2PFGA

Crystal structure of human cbr1 in complex with bigf2.
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
273
structure length
272
Chain Sequence
IHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbonyl reductase [NADPH] 1
publication title Glutathione traps formaldehyde by formation of a bicyclo[4.4.1]undecane adduct.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 103
structure length 272
sequence length 273
ec nomenclature ec 1.1.1.184: Carbonyl reductase (NADPH).
pdb deposition date 2007-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2pfgA00
3BTVA 3NEPX 3PHIA 2J6IA 5I7SA 1EDZA 4A73A 3NTOA 1TB4A 2X86A 4CMGA 1UXGA 4IDBA 5JFOA 3GRPA 1E3EA 1GR0A 3BTUA 4LMPA 4JNKA 4NJMB 4BGIA 4J4HA 1NBOA 1KVQA 1DOHA 1LC0A 3PTZA 1A71A 1BVRA 4YAIA 1ZJYA 3C85A 4R41A 4J2OA 4MVJI 3GEDA 4E31A 4KWHA 3DOOA 3CINA 3KBOA 4B3JA 4E13A 3ZZNA 3GK3A 4KUEA 3ONEA 2JFHA 2PGLA 1R15A 3LC7O 3M2PA 4RF3A 4BO0A 3F9IA 1MB4A 2X9VA 3NDIA 5I9MA 1ONPA 4Z0HO 1NWHA 4L4RA 1K6XA 2D0IA 3LDHA 3HDJA 1T24A 3N7UA 4NG5A 3IUSA 4JXKA 1MXFA 3ZHYA 4BO8A 2P5YA 1K6JA 2HMUA 1YQDA 2A92A 3IC5A 4FJ2A 4OAQA 4K28A 3HN7A 3ANMA 4GMGA 4U6SA 2EKLA 2WM3A 1M66A 2YZ7A 2GDZA 5TJHA 4IS2A 5DN9A 1LDYA 2G76A 2EERA 1OOEA 3EK2A 5HBRA 1CIVA 4U5QA 2GERA 3U9LA 1XSEA 2YQ4A 2NV6A 3PIIA 3QVOA 3DXFA 4MP3A 5IF3A 5KVVA 5L4SA 2J5KA 1TEHA 1E7MA 4NU5A 1D1SA 1QP8A 3UUWA 4OIMA 5EN4A 3ZW9A 3GDOA 3IP1A 1JKIA 1J0XO 1GY8A 4UVDA 5I8ZA 4YJFB 3U5TA 2FPIA 4W7HA 4F45A 3PHHA 4F3YA 4E6PA 3VKUA 2I3GA 2VT2A 2PK3A 2RHRA 5U1PA 4D46A 4YWJA 5L4LA 4KTVE 3L6OO 4ZHSA 3GZNA 4MKZA 3GHYA 2GLXA 1LTHR 4IQ0A 2GYYA 1LEHA 3JQFA 1SEPA 2CZCA 4MDHA 3ASUA 3DBLA 2VZ8A 4R1SA 3MZ0A 3R0IA 2YDXA 3DOCA 4TQGA 1PSDA 3WGOA 4E5PA 4WKGA 3JYLA 4DPMA 2HK9A 1B3BA 2OFPA 3QSGA 1IOLA 1NR1A 1YGYA 2OMEA 3FNFA 4MVJH 1P1RA 2E49A 3ADOA 1WLYA 4IPTA 2P9GA 4Z3KA 1FF9A 3RU9A 1R4MA 3S8MA 4IMPA 2YHIA 4I5GA 5C37A 3KYDB 3INGA 3JQDA 4HFMA 4JCOA 3JQ9C 7MDHA 4QO7A 3A06A 3HFSA 3CH6A 1PEDA 1PS0A 4RVDA 3JYNA 2C59A 3SX2A 1GU7A 4RLSA 3E9QA 1DDOA 1HDOA 1MC4A 4J16A 3IKTA 1XU7A 4I9HA 3DFUA 2B0JA 1WW8A 1PZFA 3A14A 1O8CA 1GFSA 2E6UX 4WNIA 5KKAA 1WZEA 4OOEA 5EESA 4LCJA 1ENYA 2G17A 4NI5A 3WDSA 3V2GA 5MGBA 3ZNNA 1ULUA 1ISIA 1HE5A 4YXFA 5G2OA 3AI2A 4YDRA 2IXBA 4YPOA 5ER6A 5CPBA 3T7CA 5DP1A 1GPDG 2ZQYA 3BAZA 4GAEA 3L6DA 3U09A 5GMOA 3FHLA 1ZK0A 4KOAA 3RBXA 5LDGA 1VJTA 4DBVO 1QXSA 5CEJA 4FBGA 1B16A 4FGSA 4E21A 3TRIA 3WWYA 2DBQA 4M1QA 1WDLA 2ET6A 1ZK1A 4DC1A 4EITA 1UZMA 3FPCA 4PN3A 3MOIA 4BMNA 3JQEA 4GGPA 2OZPA 2O23A 4PG5A 4YB8A 1P0FA 2D3TA 1T4BA 1ISJA 1E5LA 3QY9A 4JBHA 3BTSA 5IXSA 1VSVA 1E5QA 5JCJA 2Q1SA 2GPTA 5I7VA 1ULSA 3SEFA 1Z82A 8LDHA 3MWEB 4B7UA 1N7HA 5G4KA 3B1FA 1YRLA 1LBEA 1EBUA 3EC7A 1Q7GA 3PYXA 1QV6A 3RUDA 2FZWA 5TJ9A 4DQVA 1I3NA 1PJSA 3L0DA 1K89A 2O3JA 3OHSX 3F4LA 3GEMA 3ONDA 1YL6A 4X54A 4CLHA 4OXYA 2C20A 2Q1TA 2NVBA 4URFA 5C7IO 1C0IA 2ZTMA 3ITDA 4BNMA 1N8KA 2ZJ0A 5T64A 3CXRA 3KRTA 5BR7A 3OJEA 5IZ4A 3IKVA 1X7DA 2DFDA 2FSVA 4E32A 1LLCA 3T4EA 3FN4A 3E18A 3PQDA 2PZLA 3AWDA 1WP4A 4NDNE 1T2DA 2O50A 4IY1A 3GR6A 4RVHA 3WGTA 2GASA 4EJMA 2VWQA 3RUCA 5IG2A 3RKUA 4GX2A 1N5DA 3LF1A 2JD0A 1FMCA 2AMFA 3D4OA 1HE4A 3LLSA 4P4GA 3V5NA 4CV2A 2Q3EA 2ZYGA 1NFFA 1E92A 1X7GA 5B37A 4XCVA 3S2GA 1M2WA 1ISFA 1YOVA 3GGPA 4AJHA 1DC4A 2G1UA 4J4BA 3TZ6A 1SB8A 1XIVA 2AEFA 3JCZA 4TKLA 1O5IA 4WOKA 4AFNA 3JQ7B 5EERA 4XYGA 2ZJ1A 3RROA 2ZIZA 5ENVA 3QWBA 4XJTA 2GSDA 1I01A 1M67A 3RBVA 3BMQB 1I24A 4BGUA 2NU7A 4DMMA 1T2FA 2Y93A 4LW8A 3RCBA 1ENOA 1EFLA 1VPDA 1A5ZA 1ZMOA 1LDMA 3DAGA 5AXAA 4DYVA 2W2LA 4KUGA 4XYLA 5IDXA 4TROA 1EMDA 2Z1NA 3KLPX 4ND2A 3PQEA 1I3KA 5T57A 1PX0A 2P9CA 3GLQA 4L4XA 3NAQA 4YYZA 3OH8A 4FS3A 1UDBA 2QRJA 5JY1A 1CEQA 4WOJA 1H6CA 5CHEA 5TQVA 1P0CA 2BRUA 1GZ3A 2G0TA 3ETDA 3WQSB 4E4YA 4XKJA 3KYBA 4UVGA 1P77A 2VHWA 2WE8A 4YCAA 3WR5A 3JQAB 1JKFA 1I2BA 3HSKA 3PIDA 4KWIA 4CM3A 4R51A 3WOHA 5A9SA 4Q3DA 5DCUA 4C4OA 1ID1A 1TXGA 3JQGA 1NHWA 2OXIA 3U0BA 4AJNA 3NTRA 2NM0A 4YJDA 2XXJA 4BNUA 4ALNA 4DREA 4OGWA 3GRKA 3OIGA 3DR3A 4I5FA 3UCEA 5JPIA 2O2YA 4TRRA 4BNTA 1KY4A 4DPKA 1E3WB 3LLVA 3PPIA 1E6EA 3C3XA 1NWCA 1PWXA 4DLAA 3CE6A 1EVZA 1S6YA 3DO5A 3DBHA 1I36A 3PI7A 3GGGA 3PJEA 4M87A 3JQ8B 2A4KA 1Y81A 1U2GA 7ADHA 3B1KA 4GGOA 4BO9A 1ZVMA 3GAFA 1PJ3A 1A7KA 3X2FA 3VH4A 3ZGYA 2P9EA 3FR8A 