  5FD5 A;  4HYE A;  4A6D A;  1UHM A;  2A3S A;  3HYI A;  3LA3 A;  2A07 F;  2A61 A;  1P4X A;  1IRF A;  5CLS A;  4PCQ A;  3V8J A;  2RNJ A;  1HW5 A;  3I5U A;  5LHH A;  1FYM A;  4A6E A;  4EGY A;  2OBP A;  3F8C A;  2AXL A;  4AD9 A;  4Z2Y A;  5D5W B;  4OIR F;  2NAZ A;  3Q9S A;  3FMS A;  4XSZ F;  3ZMV A;  5D6E A;  2MC3 A;  5BMZ A;  1IN7 A;  1CF7 A;  2FA5 A;  3QP6 A;  2YPR A;  3V7S A;  1TBX A;  4NB5 A;  1R00 A;  1RIO H;  1XCV A;  2R3S A;  2ELH A;  4HF1 A;  3KE2 A;  5HDG A;  2DT5 A;  1LDJ A;  1USS A;  5TRD A;  4IRI A;  4WXH A;  3LFK A;  3N4M A;  2JSC A;  1S7O A;  3R6S A;  3I59 B;  1Z6T A;  3SZT A;  2OQG A;  3ZN1 A;  3VB2 A;  3RTR A;  4UUV A;  1SFX A;  5E17 F;  4HBL A;  1TQM A;  3W6K B;  1OPC A;  2GWR A;  5D5X B;  1UFM A;  2DW4 A;  5K1Y A;  1YO5 C;  3RI4 A;  2CSO A;  3LA2 A;  3N97 A;  4E70 A;  4L18 B;  2P4W A;  2IA1 A;  1EH6 A;  5HLI A;  5HS8 A;  2G9W A;  3BJA A;  1O3T A;  1LJ9 A;  2OAZ A;  4LD5 A;  2DAO A;  3LQQ A;  1B9M A;  4AIK A;  2CYY A;  1Q1H A;  1ZGJ A;  4I98 B;  3HRU A;  4CO8 A;  4L9N A;  5DD4 A;  3EYI A;  1K79 A;  1FY7 A;  2QUF A;  4ON0 A;  1O7F A;  3LWF A;  2Z99 A;  4G6Q A;  1T6S A;  2OQR A;  4B8X A;  3CUO A;  2GXG A;  2MLG A;  4KFC A;  2KIM A;  2Z3Y A;  2DK5 A;  2LF8 A;  3E6D A;  2ADU A;  1J0R A;  3WE2 A;  1Y0U A;  2LF7 A;  5LBQ A;  2HTJ A;  3D0S A;  2JZY A;  4N9H A;  2DPU A;  3OV8 A;  1NHA A;  2O03 A;  5LLQ A;  3GLX A;  1PDN C;  3QU6 A;  2H6B A;  3ML6 A;  2VBW A;  3GO5 A;  2QQA A;  1P4W A;  3WG9 A;  3S2W A;  3JTH A;  4RGX A;  3J80 Z;  4O5V A;  4BHC A;  2DI3 A;  4XSX F;  1DP7 P;  4M6X A;  1Z6R A;  1QNT A;  2F5F A;  1J75 A;  1MDM A;  3KEQ A;  2KIU A;  2Z9O A;  2XKO A;  2LNB A;  2GZW A;  3RDI A;  3SZP A;  2Q2E A;  4WX9 A;  1ZYR F;  4HV5 A;  2LKP A;  2ZME A;  1D8J A;  5FFX A;  5CVI A;  1IRG A;  4XLP F;  3H3Z A;  2ZO4 A;  4I2O A;  3D5L A;  3I59 A;  4WWC A;  2EA4 A;  2RN7 A;  4RAZ A;  4S05 A;  3LAP A;  1LDK B;  3HUG A;  5DUK A;  1FZP B;  1FP2 A;  2W84 A;  2DQR A;  4CHU A;  2V6C A;  1BJA A;  5J8F A;  3EUH A;  1FPQ A;  3F22 A;  2EK5 A;  4R8H A;  4BQA A;  3TDU C;  5CYV A;  3QAH A;  1H0M A;  2FBI A;  3FZV A;  1STZ A;  2EFP A;  3E6M A;  3ZMZ A;  3WGG A;  1IN5 A;  4CXF A;  3HSE A;  2FBH A;  3SXY A;  2EJR A;  1I1G A;  2H94 A;  3GYH X;  3TDZ C;  4YG2 F;  4O3M A;  4HAM A;  1LEA A;  1IN4 A;  1JGS A;  2QVO A;  5ED4 A;  4IVN A;  1YW9 A;  1SMY F;  4XLN F;  3MQ0 A;  1XSX A;  1XGM A;  4YFN F;  4G7Z F;  2UXN A;  3R60 A;  1LB2 A;  2ZNZ A;  1TW3 A;  3DKW A;  5JFR A;  1UST A;  3FXR A;  5TJJ A;  3T0Y A;  4KDP A;  2BYV E;  4HX7 A;  3AAF A;  3RPU A;  5K5O A;  2OZU A;  3C7J A;  2BV6 A;  4U0Y A;  3E5Q A;  2C6Y A;  4ZZL A;  2UWM A;  2CFX A;  1BI2 A;  1FNN A;  2ZJ2 A;  3JW4 A;  5E1Z B;  3BPV A;  4KA4 A;  1WSU A;  2V1X A;  5LGU A;  4L5J A;  1WI9 A;  2JPC A;  4LLL A;  3EET A;  2KJC A;  4AVP A;  4GXO A;  3SHF A;  5LGN A;  2A6E F;  3I71 A;  1DPR A;  4LK0 F;  3GFL A;  1ZG3 A;  1T39 A;  5ICG A;  3RKW A;  1XSV A;  1ODD A;  3FXQ A;  4DNC A;  5DV5 A;  3KEO A;  4RB2 C;  4HOB A;  3LAJ A;  3GFM A;  5FB2 A;  5CVR A;  3U2R A;  2XRN A;  4UXN A;  4ENN A;  2K7L A;  4EQQ A;  1VTN C;  2RGV A;  3QOP A;  2A5Y B;  5H20 A;  4QWQ A;  3J81 Z;  5BPI A;  1PP7 U;  1KGS A;  4A12 A;  2E1N A;  4OIN F;  2BBY A;  3MWM A;  1CF7 B;  3F6O A;  4LLN A;  2H27 A;  3KET A;  3RJP A;  2MLK A;  2Z33 A;  2NS0 A;  5BQT A;  5HOO A;  1B1B A;  3IRQ A;  1BI0 A;  3IC7 A;  1TNT A;  2W24 A;  5HLH A;  4M74 A;  1R1T A;  5CVU A;  1ZAO A;  1SD7 A;  2FEZ A;  3EDP A;  3KP7 A;  3R0J A;  3E97 A;  5LEK A;  4L0Y B;  3P9K A;  3GW2 A;  2M30 A;  2QZ8 A;  1G3T A;  1SD5 A;  1FT9 A;  5EEG A;  2OD5 A;  3KP4 A;  1KYW A;  2X4H A;  2XGX A;  3KP2 A;  1LEB A;  1HXD A;  1YFH A;  1B59 A;  3NRV A;  4M72 A;  5K5R A;  5KK1 A;  3C18 A;  3BOQ A;  1F5T A;  3WU1 B;  3NEU A;  3QPH A;  1ZRE A;  4HV6 A;  1U6G A;  5LHG A;  3P9C A;  4YFX F;  2XAQ A;  3FM3 A;  3V4G A;  5AIP A;  2AS5 F;  3HOS A;  5D5U B;  3LA7 A;  3ZPL A;  3O3K A;  1LVA A;  2NNN A;  2HYG D;  4R79 A;  4ZH4 F;  1HKQ A;  1G6N A;  2O3F A;  4OU0 A;  4I0A A;  1SFE A;  