2PFBA

Structure of oxidized ohrr from xanthamonas campestris
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
136
structure length
129
Chain Sequence
LLQLDNQLCFALYSANLAMHKLYRGLLKALDLTYPQYLVMLVLWETDERSVSEIGERLYLDSATLTPLLKRLQAAGLVTRTRVIIALTETGRALRSKAGAVPEQVFCASASSLDELRQLKQELEKLRSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Mechanism of Organic Hydroperoxide Induction of the Transcription Regulator OhrR.
pubmed doi rcsb
source organism Xanthomonas campestris
molecule tags Transcription regulator
molecule keywords Transcriptional regulator OhrR
total genus 41
structure length 129
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2pfbA00
3KEOA 2GXGA 4IVNA 1DUXC 3M9AA 5F1RA 4O5VA 2ACJA 4LK1F 3WU1B 4A12A 3MZHA 4GCVA 2FF4A 3K1MA 5E8GA 5L3DA 2FEZA 2HS5A 3F8NA 2W57A 2G9WA 5EEHA 1YO5C 1TQPA 1TQIA 2FRHA 4MEXF 2VXZA 1ZRFA 4MEYF 4U0VA 1ZARA 3ROUA 4I02A 2R7DA 1QGPA 2ESNA 3HHGA 2DO7A 3NEUA 3B02A 3KP2A 1WWXA 1YW7A 1FSEA 3VFZA 4L9TA 2QM3A 2O8XA 1REPC 4L5JA 4PCQA 1MGTA 1YTYA 3CUOA 2Z99A 4ZZDA 3EQLF 3IRRA 3C3WA 4OIRF 3T8TA 1MZBA 2V1XA 2DK5A 3S2WA 5CYVA 4G6DA 3U2RA 3WGIA 2HOEA 4XSXF 2PEXA 3LAJA 4RAYA 3M8EA 2Q2EA 3GZ6A 2F5DA 4BXUA 1OYIA 1IRFA 1DDNA 2Z9OA 3L9FA 2OAZA 2MH2A 2BGCA 3KP4A 5CVRA 5E17F 2HQRA 1KQ8A 3JW4A 3ERED 3CJNA 2PJPA 5DEQA 1OPCA 2JT1A 3MEXA 4HX7A 4EQQA 1ONVA 4ON0A 2XUBA 2L02A 3ECHA 3ULQB 1SD7A 2VBXA 2PMUA 4I09A 3E6CC 1RUNA 5BQTA 1AWCA 3ZMSA 4CO8A 1W7PD 4A0XA 4LG0B 2PG4A 2EV5A 4M6XA 1SD6A 1LB2A 1G3WA 1U5TC 3K9TA 4LLLA 2ISYA 5D6FA 4MQ9F 1JHHA 4CYDA 2DBBA 2QQBA 4AIHA 2H94A 1F5TA 4UVAA 3K1NA 1XGNA 3BJ6A 3ML6A 4I0AA 4PDKA 3BDDA 4CDGA 4BQAA 2JRTA 1WSUA 1KGSA 3LA7A 4K2EA 1I6XA 3GO5A 1XMKA 1U3EM 3MZYA 2V1UA 3HIFA 1HKSA 4HLYA 1T38A 4G9YA 3JSPA 3E6BA 4OIOF 3HRTA 1J2XA 2E1CA 5A2QK 1I5ZA 2EB7A 1J5YA 4LB6B 4N9HA 2M30A 2QUFA 2LDUA 3C18A 4LLGF 2J5OA 5E8IA 1FYMA 1TW3A 4AIKA 2HKXA 3ZMVA 4KUMA 3JAMZ 1MDMA 2P7VB 1MJAA 2FMLA 1U2WA 1KU9A 3WE2A 1RIOH 2VBZA 2D45A 4Z2YA 5FD5A 1XSXA 5L3BA 3WTTC 2FOKA 1OR7A 3D5LA 5LGUA 2MBFA 2DLLA 3RTRA 3R61A 3RKXA 2IA1A 2P7CB 2KIUA 5J8CA 5E1XA 3HRUA 4G7OF 2L3DA 1U8RA 2FXAA 1FP1D 4DQ2A 1UHWA 3PQKA 4RAZA 4P9FA 2IW5A 5LHIA 1S7OA 1PP7U 3RPQA 2EWNA 1IW7F 1SFXA 2XAQA 2HYFA 1FZPB 2NYXA 5CLSA 1HQCA 1PUEE 5K5OA 1Z7UA 1H0MA 2WWYA 4HOBA 4I2OA 2DAOA 1O3TA 1IRGA 3KFWX 2RVCA 4CZZA 5CVJA 1DPUA 1QQIA 3V8KA 1BIAA 1MDMB 3DFGA 5FLXZ 1HBXG 4XSZF 3QP6A 2STTA 4EJWA 2E1NA 3DPLC 5ICGA 3D0SA 3ABUA 3W6KB 2DTRA 1CGPA 1J0RA 1F1ZA 2GAUA 1P2FA 4KYWA 1EH8A 2K27A 1FLIA 4NQWA 4RB3C 3M8FA 2EK5A 3I53A 3P9KA 4HW0A 1IXCA 1TLHB 4RB1A 4ZYGA 2EFNA 2GZWA 4LD5A 5D5XB 4RGRA 5H6QA 1R5GA 3GXOA 2RDPA 4EV0A 1FWZA 2RGVA 3ECOA 5DD4A 2ESHA 3E3VA 4M6YA 3JTGA 2AS5F 4TV7A 2HFHA 5LBQA 3V4GA 5ICCA 3RJPA 2XAHA 3F6OA 3CLOA 2FNPA 2VONA 3TO7A 4KN7X 4ENNA 5K5RA 1CF7B 3BP8A 3EUHA 1BJAA 3JAMK 2ZKZA 1SAXA 1KU3A 3K2ZA 5TRDA 2JSCA 1U5TB 4L0ZB 1ODDA 1DPRA 4S05A 1GXQA 4AD9A 4IHTA 3RDIA 1O3SA 2FBIA 4ZYHA 4UXNA 3ZMTA 2VE9A 2PFBA 2XKPA 1SMTA 2M8EA 3M1EA 1G3YA 1XGMA 1T0FA 4CHUA 5DCMB 1T6SA 4HZFA 1R1UA 3CTAA 4G8XA 4HV5A 2ZJ2A 3IRQA 1WKMA 2KIMA 4HA8A 1FT9A 2QENA 2XAJA 3REOA 2PBIA 1YLFA 3WTSC 1XB4A 3GFMA 4OMZA 5LGTA 4M71A 2BYVE 2OQRA 2P5KA 3ZMUA 4BHCA 1YYVA 3QP5A 2L4AA 1BIBA 2MD5A 4LK0F 4YIIA 2XIGA 1UHMA 3RPUA 4Q47A 1V3FA 5HS7A 2L01A 3J7AO 4A6EA 2JPBA 3E97A 3FMQA 4UUVA 2LF7A 1D8JA 2WTEA 3DEUA 5D5UB 5L3EA 1D3YA 1WI9A 4QWQA 2XGXA 4P55A 1TW2A 4FX0A 1X3UA 2HWVA 3KZYA 1P4XA 3WTZA 2MA3A 2RC4A 3H3UA 2UXNA 4EJTA 1W7PA 4JK1X 2EJRA 2VODA 4I0BA 2W24A 2V6CA 1XCBA 4Y15A 2ZXJA 3KP7A 2VBYA 1T98A 3F21A 3GW2A 1KU7A 3I71A 5E1ZB 2OD5A 1H9TA 3I0TA 2CO5A 2WC2A 3FMSA 1BI0A 4WXHA 1Z9CA 2C6YA 2P5VA 2IRFG 1B9MA 4HQMA 3WG9A 3FX3A 5EEGA 3HTSB 2XROA 3TOBA 5FO5A 1IN8A 1KYZA 3KLOA 3O3KA 4GYGA 4EJOA 3QPHA 3IKTA 1XGSA 4UV9A 4L9VA 3WTVC 2F5CA 4L0YB 5ILSA 3SZPA 1ZRDA 1L3LA 4P5OA 1LQ1A 2YU3A 4HX4A 3SQNA 3ZN0A 5IT9K 3ABTA 3I5UA 2W85A 3F8CA 2PI0A 1UB9A 2ZNZA 2OBPA 3FM5A 2PLYA 3I59B 3V7CA 3BROA 1BI3A 4A5MA 1Q1HA 5CVVA 5DUIA 3K69A 3QAHA 4YFNF 5ERIA 4GYIA 4R1HA 2P6TA 1G6NA 4M9XA 4GGGA 5DCMA 4HV6A 5ICFA 1PP8F 1HSTA 2QZ8A 5F64A 4WF2A 4EGZA 2DPUA 2HTJA 2Q8KA 2VE8A 5KK1A 2KKOA 2LF8A 2A5YB 2G7HA 4H0EA 4ZH4F 4R79A 3FHZA 5BS6A 2PN6A 4EM0B 4G6QA 2WV0A 1XDSA 1K78B 4O6JA 4U0WA 1KYWA 1LDJA 5E1WA 5BPIA 2VBWA 1IAWA 1KQ9A 1JE8A 4F7ZA 2FSWA 1E2XA 2CW0F 3HOTA 3BOQA 1W5TA 2CGPA 1SFUA 1LEBA 1O7LA 4Q48A 1J75A 3HYIA 5D5WB 3F8FA 1BN5A 2EFOA 5LLQA 2X4HA 2O0YA 3HUGA 2JTVA 3FXRA 3TKYA 1S29A 1ZN2A 1P4WA 3HSFA 1WQ2A 4ENJA 3Q9SA 3LA2A 2E7XA 4WX9A 5LRRA 1ON2A 5H6RA 3BPVA 2FQ3A 5D4SA 1FOKA 1MJ9A 2ZMEA 4O3MA 1ZREA 1UFMA 3CUQC 2O61A 3LQQA 4LGWA 3WODF 4GXOA 1JHFA 3ZP5A 4G7HF 1P6RA 5DCFA 1O7FA 4EMSA 2QYOA 2OZ6A 4BHPA 3J81Z 3QPTA 3PQJA 2QBYA 4AWXB 4ZYEA 1MD0A 5L3CA 5LGNA 4RB2C 1B1BA 2GWRA 1FX7A 3IWZA 4ENKA 5D4RA 2QLZA 5JVTA 4ESJA 2ADUA 2YPRA 2L54A 4N9IA 5CJ9A 2VT2A 2V1DA 2ZO4A 5HOOA 1B6AA 1ZG3A 3TO6A 4ENMA 4PZJA 1OYWA 3RKYA 3DP7A 2A69F 4A6DA 1ULYA 1E17A 2GXBA 4MQVA 4A5NA 3W6JB 3RKWA 3WTYC 3N4MA 4XBFA 1XDUA 3WTXC 3GFIA 3P9IA 3WE3A 3WTUC 1VTNC 3U1DA 2QWWA 4BYYA 3F22A 1V4RA 1XN7A 3HSRA 4FX4A 2ZNYA 4L5IA 2HZTA 3BJOA 3J81K 2D1VA 1FNNA 2GQQA 5CVIA 3K0LA 2HQNA 2VOPA 5AIPA 1TNSA 4NB5A 3FZVA 1RZ4A 3G3ZA 3B73A 1IXRC 5K5QA 1WRJA 2K4BA 5FFXA 2XASA 2XAFA 2J5PA 1W7PB 2FE3A 4GO1A 3NQOA 1S7AA 1Z91A 2UZKA 4G94A 4PGHA 4EVIA 5HDKA 1IN6A 1IUYA 2ZBKA 4M9SA 2TDXA 4CGZA 3J80Z 5FFZA 4LB5A 1ZG1A 1YFHA 1DP7P 3WGGA 3IL2A 1I1GA 1IXSB 1HKTA 2XAGA 3TDZC 2Y75A 3V7RA 1S8NA 4ZZLA 3G73A 4KA4A 3SZTA 1U6GA 2V9VA 3VODA 4MTDA 5TJJA 3O2PE 2GIVA 3LWFA 1XSVA 3FF5A 5J8FA 5L3GA 1G4DA 1TTYA 3EYIA 4BH9A 4U88A 2ISZA 2OQGA 2RNJA 4OIPF 1LVAA 4IRIA 3LAPA 3C7JA 1FYLA 4KIFA 2D1HA 2OZUA 3I54A 3RYPA 1RNLA 4I7HA 3F72A 2XKOA 4HF0A 4HLXA 3SHFA 2R3SA 5JR3A 4KMFA 3L00A 3C1DA 2ZMEB 1XGOA 1R7JA 3H3ZA 3SXYA 5HLIA 2O6GE 3TGNA 2F5FA 5DDGA 3KETA 1LDKB 2CFXA 3DV8A 1AOYA 4M72A 3DQVC 1RI7A 4XRFA 1TBXA 3LQRA 4OIQF 2NNYA 1FBUA 2H6CA 4OU0A 1B4AA 1BBYA 1Z6RA 2CYYA 5LEJA 3I64A 3EDPA 5FLXK 2KIFA 4BNCA 2V79A 4IF4A 4YIFA 1LEAA 2A6EF 3KCCA 3DXJF 3E6MA 4IHSA 2MC3A 4A2UA 4WXCA 3J80K 4HBLA 2P5LC 3F6VA 1EH6A 2KJBA 1W4MA 4OINF 1F9NA 2IPQX 3K1PA 5D8LB 3E5UA 3GFJA 1U78A 4HQEA 5HVQC 2VC1A 2Q0OA 2A3SA 3MFKA 5FGMA 3R0AA 3KEQA 3LSTA 1KU2A 4LLNA 3COAC 2HKOA 4KMUX 2AXLA 2W84A 5ILUA 1HW5A 4KT5C 2VC0A 3MAJA 2DFIA 1R36A 3IKVA 4P96A 3F3XA 4L9JA 3GWZA 2XVCA 4KIGA 2EA4A 3QU3A 1HXDA 5HDNA 5HS8A 1ZGAA 2UWMA 2EV0A 2RKHA 5L3FA 3BJAA 3H92A 4LJZF 1O3QA 1ZGJA 6PAXA 4M74A 4UVCA 3KP5A 4ETSA 1RUOA 3F8MA 4CXFA 4HDUA 2VN2A 4IRHA 2IP2A 5LHHA 2Y0MA 4UVBA 3IWFA 3CUQA 3ZMDA 5LHGA 1MKMA 1ZAOA 4EM2A 3KLNA 1I1SA 1TNTA 3HRMA 2EFQA 2LNBA 3FM3A 1KA8A 2EFWA 1EV7A 3BZ6A 3GF2A 3Q9VA 2DQRA 3R4KA 3GVAA 2MLGA 4L9NA 4AIJA 2FMYA 3TDUC 1ZLJA 5IT9Z 1R22A 2R7FA 5HDGA 2YX4A 1O57A 4E70A 2K02A 1P92A 3P9CA 2DI3A 4D0PA 3DKWA 3ZMZA 2G7UA 3OOPA 4KDPA 5FD6A 1K7AA 1IN7A 2K4JA 2HGCA 5BOXA 3F23A 3RI4A 3HHHA 4HX8A 1QZZA 5ED4A 3GX4X 5FB2A 3QOPA 2PMHA 3T8RA 3E6DA 3GUDA 1ZYRF 2IA2A 3TO9A 3WTWC 4B8XA 1STZA 4WK8F 1BM9A 2CQKA 4I01A 2LSOA 3V8LA 4S04A 3KE2A 1R1VA 1KQ0A 3ELKA 4M9ZA 2W25A 1HSJA 4OMYA 1MJBA 2COMA 4RB0A 4G7ZF 1Z1DA 2MH9A 3TOAA 1B59A 3CDHA 5LRSA 2YR2A 2MLKA 4RGUA 2OA4A 1ZRCA 3HSEA 3WU0A 2XV4S 1K6OA 2HDCA 1OKRA 4P9UA 4EJVA 4WXDA 5BMZA 4EM1A 3WGHA 5HS9A 1D5VA 2NAZA 3N97A 3EETA 1HKQA 5J6XA 1QNTA 5JHUA 4UHTA 3M7GA 2F2EA 1K78A 3E5QA 2QBYB 1BI2A 2FBKA 4LG0A 3ZQ7A 3L7WA 2HEOA 4EGYA 1IF1A 1IZ1A 1LDDA 5DD8A 1J7KA 4B09A 5KVRA 1OMIA 3CO6C 4RGXA 3T0YA 2FA5A 4BHBA 1J59A 2IT0A 4WWCA 4Y17A 2BE5F 4EJUA 2Y48A 5IT3A 2KJCA 1S6LA 4MGRA 4IJAA 1R58A 3GZ5A 1Z05A 2ETHA 2QQ9A 4U7BA 1CF7A 5D6EA 4ZYDA 3FXUA 1OYYA 1YW8A 4HF1A 1NHAA 3L2CA 3KZZA 1FBQA 3QRFF 2RQPA 5CVUA 5AONA 2ELHA 1H9GA 2JPCA 2DW4A 1GVJA 2VOOA 4KN4X 1FC3A 3I4PA 5F6FA 5BPDA 5K1YA 2B0LA 2M87A 4MHGA 4N0BA 4RGSA 3LFKA 3GFLA 2A07F 4UNOA 1W5SA 2K7LA 1R00A 1BC8C 2IA0A 4M73A 4QLCU 2H09A 2A6HF 4A0YA 3JTHA 1BOAA 3BY6A 4KFCA 1IN4A 2HTSA 1YIOA 3O6BB 4NHJA 3R0JA 2BEOA 3RIRA 5ICEA 4HF2A 1BC7C 1GXPA 1J9IA 2XHKA 1F4KA 1Y0UA 4PGGA 1TQMA 1R23A 3QU6A 1PDNC 2GA2A 3HTUA 3R6SA 5D8KB 1FY7A 3VEPA 1B9NA 1QPMA 3DF8A 4I98B 3AAFA 2IVMA 4Y13A 3FMRA 2RV8A 2DU9A 2CSOA 2EV6A 4A0ZA 3IC7A 4U7DA 1XD7A 1FP2A 2M5WA 3T5XA 4KICA 4RS8A 1ZH5A 1FYKA 3VOEA 3I59A 4KNYA 4Q5SF 3R60A 4KIBA 5LEKA 4MNUA 2KRFA 3E5XA 3ZPLA 1FPQA 1G3TA 2RN7A 1ZHFA 2HR3A 1QZYA 5ILVA 3I58A 5A2QZ 2ZCWA 3ISPA 4UV8A 2BBYA 1T39A 5AIQA 1YQAA 1JGSA 2FBHA 1S3JA 4AVPA 2CWEA 3MCZA 1YS6A 2D2WA 1L0OC 3MQ0A 4OOIA 2YSRA 2STWA 2DQLA 4HDVA 2O03A 4ASNA 1USTA 2DT5A 1D8KA 2Z33A 2P4WA 5DV5A 1UCRA 2ZFWA 4L18B 1U5TA 4DNCA 1GHCA 2NRAC 2K86A 2YX7A 2IJLA 3IHUA 4LMYA 2A61A 2DPDA 2M45A 4ESBA 3ZN1A 4HAMA 2JZYA 1YW9A 1ZLKA 3JSOA 4U0YA 1YG2A 5HLGA 3GEZA 2M1BA 3GYHX 3MWMA 1R5HA 4FT8A 1USSA 2O3FA 2H27A 1FBSA 2P6SA 3P7NA 5HLHA 4HYEA 1XMAA 1IN5A 1QO0D 1ZG5A 3OV8A 4FHTA 2H6BA 3SFZA 2A68F 3BWGA 4R8HA 5DYMA 3Q5FA 1ON1A 4MTEA 1K79A 2GA1A 3RYRA 3V7SA 5E18F 3L09A 4JBAA 2X0LA 2Z3YA 3VB2A 4YG2F 2BV6A 1SFEA 1LJ9A 5JI6A 1HW2A 3T1BA 3V8JA 3NRVA 2XRNA 3HRSA 3BPXA 1R1TA 1FSHA 2NNNA 3CO7C 2L4MA 1XCVA 2VT3A 2CG4A 1QBJA 2HYGD 3KP6A 5H20A 1O3RA 1SD5A 2F5EA 2NS0A 1LNWA 5D5VB 1G3SA 5DUKA 2FNAA 1Z6TA 1T2KA 1I27A 3F8BA 5E20A 1SMYF 4YFXF 3DPTA 2FU4A 5JFRA 2UXXA 3KP3A 1JXSA 3LA3A 2OU2A 4Q4ZF 2E7WA 3EYYA 4XLPF 2P8TA 2EA2A 4ESFA 2LKPA 3FWEA 1P4AA 4IPAA 2EFPA 3CUQB 2QVOA 3FXQA 3GLXA 2DK8A 4XLNF 1A04A 4IXAA 1HW1A 3PFIA 3U9GA 4CICA 4YFKF 2Z5UA 1EH7A 4BAYA 2QQAA 1XSDA 1YS7A 4LFUA 1BI1A 2PQ8A 1C0WA 4IRGA 3HOSA 1SD4A 4JQFA 3TQNA 4WCGA
chains in the Genus database with same CATH superfamily
2JK3A 3H36A 2EZKA 2GXGA 3KEOA 4IVNA 5EEAA 1DUXC 3AKZA 3CCYA 1YJ9I 3M9AA 2W7NA 1XC5A 4O5VA 5F1RA 4QIWN 2ACJA 3QWLA 4LK1F 4CSWA 3BCAA 3WU1B 4A12A 3HPHA 3MZHA 4NNJA 3CF5F 2W82A 3IAS2 4GCVA 2FF4A 3CCLI 3K1MA 2DA4A 1QVTA 4XN0A 4HRIA 5J4YA 5E8GA 2EQRA 5L3DA 2X6XA 2FEZA 2HS5A 3S1RJ 3F8NA 1P7IA 2W57A 3CJQB 4CCJA 3MD2A 5B1AH 2G9WA 4BGDA 4V19K 2CJJA 5EEHA 1YO5C 1TQPA 4UB6C 1TQIA 3CQZJ 2FRHA 4MEXF 4KJZA 3SFIA 2VXZA 1ZRFA 4MEYF 4XLCA 1ERDA 4U0VA 3HG9A 4CA0A 1ZARA 3ROUA 4I02A 3A01A 1K4TA 1QVUA 5KCMA 2R7DA 1D5YA 1QGPA 2ESNA 4D9JA 1TL8A 4IQ4A 5M3FJ 3HHGA 4WCGA 3OSGA 2DO7A 2LG4A 4PSWA 1UG0A 3NAUA 4DYCA 1AKHA 1V54H 3B02A 3KP2A 3NEUA 1WWXA 1YW7A 3VYUB 4CZCA 3OIQA 1FSEA 1M1EB 3VFZA 2JSPA 4L9TA 2KDZA 3CCSI 2QM3A 2HVRA 2MD0A 2NVTJ 3LNQA 2O8XA 3JRIA 3FXLA 1REPC 4L5JA 4PCQA 1MGTA 1YTYA 3CUOA 1MIJA 2MC4A 2OUMA 1XG1A 1FOYA 2Z99A 4ZZDA 3EQLF 3IRRA 3C3WA 2X6OA 4OIRF 3T8TA 3CD6I 1MZBA 3L2WA 3S15J 4XLEA 1FOWA 1MH4A 1KONA 2V1XA 2DK5A 3CDLA 3AL0C 3G1OA 4E7IA 3F9KA 3S2WA 5CYVA 4CCLA 2WAFA 4G6DA 3U2RA 3WGIA 2HOEA 4XSXF 5FKOA 1X19A 3M4OJ 3JRGA 4PJMA 2PEXA 3LAJA 4RAYA 3M8EA 2L9RA 2Q2EA 3GZ6A 2FJ1A 1HCRA 2F5DA 4BXUA 1E3HA 1OYIA 2BHZA 1IRFA 1DDNA 3CCVI 2Z9OA 3NWSA 5B1BH 3L9FA 2OAZA 2MH2A 2BGCA 2CQQA 3FK7A 2FOWA 1GUUA 1IC8A 2UUZA 2K9LA 3KP4A 5CVRA 5E17F 2HQRA 3LMMA 5DM6F 1KQ8A 3JW4A 2M9HA 3ERED 1TT5B 3CJNA 3PSIA 2PJPA 5DEQA 2IS1A 1OPCA 2JT1A 3MEXA 4HX7A 1BR2A 1O4XA 3A0HC 4EQQA 1BJZA 1ONVA 3AG3H 4Y7NJ 2L7FP 4ON0A 2XUBA 2L02A 3ECHA 1NH3A 3ULQB 4DBQA 1SD7A 4A3MJ 2DOAA 2VBXA 2PMUA 4I09A 2NXNB 4MFEA 3E6CC 1RUNA 5BQTA 4IL6C 1AWCA 2CMPA 2L9SA 4Y4RA 3ZMSA 1GDTA 1W36D 4G6TB 4CO8A 1W7PD 4A0XA 4LG0B 2PG4A 2EV5A 3PFYA 1GT0C 1Y39A 3FIWA 4DIQA 1A5JA 1ENHA 4KITB 2ELKA 1VNDA 4UB8C 5EGOA 3ZRGA 2JRMA 4M6XA 1SD6A 3A1YA 1LB2A 2I10A 1G3WA 1U5TC 4FE4A 3K9TA 1G8XA 3IP4B 4LLLA 1LVKA 2ISYA 3ABLH 5IOYA 5D6FA 3OYFA 4MQ9F 1JHHA 4CYDA 3I9V2 4ZJZA 2DBBA 3PNTA 2QQBA 4AIHA 2H94A 1T08B 3M1CA 4BBRJ 1F5TA 4UVAA 3K1NA 3GTPJ 3CCEI 1XGNA 3BJ6A 