4Y8VA 4R5MA 1GYPA 3K2EA 2ZTUA 1ENZA 2Q2VA 1T26A 2LDBA 5JO9A 3V2HA 4W9NC 5L3ZA 2HAEA 4LK3A 1YJ8A 5JAZA 1LDGA 3OJFA 1Z6ZA 3C8MA 4ZGWA 4P8RA 2Q1UA 3EUWA 5IDYA 2VYND 4LVCA 3D4PA 3ENNA 4TWRA 1ARZA 3DAPA 5COBA 5AOVA 4CQLB 5L4NA 2WD7A 2BKAA 4JGBA 4S3MA 4E2YA 4S1VA 5DP2A 4Z6KA 2HU2A 3IS3A 4BO2A 4IDFA 2Z95A 2FSSA 5IZCC 3GOHA 1JTVA 4D45A 1R37A 1BSVA 4KDFA 3NUGA 3UKOA 4IZIA 4J0EA 4P22A 1ZFNA 1MFZA 3EZYA 3KM0A 3ZH2A 3GH3A 1Y8RA 2DAPA 2AE2A 4CV1A 1E1LA 2UAGA 4BKOA 1B8UA 5L7YA 1L1FA 1VJ1A 3DBVO 4RL6A 2HSDA 1NQOA 4Q3AA 2PKQO 3MJCA 2H63A 2ZB4A 4RF4A 3TSCA 3U4HA 4HNHA 2G5CA 2AQIA 5GZ1A 3GN2A 4FFOA 3ZWNA 4NBRA 4WNCA 4GPD1 3KZVA 4BUCA 5AXBA 3PWZA 1HT0A 4AJKA 1KERA 2A35A 2D5AA 2DVMA 1P45A 2RCYA 5EPOA 2AQKA 3SXPA 1QSGA 2RIRA 2WYUA 1CQIA 2C7GA 3QHAA 3H4VA 3E6AA 1PJLA 4RPHA 1DAOA 2DQ4A 3UH1A 1Z73A 2HMVA 2VHVA 1HE3A 3ZN2A 1SO8A 2B5WA 2UUOA 4NHEA 2V6GA 3JSAA 4YAEA 3HG7A 4J1TA 4I8XA 3RU7A 2NTNA 3AI1A 3GNSA 1LC3A 2EKQA 1DRVA 1X0VA 3NX4A 5AYVA 4YT4A 4ZJUA 1QYDA 3K8ZA 4YTEA 1EQUA 3UF0A 2JL1A 4TVBA 1P74A 3KYCA 5A03A 4ZRMA 2X0RA 1ZEJA 3DDNA 5C7OO 1SC6A 3OMLA 4TVOA 1LXCA 4XDYA 2IZZA 4ND5A 1I32A 3P7MA 3G3EA 1NR7A 3WYBA 1UJMA 2JD1A 1L7DA 4CODB 2AEJA 3G79A 5DZSA 4WPGA 5AQ1A 5KTKA 4UEOA 1Y8QA 4HWKA 3F5QA 4Z9XA 5G0TA 2PV7A 1AUPA 2IZ0A 1E7QA 2EP7A 1FDTA 4IS3A 1H6AA 3I4FA 3LT2A 1T2CA 1H2BA 2P91A 5ICSA 2Q46A 2Q4BA 3I1JA 4FC7A 5MDHA 3WWZA 1QYXA 2B83A 3HQ4O 4CLOA 1W4ZA 1N1GA 3DQPA 4BNZA 4MO2A 4DXHA 1AHHA 3K9QO 3L4SO 3QP9A 3VH2A 1D1TA 3ROKA 4IQ8A 1UP6A 1HZJA 3AUSA 5KCZA 3C7AA 3IUPA 1YJQA 3FWZA 1A4IA 1DFHA 1HRDA 3GFBA 1VKOA 4CM8B 4E2XA 5K0ZA 1VL0A 1F8GA 4II2A 2B4TO 5A3JA 1T25A 3HE3A 1C1XB 5KJFA 5B4TA 4DGSA 5F21A 4FIZA 1AGNA 1HDZA 3PJDA 1YQXA 4CM9A 4BNNA 3VDQA 4MVJG 3RC2A 4B4OA 4BKUA 1JVSA 1D8AA 4MVJE 1ZJZA 2AG5A 2D2IA 1P3DA 1PZHA 1T2AA 1JQBA 4OO3A 5A5FA 2CNBA 1FK8A 4NBWA 2C2XA 4H7PA 5G0VA 3H2SA 1NYTA 3PLNA 4D0RA 1K6IA 3ZW8A 3VDRA 3HDQA 6ADHA 3UCXA 3HHPA 4OSPA 3BMCB 1PL7A 3PWKA 4PG7A 2HUNA 5TT0A 1ZZEA 2X5JO 4ALMA 1IE3A 2XPCA 4Q39A 4J1NA 3ZHBA 1G0NA 4BNYA 4GH5A 4R16A 4WLUA 2EG9A 3G1TA 4MIOA 4W4TA 3RFXA 1RM5A 4YJHB 2X5OA 2SCUA 5F1KA 3CMCO 3HDHA 