3F8B A;  3MZY A;  2GAU A;  5HS9 A;  1U5T A;  2YR2 A;  4HDV A;  1AWC A;  2HTS A;  1ZAR A;  3JAM Z;  1OYY A;  1QPM A;  3KCC A;  3L7W A;  1XCB A;  1TQP A;  3LST A;  4CIC A;  4ZYG A;  4I02 A;  2HEO A;  4I01 A;  3B02 A;  1K78 B;  3DFG A;  4HX4 A;  2PJP A;  2PG4 A;  1R5G A;  5E8I A;  2RV8 A;  4RGS A;  3F8N A;  1FWZ A;  2YSR A;  2R7D A;  4Y13 A;  1LDD A;  6PAX A;  3RIR A;  1S7A A;  4RAY A;  3WTZ A;  4OIQ F;  3F8M A;  2EV5 A;  4KIB A;  1MDM B;  5FLX Z;  4HZF A;  2F2E A;  3I64 A;  1ONV A;  4EMS A;  3CTA A;  3TKY A;  3WTV C;  4HLY A;  1SD6 A;  5IT3 A;  2K02 A;  1XGN A;  1G3Y A;  2VC0 A;  3I0T A;  3M8F A;  3QPT A;  1JXS A;  3FX3 A;  3F21 A;  3ERE D;  1ZLK A;  4P9F A;  2ZME B;  4PDK A;  5JR3 A;  2QYO A;  1G4D A;  2FOK A;  5L3B A;  2EV0 A;  3KP3 A;  4HDU A;  3HOT A;  4PGG A;  2STT A;  1YW7 A;  3OOP A;  1I6X A;  1ZRC A;  3WTX C;  2YX7 A;  3ZMD A;  4L0Z B;  4MQV A;  4RB0 A;  4RB3 C;  2RKH A;  1FX7 A;  3QU3 A;  2PQ8 A;  3J80 K;  1F1Z A;  3FXU A;  4Q48 A;  2J5O A;  3CDH A;  4A0X A;  1ZH5 A;  2K27 A;  3PFI A;  1Z1D A;  4FT8 A;  2GXB A;  4IXA A;  2XHK A;  1IF1 A;  1SMT A;  2CGP A;  1ZHF A;  2V9V A;  3EQL F;  2XAG A;  3HRM A;  1IUY A;  2FNP A;  2WTE A;  4IF4 A;  5E1X A;  2DO7 A;  1YTY A;  5H6Q A;  2WC2 A;  2HYF A;  3BJO A;  4OMZ A;  2HDC A;  3LQR A;  2FU4 A;  5D5V B;  1WQ2 A;  1RNL A;  3E3V A;  4A5M A;  2GA1 A;  1EH7 A;  3CUQ C;  1BC7 C;  1MJA A;  4MHG A;  3BY6 A;  1LQ1 A;  3P9I A;  1IW7 F;  1QBJ A;  3DPL C;  3J7A O;  4ESB A;  3U1D A;  1E17 A;  4BHP A;  2HQN A;  2ISZ A;  2XV4 S;  2IT0 A;  2Y48 A;  4R1H A;  1S8N A;  1P6R A;  4K2E A;  5A2Q Z;  1XSD A;  5LRR A;  3KLO A;  1K78 A;  3F8F A;  1YW8 A;  4TV7 A;  3CLO A;  4D0P A;  3R0A A;  3IKT A;  5BPD A;  3SFZ A;  3QP5 A;  1GVJ A;  2D1H A;  1PP8 F;  2QBY B;  2JRT A;  2L01 A;  2DBB A;  1O3R A;  1WWX A;  1V3F A;  2XKP A;  1P4A A;  1H9G A;  2KKO A;  3IKV A;  2COM A;  3O6B B;  2RQP A;  2O0Y A;  1RUO A;  3ECH A;  4I7H A;  3TO9 A;  1O7L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...