3ML6A 4I0AA 4II2A 4PDKA 5M5XJ 3BDDA 4CDGA 1X2MA 4BQAA 2JRTA 1WSUA 1KGSA 3LA7A 2FQ4A 1LPQA 4K2EA 1SEUA 1I6XA 2AXTC 2FUG2 3GO5A 5BNGA 1XMKA 3CJRB 1U3EM 3MZYA 2V1UA 2DJIA 3HIFA 1HKSA 2BHYA 3H5AA 4HLYA 1T38A 4G9YA 4XLFA 3K70D 3JSPA 3E6BA 4OIOF 3HRTA 1J2XA 3FBNB 2E1CA 5A2QK 3BZCA 1OCOH 1OCZH 3ZQHA 3HOUJ 1I5ZA 2EB7A 1J5YA 1TWAJ 1WJFA 4CCMA 4U87A 3G2BA 4LB6B 4N9HA 2M30A 2QUFA 1R71A 2BY3A 2LVSA 2LDUA 1TC3C 3FXJA 3C18A 4LLGF 2J5OA 3DCFA 2XPUA 5E8IA 1WHUA 4BXXJ 3SZGA 1FYMA 4IQJA 1TW3A 4AIKA 1QU3A 4NC7A 2HKXA 3ZMVA 2DYRH 4KUMA 3JAMZ 3G1MA 2VIXA 2P7VB 1MDMA 1MJAA 2KP6A 1ZR4A 2R7VA 2QKLB 1DQUA 2FMLA 1K61A 1U2WA 4BQNA 1BW6A 1KU9A 2M2EA 3WE2A 1RIOH 2VBZA 2HPIA 2HDDA 3OY9A 2D45A 1OLTA 1VF9A 1K83J 5FD5A 4Z2YA 3SDBA 1U9NA 1XSXA 5L3BA 3WTTC 2BY2A 2FOKA 1OR7A 4XOTA 3D5LA 4L5EA 2WV1A 5LGUA 2QSGX 3DEWA 2MBFA 2DLLA 4BBSJ 3PO3J 2R0QC 3RTRA 1UELB 3R61A 2Y9ZA 3RKXA 2IA1A 2P7CB 3CZ6A 2V6EA 3H9JA 1A6IA 2KIUA 5J8CA 4LIUA 3I55I 3ZQQA 5E1XA 3HRUA 4G7OF 2L3DA 4XKVA 1U8RA 3PUBA 2JA2A 2FXAA 1FP1D 1YE9A 4DQ2A 2D5VA 2KIQA 1UHWA 3PQKA 2DA7A 4P9FA 4RAZA 2IW5A 5LHIA 1S7OA 1PP7U 3RPQA 2EWNA 1WI3A 1IW7F 1SFXA 4PK4A 2XAQA 2HYFA 1FZPB 2X85A 2NYXA 5CLSA 1HQCA 1PUEE 5K5OA 4FQGA 1Z7UA 1PUFB 1H0MA 1DGWY 4B47A 2VKHA 1SVLA 1X2NA 1LFUP 2WWYA 2X48A 4HOBA 4I2OA 3JCUC 2DAOA 5FKLA 1O3TA 4J19A 3FXOA 1IRGA 3KFWX 2RVCA 4CZZA 4BJ6C 3BCBA 1ETKA 5CVJA 2WADA 1FIAA 2CQXA 1DPUA 2VB6A 2IS6A 1QQIA 3V8KA 4XKWA 1BIAA 1MDMB 3IV5A 2VI6A 2L7MP 3DFGA 5FLXZ 1HBXG 4XSZF 2P81A 2RAEA 3QP6A 2STTA 2RNGA 4EJWA 3J7ZI 2E1NA 3DPLC 5ICGA 3D0SA 3ABUA 3W6KB 3OIPA 3ZR8X 2JA7J 2NRAC 1FTTA 2DTRA 1CGPA 1J0RA 1RR7A 2DA1A 1FEXA 5J1YA 1F1ZA 3KPHA 3OYEA 4F52A 1Y8QB 1V5FA 4Y33A 5FRNA 2GAUA 4AVZA 1P2FA 1HLVA 3IH3A 3MN2A 4KYWA 4QTRA 1X1DA 2IGMA 1EH8A 5IY5H 2LC2A 4E6KG 4HPQA 2EZLA 2K27A 4YRVA 1FLIA 2HU9A 4NQWA 3TBIA 4AYBA 4RB3C 3M8FA 2R7UA 2EK5A 2F4OB 3I53A 2PMZN 3P9KA 3BTCA 4HW0A 2JA5J 1IXCA 1TLHB 3DBHB 5B3SH 4RB1A 4ZYGA 2EFNA 2GZWA 1Z0XA 4A3KJ 2VQCA 2R5ZA 4LD5A 5D5XB 4RMNA 3CMAI 1Q1VA 2AHQA 3HZJA 1H88C 3AFHA 4RGRA 5H6QA 3GXOA 1R5GA 2JUGA 2RDPA 4EV0A 1FWZA 2RGVA 3VPRA 4F3QA 4XK4A 3CDIA 1KZHA 3A2KA 3ECOA 2DT6A 5DD4A 3Q3SA 2JVGA 3CP8A 3PJRA 2ESHA 3E3VA 2R7WA 4ZTJA 4M6YA 2Z16A 4AM3A 1TWHJ 4C3IJ 3JTGA 3GTLJ 2W4SA 2LR8A 2Y30A 3IAM2 2AS5F 2BZTA 3K4LA 4TV7A 3K4BA 1NK3P 1K4SA 3ABKH 5C4XJ 2MFZA 2HFHA 5LBQA 3V4GA 5ICCA 3RJPA 2XAHA 3CCRI 3F6OA 3LOCA 2K3FA 2ZXIA 1N78A 3CLOA 2FNPA 3FXMA 2LH9A 2VONA 2BVMA 1LUJB 1Z3YA 1YI2I 3TO7A 4KN7X 4YIRX 4ENNA 2DOEA 1AU7A 1Y56A 5K5RA 1CF7B 4DOZA 3BP8A 3EUHA 1BJAA 3JAMK 4XRSA 2ZKZA 4RM3A 2K40A 1SAXA 1KU3A 2KFDA 3K2ZA 5TRDA 2JSCA 2QSHX 1B8IA 1U5TB 4L0ZB 5EG0B 2VXDA 4J00A 4AC0A 1ODDA 3OR2C 4E7LA 1DPRA 3OSFA 4ITVA 5LFAA 4S05A 1GXQA 4AD9A 4IHTA 3RDIA 4C2MJ 4A3FJ 1O3SA 2FBIA 4XMYA 4ZYHA 4UXNA 1UJ8A 3ZMTA 3EUHC 2VE9A 2PFBA 3JRHA 2XKPA 1SMTA 2MABA 3GLLA 2M8EA 3M1EA 3S17J 1E0EA 1G3YA 1XGMA 3DBLB 5GAEJ 1T0FA 1B8IB 4PJJA 4CHUA 4BU2A 2Q2EB 1H89C 5DCMB 5FKNA 1T6SA 5TISC 4HZFA 1R1UA 3CTAA 4G8XA 4HV5A 2ZJ2A 3IRQA 1WKMA 1WCMJ 2KIMA 4HA8A 3TMOA 1D0ZA 2I8DA 5GTIC 1R5ID 1FT9A 1XTAA 2QENA 2XAJA 3PL8A 3REOA 2IGOA 2PBIA 3DEEA 1YLFA 3WTSC 1XB4A 3GFMA 3DKYA 4OMZA 5LGTA 2K9MA 4M71A 2BYVE 1VQLI 4I99C 3JRFA 3HUGB 1ZQ3P 2OQRA 4A3LJ 3U21A 2P5KA 3ZMUA 4BHCA 1YYVA 1DU0A 2VUMJ 3JRAA 3QP5A 3HC7A 2L4AA 1BIBA 1VQKI 2MD5A 4LK0F 4YIIA 2XIGA 3KYDB 2ELJA 3P5JA 1UHMA 3RSNA 3RPUA 4Q47A 3BLYA 1V3FA 4G12A 5HS7A 2HOAA 2Y0SA 2HYJA 2L01A 2ZSIB 3J7AO 5DS9A 1XS9A 3BC8A 4A6EA 1AKHB 5IYBJ 3VWBA 2JPBA 3S1QJ 2JA8J 3E97A 4BY7J 2E19A 3A0BC 2VASA 4DJAA 4E7JA 2H1KA 2ZSHB 5FKKA 3FMQA 4UUVA 2LF7A 5CQEA 1D8JA 3HM5A 2WTEA 3DEUA 5D5UB 5L3EA 1D3YA 3ZXSA 1NK2P 1WI9A 1MBHA 3ZQLA 4QWQA 2XGXA 2E2HJ 4NQWB 4P55A 2XC7A 1TW2A 4FX0A 3SEZA 1X3UA 2HWVA 3KZYA 3CC2I 3MZ8A 2GOXB 3S3MA 2O8KA 1P4XA 2X1EA 2MA3A 3PNVA 3WTZA 2W48A 2RC4A 3H3UA 2UXNA 1YJWI 1T33A 3BG9A 1W7PA 3D5SC 4EJTA 4JK1X 1D1CA 2EJRA 2VODA 4I0BA 2DA3A 2PJRB 2W24A 5CPRB 2LKXA 2V6CA 2CUJA 1XCBA 4Y15A 2ZXJA 2E34A 1ETQA 3KP7A 2R7QA 2B63J 1I6HJ 2DA2A 2ID3A 2VBYA 4C30A 1T98A 3B6AA 3F21A 3GW2A 2OTLI 1KU7A 3DTIA 3I71A 1TT0A 2DDBA 5E1ZB 2OD5A 2PX9A 3W6VA 1H9TA 1MBFA 3I0TA 1ORKA 1IG7A 4LITA 2CO5A 2WC2A 4BEHA 3HOVJ 3FMSA 2VJIA 1BI0A 4WXHA 3S16J 3QYFA 1Z9CA 2C6YA 1TZLA 4XLAA 4NDLA 2P5VA 4IKFA 1Y8RB 3Q0VA 4B44A 2IRFG 1B9MA 1ETOA 3K4JA 4HQMA 4C3HJ 3WG9A 4CUGA 5C3EJ 2V7FA 2WAQN 1JTYA 4E4HA 2QKMB 3FX3A 5EEGA 4FISA 2Y0SN 2Q1ZB 3HTSB 3K10A 3TOBA 4XKBA 5FO5A 2XROA 3A03A 1IN8A 1KYZA 3KLOA 3O3KA 4GYGA 1JKPC 2CQNA 4EJOA 3QPHA 4XOPA 3IKTA 3GBGA 5JLWA 1XGSA 2WY7Q 4UV9A 4L9VA 3WTVC 1T56A 3W2AA 2F5CA 4XONA 2M34A 4L0YB 3GTQJ 5CQGA 2LKSA 5ILSA 1UG2A 1R4MB 3SZPA 1ZRDA 1L3LA 3K70C 5J1UA 4P5OA 5E3OA 1WJCA 2JMWA 1LQ1A 2YU3A 2ECBA 2GXAA 3J7AY 2VJJA 5DM7F 2H8RA 4HX4A 5F27A 3W2WA 3D1NI 3SQNA 3ZN0A 1P7JA 5IT9K 3ABTA 3BTLA 3I5UA 5FKMA 2W85A 3F8CA 2PI0A 1UB9A 2L0KA 2OBPA 2ZNZA 3FM5A 3LSJA 4DGWB 3O8GA 5KAFC 2PLYA 1OCRH 1QRYA 3I59B 3V7CA 3E7LA 4A93J 4IX7A 3BROA 3VYRB 1BI3A 1IUFA 1WGXA 4A5MA 1Q1HA 4BE1A 5F04A 5CVVA 5DUIA 3K69A 1DGRM 1FTZA 3QAHA 5ERIA 4GYIA 4R1HA 3VYSB 2P6TA 4YFNF 2GBYA 3X2QH 1G6NA 4M9XA 4JX4A 4GGGA 5K7FA 1AA7A 5DCMA 4HV6A 5ICFA 2Z2SB 3J7YJ 1MMNA 3ZOBA 4HNVA 2JN6A 1X1BA 1PP8F 4XIDA 3U1KA 1HSTA 2QZ8A 5F64A 4WF2A 2NVYJ 1Y0NA 4EGZA 4EATA 3E0JB 2DPUA 3I4MJ 2HTJA 2VKVA 2Q8KA 4HSTA 2VE8A 5KK1A 2KKOA 2LF8A 3KZIC 2ZJRF 2A5YB 3JREA 2KHMA 5C4JJ 4D7MA 1MSFC 2G7HA 4H0EA 5FLVA 1GLNA 4ZH4F 3S2DJ 1X1AA 2K9QA 4R79A 3WHBA 4CCKA 3SDGA 3FHZA 5BS6A 2QEXI 2PN6A 1BW5A 2BW3A 5HLTA 1HDDC 4EM0B 4G6QA 2WV0A 1XDSA 1JGGA 1Z21A 1RKTA 1K78B 4O6JA 4BL0B 4A3BJ 1U9OA 1RC9A 2YUSA 1ZKGA 3RZDJ 4U0WA 1KYWA 1POGA 1LDJA 4B48A 2M4KA 2AQEA 1R4NB 3DWLE 5E1WA 1VQPI 5BPIA 2E2JJ 2VBWA 1IAWA 3BT9A 1WFXA 1AHDP 3M3YJ 3FHNA 1T8IA 1KQ9A 1JE8A 4F7ZA 2IAIA 3H3VK 2DFHA 2EPFA 2MYSA 4IHVA 5IPAA 3AG2H 3OYKA 2IS2A 2IGNA 2FSWA 1E2XA 2CW0F 2DJNA 3BOQA 1W5TA 3HOTA 1SFUA 2CGPA 1R6RA 1LEBA 1O7LA 4PSXA 4Q48A 5FLMJ 3JRBA 3G4SI 1J75A 4BACA 1W5CC 3HYIA 5D5WB 3F8FA 2B7EA 3GTKJ 1BN5A 1FMVA 2EFOA 1EF4A 1VQMI 2NOJB 3BR3A 4W1UA 1IV6A 5LLQA 1SFOJ 3S2HJ 3DBRB 1WJEA 3PM1A 3OOUA 2X4HA 2F48A 2O0YA 2K3PA 3B6CA 3HUGA 2JTVA 1JKRC 3BZKA 3HOZJ 1IDZA 5IP6A 1I3QJ 3M8JA 3FXRA 3TKYA 4DW6A 1S29A 1ZN2A 1P4WA 3HSFA 1WQ2A 4ENJA 3Q9SA 3CC7I 3AG4H 1EA3A 1E3PA 3LA2A 4A3DJ 3S1MJ 2E7XA 3UNGC 4WX9A 1ZGWA 2EH3A 2MGQA 5LRRA 2WBMA 1ON2A 3ZQIA 2KRHA 5H6RA 1WJDA 3BPVA 2FQ3A 1J09A 2LYCA 1OISA 2XF7A 1X3WB 1I3AA 4BE0A 5D4SA 4A69C 1FOKA 1MJ9A 2ZMEA 4JP0A 4O3MA 4MLOA 1ZREA 1UFMA 3CUQC 4GRIA 2WA0A 2O61A 3LQQA 1OFCX 4LGWA 5E3NA 3WODF 1FIPA 4GXOA 1APLC 1JHFA 3ZP5A 4G7HF 1JKQC 3QPLA 1P6RA 5DCFA 4RLQA 1O7FA 2A6TA 4RA2A 5M5YJ 2HVSA 4EMSA 2QYOA 4XQFA 2OZ6A 2RREA 3DU6A 4BHPA 3J81Z 3QPTA 3PQJA 3QYBA 4F91B 2QBYA 1SAUA 4AWXB 4ZYEA 2ICWG 3NWTA 2XAUA 1MD0A 3QODA 5L3CA 5LGNA 4RB2C 3L2VA 2KMUA 1B1BA 1IRZA 2GWRA 1FX7A 3IWZA 4ENKA 1FOXA 5D4RA 2QLZA 3DTKA 5JVTA 4ESJA 1MH3A 2ADUA 2YPRA 2L54A 4N9IA 2VQGA 3H0GJ 4X1EA 3SJMA 3K4CA 5CJ9A 2VT2A 2H8WA 2V1DA 2ZO4A 5HOOA 1B6AA 1ZG3A 1VI0A 2O7OA 3TO6A 1Z67A 4ENMA 4IHYA 1ETWA 1LFBA 2N8GA 1K6YA 4PZJA 1OYWA 1WJBA 2L5QA 3RKYA 3DP7A 1LKXA 1EJ9A 3MKWB 2HI3A 2A69F 4A6DA 3S3NA 1ULYA 1E17A 3KYCB 4MQVA 2GXBA 4FASD 2ZC2A 4A5NA 3OYHA 3W6JB 4NBQA 4PJLA 3RKWA 3WTYC 4IZZA 3N4MA 1BA5A 4XBFA 1PYVA 4D7NA 1YOVB 1XDUA 2YS9A 3WTXC 2DMPA 3GFIA 4E7KA 4BY1J 5J47A 2E36A 2F5VA 1NG6A 3P9IA 2M0MA 1S72I 3WE3A 5F08A 3WTUC 3O8HA 1VTNC 3U1DA 2QWWA 2QF7A 4BYYA 3F22A 1WJAA 3PIOF 2LFBA 3ASOH 4BDYA 1V4RA 1XN7A 3N05A 2BXZA 1ITYA 3BR0A 4OAZA 2Y31A 3HSRA 4FX4A 2CH0A 2ZNYA 4L5IA 4X6AJ 4XL9A 2HZTA 4RDUA 4DZPA 4AUXA 3BJOA 3J81K 2D1VA 3JRDA 1FNNA 3G1LA 1GVDA 2GQQA 5IP9J 5CVIA 1NTCA 2ZB9A 2HQNA 3K0LA 5AIPA 5LD2C 4X0GA 2VOPA 2MG4A 1TNSA 4NB5A 1WH7A 3FZVA 4IO9F 2L2OA 2E1MB 1ZR2A 2XB5A 1RZ4A 3G3ZA 1P9QC 3OYLA 3B73A 3TW7A 1Y1WJ 5JLXA 1IXRC 4CYCB 3TEDA 5K5QA 1WRJA 3K4KA 2BY0A 4UUSB 2K4BA 5FFXA 2OCCH 2M0CA 2XASA 2OF7A 2XAFA 2J5PA 1W7PB 2FE3A 5GP9A 2LRDA 4GO1A 1WJ5A 3CCJI 4XICA 5H2FC 4DYRA 3NQOA 1ACIA 1S7AA 4I6ZA 1Z91A 2UZKA 4G94A 4PGHA 3VYTB 1RR8C 4E7HA 3V42A 4EVIA 2NVXJ 4B1RA 5HDKA 1IJWC 1IN6A 1IUYA 2ZBKA 5B66C 4M9SA 2TDXA 4CGZA 3J80Z 5FFZA 2H1LA 2M8GX 4LB5A 3OMYA 1YFHA 1ZG1A 1DP7P 3WGGA 2WAQA 1Z7LA 2E35A 3IL2A 1I1GA 2X6WA 2HVQA 1V5EA 1IXSB 2X9DA 1HKTA 2XAGA 1I50J 3TDZC 2Y75A 3OL3A 3BG5A 2QA4I 3V7RA 1S8NA 2HZDA 4ZZLA 3G73A 4KA4A 3SZTA 3VDXA 3OYDA 4A3IJ 3ESWB 2CFOA 1U6GA 4AU7A 4JX5A 4UUTA 1Z77A 2V9VA 3VODA 4MTDA 5TJJA 2DCEA 1PVEA 3O2PE 2MW8A 2GIVA 2IGKA 1XSVA 2K9SA 3FF5A 3LWFA 4M6VA 1QZEA 4BQQA 5J8FA 3BTIA 1BOBA 5L3GA 2CUZA 1G4DA 1TTYA 3EYIA 3GTGJ 4BH9A 2X6YA 2XGDA 1OCPA 2X51A 4U88A 2ISZA 2OQGA 3LSIA 1MBEA 1VQ6I 2DA6A 2RNJA 4OIPF 1LVAA 4IRIA 3LAPA 3ABMH 3C7JA 2BVLA 1FYLA 4FTHA 4KIFA 3HJEA 3KIOA 3FDYA 2D1HA 2DODA 2OZUA 1VQ9I 4JX6A 3I54A 1VQOI 3RYPA 1RNLA 2KZVA 2KZGA 4I7HA 2L9VA 3F72A 2XKOA 4HF0A 4HLXA 3SHFA 1Z3XA 1JKOC 4PFPA 2R3SA 5JR3A 4KMFA 3L00A 2E71A 3GTJJ 2EBIA 2TRTA 3C1DA 1MSEC 2ZMEB 1XGOA 3HXLA 3RQ4A 1R7JA 3H3ZA 3SXYA 3JRCA 5HLIA 2CUFA 2O6GE 4F92B 3TGNA 5F0CA 3TW6A 2F5FA 2R7RA 5DDGA 1SVOA 3KETA 1JT6A 3PSFA 1MBJA 2R5YB 1LDKB 2CFXA 2AQFA 2VQLA 3DV8A 1AOYA 1R9TJ 1JJ6C 4M72A 3ZQFA 2LMDA 3DQVC 1RI7A 4XRFA 3UR3C 1TBXA 3LQRA 2O9LA 4OIQF 4M3BA 2CRGA 2NNYA 1FBUA 5C44J 2H6CA 4V2GA 4OU0A 1B4AA 3QOEA 1BBYA 1Z6RA 3DU5A 3PNYA 4RAGA 2XPVA 4QSHA 2CYYA 5LEJA 4N4OB 3I64A 3EDPA 3H1CA 2BOLA 3EPZA 2LD5A 4IOAF 5FLXK 4CCOA 2KIFA 4BNCA 2V79A 3OR1C 4IF4A 4YIFA 1LEAA 2ZMEC 2BY1A 2CW8A 2A6EF 2DTZA 3CCUI 3KCCA 3DXJF 3E6MA 3W2VA 2KISA 2Y69H 4IHSA 2MC3A 2VL8A 3OWTA 4ZYAA 4OAYA 4A2UA 4WXCA 3J80K 5JHFA 4HBLA 2P5LC 3F6VA 1ETXA 4C2UA 3GTMJ 1YX5A 5EJCA 3H35A 1MW7A 1EH6A 4RBOA 2KJBA 1W4MA 4OINF 2VPLA 1F9NA 2DFEA 2IPQX 3K1PA 5J40A 3L2UA 2DN0A 3OYAA 5D8LB 3E5UA 3GFJA 1U78A 3Q0WA 2E2IJ 4HQEA 4RM2A 2LK2A 5HVQC 2VC1A 2Q0OA 1T95A 2A3SA 3MFKA 2CS3A 1XPXA 5FGMA 3LSHA 2RQQA 2GOMA 4XKCA 3GZNB 2A05A 2GLOA 3R0AA 2IEKA 3SYTA 2JWTA 3KEQA 3LSTA 1KU2A 4LLNA 3COAC 3BR5A 3I4NJ 2HKOA 2AXLA 4KMUX 2W00A 1VFCA 1I39A 2W84A 5ILUA 1HW5A 1MMAA 4KT5C 3KX2A 4BUPA 4NUBA 2VC0A 3MAJA 1OJLA 2DFIA 2LBFB 1R36A 3IKVA 5KHDA 4P96A 1WVRA 3F3XA 3BG3A 3HL2A 4L9JA 3H9QA 3GWZA 2JUCA 2R7SA 2XVCA 4KIGA 1VQNI 2EA4A 4XRSG 3QU3A 4NC8A 2OTJI 1HXDA 5HDNA 4PFOA 5HS8A 1ZGAA 3WG7H 2EV0A 3VSLA 2CQ7A 5J1RA 1YIJI 2RKHA 2UWMA 3CCMI 5L3FA 4HEA2 2R7XA 3BJAA 1MBGA 4PUSA 2JQ7A 3H92A 4LJZF 1O3QA 1YRNB 5FJ8J 2E1OA 2I5UA 1HC8A 1ZGJA 1PUFA 6PAXA 4OWRB 4S0HB 3HOYJ 3RQIA 4M74A 4UVCA 4I76A 3HGGA 2V9KA 3KP5A 4IEJA 4ETSA 1RUOA 1X58A 2DMNA 3F8MA 1A36A 3QYEA 4CXFA 4HDUA 2VN2A 2GIZA 4IRHA 2IP2A 2KDOA 5LHHA 3S32A 2DFFA 4BJ5C 1SVMA 2Y0MA 4UVBA 3IWFA 4D5FA 5EF6A 3CUQA 4Z6YA 3ZMDA 5LHGA 1MKMA 1ZAOA 3ZQGA 1RESA 4EM2A 2HOTA 3KLNA 2VPRA 1I1SA 1TNTA 3RPUD 3HRMA 2L9NA 3LSPA 2EFQA 2LNBA 3TL4X 3FM3A 2EIJH 4YELA 1KA8A 2EFWA 1RRJA 2EZHA 1EV7A 3BZ6A 3GF2A 3EUAA 3Q9VA 2DQRA 3CF2A 3R4KA 1JT0A 1D0XA 3GVAA 4IOCF 2MLGA 2KPMA 4L9NA 3HB9A 4AIJA 2FMYA 3TDUC 5FROA 1ZLJA 2CW7A 5IT9Z 2ID6A 1R22A 2R7FA 3MKZA 3BG6A 3A4CA 2YX4A 5HDGA 4M3DA 3FBIB 2M3AA 1O57A 2X1CA 4E70A 5E3LA 2K02A 1BL0A 3S3OA 2XDVA 2F6CA 1U0JA 1QHGA 1P92A 3P9CA 2DI3A 5KNLA 2KT0A 4D0PA 3DKWA 2F4MB 3GCMA 3ZMZA 2G7UA 2R93J 3OOPA 2KRCA 4KDPA 5FD6A 3ZGKA 1K7AA 1IN7A 2K4JA 2HGCA 5BOXA 2LBFA 2XPWA 3F23A 3RI4A 2L7KA 3HHHA 1RETA 4HX8A 5HODA 3SEQA 1QZZA 4N4NB 5ED4A 1MMDA 1UHSA 2DT7B 3OIOA 3GX4X 5FB2A 3QOPA 2PMHA 2LLKA 3E6DA 3T8RA 3OYMA 3GUDA 1MMGA 1ZYRF 2IA2A 3TO9A 3WTWC 4B8XA 1STZA 4WK8F 1BM9A 2CQKA 4I01A 2LSOA 3V8LA 4S04A 3S14J 3KE2A 1R1VA 4Y52J 2DDAA 1LE8A 1QA6A 1MNDA 1ETVA 2DMTA 4P1WA 1KQ0A 4FE7A 3ELKA 