3WS7A 1TT5A 4FW8A 4CM4A 3WTCA 1HETA 3OEWA 3KOUA 1NVTA 3BYZA 3M1AA 1E1NA 2J3KA 3NV9A 1XWFA 1PGPA 4XJSA 3WYEA 3HADA 3ZCXA 1GCOA 3ROQA 1HSOA 1QG6A 1LLDA 4FCCA 4K6FA 2YV3A 2JCXA 4A03A 3O26A 4U6QA 5KJCA 2V65A 1GUFA 4BHTA 3KUXA 4BKQA 3WNQA 1B8VA 2BGMA 1KYQA 4PVDA 4HKTA 1U7HA 2QZ9A 1UDCA 3FR7A 4ALLA 3NT5A 3IDSA 4Q3CA 3DMYA 1DRUA 1J5PA 1PZGA 4AJOA 1IYZA 2EHDA 3D3EA 4IGEA 1PQWA 3BXXA 4DLBA 4DA9A 2EIHA 2O7SA 1B15A 2IYOA 1GAEO 2Q49A 1DC3A 2DUWA 1K3TA 4BV9A 2LDXA 1SNYA 4BNIA 3H3FA 3Q3CA 2PKQP 2VNSA 3VZPA 3KV3O 1PL6A 3PLRA 4N5LA 2QQ5A 4C7JA 3OICA 3SC4A 1E3IA 3WLFA 1CQJA 1O9BA 2QIOA 5AVOA 1WNTA 1HTBA 2YFQA 4UEKA 4YACA 2OO5A 1ZBQA 4WLOA 1XGKA 2C5AA 1P1IA 1U2DA 2QG4A 3D3WB 5LDHA 2DKNA 4QFCA 3FTNA 1GUZA 2FPGA 3GNQA 3PHJA 1DFGA 4L74A 1ZK3A 2EP5A 3TL2A 4R1TA 4WCFB 5C7LO 3PDUA 1GZ4A 1DIHA 3ANLA 5BNIA 2CF6A 4RORA 3KVOA 5G0WA 2HCTA 1JU9A 1O89A 1R12A 5DF1A 3NYWA 4E5NA 2BMAA 5JE8A 2VYVD 4CJXA 4RDIA 1PJ2A 1D3AA 4BIIA 4W9NA 3D5QA 4N54A 2BGLA 4Q3BA 3NDRA 4ZQHA 5K6AA 4KDEA 1X0XA 4IDDA 2DPGA 1T1SA 2Q50A 4WK6A 4E0BA 3KEQA 3PGJA 5L40A 1N92A 4EJ6A 3GN1A 3WGIA 1GQYA 1T1RA 3LQFA 4HNGA 4ND1A 3ZWYA 2Q1WA 2NADA 3G49A 1QYCA 1A4UA 4WLNA 3L9XA 2VWPA 3FSRA 3UGKA 5I9NA 1MFPA 2IRWA 1NQAO 3M6IA 1XG5A 5EIOA 5BT9A 3VTZA 5IZCA 3NJ4A 1YB4A 1VJ0A 2A9FA 4EYEA 8ADHA 4NJMA 2WWRA 4PG8A 1MG5A 3KHUA 1O95A 1CDOA 3WQQA 5KNLA 2CD9A 2HMSA 4NNJA 2WMDA 3WG9A 3QIVA 3STHA 2O4UX 3GUCA 4B4WA 3INTA 2R6JA 4FB5A 1MC5A 1G1AA 2NNLD 2YY7A 3E5RA 4CM6A 1GTMA 1HEUA 3PJFA 1B8PA 1ADCA 2PZJA 1BXGB 3KTDA 4CM1A 4U7WA 4L8VA 4QTZA 4DQXA 2RHCA 3GMDA 4CQMB 3F46A 1PWZA 4RGBA 1ADFA 1C14A 1ISHA 5JW6A 3OJOA 3ONFA 4MKRA 2ZATA 4KQWA 1N1EA 2PA3A 4MKXA 5KIAA 3UFXA 1P31A 3ZU4A 2Q2WA 4O59O 1V3VA 4JJFA 4DQUA 4FJ1A 3EHEA 4CM5A 3COSA 4LCEA 2FR1A 1P1KA 1XU9A 2UDPA 4JP2A 5BSFA 2XF8A 2C29D 2VYVA 3VPFA 4EW6A 2B35A 3DBRA 4ALJA 5COQA 5GZ3A 2X8LA 3H5NA 5HA5A 1Y9AA 1T2EA 2WE7A 4GVXA 1XEAA 2EF1A 3IL2A 3GZNB 1V3UA 2DC1A 2DBZA 1F14A 1H6DA 3PDJA 4YRAA 4E12A 1JW9B 4XGKA 3GAZA 4BNFA 1YBMA 1P9LA 3WSWA 2Y0EA 5JCJD 1R4NA 4HFRA 3OETA 4F6LA 3OQ6A 4Z9YA 5T5QA 3FTPA 1RYDA 4OXNA 3D1LA 3OSUA 1VRWA 4RDHA 3VPSA 3RD5A 3OQ1A 2NUAA 3CSDA 3FNHA 3NT4A 1E7YA 3P19A 4TZTA 1EE2A 2I76A 4J7XA 3DMTC 1F8FA 1T4DA 4D3DA 4JP3A 4ZN6A 2B4RO 3DFZA 5FFFA 1PS9A 4LRTB 1H2HA 5A06A 3V8BA 3GDFA 2DT5A 4BO6A 5TRTA 4IZHA 3DEYX 3NJ8A 3FD8A 4BNLA 3DTYA 2IODA 3D64A 3P2OA 4YEDA 4DL9A 3JD4A 3IAHA 4ZU3A 5EQDA 4NBTA 2Y1FA 4OQZA 2VZ0A 3ZV5A 3AU8A 1PGNA 3JQBA 4CL3A 3RFTA 5IAAA 3E48A 3E82A 1HYEA 2ZYDA 4GLLA 4WGGA 2JCVA 4EUEA 4O63O 4B3IA 3F3SA 1X1EA 5ES3A 3E9MA 4I9UA 4FPXA 5ADHA 1RJWA 2C2YA 4OKIA 2X5KO 2B5VA 4QUKA 2GZ1A 4M89A 3GQVA 4R9RA 1NVMB 1TT7A 3VTFA 2C07A 1ISGA 1BVUA 3UOGA 3BMNA 2B37A 3BHMA 1N9GB 1BW9A 5ILOA 5EINA 1PU2A 2O3TA 3QVWA 3H5RA 1RM4A 2PFGA 4FN4A 4E5YA 3BMOB 4AG3A 2Y0DA 3QQPA 1DIGA 1LU9A 4MP8A 4OOFA 3NGLA 3OFSA 2EXXA 1MX3A 3UXYA 2AXQA 3GDGA 1E3LA 1MV8A 3F1KA 2WJPA 2BHLA 2ZYAA 3Q11A 1HL3A 3K92A 4J91A 1U1IA 3TOZA 3ZV6A 4CMAA 3RAJA 4K1LA 2W2LD 2EJVA 2VCYA 1IULA 3X2EA 4EEXA 1FJHA 1ZW1A 2GUGA 1YE3A 3D7LA 4QX6A 4EDFA 4EUHA 4DTIA 5KVSA 5U9CA 1EBFA 5H81A 2YFHA 1U9JA 4OH1A 5AXDA 1N7GA 5JAMA 1LSSA 4KP7A 1DFIA 2PGDA 4GSKA 4O5OA 1S7CA 1HLPA 4B4UA 2D5CA 3ZWXA 1SOVA 1Q1NA 4D43A 2PH5A 2EW2A 5TT1A 4CV3A 3PRJA 1XQ1A 3AK4A 4PLVA 2R2GA 3ROMA 3ZWPA 4DRYA 2QRLA 3DZGA 3AY7A 3JTMA 1J4AA 4NFSA 4PG4A 1X13A 4GX1A 5JDIC 3KSDO 3DOJA 1W0CA 4BB5A 1DHTA 4JROA 1X1TA 3L77A 3ZWCA 1O94A 1UXKA 4WLFA 3INRA 4E5MA 1KEPA 3RFVA 3E5MA 2PR2A 1UR5A 4DIBA 5JYEA 3GVPA 5B12A 3DZIA 1X15A 1BDMA 2ZQZA 2E37A 1P44A 1PR3A 2UV8A 4FFLA 4DYDA 4B3HA 2W90A 1LRLA 2BF7A 1KBZA 4RVSA 1DLIA 2NU6A 1PQUA 1PJBA 2GN9A 2QYSA 4B4VA 4FGWA 1JLLA 3PEFA 5CG2A 1YOVB 2IEDA 2I99A 1ZNQO 1YB5A 2PKRA 2O3RA 3E1KA 1DAPA 4UEJA 3G0OA 4ALKA 2VUSA 1BMDA 4H3VA 2VWHA 4MINA 1U3VA 3QA9A 4RJTA 4A7PA 4Z9FA 4FFNA 4FJ0A 4MJLA 4AJEA 5TLSA 2YV2A 3CZRA 3PYLA 4XB2A 2GNAA 3AM5A 5DCYA 1BRMA 4NFHA 4TRMA 4PLGA 3ADPA 4JBIA 4CPDA 1TI7A 4IJUA 1JDJA 4CUKA 2Y1CA 1KEVA 1QLHA 2GZ3A 4AJPA 2DM6A 4HXYA 4INAA 1M75A 2CDBA 4CLRA 4QEDA 4BQPA 1BDBA 2Y05A 3BMQA 3A28A 3NRCA 4RQTA 5U4QA 3O8QB 1V35A 1Y9EA 1HDGO 3V2UA 3QE3A 2GN6A 1B14A 3I3OA 5A9SB 1DB3A 3JQGB 4QT0A 3DZKA 1CF2O 3LU1A 1V6AA 4CLDA 2B69A 3I9KA 3GG2A 4IJWA 1EZ4A 5T67A 3C1AA 1DEHA 2XOXA 5LC1A 4J9VA 