1HDPA 1SFKA 4M9ZA 3S93A 2W25A 3I56I 2OC6A 1HSJA 1YX3A 2NVUB 4OMYA 5IYDJ 4HSRA 3DTEA 5B5EC 1MJBA 3PIPF 3RKQA 2COMA 4RB0A 4G7ZF 5K7ZA 1Z1DA 4ZDPA 2MH9A 4A3EJ 3TOAA 1B59A 3OS2A 3CDHA 5LRSA 2YR2A 4IHXA 4C3JJ 2IS4A 2MLKA 2K85A 2CU7A 4RGUA 1XX5A 2OA4A 5M5WJ 1ZRCA 3CESA 2FD5A 2P0WA 3HSEA 3WU0A 2XV4S 4A3CJ 1K6OA 2E5NA 2HDCA 2CV0A 3CMEI 1OKRA 3LSKA 4P9UA 4EJVA 1X1CA 2QGUA 4WXDA 5BMZA 4EM1A 3MKYB 3WGHA 1H8AC 4II3A 2EZIA 2DOFA 5HS9A 1D5VA 2NAZA 3N97A 1B72B 2HDWA 3EETA 1ZTRA 1QPIA 1HKQA 3BQZA 2CV2A 1EKEA 2M7AA 5J6XA 1MNEA 2JJ7A 1QNTA 3ZQCA 5JHUA 4UHTA 1VQ8I 3DKXA 3M7GA 4J01A 3OYCA 2F2EA 5EGOB 1F36A 3UKGA 2VKEA 5HNFA 2LY2A 3E5QA 1K78A 2QBYB 1TWCJ 1UAAA 4GFBA 1BI2A 2FBKA 2CV1A 4LG0A 2DA5A 5K7HA 3ZQ7A 3L7WA 2BW3B 2DYSH 3F0CA 2HOSA 1SANA 2HEOA 4EGYA 1W0UA 1IZ1A 1LDDA 5DD8A 1IF1A 1J7KA 4IHWA 3C2BA 5F1JA 2HPMA 4A3GJ 1JUSA 2LP0A 2XGCA 4CH7A 4B09A 5KVRA 1OMIA 3CO6C 4RGXA 3T0YA 2FA5A 2VKDA 4BHBA 1J59A 2IT0A 1TWGJ 2G0EA 1XMXA 1E3OC 3LSGA 4Y17A 4WWCA 4ZDOA 2BE5F 4EJUA 1JUMA 1N25A 2Y48A 5IT3A 3K4MA 1X4PA 2ZJPF 4ZC3A 2KJCA 1S6LA 2JA6J 4MGRA 4IJAA 3Q0UA 1R58A 4XM3A 4CCNA 3MVPA 3ONQA 3GZ5A 4QPOA 1Z05A 1ZK8A 5EG0A 2V26A 2ETHA 2OPTA 3BR2A 4EEFG 5F0HA 2HNHA 1S5LC 2QQ9A 3OYBA 5DTDA 4U7BA 4Y3OA 4UY8I 5TGTA 1CF7A 5D6EA 4ZYDA 3H5NA 3FXUA 1OYYA 4YEJA 1YW8A 4HF1A 1G2HA 1NHAA 3IUOA 3L2CA 5JVGF 3KZZA 1FBQA 3QRFF 2RQPA 5CVUA 5AONA 2ELHA 1JJ8C 1H9GA 2JPCA 1IO2A 3DPUA 2DW4A 1GVJA 1X1PA 2VOOA 4KN4X 1FC3A 4XLHA 3LSRA 3I4PA 3HKZN 5F6FA 3S1NJ 5BPDA 1IDYA 1YJNI 5K1YA 3ERMA 2L7ZA 2B0LA 2M87A 3MKLA 1TWFJ 1S9HA 1WZ2A 4MHGA 4N0BA 4RGSA 3LFKA 1U8BA 3GFLA 2A07F 1GV5A 2M4GA 2V4JC 4UNOA 1W5SA 2W1OA 2K7LA 1R00A 1BC8C 1DP3A 1QHHD 3WU2C 5EDNA 1IGNA 2IA0A 3FXKA 4M73A 1UMQA 2QSFX 4QLCU 2R4GA 5E79C 1IRXA 1Y1VJ 1T0FC 3K6GA 4XR6A 3KEYA 2H09A 2K5CA 2Y9YA 2EILH 5FRMA 2ZFUA 3OYNA 4MIMA 5EYRA 2LREA 2A6HF 4A0YA 3JTHA 1BOAA 3A01B 4BDZA 3BY6A 4KFCA 1IN4A 2HTSA 3A02A 1VQ4I 3RCOA 1YIOA 2UV1A 3O6BB 4NHJA 3R0JA 2BEOA 3RIRA 5ICEA 3CP2A 3H0DA 3VSKA 4HF2A 1BC7C 4LOCA 1GXPA 2XHKA 1OCTC 1J9IA 1F4KA 1Y0UA 2E1MC 4PGGA 4CYCA 1TQMA 2O5RA 1R23A 2XB0X 1HA8A 3QU6A 3QPSA 5J3LA 2TCTA 3IH2A 2GA2A 1PDNC 2WY8Q 4HG2A 3HTUA 3R6SA 4BXFA 5D8KB 1FY7A 3HPGA 3VEPA 1B9NA 1QPMA 3DF8A 4I98B 1NG7A 3AAFA 1BR4A 3FK6A 2IVMA 3CCQI 3PO2J 4Y13A 3FMRA 2PJRA 2RV8A 2DU9A 2CSOA 5EZHA 2ME0A 3C2GA 3AL0B 2ZXHA 2EV6A 3L2RA 4DYQA 4FCYA 1FMWA 4A0ZA 3IC7A 4RAFA 1N75A 5GPCA 5GADJ 3IH4A 1X4OA 4U7DA 1XD7A 4B4CA 1FP2A 2M5WA 2HXOA 4KICA 3T5XA 5GAHJ 4RS8A 2VLAA 1ZH5A 1FYKA 2E5ZA 1LFPA 3OYGA 3VOEA 3I59A 2DMQA 4KNYA 4Q5SF 2A5WA 3LFUA 3QQAA 2QQ8A 2Z1DA 3R60A 4KIBA 2V9PA 5LEKA 4MNUA 2WAEA 2KRFA 2QCOA 2VJ5A 3E5XA 3ZPLA 2LY9A 3HOXJ 2BXYA 1FPQA 4RLFA 4XORA 4MFDA 2IBDA 1G3TA 2RN7A 1CQTA 3BR1A 4AIDA 1ZHFA 2HR3A 1QZYA 2COBA 5ILVA 3I58A 3M07A 5A2QZ 1BR1A 3LL7A 2E60A 2ZCWA 3ISPA 1S7EA 4UV8A 3G71I 2B9SA 2YU9J 2F4IA 1D0YA 2XF5A 3GMEA 5CKTA 4M3EA 2BBYA 4XRMA 1T39A 5AIQA 2MSYA 4BE2A 1YQAA 1JGSA 2FBHA 1S3JA 3FKJA 4AVPA 4W97A 2ZJQF 1YRNA 2CWEA 2OCEA 5F0FA 4LG3A 1X3ZB 3MCZA 4E7ZA 1YS6A 4V2FA 2D2WA 3G6EI 1L0OC 1YHQI 2OJED 3CMYA 3MQ0A 4OOIA 2EINH 1VQ7I 1MBKA 1WPKA 4E7SA 4KISA 2YSRA 2STWA 2DQLA 4HDVA 2O03A 4ASNA 1USTA 5E3MA 2DT5A 3EUKL 1D8KA 4BEHB 3L1PA 3PUFA 2Z33A 1G59A 3JR9A 4KT6A 5IYCJ 4C9YA 3ASNH 1ZELA 2R92J 2P4WA 3RZOJ 5DV5A 1OR7C 3NARA 1UCRA 2KL4A 3TP3A 2M7BA 2R7TA 4HNTA 2VQHA 3AG1H 2NS8A 1V55H 3HGYA 2WB1A 2HQAA 1IV8A 2ZFWA 4L18B 3FISA 4F55A 1U5TA 4DNCA 3OYJA 1SC7A 1GHCA 3L2QA 2K86A 3BG7A 4BS9A 2YX7A 2IJLA 3IHUA 4LMYA 4M3GA 2A61A 1W1WE 2DPDA 2M45A 4ESBA 2NOGA 2XSJC 3H5RA 2X1DA 4D1QA 4LIVA 3ZN1A 4HAMA 1DU6A 2R7ZJ 5GTHC 2JZYA 1YW9A 3LSMA 2XRLA 3FKIJ 1ZLKA 3JSOA 2KLOA 4U0YA 1YG2A 3D5RC 5HLGA 3GEZA 3OYIA 1OCCH 2M1BA 4NC6A 1F43A 3GYHX 3MWMA 1R5HA 3E1SA 4FT8A 5GPAA 1R49A 1USSA 2O3FA 3H9GA 1B72A 2H27A 1FBSA 2P6SA 1MNMC 2DXIA 3CC4I 3P7NA 5HLHA 4HYEA 1XMAA 1IN5A 1QO0D 2GM4A 1ZG5A 3OV8A 4FHTA 4D5CA 4PJNA 2H6BA 2IXSA 3SFZA 3C2HA 2A68F 2LY1A 4B3AA 1WH5A 2LTPA 2V1NA 1JI8A 3K7AJ 3BWGA 5M3MJ 4R8HA 5DYMA 2AO9A 3Q5FA 4GDFA 1ON1A 3BR6A 3HBLA 4BQOA 3I3LA 4MTEA 2HQ5A 1V5GA 1K79A 1N77A 2XSDC 4ZTFA 3HDDA 2EIMH 2XF6A 4F93B 1HF0A 2GA1A 3RYRA 1Y6IA 1JTXA 4JYKA 3V7SA 5IP7J 4C2TA 3HKZA 5E18F 4DZJA 2K9NA 2R5YA 2EIKH 3L09A 4JBAA 2X0LA 1PJRA 2Z3YA 2ME6A 1VZ0A 2ECCA 3VB2A 4YG2F 4ABZA 3OS0A 1FJLA 2NVQJ 2BV6A 1SFEA 1LJ9A 4JOMA 5JI6A 3GTOJ 3BTJA 2HXIA 1HW2A 3T1BA 3V8JA 3NRVA 1A31A 4QPQA 1W36C 2JVHA 4B43A 2XRNA 3HRSA 3BPXA 4HNUA 1A35A 1R1TA 1FSHA 2NNNA 1TP4A 3KYLA 3CO7C 2L4MA 1XCVA 3W3CA 2PMZA 4ANJA 2VT3A 2CG4A 1QBJA 2NS7A 4AYBN 2HYGD 3KP6A 5H20A 3WHCA 2OV7A 3DLLF 2XGEA 1O3RA 9ANTA 1OQYA 3S8PA 1SD5A 2F5EA 2NS0A 1LNWA 5D5VB 4H4KC 1G3SA 5DUKA 2FNAA 1Z6TA 1T2KA 1ETYA 4FETA 1I27A 2VJ4A 3DLAA 5KAIC 1RKWA 5EZGA 3F8BA 5E20A 1SMYF 4YFXF 3DPTA 1JUPA 4BKXA 2FU4A 5JFRA 2UXXA 3KP3A 1JXSA 3LA3A 3ZCOA 2OU2A 4Q4ZF 1UZCA 2E7WA 3EYYA 4XN3A 4XLPF 2ZXWH 2P8TA 5HNHA 4ZDLA 2EA2A 5IOZA 4ESFA 2LKPA 5J4VA 3FWEA 4PJ0C 3CMMA 1P4AA 3MMYB 4IPAA 2EFPA 3CUQB 4MO7A 4XNFA 2QVOA 1D1BA 3FXQA 3GLXA 2DK8A 3HEFA 2WB1N 3OL4A 1MMSA 1HOMA 2LOOA 4XLNF 4BJTA 1A04A 4IXAA 1HW1A 3PFIA 1RPWA 3U9GA 1YITI 2Y2ZA 3CLQA 5GAGJ 1D1AA 4CICA 2R5ZB 4YFKF 3HOWJ 2R7OA 2Z5UA 4B3XA 1EH7A 4BAYA 2FX0A 2QQAA 1W0TA 1XSDA 1YS7A 4LFUA 3K4NA 4A3JJ 3CJTB 1LE8B 1BI1A 2PQ8A 3TP0A 4DBRA 1C0WA 2KQRA 1VQ5I 4IRGA 1GV2A 1A6QA 4M3FA 2DMUA 3HOSA 3OS1A 1SD4A 4JQFA 3K2AA 3TQNA 4UUSA 3BQYA 2CUEA
chains in the Genus database with same CATH topology
3KEOA 2GXGA 4IVNA 1DUXC 3M9AA 5F1RA 4O5VA 2ACJA 4LK1F 3WU1B 4A12A 3MZHA 4GCVA 2FF4A 3K1MA 5E8GA 5L3DA 2FEZA 2HS5A 3F8NA 2W57A 2G9WA 5EEHA 1YO5C 1TQPA 1TQIA 2FRHA 4MEXF 2VXZA 1ZRFA 4MEYF 4U0VA 1ZARA 3ROUA 4I02A 2R7DA 1QGPA 2ESNA 3HHGA 2DO7A 3NEUA 3B02A 3KP2A 1WWXA 1YW7A 1FSEA 3VFZA 4L9TA 2QM3A 2O8XA 1REPC 4L5JA 4PCQA 1MGTA 1YTYA 3CUOA 2Z99A 4ZZDA 3EQLF 3IRRA 3C3WA 4OIRF 3T8TA 1MZBA 2V1XA 2DK5A 3S2WA 5CYVA 4G6DA 3U2RA 3WGIA 2HOEA 4XSXF 2PEXA 3LAJA 4RAYA 3M8EA 2Q2EA 3GZ6A 2F5DA 4BXUA 1OYIA 1IRFA 1DDNA 2Z9OA 3L9FA 2OAZA 2MH2A 2BGCA 3KP4A 5CVRA 5E17F 2HQRA 1KQ8A 3JW4A 3ERED 3CJNA 2PJPA 5DEQA 1OPCA 2JT1A 3MEXA 4HX7A 4EQQA 1ONVA 4ON0A 2XUBA 2L02A 3ECHA 3ULQB 1SD7A 2VBXA 2PMUA 4I09A 3E6CC 1RUNA 5BQTA 1AWCA 3ZMSA 4CO8A 1W7PD 4A0XA 4LG0B 2PG4A 2EV5A 4M6XA 1SD6A 1LB2A 1G3WA 1U5TC 3K9TA 4LLLA 2ISYA 5D6FA 4MQ9F 1JHHA 4CYDA 2DBBA 2QQBA 4AIHA 2H94A 1F5TA 4UVAA 3K1NA 1XGNA 3BJ6A 3ML6A 4I0AA 4PDKA 3BDDA 4CDGA 4BQAA 2JRTA 1WSUA 1KGSA 3LA7A 4K2EA 1I6XA 3GO5A 1XMKA 1U3EM 3MZYA 2V1UA 3HIFA 1HKSA 4HLYA 1T38A 4G9YA 3JSPA 3E6BA 4OIOF 3HRTA 1J2XA 2E1CA 5A2QK 1I5ZA 2EB7A 1J5YA 4LB6B 4N9HA 2M30A 2QUFA 2LDUA 3C18A 4LLGF 2J5OA 5E8IA 1FYMA 1TW3A 4AIKA 2HKXA 3ZMVA 4KUMA 3JAMZ 1MDMA 2P7VB 1MJAA 2FMLA 1U2WA 1KU9A 3WE2A 1RIOH 2VBZA 2D45A 4Z2YA 5FD5A 1XSXA 5L3BA 3WTTC 2FOKA 1OR7A 3D5LA 5LGUA 2MBFA 2DLLA 3RTRA 3R61A 3RKXA 2IA1A 2P7CB 2KIUA 5J8CA 5E1XA 3HRUA 4G7OF 2L3DA 1U8RA 2FXAA 1FP1D 4DQ2A 1UHWA 3PQKA 4RAZA 4P9FA 2IW5A 5LHIA 1S7OA 1PP7U 3RPQA 2EWNA 1IW7F 1SFXA 2XAQA 2HYFA 1FZPB 2NYXA 5CLSA 1HQCA 1PUEE 5K5OA 1Z7UA 1H0MA 2WWYA 4HOBA 4I2OA 2DAOA 1O3TA 1IRGA 3KFWX 2RVCA 4CZZA 5CVJA 1DPUA 1QQIA 3V8KA 1BIAA 1MDMB 3DFGA 5FLXZ 1HBXG 4XSZF 3QP6A 2STTA 4EJWA 2E1NA 3DPLC 5ICGA 3D0SA 3ABUA 3W6KB 2DTRA 1CGPA 1J0RA 1F1ZA 2GAUA 1P2FA 4KYWA 1EH8A 2K27A 1FLIA 4NQWA 4RB3C 3M8FA 2EK5A 3I53A 3P9KA 4HW0A 1IXCA 1TLHB 4RB1A 4ZYGA 2EFNA 2GZWA 4LD5A 5D5XB 4RGRA 5H6QA 1R5GA 3GXOA 2RDPA 4EV0A 1FWZA 2RGVA 3ECOA 5DD4A 2ESHA 3E3VA 4M6YA 3JTGA 2AS5F 4TV7A 2HFHA 5LBQA 3V4GA 5ICCA 3RJPA 2XAHA 3F6OA 3CLOA 2FNPA 2VONA 3TO7A 4KN7X 4ENNA 5K5RA 1CF7B 3BP8A 3EUHA 1BJAA 3JAMK 2ZKZA 1SAXA 1KU3A 3K2ZA 5TRDA 2JSCA 1U5TB 4L0ZB 1ODDA 1DPRA 4S05A 1GXQA 4AD9A 4IHTA 3RDIA 1O3SA 2FBIA 4ZYHA 4UXNA 3ZMTA 2VE9A 2PFBA 2XKPA 1SMTA 2M8EA 3M1EA 1G3YA 1XGMA 1T0FA 4CHUA 5DCMB 1T6SA 4HZFA 1R1UA 3CTAA 4G8XA 4HV5A 2ZJ2A 3IRQA 1WKMA 2KIMA 4HA8A 1FT9A 2QENA 2XAJA 3REOA 2PBIA 1YLFA 3WTSC 1XB4A 3GFMA 4OMZA 5LGTA 4M71A 2BYVE 2OQRA 2P5KA 3ZMUA 4BHCA 1YYVA 3QP5A 2L4AA 1BIBA 2MD5A 4LK0F 4YIIA 2XIGA 1UHMA 3RPUA 4Q47A 1V3FA 5HS7A 2L01A 3J7AO 4A6EA 2JPBA 3E97A 3FMQA 4UUVA 2LF7A 1D8JA 2WTEA 3DEUA 5D5UB 5L3EA 1D3YA 1WI9A 4QWQA 2XGXA 4P55A 1TW2A 4FX0A 1X3UA 2HWVA 3KZYA 1P4XA 3WTZA 2MA3A 2RC4A 3H3UA 2UXNA 4EJTA 1W7PA 4JK1X 2EJRA 2VODA 4I0BA 2W24A 2V6CA 1XCBA 4Y15A 2ZXJA 3KP7A 2VBYA 1T98A 3F21A 3GW2A 1KU7A 3I71A 5E1ZB 2OD5A 1H9TA 3I0TA 2CO5A 2WC2A 3FMSA 1BI0A 4WXHA 1Z9CA 2C6YA 2P5VA 2IRFG 1B9MA 4HQMA 3WG9A 3FX3A 5EEGA 3HTSB 2XROA 3TOBA 5FO5A 1IN8A 1KYZA 3KLOA 3O3KA 4GYGA 4EJOA 3QPHA 3IKTA 1XGSA 4UV9A 4L9VA 3WTVC 2F5CA 4L0YB 5ILSA 3SZPA 1ZRDA 1L3LA 4P5OA 1LQ1A 2YU3A 4HX4A 3SQNA 3ZN0A 5IT9K 3ABTA 3I5UA 2W85A 3F8CA 2PI0A 1UB9A 2ZNZA 2OBPA 3FM5A 2PLYA 3I59B 3V7CA 3BROA 1BI3A 4A5MA 1Q1HA 5CVVA 5DUIA 3K69A 3QAHA 4YFNF 5ERIA 4GYIA 4R1HA 2P6TA 1G6NA 4M9XA 4GGGA 5DCMA 4HV6A 5ICFA 1PP8F 1HSTA 2QZ8A 5F64A 4WF2A 4EGZA 2DPUA 2HTJA 2Q8KA 2VE8A 5KK1A 2KKOA 2LF8A 2A5YB 2G7HA 4H0EA 4ZH4F 4R79A 3FHZA 5BS6A 2PN6A 4EM0B 4G6QA 2WV0A 1XDSA 1K78B 4O6JA 4U0WA 1KYWA 1LDJA 5E1WA 5BPIA 2VBWA 1IAWA 1KQ9A 1JE8A 4F7ZA 2FSWA 1E2XA 2CW0F 3HOTA 3BOQA 1W5TA 2CGPA 1SFUA 1LEBA 1O7LA 4Q48A 1J75A 3HYIA 5D5WB 3F8FA 1BN5A 2EFOA 5LLQA 2X4HA 2O0YA 3HUGA 2JTVA 3FXRA 3TKYA 1S29A 1ZN2A 1P4WA 3HSFA 1WQ2A 4ENJA 3Q9SA 3LA2A 2E7XA 4WX9A 5LRRA 1ON2A 5H6RA 3BPVA 2FQ3A 5D4SA 1FOKA 1MJ9A 2ZMEA 4O3MA 1ZREA 1UFMA 3CUQC 2O61A 3LQQA 4LGWA 3WODF 4GXOA 1JHFA 3ZP5A 4G7HF 1P6RA 5DCFA 1O7FA 4EMSA 2QYOA 2OZ6A 4BHPA 3J81Z 3QPTA 3PQJA 2QBYA 4AWXB 4ZYEA 1MD0A 5L3CA 5LGNA 4RB2C 1B1BA 2GWRA 1FX7A 3IWZA 4ENKA 5D4RA 2QLZA 5JVTA 4ESJA 2ADUA 2YPRA 2L54A 4N9IA 5CJ9A 2VT2A 2V1DA 2ZO4A 5HOOA 1B6AA 1ZG3A 3TO6A 4ENMA 4PZJA 1OYWA 3RKYA 3DP7A 2A69F 4A6DA 1ULYA 1E17A 2GXBA 4MQVA 4A5NA 3W6JB 3RKWA 3WTYC 3N4MA 4XBFA 1XDUA 3WTXC 3GFIA 3P9IA 3WE3A 3WTUC 1VTNC 3U1DA 2QWWA 4BYYA 3F22A 1V4RA 1XN7A 3HSRA 4FX4A 2ZNYA 4L5IA 2HZTA 3BJOA 3J81K 2D1VA 1FNNA 2GQQA 5CVIA 3K0LA 2HQNA 2VOPA 5AIPA 1TNSA 4NB5A 3FZVA 1RZ4A 3G3ZA 3B73A 1IXRC 5K5QA 1WRJA 2K4BA 5FFXA 2XASA 2XAFA 2J5PA 1W7PB 2FE3A 4GO1A 3NQOA 1S7AA 1Z91A 2UZKA 4G94A 4PGHA 4EVIA 5HDKA 1IN6A 1IUYA 2ZBKA 4M9SA 2TDXA 4CGZA 3J80Z 5FFZA 4LB5A 1ZG1A 1YFHA 1DP7P 3WGGA 3IL2A 1I1GA 1IXSB 1HKTA 2XAGA 3TDZC 2Y75A 3V7RA 1S8NA 4ZZLA 3G73A 4KA4A 3SZTA 1U6GA 2V9VA 3VODA 4MTDA 5TJJA 3O2PE 2GIVA 3LWFA 1XSVA 3FF5A 5J8FA 5L3GA 1G4DA 1TTYA 3EYIA 4BH9A 4U88A 2ISZA 2OQGA 2RNJA 4OIPF 1LVAA 4IRIA 3LAPA 3C7JA 1FYLA 4KIFA 2D1HA 2OZUA 3I54A 3RYPA 1RNLA 4I7HA 3F72A 2XKOA 4HF0A 4HLXA 3SHFA 2R3SA 5JR3A 4KMFA 3L00A 3C1DA 2ZMEB 1XGOA 1R7JA 3H3ZA 3SXYA 5HLIA 2O6GE 3TGNA 2F5FA 5DDGA 3KETA 1LDKB 2CFXA 3DV8A 1AOYA 4M72A 3DQVC 1RI7A 4XRFA 1TBXA 3LQRA 4OIQF 2NNYA 1FBUA 2H6CA 4OU0A 1B4AA 1BBYA 1Z6RA 2CYYA 5LEJA 3I64A 3EDPA 5FLXK 2KIFA 4BNCA 2V79A 4IF4A 4YIFA 1LEAA 2A6EF 3KCCA 3DXJF 3E6MA 4IHSA 2MC3A 4A2UA 4WXCA 3J80K 4HBLA 2P5LC 3F6VA 1EH6A 2KJBA 1W4MA 4OINF 1F9NA 2IPQX 3K1PA 5D8LB 3E5UA 3GFJA 1U78A 4HQEA 5HVQC 2VC1A 2Q0OA 2A3SA 3MFKA 5FGMA 3R0AA 3KEQA 3LSTA 1KU2A 4LLNA 3COAC 2HKOA 4KMUX 2AXLA 2W84A 5ILUA 1HW5A 4KT5C 2VC0A 3MAJA 2DFIA 1R36A 3IKVA 4P96A 3F3XA 4L9JA 3GWZA 2XVCA 4KIGA 2EA4A 3QU3A 1HXDA 5HDNA 5HS8A 1ZGAA 2UWMA 2EV0A 2RKHA 5L3FA 3BJAA 3H92A 4LJZF 1O3QA 1ZGJA 6PAXA 4M74A 4UVCA 3KP5A 4ETSA 1RUOA 3F8MA 4CXFA 4HDUA 2VN2A 4IRHA 2IP2A 5LHHA 2Y0MA 4UVBA 3IWFA 3CUQA 3ZMDA 5LHGA 1MKMA 1ZAOA 4EM2A 3KLNA 1I1SA 1TNTA 3HRMA 2EFQA 2LNBA 3FM3A 1KA8A 2EFWA 1EV7A 3BZ6A 3GF2A 3Q9VA 2DQRA 3R4KA 3GVAA 2MLGA 4L9NA 4AIJA 2FMYA 3TDUC 1ZLJA 5IT9Z 1R22A 2R7FA 5HDGA 2YX4A 1O57A 4E70A 2K02A 1P92A 3P9CA 