5HS6A 1KOLA 2VTEA 4M86A 4UUMA 6LDHA 3I9MA 1YDEA 1KETA 3TDKA 3DBHB 4Y67A 2BFPA 2Y0CA 2PNFA 3AY3A 4FFPA 3JD3A 2NVUA 3OF2A 4XDZA 1ZK2A 4Q9NA 4JIGA 3AI3A 3ZWAA 3I4CA 4NR0A 4WE3A 4G81A 2NQ8A 3JYQA 3IMFA 3ZWBA 2GZ2A 3QW2A 4WLVA 5L45A 2JHGA 4XRGA 1XHLA 1HF3A 1E3WA 1NAIA 5DBFA 3RUEA 2Y1DA 4IDCA 2Z1MA 1ENPA 5KJ1A 5B1YA 5K6AC 4WCFC 1AN9A 2PY6A 3ZHZA 4D44A 1CYDA 3JYPA 3ZWWA 3JQ8A 3OQBA 1E0DA 3ETEA 3R1IA 3W4KA 4K9DA 4XIYA 3QWFA 4QXMA 2GN4A 2W98A 4BMSA 2WD7B 4XGNA 2GGSA 2HK8A 4LGVA 3WQRA 2VRCD 3GVHA 1NQTA 1PJ4A 2CSUA 3K73O 3EGOA 5FWNA 5ITWA 4FQ8A 4Y98A 4KZPA 3E03A 1MGOA 3WSVA 1MUUA 3H9QA 3K96A 1YBVA 4XR9A 1OC2A 2VT3A 4OYRA 4FD3A 4O1MA 3DHEA 4WUVA 2J3JA 1GZ6A 4YJGA 3Q2KA 4D41A 4QQRA 3TZQA 4D79A 4G2NA 5JDCC 4AVYA 5B4UA 4PLZA 3WYCA 1YB1A 1M6HA 1MXHA 2XAAA 2IYPA 1UXJA 4CLXA 1HSZA 4JK3A 1D7OA 3I9OA 4BB6A 1OBFO 1B3RA 3LVFO 5T8KC 3RC1A 5F1PA 2NSDA 3HUDA 4PLYA 3AUTA 2HO5A 3CMMA 3A9WA 1WVGA 1XYGA 4HY3A 1VSUA 4J6FA 4MVJA 4BL5A 2HRZA 1NM5A 4NIMA 4CM9D 1PJQA 4B7XA 5A3VA 4E5KA 5L53A 3DMTA 1WPQA 3H6KA 1DO8A 4EBFA 3MTJA 3Q0EA 1ZKMA 1Y5RA 2IE0A 3GA0A 3ZHXA 4J1QA 4K6CA 4M8SA 1RM0A 2Y99A 3A4VA 5TX7A 5IDWA 3FBGA 4YBZA 1A9YA 4I5DA 4R9SA 5JC8A 3B6ZA 3PFFA 4RVGA 4ESOA 4D0SA 1QRRA 5I8WA 2E48A 2DLDA 1LLUA 4J2HA 3JQ6A 3K30A 3TFQA 3WGQA 1I0ZA 4UVEA 4E30A 4L0QA 4B8WA 5JNLA 2DTEA 4JX8A 2GCGA 3C1OA 4WEOA 3KYCB 3RUIA 4DIOA 5JCXA 3P2YA 2AG8A 3WGYA 1H0KA 4NZ9A 3AOEA 4L75A 2BFOA 2BD0A 4B7CA 1EVIA 3TFOA 1U28A 4F6CA 1G0OA 5DDIP 3LC2O 1P33A 1BXZA 3MOGA 4I9NA 4Q3EA 3EAGA 3IJPA 1KIFA 2GO1A 2HQ1A 1UZLA 3W8EA 1C3VA 1Y8QB 2X7HA 3T7EA 1WMAA 2P4HX 4FFRA 1LDEA 2OBNA 4WEQA 1SAYA 4D42A 4IUYA 1HXHA 4BNGA 2D59A 1EK5A 1UP4A 2VRCA 4D3SA 5BNTA 1HDCA 2O3UA 1H9AA 4NK5A 1DC6A 1C1DA 1JVBA 1P1JA 3DZBA 1SBYA 2VHXA 3HB5X 4I5EA 2VHYA 4MPDA 3WTBA 1ZXBA 4CLOB 3QVSA 5F1OA 5JYDA 4UUPA 3H7AA 3LC1O 1HE2A 1GUYA 4BKRA 2P5UA 4MIYA 4Y6SA 2V7PA 3IIEA 3RI3A 3OIDA 1V0JA 4TRJA 2UVDA 4R5HA 1ZSVA 3WBBA 2DFVA 3I6QA 3ZWOA 1DSSG 3ZDFA 1I2CA 4HBGA 1EDOA 2EEZA 4MOWA 3CUKA 1B26A 1UUFA 4KMSA 2W2KA 1R0SA 1LI4A 2HJRA 3TZKA 1OAAA 2VQ3A 3JQBC 1Q2XA 1LJ8A 4M55A 4ILKA 1U4OA 1I3MA 5FYDA 2Q45A 1ISMA 