2DI3A 4D0PA 3DKWA 3ZMZA 2G7UA 3OOPA 4KDPA 5FD6A 1K7AA 1IN7A 2K4JA 2HGCA 5BOXA 3F23A 3RI4A 3HHHA 4HX8A 1QZZA 5ED4A 3GX4X 5FB2A 3QOPA 2PMHA 3T8RA 3E6DA 3GUDA 1ZYRF 2IA2A 3TO9A 3WTWC 4B8XA 1STZA 4WK8F 1BM9A 2CQKA 4I01A 2LSOA 3V8LA 4S04A 3KE2A 1R1VA 1KQ0A 3ELKA 4M9ZA 2W25A 1HSJA 4OMYA 1MJBA 2COMA 4RB0A 4G7ZF 1Z1DA 2MH9A 3TOAA 1B59A 3CDHA 5LRSA 2YR2A 2MLKA 4RGUA 2OA4A 1ZRCA 3HSEA 3WU0A 2XV4S 1K6OA 2HDCA 1OKRA 4P9UA 4EJVA 4WXDA 5BMZA 4EM1A 3WGHA 5HS9A 1D5VA 2NAZA 3N97A 3EETA 1HKQA 5J6XA 1QNTA 5JHUA 4UHTA 3M7GA 2F2EA 1K78A 3E5QA 2QBYB 1BI2A 2FBKA 4LG0A 3ZQ7A 3L7WA 2HEOA 4EGYA 1IF1A 1IZ1A 1LDDA 5DD8A 1J7KA 4B09A 5KVRA 1OMIA 3CO6C 4RGXA 3T0YA 2FA5A 4BHBA 1J59A 2IT0A 4WWCA 4Y17A 2BE5F 4EJUA 2Y48A 5IT3A 2KJCA 1S6LA 4MGRA 4IJAA 1R58A 3GZ5A 1Z05A 2ETHA 2QQ9A 4U7BA 1CF7A 5D6EA 4ZYDA 3FXUA 1OYYA 1YW8A 4HF1A 1NHAA 3L2CA 3KZZA 1FBQA 3QRFF 2RQPA 5CVUA 5AONA 2ELHA 1H9GA 2JPCA 2DW4A 1GVJA 2VOOA 4KN4X 1FC3A 3I4PA 5F6FA 5BPDA 5K1YA 2B0LA 2M87A 4MHGA 4N0BA 4RGSA 3LFKA 3GFLA 2A07F 4UNOA 1W5SA 2K7LA 1R00A 1BC8C 2IA0A 4M73A 4QLCU 2H09A 2A6HF 4A0YA 3JTHA 1BOAA 3BY6A 4KFCA 1IN4A 2HTSA 1YIOA 3O6BB 4NHJA 3R0JA 2BEOA 3RIRA 5ICEA 4HF2A 1BC7C 1GXPA 1J9IA 2XHKA 1F4KA 1Y0UA 4PGGA 1TQMA 1R23A 3QU6A 1PDNC 2GA2A 3HTUA 3R6SA 5D8KB 1FY7A 3VEPA 1B9NA 1QPMA 3DF8A 4I98B 3AAFA 2IVMA 4Y13A 3FMRA 2RV8A 2DU9A 2CSOA 2EV6A 4A0ZA 3IC7A 4U7DA 1XD7A 1FP2A 2M5WA 3T5XA 4KICA 4RS8A 1ZH5A 1FYKA 3VOEA 3I59A 4KNYA 4Q5SF 3R60A 4KIBA 5LEKA 4MNUA 2KRFA 3E5XA 3ZPLA 1FPQA 1G3TA 2RN7A 1ZHFA 2HR3A 1QZYA 5ILVA 3I58A 5A2QZ 2ZCWA 3ISPA 4UV8A 2BBYA 1T39A 5AIQA 1YQAA 1JGSA 2FBHA 1S3JA 4AVPA 2CWEA 3MCZA 1YS6A 2D2WA 1L0OC 3MQ0A 4OOIA 2YSRA 2STWA 2DQLA 4HDVA 2O03A 4ASNA 1USTA 2DT5A 1D8KA 2Z33A 2P4WA 5DV5A 1UCRA 2ZFWA 4L18B 1U5TA 4DNCA 1GHCA 2NRAC 2K86A 2YX7A 2IJLA 3IHUA 4LMYA 2A61A 2DPDA 2M45A 4ESBA 3ZN1A 4HAMA 2JZYA 1YW9A 1ZLKA 3JSOA 4U0YA 1YG2A 5HLGA 3GEZA 2M1BA 3GYHX 3MWMA 1R5HA 4FT8A 1USSA 2O3FA 2H27A 1FBSA 2P6SA 3P7NA 5HLHA 4HYEA 1XMAA 1IN5A 1QO0D 1ZG5A 3OV8A 4FHTA 2H6BA 3SFZA 2A68F 3BWGA 4R8HA 5DYMA 3Q5FA 1ON1A 4MTEA 1K79A 2GA1A 3RYRA 3V7SA 5E18F 3L09A 4JBAA 2X0LA 2Z3YA 3VB2A 4YG2F 2BV6A 1SFEA 1LJ9A 5JI6A 1HW2A 3T1BA 3V8JA 3NRVA 2XRNA 3HRSA 3BPXA 1R1TA 1FSHA 2NNNA 3CO7C 2L4MA 1XCVA 2VT3A 2CG4A 1QBJA 2HYGD 3KP6A 5H20A 1O3RA 1SD5A 2F5EA 2NS0A 1LNWA 5D5VB 1G3SA 5DUKA 2FNAA 1Z6TA 1T2KA 1I27A 3F8BA 5E20A 1SMYF 4YFXF 3DPTA 2FU4A 5JFRA 2UXXA 3KP3A 1JXSA 3LA3A 2OU2A 4Q4ZF 2E7WA 3EYYA 4XLPF 2P8TA 2EA2A 4ESFA 2LKPA 3FWEA 1P4AA 4IPAA 2EFPA 3CUQB 2QVOA 3FXQA 3GLXA 2DK8A 4XLNF 1A04A 4IXAA 1HW1A 3PFIA 3U9GA 4CICA 4YFKF 2Z5UA 1EH7A 4BAYA 2QQAA 1XSDA 1YS7A 4LFUA 1BI1A 2PQ8A 1C0WA 4IRGA 3HOSA 1SD4A 4JQFA 3TQNA 4WCGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KEO A;  2GXG A;  4IVN A;  1DUX C;  3M9A A;  5F1R A;  4O5V A;  2ACJ A;  4LK1 F;  3WU1 B;  4A12 A;  3MZH A;  4GCV A;  2FF4 A;  3K1M A;  5E8G A;  5L3D A;  2FEZ A;  2HS5 A;  3F8N A;  2W57 A;  2G9W A;  5EEH A;  1YO5 C;  1TQP A;  1TQI A;  2FRH A;  4MEX F;  2VXZ A;  1ZRF A;  4MEY F;  4U0V A;  1ZAR A;  3ROU A;  4I02 A;  2R7D A;  1QGP A;  2ESN A;  3HHG A;  2DO7 A;  3NEU A;  3B02 A;  3KP2 A;  1WWX A;  1YW7 A;  1FSE A;  3VFZ A;  4L9T A;  2QM3 A;  2O8X A;  1REP C;  4L5J A;  4PCQ A;  1MGT A;  1YTY A;  3CUO A;  2Z99 A;  4ZZD A;  3EQL F;  3IRR A;  3C3W A;  4OIR F;  3T8T A;  1MZB A;  2V1X A;  2DK5 A;  3S2W A;  5CYV A;  4G6D A;  3U2R A;  3WGI A;  2HOE A;  4XSX F;  2PEX A;  3LAJ A;  4RAY A;  3M8E A;  2Q2E A;  3GZ6 A;  2F5D A;  4BXU A;  1OYI A;  1IRF A;  1DDN A;  2Z9O A;  3L9F A;  2OAZ A;  2MH2 A;  2BGC A;  3KP4 A;  5CVR A;  5E17 F;  2HQR A;  1KQ8 A;  3JW4 A;  3ERE D;  3CJN A;  2PJP A;  5DEQ A;  1OPC A;  2JT1 A;  3MEX A;  4HX7 A;  4EQQ A;  1ONV A;  4ON0 A;  2XUB A;  2L02 A;  3ECH A;  3ULQ B;  1SD7 A;  2VBX A;  2PMU A;  4I09 A;  3E6C C;  1RUN A;  5BQT A;  1AWC A;  3ZMS A;  4CO8 A;  1W7P D;  4A0X A;  4LG0 B;  2PG4 A;  2EV5 A;  4M6X A;  1SD6 A;  1LB2 A;  1G3W A;  1U5T C;  3K9T A;  4LLL A;  2ISY A;  5D6F A;  4MQ9 F;  1JHH A;  4CYD A;  2DBB A;  2QQB A;  4AIH A;  2H94 A;  1F5T A;  4UVA A;  3K1N A;  1XGN A;  3BJ6 A;  3ML6 A;  4I0A A;  4PDK A;  3BDD A;  4CDG A;  4BQA A;  2JRT A;  1WSU A;  1KGS A;  3LA7 A;  4K2E A;  1I6X A;  3GO5 A;  1XMK A;  1U3E M;  3MZY A;  2V1U A;  3HIF A;  1HKS A;  4HLY A;  1T38 A;  4G9Y A;  3JSP A;  3E6B A;  4OIO F;  3HRT A;  1J2X A;  2E1C A;  5A2Q K;  1I5Z A;  2EB7 A;  1J5Y A;  4LB6 B;  4N9H A;  2M30 A;  2QUF A;  2LDU A;  3C18 A;  4LLG F;  2J5O A;  5E8I A;  1FYM A;  1TW3 A;  4AIK A;  2HKX A;  3ZMV A;  4KUM A;  3JAM Z;  1MDM A;  2P7V B;  1MJA A;  2FML A;  1U2W A;  1KU9 A;  3WE2 A;  1RIO H;  2VBZ A;  2D45 A;  4Z2Y A;  5FD5 A;  1XSX A;  5L3B A;  3WTT C;  2FOK A;  1OR7 A;  3D5L A;  5LGU A;  2MBF A;  2DLL A;  3RTR A;  3R61 A;  3RKX A;  2IA1 A;  2P7C B;  2KIU A;  5J8C A;  5E1X A;  3HRU A;  4G7O F;  2L3D A;  1U8R A;  2FXA A;  1FP1 D;  4DQ2 A;  1UHW A;  3PQK A;  4RAZ A;  4P9F A;  2IW5 A;  5LHI A;  1S7O A;  1PP7 U;  3RPQ A;  2EWN A;  1IW7 F;  1SFX A;  2XAQ A;  2HYF A;  1FZP B;  2NYX A;  5CLS A;  1HQC A;  1PUE E;  5K5O A;  1Z7U A;  1H0M A;  2WWY A;  4HOB A;  4I2O A;  2DAO A;  1O3T A;  1IRG A;  3KFW X;  2RVC A;  4CZZ A;  5CVJ A;  1DPU A;  1QQI A;  3V8K A;  1BIA A;  1MDM B;  3DFG A;  5FLX Z;  1HBX G;  4XSZ F;  3QP6 A;  2STT A;  4EJW A;  2E1N A;  3DPL C;  5ICG A;  3D0S A;  3ABU A;  3W6K B;  2DTR A;  1CGP A;  1J0R A;  1F1Z A;  2GAU A;  1P2F A;  4KYW A;  1EH8 A;  2K27 A;  1FLI A;  4NQW A;  4RB3 C;  3M8F A;  2EK5 A;  3I53 A;  3P9K A;  4HW0 A;  1IXC A;  1TLH B;  4RB1 A;  4ZYG A;  2EFN A;  2GZW A;  4LD5 A;  5D5X B;  4RGR A;  5H6Q A;  1R5G A;  3GXO A;  2RDP A;  4EV0 A;  1FWZ A;  2RGV A;  3ECO A;  5DD4 A;  2ESH A;  3E3V A;  4M6Y A;  3JTG A;  2AS5 F;  4TV7 A;  2HFH A;  5LBQ A;  3V4G A;  5ICC A;  3RJP A;  2XAH A;  3F6O A;  3CLO A;  2FNP A;  2VON A;  3TO7 A;  4KN7 X;  4ENN A;  5K5R A;  1CF7 B;  3BP8 A;  3EUH A;  1BJA A;  3JAM K;  2ZKZ A;  1SAX A;  1KU3 A;  3K2Z A;  5TRD A;  2JSC A;  1U5T B;  4L0Z B;  1ODD A;  1DPR A;  4S05 A;  1GXQ A;  4AD9 A;  4IHT A;  3RDI A;  1O3S A;  2FBI A;  4ZYH A;  4UXN A;  3ZMT A;  2VE9 A;  2PFB A;  2XKP A;  1SMT A;  2M8E A;  3M1E A;  1G3Y A;  1XGM A;  1T0F A;  4CHU A;  5DCM B;  1T6S A;  4HZF A;  1R1U A;  3CTA A;  4G8X A;  4HV5 A;  2ZJ2 A;  3IRQ A;  1WKM A;  2KIM A;  4HA8 A;  1FT9 A;  2QEN A;  2XAJ A;  3REO A;  2PBI A;  1YLF A;  3WTS C;  1XB4 A;  3GFM A;  4OMZ A;  5LGT A;  4M71 A;  2BYV E;  2OQR A;  2P5K A;  3ZMU A;  4BHC A;  1YYV A;  3QP5 A;  2L4A A;  1BIB A;  2MD5 A;  4LK0 F;  4YII A;  2XIG A;  1UHM A;  3RPU A;  4Q47 A;  1V3F A;  5HS7 A;  2L01 A;  3J7A O;  4A6E A;  2JPB A;  3E97 A;  3FMQ A;  4UUV A;  2LF7 A;  1D8J A;  2WTE A;  3DEU A;  5D5U B;  5L3E A;  1D3Y A;  1WI9 A;  4QWQ A;  2XGX A;  4P55 A;  1TW2 A;  4FX0 A;  1X3U A;  2HWV A;  3KZY A;  1P4X A;  3WTZ A;  2MA3 A;  2RC4 A;  3H3U A;  2UXN A;  4EJT A;  1W7P A;  4JK1 X;  2EJR A;  2VOD A;  4I0B A;  2W24 A;  2V6C A;  1XCB A;  4Y15 A;  2ZXJ A;  3KP7 A;  2VBY A;  1T98 A;  3F21 A;  3GW2 A;  1KU7 A;  3I71 A;  5E1Z B;  2OD5 A;  1H9T A;  3I0T A;  2CO5 A;  2WC2 A;  3FMS A;  1BI0 A;  4WXH A;  1Z9C A;  2C6Y A;  2P5V A;  2IRF G;  1B9M A;  4HQM A;  3WG9 A;  3FX3 A;  5EEG A;  3HTS B;  2XRO A;  3TOB A;  5FO5 A;  1IN8 A;  1KYZ A;  3KLO A;  3O3K A;  4GYG A;  4EJO A;  3QPH A;  3IKT A;  1XGS A;  4UV9 A;  4L9V A;  3WTV C;  2F5C A;  4L0Y B;  5ILS A;  3SZP A;  1ZRD A;  1L3L A;  4P5O A;  1LQ1 A;  2YU3 A;  4HX4 A;  3SQN A;  3ZN0 A;  5IT9 K;  3ABT A;  3I5U A;  2W85 A;  3F8C A;  2PI0 A;  1UB9 A;  2ZNZ A;  2OBP A;  3FM5 A;  2PLY A;  3I59 B;  3V7C A;  3BRO A;  1BI3 A;  4A5M A;  1Q1H A;  5CVV A;  5DUI A;  3K69 A;  3QAH A;  4YFN F;  5ERI A;  4GYI A;  4R1H A;  2P6T A;  1G6N A;  4M9X A;  4GGG A;  5DCM A;  4HV6 A;  5ICF A;  1PP8 F;  1HST A;  2QZ8 A;  5F64 A;  4WF2 A;  4EGZ A;  2DPU A;  2HTJ A;  2Q8K A;  2VE8 A;  5KK1 A;  2KKO A;  2LF8 A;  2A5Y B;  2G7H A;  4H0E A;  4ZH4 F;  4R79 A;  3FHZ A;  5BS6 A;  2PN6 A;  4EM0 B;  4G6Q A;  2WV0 A;  1XDS A;  1K78 B;  4O6J A;  4U0W A;  1KYW A;  1LDJ A;  5E1W A;  5BPI A;  2VBW A;  1IAW A;  1KQ9 A;  1JE8 A;  4F7Z A;  2FSW A;  1E2X A;  2CW0 F;  3HOT A;  3BOQ A;  1W5T A;  2CGP A;  1SFU A;  1LEB A;  1O7L A;  4Q48 A;  1J75 A;  3HYI A;  5D5W B;  3F8F A;  1BN5 A;  2EFO A;  5LLQ A;  2X4H A;  2O0Y A;  3HUG A;  2JTV A;  3FXR A;  3TKY A;  1S29 A;  1ZN2 A;  1P4W A;  3HSF A;  1WQ2 A;  4ENJ A;  3Q9S A;  3LA2 A;  2E7X A;  4WX9 A;  5LRR A;  1ON2 A;  5H6R A;  3BPV A;  2FQ3 A;  5D4S A;  1FOK A;  1MJ9 A;  2ZME A;  4O3M A;  1ZRE A;  1UFM A;  3CUQ C;  2O61 A;  3LQQ A;  4LGW A;  3WOD F;  4GXO A;  1JHF A;  3ZP5 A;  4G7H F;  1P6R A;  5DCF A;  1O7F A;  4EMS A;  2QYO A;  2OZ6 A;  4BHP A;  3J81 Z;  3QPT A;  3PQJ A;  2QBY A;  4AWX B;  4ZYE A;  1MD0 A;  5L3C A;  5LGN A;  4RB2 C;  1B1B A;  2GWR A;  1FX7 A;  3IWZ A;  4ENK A;  5D4R A;  2QLZ A;  5JVT A;  4ESJ A;  2ADU A;  2YPR A;  2L54 A;  4N9I A;  5CJ9 A;  2VT2 A;  2V1D A;  2ZO4 A;  5HOO A;  1B6A A;  1ZG3 A;  3TO6 A;  4ENM A;  4PZJ A;  1OYW A;  3RKY A;  3DP7 A;  2A69 F;  4A6D A;  1ULY A;  1E17 A;  2GXB A;  4MQV A;  4A5N A;  3W6J B;  3RKW A;  3WTY C;  3N4M A;  4XBF A;  1XDU A;  3WTX C;  3GFI A;  3P9I A;  3WE3 A;  3WTU C;  1VTN C;  3U1D A;  2QWW A;  4BYY A;  3F22 A;  1V4R A;  1XN7 A;  3HSR A;  4FX4 A;  2ZNY A;  4L5I A;  2HZT A;  3BJO A;  3J81 K;  2D1V A;  1FNN A;  2GQQ A;  5CVI A;  3K0L A;  2HQN A;  2VOP A;  5AIP A;  1TNS A;  4NB5 A;  3FZV A;  1RZ4 A;  3G3Z A;  3B73 A;  1IXR C;  5K5Q A;  1WRJ A;  2K4B A;  5FFX A;  2XAS A;  2XAF A;  2J5P A;  1W7P B;  2FE3 A;  4GO1 A;  3NQO A;  1S7A A;  1Z91 A;  2UZK A;  4G94 A;  4PGH A;  4EVI A;  5HDK A;  1IN6 A;  1IUY A;  2ZBK A;  4M9S A;  2TDX A;  4CGZ A;  3J80 Z;  5FFZ A;  4LB5 A;  1ZG1 A;  1YFH A;  1DP7 P;  3WGG A;  3IL2 A;  1I1G A;  1IXS B;  1HKT A;  2XAG A;  3TDZ C;  2Y75 A;  3V7R A;  1S8N A;  4ZZL A;  3G73 A;  4KA4 A;  3SZT A;  1U6G A;  2V9V A;  3VOD A;  4MTD A;  5TJJ A;  3O2P E;  2GIV A;  3LWF A;  1XSV A;  3FF5 A;  5J8F A;  5L3G A;  1G4D A;  1TTY A;  3EYI A;  4BH9 A;  4U88 A;  2ISZ A;  2OQG A;  2RNJ A;  4OIP F;  1LVA A;  4IRI A;  3LAP A;  3C7J A;  1FYL A;  4KIF A;  2D1H A;  2OZU A;  3I54 A;  3RYP A;  1RNL A;  4I7H A;  3F72 A;  2XKO A;  4HF0 A;  4HLX A;  3SHF A;  2R3S A;  5JR3 A;  4KMF A;  3L00 A;  3C1D A;  2ZME B;  1XGO A;  1R7J A;  3H3Z A;  3SXY A;  5HLI A;  2O6G E;  3TGN A;  2F5F A;  5DDG A;  3KET A;  1LDK B;  2CFX A;  3DV8 A;  1AOY A;  4M72 A;  3DQV C;  1RI7 A;  4XRF A;  1TBX A;  3LQR A;  4OIQ F;  2NNY A;  1FBU A;  2H6C A;  4OU0 A;  1B4A A;  1BBY A;  1Z6R A;  2CYY A;  5LEJ A;  3I64 A;  3EDP A;  5FLX K;  2KIF A;  4BNC A;  2V79 A;  4IF4 A;  4YIF A;  1LEA A;  2A6E F;  3KCC A;  3DXJ F;  3E6M A;  4IHS A;  2MC3 A;  4A2U A;  4WXC A;  3J80 K;  4HBL A;  2P5L C;  3F6V A;  1EH6 A;  2KJB A;  1W4M A;  4OIN F;  1F9N A;  2IPQ X;  3K1P A;  5D8L B;  3E5U A;  3GFJ A;  1U78 A;  4HQE A;  5HVQ C;  2VC1 A;  2Q0O A;  2A3S A;  3MFK A;  5FGM A;  3R0A A;  3KEQ A;  3LST A;  1KU2 A;  4LLN A;  3COA C;  2HKO A;  4KMU X;  2AXL A;  2W84 A;  5ILU A;  1HW5 A;  4KT5 C;  2VC0 A;  3MAJ A;  2DFI A;  1R36 A;  3IKV A;  4P96 A;  3F3X A;  4L9J A;  3GWZ A;  2XVC A;  4KIG A;  2EA4 A;  3QU3 A;  1HXD A;  5HDN A;  5HS8 A;  1ZGA A;  2UWM A;  2EV0 A;  2RKH A;  5L3F A;  3BJA A;  3H92 A;  4LJZ F;  1O3Q A;  1ZGJ A;  6PAX A;  4M74 A;  4UVC A;  3KP5 A;  4ETS A;  1RUO A;  3F8M A;  4CXF A;  4HDU A;  2VN2 A;  4IRH A;  2IP2 A;  5LHH A;  2Y0M A;  4UVB A;  3IWF A;  3CUQ A;  3ZMD A;  5LHG A;  1MKM A;  1ZAO A;  4EM2 A;  3KLN A;  1I1S A;  1TNT A;  3HRM A;  2EFQ A;  2LNB A;  3FM3 A;  1KA8 A;  2EFW A;  1EV7 A;  3BZ6 A;  3GF2 A;  3Q9V A;  2DQR A;  3R4K A;  3GVA A;  2MLG A;  4L9N A;  4AIJ A;  2FMY A;  3TDU C;  1ZLJ A;  5IT9 Z;  1R22 A;  2R7F A;  5HDG A;  2YX4 A;  1O57 A;  4E70 A;  2K02 A;  1P92 A;  3P9C A;  2DI3 A;  4D0P A;  3DKW A;  3ZMZ A;  2G7U A;  3OOP A;  4KDP A;  5FD6 A;  1K7A A;  1IN7 A;  2K4J A;  2HGC A;  5BOX A;  3F23 A;  3RI4 A;  3HHH A;  4HX8 A;  1QZZ A;  5ED4 A;  3GX4 X;  5FB2 A;  3QOP A;  2PMH A;  3T8R A;  3E6D A;  3GUD A;  1ZYR F;  2IA2 A;  3TO9 A;  3WTW C;  4B8X A;  1STZ A;  4WK8 F;  1BM9 A;  2CQK A;  4I01 A;  2LSO A;  3V8L A;  4S04 A;  3KE2 A;  1R1V A;  1KQ0 A;  3ELK A;  4M9Z A;  2W25 A;  1HSJ A;  4OMY A;  1MJB A;  2COM A;  4RB0 A;  4G7Z F;  1Z1D A;  2MH9 A;  3TOA A;  1B59 A;  3CDH A;  5LRS A;  2YR2 A;  2MLK A;  4RGU A;  2OA4 A;  1ZRC A;  3HSE A;  3WU0 A;  2XV4 S;  1K6O A;  2HDC A;  1OKR A;  4P9U A;  4EJV A;  4WXD A;  5BMZ A;  4EM1 A;  3WGH A;  5HS9 A;  1D5V A;  2NAZ A;  3N97 A;  3EET A;  1HKQ A;  5J6X A;  1QNT A;  5JHU A;  4UHT A;  3M7G A;  2F2E A;  1K78 A;  3E5Q A;  2QBY B;  1BI2 A;  2FBK A;  4LG0 A;  3ZQ7 A;  3L7W A;  2HEO A;  4EGY A;  1IF1 A;  1IZ1 A;  1LDD A;  5DD8 A;  1J7K A;  4B09 A;  5KVR A;  1OMI A;  3CO6 C;  4RGX A;  3T0Y A;  2FA5 A;  4BHB A;  1J59 A;  2IT0 A;  4WWC A;  4Y17 A;  2BE5 F;  4EJU A;  2Y48 A;  5IT3 A;  2KJC A;  1S6L A;  4MGR A;  4IJA A;  1R58 A;  3GZ5 A;  1Z05 A;  2ETH A;  2QQ9 A;  4U7B A;  1CF7 A;  5D6E A;  4ZYD A;  3FXU A;  1OYY A;  1YW8 A;  4HF1 A;  1NHA A;  3L2C A;  3KZZ A;  1FBQ A;  3QRF F;  2RQP A;  5CVU A;  5AON A;  2ELH A;  1H9G A;  2JPC A;  2DW4 A;  1GVJ A;  2VOO A;  4KN4 X;  1FC3 A;  3I4P A;  5F6F A;  5BPD A;  5K1Y A;  2B0L A;  2M87 A;  4MHG A;  4N0B A;  4RGS A;  3LFK A;  3GFL A;  2A07 F;  4UNO A;  1W5S A;  2K7L A;  1R00 A;  1BC8 C;  2IA0 A;  4M73 A;  4QLC U;  2H09 A;  2A6H F;  4A0Y A;  3JTH A;  1BOA A;  3BY6 A;  4KFC A;  1IN4 A;  2HTS A;  1YIO A;  3O6B B;  4NHJ A;  3R0J A;  2BEO A;  3RIR A;  5ICE A;  4HF2 A;  1BC7 C;  1GXP A;  1J9I A;  2XHK A;  1F4K A;  1Y0U A;  4PGG A;  1TQM A;  1R23 A;  3QU6 A;  1PDN C;  2GA2 A;  3HTU A;  3R6S A;  5D8K B;  1FY7 A;  3VEP A;  1B9N A;  1QPM A;  3DF8 A;  4I98 B;  3AAF A;  2IVM A;  4Y13 A;  3FMR A;  2RV8 A;  2DU9 A;  2CSO A;  2EV6 A;  4A0Z A;  3IC7 A;  4U7D A;  1XD7 A;  1FP2 A;  2M5W A;  3T5X A;  4KIC A;  4RS8 A;  1ZH5 A;  1FYK A;  3VOE A;  3I59 A;  4KNY A;  4Q5S F;  3R60 A;  4KIB A;  5LEK A;  4MNU A;  2KRF A;  3E5X A;  3ZPL A;  1FPQ A;  1G3T A;  2RN7 A;  1ZHF A;  2HR3 A;  1QZY A;  5ILV A;  3I58 A;  5A2Q Z;  2ZCW A;  3ISP A;  4UV8 A;  2BBY A;  1T39 A;  5AIQ A;  1YQA A;  1JGS A;  2FBH A;  1S3J A;  4AVP A;  2CWE A;  3MCZ A;  1YS6 A;  2D2W A;  1L0O C;  3MQ0 A;  4OOI A;  2YSR A;  2STW A;  2DQL A;  4HDV A;  2O03 A;  4ASN A;  1UST A;  2DT5 A;  1D8K A;  2Z33 A;  2P4W A;  5DV5 A;  1UCR A;  2ZFW A;  4L18 B;  1U5T A;  4DNC A;  1GHC A;  2NRA C;  2K86 A;  2YX7 A;  2IJL A;  3IHU A;  4LMY A;  2A61 A;  2DPD A;  2M45 A;  4ESB A;  3ZN1 A;  4HAM A;  2JZY A;  1YW9 A;  1ZLK A;  3JSO A;  4U0Y A;  1YG2 A;  5HLG A;  3GEZ A;  2M1B A;  3GYH X;  3MWM A;  1R5H A;  4FT8 A;  1USS A;  2O3F A;  2H27 A;  1FBS A;  2P6S A;  3P7N A;  5HLH A;  4HYE A;  1XMA A;  1IN5 A;  1QO0 D;  1ZG5 A;  3OV8 A;  4FHT A;  2H6B A;  3SFZ A;  2A68 F;  3BWG A;  4R8H A;  5DYM A;  3Q5F A;  1ON1 A;  4MTE A;  1K79 A;  2GA1 A;  3RYR A;  3V7S A;  5E18 F;  3L09 A;  4JBA A;  2X0L A;  2Z3Y A;  3VB2 A;  4YG2 F;  2BV6 A;  1SFE A;  1LJ9 A;  5JI6 A;  1HW2 A;  3T1B A;  3V8J A;  3NRV A;  2XRN A;  3HRS A;  3BPX A;  1R1T A;  1FSH A;  2NNN A;  3CO7 C;  2L4M A;  1XCV A;  2VT3 A;  2CG4 A;  1QBJ A;  2HYG D;  3KP6 A;  5H20 A;  1O3R A;  1SD5 A;  2F5E A;  2NS0 A;  1LNW A;  5D5V B;  1G3S A;  5DUK A;  2FNA A;  1Z6T A;  1T2K A;  1I27 A;  3F8B A;  5E20 A;  1SMY F;  4YFX F;  3DPT A;  2FU4 A;  5JFR A;  2UXX A;  3KP3 A;  1JXS A;  3LA3 A;  2OU2 A;  4Q4Z F;  2E7W A;  3EYY A;  4XLP F;  2P8T A;  2EA2 A;  4ESF A;  2LKP A;  3FWE A;  1P4A A;  4IPA A;  2EFP A;  3CUQ B;  2QVO A;  3FXQ A;  3GLX A;  2DK8 A;  4XLN F;  1A04 A;  4IXA A;  1HW1 A;  3PFI A;  3U9G A;  4CIC A;  4YFK F;  2Z5U A;  1EH7 A;  4BAY A;  2QQA A;  1XSD A;  1YS7 A;  4LFU A;  1BI1 A;  2PQ8 A;  1C0W A;  4IRG A;  3HOS A;  1SD4 A;  4JQF A;  3TQN A;  4WCG A; 
#chains in the Genus database with same CATH topology
 2JK3 A;  3H36 A;  2EZK A;  2GXG A;  3KEO A;  4IVN A;  5EEA A;  1DUX C;  3AKZ A;  3CCY A;  1YJ9 I;  3M9A A;  2W7N A;  1XC5 A;  4O5V A;  5F1R A;  4QIW N;  2ACJ A;  3QWL A;  4LK1 F;  4CSW A;  3BCA A;  3WU1 B;  4A12 A;  3HPH A;  3MZH A;  4NNJ A;  3CF5 F;  2W82 A;  3IAS 2;  4GCV A;  2FF4 A;  3CCL I;  3K1M A;  2DA4 A;  1QVT A;  4XN0 A;  4HRI A;  5J4Y A;  5E8G A;  2EQR A;  5L3D A;  2X6X A;  2FEZ A;  2HS5 A;  3S1R J;  3F8N A;  1P7I A;  2W57 A;  3CJQ B;  4CCJ A;  3MD2 A;  5B1A H;  2G9W A;  4BGD A;  4V19 K;  2CJJ A;  5EEH A;  1YO5 C;  1TQP A;  4UB6 C;  1TQI A;  3CQZ J;  2FRH A;  4MEX F;  4KJZ A;  3SFI A;  2VXZ A;  1ZRF A;  4MEY F;  4XLC A;  1ERD A;  4U0V A;  3HG9 A;  4CA0 A;  1ZAR A;  3ROU A;  4I02 A;  3A01 A;  1K4T A;  1QVU A;  5KCM A;  2R7D A;  1D5Y A;  1QGP A;  2ESN A;  4D9J A;  1TL8 A;  4IQ4 A;  5M3F J;  3HHG A;  4WCG A;  3OSG A;  2DO7 A;  2LG4 A;  4PSW A;  1UG0 A;  3NAU A;  4DYC A;  1AKH A;  1V54 H;  3B02 A;  3KP2 A;  3NEU A;  1WWX A;  1YW7 A;  3VYU B;  4CZC A;  3OIQ A;  1FSE A;  1M1E B;  3VFZ A;  2JSP A;  4L9T A;  2KDZ A;  3CCS I;  2QM3 A;  2HVR A;  2MD0 A;  2NVT J;  3LNQ A;  2O8X A;  3JRI A;  3FXL A;  1REP C;  4L5J A;  4PCQ A;  1MGT A;  1YTY A;  3CUO A;  1MIJ A;  2MC4 A;  2OUM A;  1XG1 A;  1FOY A;  2Z99 A;  4ZZD A;  3EQL F;  3IRR A;  3C3W A;  2X6O A;  4OIR F;  3T8T A;  3CD6 I;  1MZB A;  3L2W A;  3S15 J;  4XLE A;  1FOW A;  1MH4 A;  1KON A;  2V1X A;  2DK5 A;  3CDL A;  3AL0 C;  3G1O A;  4E7I A;  3F9K A;  3S2W A;  5CYV A;  4CCL A;  2WAF A;  4G6D A;  3U2R A;  3WGI A;  2HOE A;  4XSX F;  5FKO A;  1X19 A;  3M4O J;  3JRG A;  4PJM A;  2PEX A;  3LAJ A;  4RAY A;  3M8E A;  2L9R A;  2Q2E A;  3GZ6 A;  2FJ1 A;  1HCR A;  2F5D A;  4BXU A;  1E3H A;  1OYI A;  2BHZ A;  1IRF A;  1DDN A;  3CCV I;  2Z9O A;  3NWS A;  5B1B H;  3L9F A;  2OAZ A;  2MH2 A;  2BGC A;  2CQQ A;  3FK7 A;  2FOW A;  1GUU A;  1IC8 A;  2UUZ A;  2K9L A;  3KP4 A;  5CVR A;  5E17 F;  2HQR A;  3LMM A;  5DM6 F;  1KQ8 A;  3JW4 A;  2M9H A;  3ERE D;  1TT5 B;  3CJN A;  3PSI A;  2PJP A;  5DEQ A;  2IS1 A;  1OPC A;  2JT1 A;  3MEX A;  4HX7 A;  1BR2 A;  1O4X A;  3A0H C;  4EQQ A;  1BJZ A;  1ONV A;  3AG3 H;  4Y7N J;  2L7F P;  4ON0 A;  2XUB A;  2L02 A;  3ECH A;  1NH3 A;  3ULQ B;  4DBQ A;  1SD7 A;  4A3M J;  2DOA A;  2VBX A;  2PMU A;  4I09 A;  2NXN B;  4MFE A;  3E6C C;  1RUN A;  5BQT A;  4IL6 C;  1AWC A;  2CMP A;  2L9S A;  4Y4R A;  3ZMS A;  1GDT A;  1W36 D;  4G6T B;  4CO8 A;  1W7P D;  4A0X A;  4LG0 B;  2PG4 A;  2EV5 A;  3PFY A;  1GT0 C;  1Y39 A;  3FIW A;  4DIQ A;  1A5J A;  1ENH A;  4KIT B;  2ELK A;  1VND A;  4UB8 C;  5EGO A;  3ZRG A;  2JRM A;  4M6X A;  1SD6 A;  3A1Y A;  1LB2 A;  2I10 A;  1G3W A;  1U5T C;  4FE4 A;  3K9T A;  1G8X A;  3IP4 B;  4LLL A;  1LVK A;  2ISY A;  3ABL H;  5IOY A;  5D6F A;  3OYF A;  4MQ9 F;  1JHH A;  4CYD A;  3I9V 2;  4ZJZ A;  2DBB A;  3PNT A;  2QQB A;  4AIH A;  2H94 A;  1T08 B;  3M1C A;  4BBR J;  1F5T A;  4UVA A;  3K1N A;  3GTP J;  3CCE I;  1XGN A;  3BJ6 A;  3ML6 A;  4I0A A;  4II2 A;  4PDK A;  5M5X J;  3BDD A;  4CDG A;  1X2M A;  4BQA A;  2JRT A;  1WSU A;  1KGS A;  3LA7 A;  2FQ4 A;  1LPQ A;  4K2E A;  1SEU A;  1I6X A;  2AXT C;  2FUG 2;  3GO5 A;  5BNG A;  1XMK A;  3CJR B;  1U3E M;  3MZY A;  2V1U A;  2DJI A;  3HIF A;  1HKS A;  2BHY A;  3H5A A;  4HLY A;  1T38 A;  4G9Y A;  4XLF A;  3K70 D;  3JSP A;  3E6B A;  4OIO F;  3HRT A;  1J2X A;  3FBN B;  2E1C A;  5A2Q K;  3BZC A;  1OCO H;  1OCZ H;  3ZQH A;  3HOU J;  1I5Z A;  2EB7 A;  1J5Y A;  1TWA J;  1WJF A;  4CCM A;  4U87 A;  3G2B A;  4LB6 B;  4N9H A;  2M30 A;  2QUF A;  1R71 A;  2BY3 A;  2LVS A;  2LDU A;  1TC3 C;  3FXJ A;  3C18 A;  4LLG F;  2J5O A;  3DCF A;  2XPU A;  5E8I A;  1WHU A;  4BXX J;  3SZG A;  1FYM A;  4IQJ A;  1TW3 A;  4AIK A;  1QU3 A;  4NC7 A;  2HKX A;  3ZMV A;  2DYR H;  4KUM A;  3JAM Z;  3G1M A;  2VIX A;  2P7V B;  1MDM A;  1MJA A;  2KP6 A;  1ZR4 A;  2R7V A;  2QKL B;  1DQU A;  2FML A;  1K61 A;  1U2W A;  4BQN A;  1BW6 A;  1KU9 A;  2M2E A;  3WE2 A;  1RIO H;  2VBZ A;  2HPI A;  2HDD A;  3OY9 A;  2D45 A;  1OLT A;  1VF9 A;  1K83 J;  5FD5 A;  4Z2Y A;  3SDB A;  1U9N A;  1XSX A;  5L3B A;  3WTT C;  2BY2 A;  2FOK A;  1OR7 A;  4XOT A;  3D5L A;  4L5E A;  2WV1 A;  5LGU A;  2QSG X;  3DEW A;  2MBF A;  2DLL A;  4BBS J;  3PO3 J;  2R0Q C;  3RTR A;  1UEL B;  3R61 A;  2Y9Z A;  3RKX A;  2IA1 A;  2P7C B;  3CZ6 A;  2V6E A;  3H9J A;  1A6I A;  2KIU A;  5J8C A;  4LIU A;  3I55 I;  3ZQQ A;  5E1X A;  3HRU A;  4G7O F;  2L3D A;  4XKV A;  1U8R A;  3PUB A;  2JA2 A;  2FXA A;  1FP1 D;  1YE9 A;  4DQ2 A;  2D5V A;  2KIQ A;  1UHW A;  3PQK A;  2DA7 A;  4P9F A;  4RAZ A;  2IW5 A;  5LHI A;  1S7O A;  1PP7 U;  3RPQ A;  2EWN A;  1WI3 A;  1IW7 F;  1SFX A;  4PK4 A;  2XAQ A;  2HYF A;  1FZP B;  2X85 A;  2NYX A;  5CLS A;  1HQC A;  1PUE E;  5K5O A;  4FQG A;  1Z7U A;  1PUF B;  1H0M A;  1DGW Y;  4B47 A;  2VKH A;  1SVL A;  1X2N A;  1LFU P;  2WWY A;  2X48 A;  4HOB A;  4I2O A;  3JCU C;  2DAO A;  5FKL A;  1O3T A;  4J19 A;  3FXO A;  1IRG A;  3KFW X;  2RVC A;  4CZZ A;  4BJ6 C;  3BCB A;  1ETK A;  5CVJ A;  2WAD A;  1FIA A;  2CQX A;  1DPU A;  2VB6 A;  2IS6 A;  1QQI A;  3V8K A;  4XKW A;  1BIA A;  1MDM B;  3IV5 A;  2VI6 A;  2L7M P;  3DFG A;  5FLX Z;  1HBX G;  4XSZ F;  2P81 A;  2RAE A;  3QP6 A;  2STT A;  2RNG A;  4EJW A;  3J7Z I;  2E1N A;  3DPL C;  5ICG A;  3D0S A;  3ABU A;  3W6K B;  3OIP A;  3ZR8 X;  2JA7 J;  2NRA C;  1FTT A;  2DTR A;  1CGP A;  1J0R A;  1RR7 A;  2DA1 A;  1FEX A;  5J1Y A;  1F1Z A;  3KPH A;  3OYE A;  4F52 A;  1Y8Q B;  1V5F A;  4Y33 A;  5FRN A;  2GAU A;  4AVZ A;  1P2F A;  1HLV A;  3IH3 A;  3MN2 A;  4KYW A;  4QTR A;  1X1D A;  2IGM A;  1EH8 A;  5IY5 H;  2LC2 A;  4E6K G;  4HPQ A;  2EZL A;  2K27 A;  4YRV A;  1FLI A;  2HU9 A;  4NQW A;  3TBI A;  4AYB A;  4RB3 C;  3M8F A;  2R7U A;  2EK5 A;  2F4O B;  3I53 A;  2PMZ N;  3P9K A;  3BTC A;  4HW0 A;  2JA5 J;  1IXC A;  1TLH B;  3DBH B;  5B3S H;  4RB1 A;  4ZYG A;  2EFN A;  2GZW A;  1Z0X A;  4A3K J;  2VQC A;  2R5Z A;  4LD5 A;  5D5X B;  4RMN A;  3CMA I;  1Q1V A;  2AHQ A;  3HZJ A;  1H88 C;  3AFH A;  4RGR A;  5H6Q A;  3GXO A;  1R5G A;  2JUG A;  2RDP A;  4EV0 A;  1FWZ A;  2RGV A;  3VPR A;  4F3Q A;  4XK4 A;  3CDI A;  1KZH A;  3A2K A;  3ECO A;  2DT6 A;  5DD4 A;  3Q3S A;  2JVG A;  3CP8 A;  3PJR A;  2ESH A;  3E3V A;  2R7W A;  4ZTJ A;  4M6Y A;  2Z16 A;  4AM3 A;  1TWH J;  4C3I J;  3JTG A;  3GTL J;  2W4S A;  2LR8 A;  2Y30 A;  3IAM 2;  2AS5 F;  2BZT A;  3K4L A;  4TV7 A;  3K4B A;  1NK3 P;  1K4S A;  3ABK H;  5C4X J;  2MFZ A;  2HFH A;  5LBQ A;  3V4G A;  5ICC A;  3RJP A;  2XAH A;  3CCR I;  3F6O A;  3LOC A;  2K3F A;  2ZXI A;  1N78 A;  3CLO A;  2FNP A;  3FXM A;  2LH9 A;  2VON A;  2BVM A;  1LUJ B;  1Z3Y A;  1YI2 I;  3TO7 A;  4KN7 X;  4YIR X;  4ENN A;  2DOE A;  1AU7 A;  1Y56 A;  5K5R A;  1CF7 B;  4DOZ A;  3BP8 A;  3EUH A;  1BJA A;  3JAM K;  4XRS A;  2ZKZ A;  4RM3 A;  2K40 A;  1SAX A;  1KU3 A;  2KFD A;  3K2Z A;  5TRD A;  2JSC A;  2QSH X;  1B8I A;  1U5T B;  4L0Z B;  5EG0 B;  2VXD A;  4J00 A;  4AC0 A;  1ODD A;  3OR2 C;  4E7L A;  1DPR A;  3OSF A;  4ITV A;  5LFA A;  4S05 