1ADBA 4CLEA 4YRBA 3HJAA 3DONA 3GGOA 3MJSA 4JJGA 4J7UA 1G6KA 1KS9A 3JYOA 4BNXA 3PHLA 4NK4A 1OC4A 1I2ZA 4KUHA 4P4NA 1FDVA 3ZNOA 3GVCA 2PD4A 2ZB7A 3DZJA 2NTVA 3MWDB 4NPCA 2PTGA 1I30A 2C82A 3ICPA 5CDGA 1W6UA 4II3A 5CFZA 4CMHA 3QWIA 4CM8A 5JDIA 3LT1A 3TNLA 4FDAA 4TZKA 5C3MA 4R54A 1HLDA 1Z75A 4DLLA 2I66A 2JAPA 1IPEA 1H9BA 3PWSA 5THQA 2BFAA 5DOZA 3UAGA 3RC7A 3RWBA 4F46A 1PQPA 2QZZA 4XIJA 4GWKA 1U8FO 1WAMA 1XLTA 2J3HA 2XXBA 1BXKA 3PZRA 1OFGA 3I6IA 3LZ6A 4MVJF 5TNXA 4QECA 4YT8A 2I5PO 2YV1A 4Y9DA 2QYTA 5JO0A 3PVZA 3UN1A 4R3NA 4BO4A 1LSJA 1DRWA 2PZMA 5KVQA 5CG1A 2YHUA 4JBGA 1A72A 3BMCA 5HRUA 3WMWA 1MA0A 1NQ5A 1NAHA 3F47A 4AJ1A 2GD1O 1GDHA 4ZQBA 2YQ5A 1IB6A 4P4LA 3I9LA 1B7GO 4YJHA 1NASA 1FXSA 2O3QA 3EZLA 2GRAA 3KLMX 3VKVA 4JQCA 3ASVA 4RPLA 4CR8A 4DMLA 1JWAB 2BH9A 4OM8A 3FF4A 4P38A 4BV8A 4XGIA 3OM9A 1R0KA 5DULA 1YDWA 4A5OA 3SVTA 3WICA 4G5HA 4JN6B 2E82A 3PHGA 3SC6A 2HK7A 4NBVA 1NFRA 3WJAA 4CV0A 5ICMA 4R01A 2EJWA 4ZQFA 1CETA 2CDAA 3H65A 4RPJA 5DCWA 3VPXA 1ZK4A 5JXWA 2PD3A 1SEVA 5F5NA 1YVEI 3DHNA 1HZZA 3VVCA 1YWGO 3PP8A 1JA9A 1DIAA 5A04A 1IY8A 4BO1A 4XB1A 1MLDA 3LK7A 1NP3A 3JD2A 2HLPA 4L73A 4IQGA 2EKPA 2F1KA 1E77A 4TSKA 3ZWVA 3KXDA 3F1LA 1MG0A 3Q2IA 3RJ5A 4NMHA 1UZNA 2DPHA 1YL7A 4N18A 4RF2A 3WIDA 4YAKA 5IFLA 4H15A 3ZU3A 1ZH8A 1E7RA 2W4QA 5L51A 5KWEA 4PG6A 2V6BA 4PLHA 3F4BA 4FC6A 3I23A 3GVXA 1QV7A 4W6ZA 5DOVA 3GVIA 4GX0A 1VL8A 1MP0A 4HADA 4XRRA 1SCUA 3VPGA 2NU9A 4A10A 2OP0A 4BO5A 4HFJA 5JAQA 3GFGA 1NPDA 5KVCA 2OGUA 1YQGA 4DUPA 1DPGA 3D4NA 2HMWA 1WMBA 1C0PA 2X0JA 3G17A 4WCFA 3GPIA 4A27A 5HTOA 1A7AA 4Y6PA 1P1FA 4ALIA 3WX0A 2FP4A 3FPLA 3DB2A 4PZDA 4HV4A 3AOGA 5KOIA 4Q3NA 3FI9A 3GY0A 3AJRA 2VRBA 3SJ7A 1HYHA 5C5IA 1HDRA 1V9LA 4CMIA 2DU8A 3V1TC 2JFFA 2X9NA 4AJ2A 4UUOA 3EMKA 1SZJG 4W99A 3TZCA 1I5RA 2JAHA 3VAZA 2DBVO 2CUKA 1YH3A 2DTDA 3D5TA 4GX5A 3O9ZA 4EJ0A 1AXEA 5IN4A 4IDAA 3LT0A 5DBIA 3GMSA 5L9AA 4HUJA 1I10A 3SLGA 3QVXA 3WGHA 3VZRA 1BWSA 1XCBA 4JLWA 3WFJA 4WJZA 5JDCA 1YONA 1CJCA 3NGXA 1NPYA 3ZWMA 3TN7A 2O7QA 2JKVA 1ONOA 4M49A 1SPXA 5JLAA 3UCFA 4ZD6A 4WCDA 1DXYA 4UVHA 5T8KA 3W6ZA 4BNKA 4TRNA 2CMDA 3WGGA 1LRJA 1K2WA 4EI2A 