A;  1GXQ A;  4AD9 A;  4IHT A;  3RDI A;  4C2M J;  4A3F J;  1O3S A;  2FBI A;  4XMY A;  4ZYH A;  4UXN A;  1UJ8 A;  3ZMT A;  3EUH C;  2VE9 A;  2PFB A;  3JRH A;  2XKP A;  1SMT A;  2MAB A;  3GLL A;  2M8E A;  3M1E A;  3S17 J;  1E0E A;  1G3Y A;  1XGM A;  3DBL B;  5GAE J;  1T0F A;  1B8I B;  4PJJ A;  4CHU A;  4BU2 A;  2Q2E B;  1H89 C;  5DCM B;  5FKN A;  1T6S A;  5TIS C;  4HZF A;  1R1U A;  3CTA A;  4G8X A;  4HV5 A;  2ZJ2 A;  3IRQ A;  1WKM A;  1WCM J;  2KIM A;  4HA8 A;  3TMO A;  1D0Z A;  2I8D A;  5GTI C;  1R5I D;  1FT9 A;  1XTA A;  2QEN A;  2XAJ A;  3PL8 A;  3REO A;  2IGO A;  2PBI A;  3DEE A;  1YLF A;  3WTS C;  1XB4 A;  3GFM A;  3DKY A;  4OMZ A;  5LGT A;  2K9M A;  4M71 A;  2BYV E;  1VQL I;  4I99 C;  3JRF A;  3HUG B;  1ZQ3 P;  2OQR A;  4A3L J;  3U21 A;  2P5K A;  3ZMU A;  4BHC A;  1YYV A;  1DU0 A;  2VUM J;  3JRA A;  3QP5 A;  3HC7 A;  2L4A A;  1BIB A;  1VQK I;  2MD5 A;  4LK0 F;  4YII A;  2XIG A;  3KYD B;  2ELJ A;  3P5J A;  1UHM A;  3RSN A;  3RPU A;  4Q47 A;  3BLY A;  1V3F A;  4G12 A;  5HS7 A;  2HOA A;  2Y0S A;  2HYJ A;  2L01 A;  2ZSI B;  3J7A O;  5DS9 A;  1XS9 A;  3BC8 A;  4A6E A;  1AKH B;  5IYB J;  3VWB A;  2JPB A;  3S1Q J;  2JA8 J;  3E97 A;  4BY7 J;  2E19 A;  3A0B C;  2VAS A;  4DJA A;  4E7J A;  2H1K A;  2ZSH B;  5FKK A;  3FMQ A;  4UUV A;  2LF7 A;  5CQE A;  1D8J A;  3HM5 A;  2WTE A;  3DEU A;  5D5U B;  5L3E A;  1D3Y A;  3ZXS A;  1NK2 P;  1WI9 A;  1MBH A;  3ZQL A;  4QWQ A;  2XGX A;  2E2H J;  4NQW B;  4P55 A;  2XC7 A;  1TW2 A;  4FX0 A;  3SEZ A;  1X3U A;  2HWV A;  3KZY A;  3CC2 I;  3MZ8 A;  2GOX B;  3S3M A;  2O8K A;  1P4X A;  2X1E A;  2MA3 A;  3PNV A;  3WTZ A;  2W48 A;  2RC4 A;  3H3U A;  2UXN A;  1YJW I;  1T33 A;  3BG9 A;  1W7P A;  3D5S C;  4EJT A;  4JK1 X;  1D1C A;  2EJR A;  2VOD A;  4I0B A;  2DA3 A;  2PJR B;  2W24 A;  5CPR B;  2LKX A;  2V6C A;  2CUJ A;  1XCB A;  4Y15 A;  2ZXJ A;  2E34 A;  1ETQ A;  3KP7 A;  2R7Q A;  2B63 J;  1I6H J;  2DA2 A;  2ID3 A;  2VBY A;  4C30 A;  1T98 A;  3B6A A;  3F21 A;  3GW2 A;  2OTL I;  1KU7 A;  3DTI A;  3I71 A;  1TT0 A;  2DDB A;  5E1Z B;  2OD5 A;  2PX9 A;  3W6V A;  1H9T A;  1MBF A;  3I0T A;  1ORK A;  1IG7 A;  4LIT A;  2CO5 A;  2WC2 A;  4BEH A;  3HOV J;  3FMS A;  2VJI A;  1BI0 A;  4WXH A;  3S16 J;  3QYF A;  1Z9C A;  2C6Y A;  1TZL A;  4XLA A;  4NDL A;  2P5V A;  4IKF A;  1Y8R B;  3Q0V A;  4B44 A;  2IRF G;  1B9M A;  1ETO A;  3K4J A;  4HQM A;  4C3H J;  3WG9 A;  4CUG A;  5C3E J;  2V7F A;  2WAQ N;  1JTY A;  4E4H A;  2QKM B;  3FX3 A;  5EEG A;  4FIS A;  2Y0S N;  2Q1Z B;  3HTS B;  3K10 A;  3TOB A;  4XKB A;  5FO5 A;  2XRO A;  3A03 A;  1IN8 A;  1KYZ A;  3KLO A;  3O3K A;  4GYG A;  1JKP C;  2CQN A;  4EJO A;  3QPH A;  4XOP A;  3IKT A;  3GBG A;  5JLW A;  1XGS A;  2WY7 Q;  4UV9 A;  4L9V A;  3WTV C;  1T56 A;  3W2A A;  2F5C A;  4XON A;  2M34 A;  4L0Y B;  3GTQ J;  5CQG A;  2LKS A;  5ILS A;  1UG2 A;  1R4M B;  3SZP A;  1ZRD A;  1L3L A;  3K70 C;  5J1U A;  4P5O A;  5E3O A;  1WJC A;  2JMW A;  1LQ1 A;  2YU3 A;  2ECB A;  2GXA A;  3J7A Y;  2VJJ A;  5DM7 F;  2H8R A;  4HX4 A;  5F27 A;  3W2W A;  3D1N I;  3SQN A;  3ZN0 A;  1P7J A;  5IT9 K;  3ABT A;  3BTL A;  3I5U A;  5FKM A;  2W85 A;  3F8C A;  2PI0 A;  1UB9 A;  2L0K A;  2OBP A;  2ZNZ A;  3FM5 A;  3LSJ A;  4DGW B;  3O8G A;  5KAF C;  2PLY A;  1OCR H;  1QRY A;  3I59 B;  3V7C A;  3E7L A;  4A93 J;  4IX7 A;  3BRO A;  3VYR B;  1BI3 A;  1IUF A;  1WGX A;  4A5M A;  1Q1H A;  4BE1 A;  5F04 A;  5CVV A;  5DUI A;  3K69 A;  1DGR M;  1FTZ A;  3QAH A;  5ERI A;  4GYI A;  4R1H A;  3VYS B;  2P6T A;  4YFN F;  2GBY A;  3X2Q H;  1G6N A;  4M9X A;  4JX4 A;  4GGG A;  5K7F A;  1AA7 A;  5DCM A;  4HV6 A;  5ICF A;  2Z2S B;  3J7Y J;  1MMN A;  3ZOB A;  4HNV A;  2JN6 A;  1X1B A;  1PP8 F;  4XID A;  3U1K A;  1HST A;  2QZ8 A;  5F64 A;  4WF2 A;  2NVY J;  1Y0N A;  4EGZ A;  4EAT A;  3E0J B;  2DPU A;  3I4M J;  2HTJ A;  2VKV A;  2Q8K A;  4HST A;  2VE8 A;  5KK1 A;  2KKO A;  2LF8 A;  3KZI C;  2ZJR F;  2A5Y B;  3JRE A;  2KHM A;  5C4J J;  4D7M A;  1MSF C;  2G7H A;  4H0E A;  5FLV A;  1GLN A;  4ZH4 F;  3S2D J;  1X1A A;  2K9Q A;  4R79 A;  3WHB A;  4CCK A;  3SDG A;  3FHZ A;  5BS6 A;  2QEX I;  2PN6 A;  1BW5 A;  2BW3 A;  5HLT A;  1HDD C;  4EM0 B;  4G6Q A;  2WV0 A;  1XDS A;  1JGG A;  1Z21 A;  1RKT A;  1K78 B;  4O6J A;  4BL0 B;  4A3B J;  1U9O A;  1RC9 A;  2YUS A;  1ZKG A;  3RZD J;  4U0W A;  1KYW A;  1POG A;  1LDJ A;  4B48 A;  2M4K A;  2AQE A;  1R4N B;  3DWL E;  5E1W A;  1VQP I;  5BPI A;  2E2J J;  2VBW A;  1IAW A;  3BT9 A;  1WFX A;  1AHD P;  3M3Y J;  3FHN A;  1T8I A;  1KQ9 A;  1JE8 A;  4F7Z A;  2IAI A;  3H3V K;  2DFH A;  2EPF A;  2MYS A;  4IHV A;  5IPA A;  3AG2 H;  3OYK A;  2IS2 A;  2IGN A;  2FSW A;  1E2X A;  2CW0 F;  2DJN A;  3BOQ A;  1W5T A;  3HOT A;  1SFU A;  2CGP A;  1R6R A;  1LEB A;  1O7L A;  4PSX A;  4Q48 A;  5FLM J;  3JRB A;  3G4S I;  1J75 A;  4BAC A;  1W5C C;  3HYI A;  5D5W B;  3F8F A;  2B7E A;  3GTK J;  1BN5 A;  1FMV A;  2EFO A;  1EF4 A;  1VQM I;  2NOJ B;  3BR3 A;  4W1U A;  1IV6 A;  5LLQ A;  1SFO J;  3S2H J;  3DBR B;  1WJE A;  3PM1 A;  3OOU A;  2X4H A;  2F48 A;  2O0Y A;  2K3P A;  3B6C A;  3HUG A;  2JTV A;  1JKR C;  3BZK A;  3HOZ J;  1IDZ A;  5IP6 A;  1I3Q J;  3M8J A;  3FXR A;  3TKY A;  4DW6 A;  1S29 A;  1ZN2 A;  1P4W A;  3HSF A;  1WQ2 A;  4ENJ A;  3Q9S A;  3CC7 I;  3AG4 H;  1EA3 A;  1E3P A;  3LA2 A;  4A3D J;  3S1M J;  2E7X A;  3UNG C;  4WX9 A;  1ZGW A;  2EH3 A;  2MGQ A;  5LRR A;  2WBM A;  1ON2 A;  3ZQI A;  2KRH A;  5H6R A;  1WJD A;  3BPV A;  2FQ3 A;  1J09 A;  2LYC A;  1OIS A;  2XF7 A;  1X3W B;  1I3A A;  4BE0 A;  5D4S A;  4A69 C;  1FOK A;  1MJ9 A;  2ZME A;  4JP0 A;  4O3M A;  4MLO A;  1ZRE A;  1UFM A;  3CUQ C;  4GRI A;  2WA0 A;  2O61 A;  3LQQ A;  1OFC X;  4LGW A;  5E3N A;  3WOD F;  1FIP A;  4GXO A;  1APL C;  1JHF A;  3ZP5 A;  4G7H F;  1JKQ C;  3QPL A;  1P6R A;  5DCF A;  4RLQ A;  1O7F A;  2A6T A;  4RA2 A;  5M5Y J;  2HVS A;  4EMS A;  2QYO A;  4XQF A;  2OZ6 A;  2RRE A;  3DU6 A;  4BHP A;  3J81 Z;  3QPT A;  3PQJ A;  3QYB A;  4F91 B;  2QBY A;  1SAU A;  4AWX B;  4ZYE A;  2ICW G;  3NWT A;  2XAU A;  1MD0 A;  3QOD A;  5L3C A;  5LGN A;  4RB2 C;  3L2V A;  2KMU A;  1B1B A;  1IRZ A;  2GWR A;  1FX7 A;  3IWZ A;  4ENK A;  1FOX A;  5D4R A;  2QLZ A;  3DTK A;  5JVT A;  4ESJ A;  1MH3 A;  2ADU A;  2YPR A;  2L54 A;  4N9I A;  2VQG A;  3H0G J;  4X1E A;  3SJM A;  3K4C A;  5CJ9 A;  2VT2 A;  2H8W A;  2V1D A;  2ZO4 A;  5HOO A;  1B6A A;  1ZG3 A;  1VI0 A;  2O7O A;  3TO6 A;  1Z67 A;  4ENM A;  4IHY A;  1ETW A;  1LFB A;  2N8G A;  1K6Y A;  4PZJ A;  1OYW A;  1WJB A;  2L5Q A;  3RKY A;  3DP7 A;  1LKX A;  1EJ9 A;  3MKW B;  2HI3 A;  2A69 F;  4A6D A;  3S3N A;  1ULY A;  1E17 A;  3KYC B;  4MQV A;  2GXB A;  4FAS D;  2ZC2 A;  4A5N A;  3OYH A;  3W6J B;  4NBQ A;  4PJL A;  3RKW A;  3WTY C;  4IZZ A;  3N4M A;  1BA5 A;  4XBF A;  1PYV A;  4D7N A;  1YOV B;  1XDU A;  2YS9 A;  3WTX C;  2DMP A;  3GFI A;  4E7K A;  4BY1 J;  5J47 A;  2E36 A;  2F5V A;  1NG6 A;  3P9I A;  2M0M A;  1S72 I;  3WE3 A;  5F08 A;  3WTU C;  3O8H A;  1VTN C;  3U1D A;  2QWW A;  2QF7 A;  4BYY A;  3F22 A;  1WJA A;  3PIO F;  2LFB A;  3ASO H;  4BDY A;  1V4R A;  1XN7 A;  3N05 A;  2BXZ A;  1ITY A;  3BR0 A;  4OAZ A;  2Y31 A;  3HSR A;  4FX4 A;  2CH0 A;  2ZNY A;  4L5I A;  4X6A J;  4XL9 A;  2HZT A;  4RDU A;  4DZP A;  4AUX A;  3BJO A;  3J81 K;  2D1V A;  3JRD A;  1FNN A;  3G1L A;  1GVD A;  2GQQ A;  5IP9 J;  5CVI A;  1NTC A;  2ZB9 A;  2HQN A;  3K0L A;  5AIP A;  5LD2 C;  4X0G A;  2VOP A;  2MG4 A;  1TNS A;  4NB5 A;  1WH7 A;  3FZV A;  4IO9 F;  2L2O A;  2E1M B;  1ZR2 A;  2XB5 A;  1RZ4 A;  3G3Z A;  1P9Q C;  3OYL A;  3B73 A;  3TW7 A;  1Y1W J;  5JLX A;  1IXR C;  4CYC B;  3TED A;  5K5Q A;  1WRJ A;  3K4K A;  2BY0 A;  4UUS B;  2K4B A;  5FFX A;  2OCC H;  2M0C A;  2XAS A;  2OF7 A;  2XAF A;  2J5P A;  1W7P B;  2FE3 A;  5GP9 A;  2LRD A;  4GO1 A;  1WJ5 A;  3CCJ I;  4XIC A;  5H2F C;  4DYR A;  3NQO A;  1ACI A;  1S7A A;  4I6Z A;  1Z91 A;  2UZK A;  4G94 A;  4PGH A;  3VYT B;  1RR8 C;  4E7H A;  3V42 A;  4EVI A;  2NVX J;  4B1R A;  5HDK A;  1IJW C;  1IN6 A;  1IUY A;  2ZBK A;  5B66 C;  4M9S A;  2TDX A;  4CGZ A;  3J80 Z;  5FFZ A;  2H1L A;  2M8G X;  4LB5 A;  3OMY A;  1YFH A;  1ZG1 A;  1DP7 P;  3WGG A;  2WAQ A;  1Z7L A;  2E35 A;  3IL2 A;  1I1G A;  2X6W A;  2HVQ A;  1V5E A;  1IXS B;  2X9D A;  1HKT A;  2XAG A;  1I50 J;  3TDZ C;  2Y75 A;  3OL3 A;  3BG5 A;  2QA4 I;  3V7R A;  1S8N A;  2HZD A;  4ZZL A;  3G73 A;  4KA4 A;  3SZT A;  3VDX A;  3OYD A;  4A3I J;  3ESW B;  2CFO A;  1U6G A;  4AU7 A;  4JX5 A;  4UUT A;  1Z77 A;  2V9V A;  3VOD A;  4MTD A;  5TJJ A;  2DCE A;  1PVE A;  3O2P E;  2MW8 A;  2GIV A;  2IGK A;  1XSV A;  2K9S A;  3FF5 A;  3LWF A;  4M6V A;  1QZE A;  4BQQ A;  5J8F A;  3BTI A;  1BOB A;  5L3G A;  2CUZ A;  1G4D A;  1TTY A;  3EYI A;  3GTG J;  4BH9 A;  2X6Y A;  2XGD A;  1OCP A;  2X51 A;  4U88 A;  2ISZ A;  2OQG A;  3LSI A;  1MBE A;  1VQ6 I;  2DA6 A;  2RNJ A;  4OIP F;  1LVA A;  4IRI A;  3LAP A;  3ABM H;  3C7J A;  2BVL A;  1FYL A;  4FTH A;  4KIF A;  3HJE A;  3KIO A;  3FDY A;  2D1H A;  2DOD A;  2OZU A;  1VQ9 I;  4JX6 A;  3I54 A;  1VQO I;  3RYP A;  1RNL A;  2KZV A;  2KZG A;  4I7H A;  2L9V A;  3F72 A;  2XKO A;  4HF0 A;  4HLX A;  3SHF A;  1Z3X A;  1JKO C;  4PFP A;  2R3S A;  5JR3 A;  4KMF A;  3L00 A;  2E71 A;  3GTJ J;  2EBI A;  2TRT A;  3C1D A;  1MSE C;  2ZME B;  1XGO A;  3HXL A;  3RQ4 A;  1R7J A;  3H3Z A;  3SXY A;  3JRC A;  5HLI A;  2CUF A;  2O6G E;  4F92 B;  3TGN A;  5F0C A;  3TW6 A;  2F5F A;  2R7R A;  5DDG A;  1SVO A;  3KET A;  1JT6 A;  3PSF A;  1MBJ A;  2R5Y B;  1LDK B;  2CFX A;  2AQF A;  2VQL A;  3DV8 A;  1AOY A;  1R9T J;  1JJ6 C;  4M72 A;  3ZQF A;  2LMD A;  3DQV C;  1RI7 A;  4XRF A;  3UR3 C;  1TBX A;  3LQR A;  2O9L A;  4OIQ F;  4M3B A;  2CRG A;  2NNY A;  1FBU A;  5C44 J;  2H6C A;  4V2G A;  4OU0 A;  1B4A A;  3QOE A;  1BBY A;  1Z6R A;  3DU5 A;  3PNY A;  4RAG A;  2XPV A;  4QSH A;  2CYY A;  5LEJ A;  4N4O B;  3I64 A;  3EDP A;  3H1C A;  2BOL A;  3EPZ A;  2LD5 A;  4IOA F;  5FLX K;  4CCO A;  2KIF A;  4BNC A;  2V79 A;  3OR1 C;  4IF4 A;  4YIF A;  1LEA A;  2ZME C;  2BY1 A;  2CW8 A;  2A6E F;  2DTZ A;  3CCU I;  3KCC A;  3DXJ F;  3E6M A;  3W2V A;  2KIS A;  2Y69 H;  4IHS A;  2MC3 A;  2VL8 A;  3OWT A;  4ZYA A;  4OAY A;  4A2U A;  4WXC A;  3J80 K;  5JHF A;  4HBL A;  2P5L C;  3F6V A;  1ETX A;  4C2U A;  3GTM J;  1YX5 A;  5EJC A;  3H35 A;  1MW7 A;  1EH6 A;  4RBO A;  2KJB A;  1W4M A;  4OIN F;  2VPL A;  1F9N A;  2DFE A;  2IPQ X;  3K1P A;  5J40 A;  3L2U A;  2DN0 A;  3OYA A;  5D8L B;  3E5U A;  3GFJ A;  1U78 A;  3Q0W A;  2E2I J;  4HQE A;  4RM2 A;  2LK2 A;  5HVQ C;  2VC1 A;  2Q0O A;  1T95 A;  2A3S A;  3MFK A;  2CS3 A;  1XPX A;  5FGM A;  3LSH A;  2RQQ A;  2GOM A;  4XKC A;  3GZN B;  2A05 A;  2GLO A;  3R0A A;  2IEK A;  3SYT A;  2JWT A;  3KEQ A;  3LST A;  1KU2 A;  4LLN A;  3COA C;  3BR5 A;  3I4N J;  2HKO A;  2AXL A;  4KMU X;  2W00 A;  1VFC A;  1I39 A;  2W84 A;  5ILU A;  1HW5 A;  1MMA A;  4KT5 C;  3KX2 A;  4BUP A;  4NUB A;  2VC0 A;  3MAJ A;  1OJL A;  2DFI A;  2LBF B;  1R36 A;  3IKV A;  5KHD A;  4P96 A;  1WVR A;  3F3X A;  3BG3 A;  3HL2 A;  4L9J A;  3H9Q A;  3GWZ A;  2JUC A;  2R7S A;  2XVC A;  4KIG A;  1VQN I;  2EA4 A;  4XRS G;  3QU3 A;  4NC8 A;  2OTJ I;  1HXD A;  5HDN A;  4PFO A;  5HS8 A;  1ZGA A;  3WG7 H;  2EV0 A;  3VSL A;  2CQ7 A;  5J1R A;  1YIJ I;  2RKH A;  2UWM A;  3CCM I;  5L3F A;  4HEA 2;  2R7X A;  3BJA A;  1MBG A;  4PUS A;  2JQ7 A;  3H92 A;  4LJZ F;  1O3Q A;  1YRN B;  5FJ8 J;  2E1O A;  2I5U A;  1HC8 A;  1ZGJ A;  1PUF A;  6PAX A;  4OWR B;  4S0H B;  3HOY J;  3RQI A;  4M74 A;  4UVC A;  4I76 A;  3HGG A;  2V9K A;  3KP5 A;  4IEJ A;  4ETS A;  1RUO A;  1X58 A;  2DMN A;  3F8M A;  1A36 A;  3QYE A;  4CXF A;  4HDU A;  2VN2 A;  2GIZ A;  4IRH A;  2IP2 A;  2KDO A;  5LHH A;  3S32 A;  2DFF A;  4BJ5 C;  1SVM A;  2Y0M A;  4UVB A;  3IWF A;  4D5F A;  5EF6 A;  3CUQ A;  4Z6Y A;  3ZMD A;  5LHG A;  1MKM A;  1ZAO A;  3ZQG A;  1RES A;  4EM2 A;  2HOT A;  3KLN A;  2VPR A;  1I1S A;  1TNT A;  3RPU D;  3HRM A;  2L9N A;  3LSP A;  2EFQ A;  2LNB A;  3TL4 X;  3FM3 A;  2EIJ H;  4YEL A;  1KA8 A;  2EFW A;  1RRJ A;  2EZH A;  1EV7 A;  3BZ6 A;  3GF2 A;  3EUA A;  3Q9V A;  2DQR A;  3CF2 A;  3R4K A;  1JT0 A;  1D0X A;  3GVA A;  4IOC F;  2MLG A;  2KPM A;  4L9N A;  3HB9 A;  4AIJ A;  2FMY A;  3TDU C;  5FRO A;  1ZLJ A;  2CW7 A;  5IT9 Z;  2ID6 A;  1R22 A;  2R7F A;  3MKZ A;  3BG6 A;  3A4C A;  2YX4 A;  5HDG A;  4M3D A;  3FBI B;  2M3A A;  1O57 A;  2X1C A;  4E70 A;  5E3L A;  2K02 A;  1BL0 A;  3S3O A;  2XDV A;  2F6C A;  1U0J A;  1QHG A;  1P92 A;  3P9C A;  2DI3 A;  5KNL A;  2KT0 A;  4D0P A;  3DKW A;  2F4M B;  3GCM A;  3ZMZ A;  2G7U A;  2R93 J;  3OOP A;  2KRC A;  4KDP A;  5FD6 A;  3ZGK A;  1K7A A;  1IN7 A;  2K4J A;  2HGC A;  5BOX A;  2LBF A;  2XPW A;  3F23 A;  3RI4 A;  2L7K A;  3HHH A;  1RET A;  4HX8 A;  5HOD A;  3SEQ A;  1QZZ A;  4N4N B;  5ED4 A;  1MMD A;  1UHS A;  2DT7 B;  3OIO A;  3GX4 X;  5FB2 A;  3QOP A;  2PMH A;  2LLK A;  3E6D A;  3T8R A;  3OYM A;  3GUD A;  1MMG A;  1ZYR F;  2IA2 A;  3TO9 A;  3WTW C;  4B8X A;  1STZ A;  4WK8 F;  1BM9 A;  2CQK A;  4I01 A;  2LSO A;  3V8L A;  4S04 A;  3S14 J;  3KE2 A;  1R1V A;  4Y52 J;  2DDA A;  1LE8 A;  1QA6 A;  1MND A;  1ETV A;  2DMT A;  4P1W A;  1KQ0 A;  4FE7 A;  3ELK A;  1HDP A;  1SFK A;  4M9Z A;  3S93 A;  2W25 A;  3I56 I;  2OC6 A;  1HSJ A;  1YX3 A;  2NVU B;  4OMY A;  5IYD J;  4HSR A;  3DTE A;  5B5E C;  1MJB A;  3PIP F;  3RKQ A;  2COM A;  4RB0 A;  4G7Z F;  5K7Z A;  1Z1D A;  4ZDP A;  2MH9 A;  4A3E J;  3TOA A;  1B59 A;  3OS2 A;  3CDH A;  5LRS A;  2YR2 A;  4IHX A;  4C3J J;  2IS4 A;  2MLK A;  2K85 A;  2CU7 A;  4RGU A;  1XX5 A;  2OA4 A;  5M5W J;  1ZRC A;  3CES A;  2FD5 A;  2P0W A;  3HSE A;  3WU0 A;  2XV4 S;  4A3C J;  1K6O A;  2E5N A;  2HDC A;  2CV0 A;  3CME I;  1OKR A;  3LSK A;  4P9U A;  4EJV A;  1X1C A;  2QGU A;  4WXD A;  5BMZ A;  4EM1 A;  3MKY B;  3WGH A;  1H8A C;  4II3 A;  2EZI A;  2DOF A;  5HS9 A;  1D5V A;  2NAZ A;  3N97 A;  1B72 B;  2HDW A;  3EET A;  1ZTR A;  1QPI A;  1HKQ A;  3BQZ A;  2CV2 A;  1EKE A;  2M7A A;  5J6X A;  1MNE A;  2JJ7 A;  1QNT A;  3ZQC A;  5JHU A;  4UHT A;  1VQ8 I;  3DKX A;  3M7G A;  4J01 A;  3OYC A;  2F2E A;  5EGO B;  1F36 A;  3UKG A;  2VKE A;  5HNF A;  2LY2 A;  3E5Q A;  1K78 A;  2QBY B;  1TWC J;  1UAA A;  4GFB A;  1BI2 A;  2FBK A;  2CV1 A;  4LG0 A;  2DA5 A;  5K7H A;  3ZQ7 A;  3L7W A;  2BW3 B;  2DYS H;  3F0C A;  2HOS A;  1SAN A;  2HEO A;  4EGY A;  1W0U A;  1IZ1 A;  1LDD A;  5DD8 A;  1IF1 A;  1J7K A;  4IHW A;  3C2B A;  5F1J A;  2HPM A;  4A3G J;  1JUS A;  2LP0 A;  2XGC A;  4CH7 A;  4B09 A;  5KVR A;  1OMI A;  3CO6 C;  4RGX A;  3T0Y A;  2FA5 A;  2VKD A;  4BHB A;  1J59 A;  2IT0 A;  1TWG J;  2G0E A;  1XMX A;  1E3O C;  3LSG A;  4Y17 A;  4WWC A;  4ZDO A;  2BE5 F;  4EJU A;  1JUM A;  1N25 A;  2Y48 A;  5IT3 A;  3K4M A;  1X4P A;  2ZJP F;  4ZC3 A;  2KJC A;  1S6L A;  2JA6 J;  4MGR A;  4IJA A;  3Q0U A;  1R58 A;  4XM3 A;  4CCN A;  3MVP A;  3ONQ A;  3GZ5 A;  4QPO A;  1Z05 A;  1ZK8 A;  5EG0 A;  2V26 A;  2ETH A;  2OPT A;  3BR2 A;  4EEF G;  5F0H A;  2HNH A;  1S5L C;  2QQ9 A;  3OYB A;  5DTD A;  4U7B A;  4Y3O A;  4UY8 I;  5TGT A;  1CF7 A;  5D6E A;  4ZYD A;  3H5N A;  3FXU A;  1OYY A;  4YEJ A;  1YW8 A;  4HF1 A;  1G2H A;  1NHA A;  3IUO A;  3L2C A;  5JVG F;  3KZZ A;  1FBQ A;  3QRF F;  2RQP A;  5CVU A;  5AON A;  2ELH A;  1JJ8 C;  1H9G A;  2JPC A;  1IO2 A;  3DPU A;  2DW4 A;  1GVJ A;  1X1P A;  2VOO A;  4KN4 X;  1FC3 A;  4XLH A;  3LSR A;  3I4P A;  3HKZ N;  5F6F A;  3S1N J;  5BPD A;  1IDY A;  1YJN I;  5K1Y A;  3ERM A;  2L7Z A;  2B0L A;  2M87 A;  3MKL A;  1TWF J;  1S9H A;  1WZ2 A;  4MHG A;  4N0B A;  4RGS A;  3LFK A;  1U8B A;  3GFL A;  2A07 F;  1GV5 A;  2M4G A;  2V4J C;  4UNO A;  1W5S A;  2W1O A;  2K7L A;  1R00 A;  1BC8 C;  1DP3 A;  1QHH D;  3WU2 C;  5EDN A;  1IGN A;  2IA0 A;  3FXK A;  4M73 A;  1UMQ A;  2QSF X;  4QLC U;  2R4G A;  5E79 C;  1IRX A;  1Y1V J;  1T0F C;  3K6G A;  4XR6 A;  3KEY A;  2H09 A;  2K5C A;  2Y9Y A;  2EIL H;  5FRM A;  2ZFU A;  3OYN A;  4MIM A;  5EYR A;  2LRE A;  2A6H F;  4A0Y A;  3JTH A;  1BOA A;  3A01 B;  4BDZ A;  3BY6 A;  4KFC A;  1IN4 A;  2HTS A;  3A02 A;  1VQ4 I;  3RCO A;  1YIO A;  2UV1 A;  3O6B B;  4NHJ A;  3R0J A;  2BEO A;  3RIR A;  5ICE A;  3CP2 A;  3H0D A;  3VSK A;  4HF2 A;  1BC7 C;  4LOC A;  1GXP A;  2XHK A;  1OCT C;  1J9I A;  1F4K A;  1Y0U A;  2E1M C;  4PGG A;  4CYC A;  1TQM A;  2O5R A;  1R23 A;  2XB0 X;  1HA8 A;  3QU6 A;  3QPS A;  5J3L A;  2TCT A;  3IH2 A;  2GA2 A;  1PDN C;  2WY8 Q;  4HG2 A;  3HTU A;  3R6S A;  4BXF A;  5D8K B;  1FY7 A;  3HPG A;  3VEP A;  1B9N A;  1QPM A;  3DF8 A;  4I98 B;  1NG7 A;  3AAF A;  1BR4 A;  3FK6 A;  2IVM A;  3CCQ I;  3PO2 J;  4Y13 A;  3FMR A;  2PJR A;  2RV8 A;  2DU9 A;  2CSO A;  5EZH A;  2ME0 A;  3C2G A;  3AL0 B;  2ZXH A;  2EV6 A;  3L2R A;  4DYQ A;  4FCY A;  1FMW A;  4A0Z A;  3IC7 A;  4RAF A;  1N75 A;  5GPC A;  5GAD J;  3IH4 A;  1X4O A;  4U7D A;  1XD7 A;  4B4C A;  1FP2 A;  2M5W A;  2HXO A;  4KIC A;  3T5X A;  5GAH J;  4RS8 A;  2VLA A;  1ZH5 A;  1FYK A;  2E5Z A;  1LFP A;  3OYG A;  3VOE A;  3I59 A;  2DMQ A;  4KNY A;  4Q5S F;  2A5W A;  3LFU A;  3QQA A;  2QQ8 A;  2Z1D A;  3R60 A;  4KIB A;  2V9P A;  5LEK A;  4MNU A;  2WAE A;  2KRF A;  2QCO A;  2VJ5 A;  3E5X A;  3ZPL A;  2LY9 A;  3HOX J;  2BXY A;  1FPQ A;  4RLF A;  4XOR A;  4MFD A;  2IBD A;  1G3T A;  2RN7 A;  1CQT A;  3BR1 A;  4AID A;  1ZHF A;  2HR3 A;  1QZY A;  2COB A;  5ILV A;  3I58 A;  3M07 A;  5A2Q Z;  1BR1 A;  3LL7 A;  2E60 A;  2ZCW A;  3ISP A;  1S7E A;  4UV8 A;  3G71 I;  2B9S A;  2YU9 J;  2F4I A;  1D0Y A;  2XF5 A;  3GME A;  5CKT A;  4M3E A;  2BBY A;  4XRM A;  1T39 A;  5AIQ A;  2MSY A;  4BE2 A;  1YQA A;  1JGS A;  2FBH A;  1S3J A;  3FKJ A;  4AVP A;  4W97 A;  2ZJQ F;  1YRN A;  2CWE A;  2OCE A;  5F0F A;  4LG3 A;  1X3Z B;  3MCZ A;  4E7Z A;  1YS6 A;  4V2F A;  2D2W A;  3G6E I;  1L0O C;  1YHQ I;  2OJE D;  3CMY A;  3MQ0 A;  4OOI A;  2EIN H;  1VQ7 I;  1MBK A;  1WPK A;  4E7S A;  4KIS A;  2YSR A;  2STW A;  2DQL A;  4HDV A;  2O03 A;  4ASN A;  1UST A;  5E3M A;  2DT5 A;  3EUK L;  1D8K A;  4BEH B;  3L1P A;  3PUF A;  2Z33 A;  1G59 A;  3JR9 A;  4KT6 A;  5IYC J;  4C9Y A;  3ASN H;  1ZEL A;  2R92 J;  2P4W A;  3RZO J;  5DV5 A;  1OR7 C;  3NAR A;  1UCR A;  2KL4 A;  3TP3 A;  2M7B A;  2R7T A;  4HNT A;  2VQH A;  3AG1 H;  2NS8 A;  1V55 H;  3HGY A;  2WB1 A;  2HQA A;  1IV8 A;  2ZFW A;  4L18 B;  3FIS A;  4F55 A;  1U5T A;  4DNC A;  3OYJ A;  1SC7 A;  1GHC A;  3L2Q A;  2K86 A;  3BG7 A;  4BS9 A;  2YX7 A;  2IJL A;  3IHU A;  4LMY A;  4M3G A;  2A61 A;  1W1W E;  2DPD A;  2M45 A;  4ESB A;  2NOG A;  2XSJ C;  3H5R A;  2X1D A;  4D1Q A;  4LIV A;  3ZN1 A;  4HAM A;  1DU6 A;  2R7Z J;  5GTH C;  2JZY A;  1YW9 A;  3LSM A;  2XRL A;  3FKI J;  1ZLK A;  3JSO A;  2KLO A;  4U0Y A;  1YG2 A;  3D5R C;  5HLG A;  3GEZ A;  3OYI A;  1OCC H;  2M1B A;  4NC6 A;  1F43 A;  3GYH X;  3MWM A;  1R5H A;  3E1S A;  4FT8 A;  5GPA A;  1R49 A;  1USS A;  2O3F A;  3H9G A;  1B72 A;  2H27 A;  1FBS A;  2P6S A;  1MNM C;  2DXI A;  3CC4 I;  3P7N A;  5HLH A;  4HYE A;  1XMA A;  1IN5 A;  1QO0 D;  2GM4 A;  1ZG5 A;  3OV8 A;  4FHT A;  4D5C A;  4PJN A;  2H6B A;  2IXS A;  3SFZ A;  3C2H A;  2A68 F;  2LY1 A;  4B3A A;  1WH5 A;  2LTP A;  2V1N A;  1JI8 A;  3K7A J;  3BWG A;  5M3M J;  4R8H A;  5DYM A;  2AO9 A;  3Q5F A;  4GDF A;  1ON1 A;  3BR6 A;  3HBL A;  4BQO A;  3I3L A;  4MTE A;  2HQ5 A;  1V5G A;  1K79 A;  1N77 A;  2XSD C;  4ZTF A;  3HDD A;  2EIM H;  2XF6 A;  4F93 B;  1HF0 A;  2GA1 A;  3RYR A;  1Y6I A;  1JTX A;  4JYK A;  3V7S A;  5IP7 J;  4C2T A;  3HKZ A;  5E18 F;  4DZJ A;  2K9N A;  2R5Y A;  2EIK H;  3L09 A;  4JBA A;  2X0L A;  1PJR A;  2Z3Y A;  2ME6 A;  1VZ0 A;  2ECC A;  3VB2 A;  4YG2 F;  4ABZ A;  3OS0 A;  1FJL A;  2NVQ J;  2BV6 A;  1SFE A;  1LJ9 A;  4JOM A;  5JI6 A;  3GTO J;  3BTJ A;  2HXI A;  1HW2 A;  3T1B A;  3V8J A;  3NRV A;  1A31 A;  4QPQ A;  1W36 C;  2JVH A;  4B43 A;  2XRN A;  3HRS A;  3BPX A;  4HNU A;  1A35 A;  1R1T A;  1FSH A;  2NNN A;  1TP4 A;  3KYL A;  3CO7 C;  2L4M A;  1XCV A;  3W3C A;  2PMZ A;  4ANJ A;  2VT3 A;  2CG4 A;  1QBJ A;  2NS7 A;  4AYB N;  2HYG D;  3KP6 A;  5H20 A;  3WHC A;  2OV7 A;  3DLL F;  2XGE A;  1O3R A;  9ANT A;  1OQY A;  3S8P A;  1SD5 A;  2F5E A;  2NS0 A;  1LNW A;  5D5V B;  4H4K C;  1G3S A;  5DUK A;  2FNA A;  1Z6T A;  1T2K A;  1ETY A;  4FET A;  1I27 A;  2VJ4 A;  3DLA A;  5KAI C;  1RKW A;  5EZG A;  3F8B A;  5E20 A;  1SMY F;  4YFX F;  3DPT A;  1JUP A;  4BKX A;  2FU4 A;  5JFR A;  2UXX A;  3KP3 A;  1JXS A;  3LA3 A;  3ZCO A;  2OU2 A;  4Q4Z F;  1UZC A;  2E7W A;  3EYY A;  4XN3 A;  4XLP F;  2ZXW H;  2P8T A;  5HNH A;  4ZDL A;  2EA2 A;  5IOZ A;  4ESF A;  2LKP A;  5J4V A;  3FWE A;  4PJ0 C;  3CMM A;  1P4A A;  3MMY B;  4IPA A;  2EFP A;  3CUQ B;  4MO7 A;  4XNF A;  2QVO A;  1D1B A;  3FXQ A;  3GLX A;  2DK8 A;  3HEF A;  2WB1 N;  3OL4 A;  1MMS A;  1HOM A;  2LOO A;  4XLN F;  4BJT A;  1A04 A;  4IXA A;  1HW1 A;  3PFI A;  1RPW A;  3U9G A;  1YIT I;  2Y2Z A;  3CLQ A;  5GAG J;  1D1A A;  4CIC A;  2R5Z B;  4YFK F;  3HOW J;  2R7O A;  2Z5U A;  4B3X A;  1EH7 A;  4BAY A;  2FX0 A;  2QQA A;  1W0T A;  1XSD A;  1YS7 A;  4LFU A;  3K4N A;  4A3J J;  3CJT B;  1LE8 B;  1BI1 A;  2PQ8 A;  3TP0 A;  4DBR A;  1C0W A;  2KQR A;  1VQ5 I;  4IRG A;  1GV2 A;  1A6Q A;  4M3F A;  2DMU A;  3HOS A;  3OS1 A;  1SD4 A;  4JQF A;  3K2A A;  3TQN A;  4UUS A;  3BQY A;  2CUE A; 
#chains in the Genus database with same CATH homology
 3KEO A;  2GXG A;  4IVN A;  1DUX C;  3M9A A;  5F1R A;  4O5V A;  2ACJ A;  4LK1 F;  3WU1 B;  4A12 A;  3MZH A;  4GCV A;  2FF4 A;  3K1M A;  5E8G A;  5L3D A;  2FEZ A;  2HS5 A;  3F8N A;  2W57 A;  2G9W A;  5EEH A;  1YO5 C;  1TQP A;  1TQI A;  2FRH A;  4MEX F;  2VXZ A;  1ZRF A;  4MEY F;  4U0V A;  1ZAR A;  3ROU A;  4I02 A;  2R7D A;  1QGP A;  2ESN A;  3HHG A;  2DO7 A;  3NEU A;  3B02 A;  3KP2 A;  1WWX A;  1YW7 A;  1FSE A;  3VFZ A;  4L9T A;  2QM3 A;  2O8X A;  1REP C;  4L5J A;  4PCQ A;  1MGT A;  1YTY A;  3CUO A;  2Z99 A;  4ZZD A;  3EQL F;  3IRR A;  3C3W A;  4OIR F;  3T8T A;  1MZB A;  2V1X A;  2DK5 A;  3S2W A;  5CYV A;  4G6D A;  3U2R A;  3WGI A;  2HOE A;  4XSX F;  2PEX A;  3LAJ A;  4RAY A;  3M8E A;  2Q2E A;  3GZ6 A;  2F5D A;  4BXU A;  1OYI A;  1IRF A;  1DDN A;  2Z9O A;  3L9F A;  2OAZ A;  2MH2 A;  2BGC A;  3KP4 A;  5CVR A;  5E17 F;  2HQR A;  1KQ8 A;  3JW4 A;  3ERE D;  3CJN A;  2PJP A;  5DEQ A;  1OPC A;  2JT1 A;  3MEX A;  4HX7 A;  4EQQ A;  1ONV A;  4ON0 A;  2XUB A;  2L02 A;  3ECH A;  3ULQ B;  1SD7 A;  2VBX A;  2PMU A;  4I09 A;  3E6C C;  1RUN A;  5BQT A;  1AWC A;  3ZMS A;  4CO8 A;  1W7P D;  4A0X A;  4LG0 B;  2PG4 A;  2EV5 A;  4M6X A;  1SD6 A;  1LB2 A;  1G3W A;  1U5T C;  3K9T A;  4LLL A;  2ISY A;  5D6F A;  4MQ9 F;  1JHH A;  4CYD A;  2DBB A;  2QQB A;  4AIH A;  2H94 A;  1F5T A;  4UVA A;  3K1N A;  1XGN A;  3BJ6 A;  3ML6 A;  4I0A A;  4PDK A;  3BDD A;  4CDG A;  4BQA A;  2JRT A;  1WSU A;  1KGS A;  3LA7 A;  4K2E A;  1I6X A;  3GO5 A;  1XMK A;  1U3E M;  3MZY A;  2V1U A;  3HIF A;  1HKS A;  4HLY A;  1T38 A;  4G9Y A;  3JSP A;  3E6B A;  4OIO F;  3HRT A;  1J2X A;  2E1C A;  5A2Q K;  1I5Z A;  2EB7 A;  1J5Y A;  4LB6 B;  4N9H A;  2M30 A;  2QUF A;  2LDU A;  3C18 A;  4LLG F;  2J5O A;  5E8I A;  1FYM A;  1TW3 A;  4AIK A;  2HKX A;  3ZMV A;  4KUM A;  3JAM Z;  1MDM A;  2P7V B;  1MJA A;  2FML A;  1U2W A;  1KU9 A;  3WE2 A;  1RIO H;  2VBZ A;  2D45 A;  4Z2Y A;  5FD5 A;  1XSX A;  5L3B A;  3WTT C;  2FOK A;  1OR7 A;  3D5L A;  5LGU A;  2MBF A;  2DLL A;  3RTR A;  3R61 A;  3RKX A;  2IA1 A;  2P7C B;  2KIU A;  5J8C A;  5E1X A;  3HRU A;  4G7O F;  2L3D A;  1U8R A;  2FXA A;  1FP1 D;  4DQ2 A;  1UHW A;  3PQK A;  4RAZ A;  4P9F A;  2IW5 A;  5LHI A;  1S7O A;  1PP7 U;  3RPQ A;  2EWN A;  1IW7 F;  1SFX A;  2XAQ A;  2HYF A;  1FZP B;  2NYX A;  5CLS A;  1HQC A;  1PUE E;  5K5O A;  1Z7U A;  1H0M A;  2WWY A;  4HOB A;  4I2O A;  2DAO A;  1O3T A;  1IRG A;  3KFW X;  2RVC A;  4CZZ A;  5CVJ A;  1DPU A;  1QQI A;  3V8K A;  1BIA A;  1MDM B;  3DFG A;  5FLX Z;  1HBX G;  4XSZ F;  3QP6 A;  2STT A;  4EJW A;  2E1N A;  3DPL C;  5ICG A;  3D0S A;  3ABU A;  3W6K B;  2DTR A;  1CGP A;  1J0R A;  1F1Z A;  2GAU A;  1P2F A;  4KYW A;  1EH8 A;  2K27 A;  1FLI A;  4NQW A;  4RB3 C;  3M8F A;  2EK5 A;  3I53 A;  3P9K A;  4HW0 A;  1IXC A;  1TLH B;  4RB1 A;  4ZYG A;  2EFN A;  2GZW A;  4LD5 A;  5D5X B;  4RGR A;  5H6Q A;  1R5G A;  3GXO A;  2RDP A;  4EV0 A;  1FWZ A;  2RGV A;  3ECO A;  5DD4 A;  2ESH A;  3E3V A;  4M6Y A;  3JTG A;  2AS5 F;  4TV7 A;  2HFH A;  5LBQ A;  3V4G A;  5ICC A;  3RJP A;  2XAH A;  3F6O A;  3CLO A;  2FNP A;  2VON A;  3TO7 A;  4KN7 X;  4ENN A;  5K5R A;  1CF7 B;  3BP8 A;  3EUH A;  1BJA A;  3JAM K;  2ZKZ A;  1SAX A;  1KU3 A;  3K2Z A;  5TRD A;  2JSC A;  1U5T B;  4L0Z B;  1ODD A;  1DPR A;  4S05 A;  1GXQ A;  4AD9 A;  4IHT A;  3RDI A;  1O3S A;  2FBI A;  4ZYH A;  4UXN A;  3ZMT A;  2VE9 A;  2PFB A;  2XKP A;  1SMT A;  2M8E A;  3M1E A;  1G3Y A;  1XGM A;  1T0F A;  4CHU A;  5DCM B;  1T6S A;  4HZF A;  1R1U A;  3CTA A;  4G8X A;  4HV5 A;  2ZJ2 A;  3IRQ A;  1WKM A;  2KIM A;  4HA8 A;  1FT9 A;  2QEN A;  2XAJ A;  3REO A;  2PBI A;  1YLF A;  3WTS C;  1XB4 A;  3GFM A;  4OMZ A;  5LGT A;  4M71 A;  2BYV E;  2OQR A;  2P5K A;  3ZMU A;  4BHC A;  1YYV A;  3QP5 A;  2L4A A;  1BIB A;  2MD5 A;  4LK0 F;  4YII A;  2XIG A;  1UHM A;  3RPU A;  4Q47 A;  1V3F A;  5HS7 A;  2L01 A;  3J7A O;  4A6E A;  2JPB A;  3E97 A;  3FMQ A;  4UUV A;  2LF7 A;  1D8J A;  2WTE A;  3DEU A;  5D5U B;  5L3E A;  1D3Y A;  1WI9 A;  4QWQ A;  2XGX A;  4P55 A;  1TW2 A;  4FX0 A;  1X3U A;  2HWV A;  3KZY A;  1P4X A;  3WTZ A;  2MA3 A;  2RC4 A;  3H3U A;  2UXN A;  4EJT A;  1W7P A;  4JK1 X;  2EJR A;  2VOD A;  4I0B A;  2W24 A;  2V6C A;  1XCB A;  4Y15 A;  2ZXJ A;  3KP7 A;  2VBY A;  1T98 A;  3F21 A;  3GW2 A;  1KU7 A;  3I71 A;  5E1Z B;  2OD5 A;  1H9T A;  3I0T A;  2CO5 A;  2WC2 A;  3FMS A;  1BI0 A;  4WXH A;  1Z9C A;  2C6Y A;  2P5V A;  2IRF G;  1B9M A;  4HQM A;  3WG9 A;  3FX3 A;  5EEG A;  3HTS B;  2XRO A;  3TOB A;  5FO5 A;  1IN8 A;  1KYZ A;  3KLO A;  3O3K A;  4GYG A;  4EJO A;  3QPH A;  3IKT A;  1XGS A;  4UV9 A;  4L9V A;  3WTV C;  2F5C A;  4L0Y B;  5ILS A;  3SZP A;  1ZRD A;  1L3L A;  4P5O A;  1LQ1 A;  2YU3 A;  4HX4 A;  3SQN A;  3ZN0 A;  5IT9 K;  3ABT A;  3I5U A;  2W85 A;  3F8C A;  2PI0 A;  1UB9 A;  2ZNZ A;  2OBP A;  3FM5 A;  2PLY A;  3I59 B;  3V7C A;  3BRO A;  1BI3 A;  4A5M A;  1Q1H A;  5CVV A;  5DUI A;  3K69 A;  3QAH A;  4YFN F;  5ERI A;  4GYI A;  4R1H A;  2P6T A;  1G6N A;  4M9X A;  4GGG A;  5DCM A;  4HV6 A;  5ICF A;  1PP8 F;  1HST A;  2QZ8 A;  5F64 A;  4WF2 A;  4EGZ A;  2DPU A;  2HTJ A;  2Q8K A;  2VE8 A;  5KK1 A;  2KKO A;  2LF8 A;  2A5Y B;  2G7H A;  4H0E A;  4ZH4 F;  4R79 A;  3FHZ A;  5BS6 A;  2PN6 A;  4EM0 B;  4G6Q A;  2WV0 A;  1XDS A;  1K78 B;  4O6J A;  4U0W A;  1KYW A;  1LDJ A;  5E1W A;  5BPI A;  2VBW A;  1IAW A;  1KQ9 A;  1JE8 A;  4F7Z A;  2FSW A;  1E2X A;  2CW0 F;  3HOT A;  3BOQ A;  1W5T A;  2CGP A;  1SFU A;  1LEB A;  1O7L A;  4Q48 A;  1J75 A;  3HYI A;  5D5W B;  3F8F A;  1BN5 A;  2EFO A;  5LLQ A;  2X4H A;  2O0Y A;  3HUG A;  2JTV A;  3FXR A;  3TKY A;  1S29 A;  1ZN2 A;  1P4W A;  3HSF A;  1WQ2 A;  4ENJ A;  3Q9S A;  3LA2 A;  2E7X A;  4WX9 A;  5LRR A;  1ON2 A;  5H6R A;  3BPV A;  2FQ3 A;  5D4S A;  1FOK A;  1MJ9 A;  2ZME A;  4O3M A;  1ZRE A;  1UFM A;  3CUQ C;  2O61 A;  3LQQ A;  4LGW A;  3WOD F;  4GXO A;  1JHF A;  3ZP5 A;  4G7H F;  1P6R A;  5DCF A;  1O7F A;  4EMS A;  2QYO A;  2OZ6 A;  4BHP A;  3J81 Z;  3QPT A;  3PQJ A;  2QBY A;  4AWX B;  4ZYE A;  1MD0 A;  5L3C A;  5LGN A;  4RB2 C;  1B1B A;  2GWR A;  1FX7 A;  3IWZ A;  4ENK A;  5D4R A;  2QLZ A;  5JVT A;  4ESJ A;  2ADU A;  2YPR A;  2L54 A;  4N9I A;  5CJ9 A;  2VT2 A;  2V1D A;  2ZO4 A;  5HOO A;  1B6A A;  1ZG3 A;  3TO6 A;  4ENM A;  4PZJ A;  1OYW A;  3RKY A;  3DP7 A;  2A69 F;  4A6D A;  1ULY A;  1E17 A;  2GXB A;  4MQV A;  4A5N A;  3W6J B;  3RKW A;  3WTY C;  3N4M A;  4XBF A;  1XDU A;  3WTX C;  3GFI A;  3P9I A;  3WE3 A;  3WTU C;  1VTN C;  3U1D A;  2QWW A;  4BYY A;  3F22 A;  1V4R A;  1XN7 A;  3HSR A;  4FX4 A;  2ZNY A;  4L5I A;  2HZT A;  3BJO A;  3J81 K;  2D1V A;  1FNN A;  2GQQ A;  5CVI A;  3K0L A;  2HQN A;  2VOP A;  5AIP A;  1TNS A;  4NB5 A;  3FZV A;  1RZ4 A;  3G3Z A;  3B73 A;  1IXR C;  5K5Q A;  1WRJ A;  2K4B A;  5FFX A;  2XAS A;  2XAF A;  2J5P A;  1W7P B;  2FE3 A;  4GO1 A;  3NQO A;  1S7A A;  1Z91 A;  2UZK A;  4G94 A;  4PGH A;  4EVI A;  5HDK A;  1IN6 A;  1IUY A;  2ZBK A;  4M9S A;  2TDX A;  4CGZ A;  3J80 Z;  5FFZ A;  4LB5 A;  1ZG1 A;  1YFH A;  1DP7 P;  3WGG A;  3IL2 A;  1I1G A;  1IXS B;  1HKT A;  2XAG A;  3TDZ C;  2Y75 A;  3V7R A;  1S8N A;  4ZZL A;  3G73 A;  4KA4 A;  3SZT A;  1U6G A;  2V9V A;  3VOD A;  4MTD A;  5TJJ A;  3O2P E;  2GIV A;  3LWF A;  1XSV A;  3FF5 A;  5J8F A;  5L3G A;  1G4D A;  1TTY A;  3EYI A;  4BH9 A;  4U88 A;  2ISZ A;  2OQG A;  2RNJ A;  4OIP F;  1LVA A;  4IRI A;  3LAP A;  3C7J A;  1FYL A;  4KIF A;  2D1H A;  2OZU A;  3I54 A;  3RYP A;  1RNL A;  4I7H A;  3F72 A;  2XKO A;  4HF0 A;  4HLX A;  3SHF A;  2R3S A;  5JR3 A;  4KMF A;  3L00 A;  3C1D A;  2ZME B;  1XGO A;  1R7J A;  3H3Z A;  3SXY A;  5HLI A;  2O6G E;  3TGN A;  2F5F A;  5DDG A;  3KET A;  1LDK B;  2CFX A;  3DV8 A;  1AOY A;  4M72 A;  3DQV C;  1RI7 A;  4XRF A;  1TBX A;  3LQR A;  4OIQ F;  2NNY A;  1FBU A;  2H6C A;  4OU0 A;  1B4A A;  1BBY A;  1Z6R A;  2CYY A;  5LEJ A;  3I64 A;  3EDP A;  5FLX K;  2KIF A;  4BNC A;  2V79 A;  4IF4 A;  4YIF A;  1LEA A;  2A6E F;  3KCC A;  3DXJ F;  3E6M A;  4IHS A;  2MC3 A;  4A2U A;  4WXC A;  3J80 K;  4HBL A;  2P5L C;  3F6V A;  1EH6 A;  2KJB A;  1W4M A;  4OIN F;  1F9N A;  2IPQ X;  3K1P A;  5D8L B;  3E5U A;  3GFJ A;  1U78 A;  4HQE A;  5HVQ C;  2VC1 A;  2Q0O A;  2A3S A;  3MFK A;  5FGM A;  3R0A A;  3KEQ A;  3LST A;  1KU2 A;  4LLN A;  3COA C;  2HKO A;  4KMU X;  2AXL A;  2W84 A;  5ILU A;  1HW5 A;  4KT5 C;  2VC0 A;  3MAJ A;  2DFI A;  1R36 A;  3IKV A;  4P96 A;  3F3X A;  4L9J A;  3GWZ A;  2XVC A;  4KIG A;  2EA4 A;  3QU3 A;  1HXD A;  5HDN A;  5HS8 A;  1ZGA A;  2UWM A;  2EV0 A;  2RKH A;  5L3F A;  3BJA A;  3H92 A;  4LJZ F;  1O3Q A;  1ZGJ A;  6PAX A;  4M74 A;  4UVC A;  3KP5 A;  4ETS A;  1RUO A;  3F8M A;  4CXF A;  4HDU A;  2VN2 A;  4IRH A;  2IP2 A;  5LHH A;  2Y0M A;  4UVB A;  3IWF A;  3CUQ A;  3ZMD A;  5LHG A;  1MKM A;  1ZAO A;  4EM2 A;  3KLN A;  1I1S A;  1TNT A;  3HRM A;  2EFQ A;  2LNB A;  3FM3 A;  1KA8 A;  2EFW A;  1EV7 A;  3BZ6 A;  3GF2 A;  3Q9V A;  2DQR A;  3R4K A;  3GVA A;  2MLG A;  4L9N A;  4AIJ A;  2FMY A;  3TDU C;  1ZLJ A;  5IT9 Z;  1R22 A;  2R7F A;  5HDG A;  2YX4 A;  1O57 A;  4E70 A;  2K02 A;  1P92 A;  3P9C A;  2DI3 A;  4D0P A;  3DKW A;  3ZMZ A;  2G7U A;  3OOP A;  4KDP A;  5FD6 A;  1K7A A;  1IN7 A;  2K4J A;  2HGC A;  5BOX A;  3F23 A;  3RI4 A;  3HHH A;  4HX8 A;  1QZZ A;  5ED4 A;  3GX4 X;  5FB2 A;  3QOP A;  2PMH A;  3T8R A;  3E6D A;  3GUD A;  1ZYR F;  2IA2 A;  3TO9 A;  3WTW C;  4B8X A;  1STZ A;  4WK8 F;  1BM9 A;  2CQK A;  4I01 A;  2LSO A;  3V8L A;  4S04 A;  3KE2 A;  1R1V A;  1KQ0 A;  3ELK A;  4M9Z A;  2W25 A;  1HSJ A;  4OMY A;  1MJB A;  2COM A;  4RB0 A;  4G7Z F;  1Z1D A;  2MH9 A;  3TOA A;  1B59 A;  3CDH A;  5LRS A;  2YR2 A;  2MLK A;  4RGU A;  2OA4 A;  1ZRC A;  3HSE A;  3WU0 A;  2XV4 S;  1K6O A;  2HDC A;  1OKR A;  4P9U A;  4EJV A;  4WXD A;  5BMZ A;  4EM1 A;  3WGH A;  5HS9 A;  1D5V A;  2NAZ A;  3N97 A;  3EET A;  1HKQ A;  5J6X A;  1QNT A;  5JHU A;  4UHT A;  3M7G A;  2F2E A;  1K78 A;  3E5Q A;  2QBY B;  1BI2 A;  2FBK A;  4LG0 A;  3ZQ7 A;  3L7W A;  2HEO A;  4EGY A;  1IF1 A;  1IZ1 A;  1LDD A;  5DD8 A;  1J7K A;  4B09 A;  5KVR A;  1OMI A;  3CO6 C;  4RGX A;  3T0Y A;  2FA5 A;  4BHB A;  1J59 A;  2IT0 A;  4WWC A;  4Y17 A;  2BE5 F;  4EJU A;  2Y48 A;  5IT3 A;  2KJC A;  1S6L A;  4MGR A;  4IJA A;  1R58 A;  3GZ5 A;  1Z05 A;  2ETH A;  2QQ9 A;  4U7B A;  1CF7 A;  5D6E A;  4ZYD A;  3FXU A;  1OYY A;  1YW8 A;  4HF1 A;  1NHA A;  3L2C A;  3KZZ A;  1FBQ A;  3QRF F;  2RQP A;  5CVU A;  5AON A;  2ELH A;  1H9G A;  2JPC A;  2DW4 A;  1GVJ A;  2VOO A;  4KN4 X;  1FC3 A;  3I4P A;  5F6F A;  5BPD A;  5K1Y A;  2B0L A;  2M87 A;  4MHG A;  4N0B A;  4RGS A;  3LFK A;  3GFL A;  2A07 F;  4UNO A;  1W5S A;  2K7L A;  1R00 A;  1BC8 C;  2IA0 A;  4M73 A;  4QLC U;  2H09 A;  2A6H F;  4A0Y A;  3JTH A;  1BOA A;  3BY6 A;  4KFC A;  1IN4 A;  2HTS A;  1YIO A;  3O6B B;  4NHJ A;  3R0J A;  2BEO A;  3RIR A;  5ICE A;  4HF2 A;  1BC7 C;  1GXP A;  1J9I A;  2XHK A;  1F4K A;  1Y0U A;  4PGG A;  1TQM A;  1R23 A;  3QU6 A;  1PDN C;  2GA2 A;  3HTU A;  3R6S A;  5D8K B;  1FY7 A;  3VEP A;  1B9N A;  1QPM A;  3DF8 A;  4I98 B;  3AAF A;  2IVM A;  4Y13 A;  3FMR A;  2RV8 A;  2DU9 A;  2CSO A;  2EV6 A;  4A0Z A;  3IC7 A;  4U7D A;  1XD7 A;  1FP2 A;  2M5W A;  3T5X A;  4KIC A;  4RS8 A;  1ZH5 A;  1FYK A;  3VOE A;  3I59 A;  4KNY A;  4Q5S F;  3R60 A;  4KIB A;  5LEK A;  4MNU A;  2KRF A;  3E5X A;  3ZPL A;  1FPQ A;  1G3T A;  2RN7 A;  1ZHF A;  2HR3 A;  1QZY A;  5ILV A;  3I58 A;  5A2Q Z;  2ZCW A;  3ISP A;  4UV8 A;  2BBY A;  1T39 A;  5AIQ A;  1YQA A;  1JGS A;  2FBH A;  1S3J A;  4AVP A;  2CWE A;  3MCZ A;  1YS6 A;  2D2W A;  1L0O C;  3MQ0 A;  4OOI A;  2YSR A;  2STW A;  2DQL A;  4HDV A;  2O03 A;  4ASN A;  1UST A;  2DT5 A;  1D8K A;  2Z33 A;  2P4W A;  5DV5 A;  1UCR A;  2ZFW A;  4L18 B;  1U5T A;  4DNC A;  1GHC A;  2NRA C;  2K86 A;  2YX7 A;  2IJL A;  3IHU A;  4LMY A;  2A61 A;  2DPD A;  2M45 A;  4ESB A;  3ZN1 A;  4HAM A;  2JZY A;  1YW9 A;  1ZLK A;  3JSO A;  4U0Y A;  1YG2 A;  5HLG A;  3GEZ A;  2M1B A;  3GYH X;  3MWM A;  1R5H A;  4FT8 A;  1USS A;  2O3F A;  2H27 A;  1FBS A;  2P6S A;  3P7N A;  5HLH A;  4HYE A;  1XMA A;  1IN5 A;  1QO0 D;  1ZG5 A;  3OV8 A;  4FHT A;  2H6B A;  3SFZ A;  2A68 F;  3BWG A;  4R8H A;  5DYM A;  3Q5F A;  1ON1 A;  4MTE A;  1K79 A;  2GA1 A;  3RYR A;  3V7S A;  5E18 F;  3L09 A;  4JBA A;  2X0L A;  2Z3Y A;  3VB2 A;  4YG2 F;  2BV6 A;  1SFE A;  1LJ9 A;  5JI6 A;  1HW2 A;  3T1B A;  3V8J A;  3NRV A;  2XRN A;  3HRS A;  3BPX A;  1R1T A;  1FSH A;  2NNN A;  3CO7 C;  2L4M A;  1XCV A;  2VT3 A;  2CG4 A;  1QBJ A;  2HYG D;  3KP6 A;  5H20 A;  1O3R A;  1SD5 A;  2F5E A;  2NS0 A;  1LNW A;  5D5V B;  1G3S A;  5DUK A;  2FNA A;  1Z6T A;  1T2K A;  1I27 A;  3F8B A;  5E20 A;  1SMY F;  4YFX F;  3DPT A;  2FU4 A;  5JFR A;  2UXX A;  3KP3 A;  1JXS A;  3LA3 A;  2OU2 A;  4Q4Z F;  2E7W A;  3EYY A;  4XLP F;  2P8T A;  2EA2 A;  4ESF A;  2LKP A;  3FWE A;  1P4A A;  4IPA A;  2EFP A;  3CUQ B;  2QVO A;  3FXQ A;  3GLX A;  2DK8 A;  4XLN F;  1A04 A;  4IXA A;  1HW1 A;  3PFI A;  3U9G A;  4CIC A;  4YFK F;  2Z5U A;  1EH7 A;  4BAY A;  2QQA A;  1XSD A;  1YS7 A;  4LFU A;  1BI1 A;  2PQ8 A;  1C0W A;  4IRG A;  3HOS A;  1SD4 A;  4JQF A;  3TQN A;  4WCG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...