1D4FA 1H94A 4M54A 1WXDA 1R6DA 1Y1PA 4L76A 3ITKA 1WWKA 2ILTA 4CMEC 4ZVVA 4PZEA 4PLWA 4OXKA 4BKPA 4CL8A 2HMTA 2O3SA 2QX7A 4O6VA 4OJNA 3RBZA 3UICA 4FOOA 1PIWA 1YS4A 1PL8A 1BXGA 5CAEA 2ZB3A 1LDNA 4L4SA 3VH1A 3EVNA 4DIFA 4R4JA 1EEHA 4XYEA 4XQ9A 4AICA 4D7AA 1M76A 5CDTA 3QWAA 4CQMA 5CDYA 1VKNA 4GL4A 3ORFA 1BG6A 3DBRB 4YVFA 2W8ZA 3NT2A 1DJNA 1EUZA 4GVLA 4PLCA 1BHSA 4A2CA 2H9IA 3GZ4A 3Q9UA 3G1UA 3L4BA 4J3FA 4UULA 1EQ2A 1F06A 1I33A 3AFNA 2CY0A 1QKIA 4OQYA 3AFMA 3DBLB 3B70A 3RKRA 3S2EA 4YJFA 2J5RA 4ZRNA 1R4NB 2JCYA 1E6WA 2O4CA 3QWHA 3AY6A 3OA2A 2VTDA 4XYMA 1QYWA 1Z74A 1PJCA 3I52A 1Q0QA 4CUJA 3HDYA 5TIIA 5JMPA 4IXTA 2VOEA 1A9ZA 5A1TA 1F12A 1H93A 1XR3A 2C54A 3DHYA 4QSMA 1R4MB 2CFCA 4IINA 5BSGA 2YHIB 4AJJA 4RQUA 1Y5MA 5TGDA 4IGFA 4IIUA 5B4VA 2BGKA 5LCXA 3RSHA 3W1VA 3F6YA 4L9RA 4YQZA 2X9GA 3OBBA 4O0LA 3C7CB 3CEAA 1PGQA 2NLOA 2ZCVA 3V1UA 2PGJA 3ZNPA 4CR6A 5H82A 1E7SA 2C5EA 1LQUA 1U5CA 3H9JA 2RBEA 1VLLA 2YUTA 2I9PA 3AOEC 5AXCA 3KYDA 1PS8A 3T4XA 4RV9A 4UAGA 2ZCUA 1ORRA 5ENDA 1FDWA 2POQX 2NQTA 1NTOA 1YXMA 2VZ9A 1E1KA 1KEWA 4DC0A 4EZBA 3WFIA 3GG9A 4NU6A 5CPFA 3BMNB 1OI7A 3VC7A 1BW9B 3JV7A 2QW8A 1YBAA 3DZHA 4BQRA 4GMFA 2A94A 1DLJA 3MJTA 4XQGA 1IHXA 1O0SA 2EV9A 4ITUA 3OA0A 4U0JA 4YT5A 3TQHA 4UUNA 2NU8A 5A5EA 4GKBA 1UAYA 1U3UA 4HFNA 1ML3A 2HDHA 3WGZA 4YAJA 4EEZA 5CP8A 1LNQA 1HDXA 4AJ4A 5HWSA 2VHZA 4J49A 2X4GA 4MVJM 4B8ZA 1N9GA 3H5AA 3OIFA 4IXWA 2WSBA 1Q7BA 2NTJA 2B4QA 3TWOA 1GEEA 1H5QA 3BMOA 4E3ZA 5JMWA 2WTBA 3WMXA 3LSYA 5KJEA 5DBGA 1Z7EA 3C1TA 5EQFA 3RC9A 5HM8A 3U3XA 1K5HA 2EW8A 3QRWA 5F5LA 4EUFA 2FZEA 3ZU2A 3PGXA 5G4KB 3GF4A 1B0AA 1U8XX 3O03A 4BVAA 3QV1A 3HWRA 3CZMA 2OP1A 3MJ4A 1NVGA 3KSZO 5HS4A 1UXIA 2J5QA 5A02A 1VL6A 1M6WA 1DHRA 3ZU5A 3EDMA 3GNTA 3U4DA 5K9ZA 3L6EA 4NQZA 4E33A 1P1HA 3K5PA 3WNVA 3TOXA 4BMVA 2AEMA 4IBOA 2I67A 3EVTA 1CRWG 3AUAA 3KEOA 1YKFA 2FPPA 4PLFA 2Y1GA 3GEGA 3IQDB 4IIVA 3JQAD 4RVFA 4NH4A 1AE1A 3OJLA 1Q0LA 2I6TA 5IN5A 3GUYA 3IJRA 3H2ZA 4CMKA 3MJEA 3FNGA 5FI5A 1QYVA 4ONEA 2FMUA 1LRKA 2OHXA 3M2TA 2O48X 2B36A 1UAGA 3MEQA 4DVJA 1KEUA 3RUFA 3HN2A 3VHRA 1DIBA 2DUUA 3S2IA 3ZV4A 3PQFA 1QORA 4ZQGA 1R0LA 5F3RA 1UP7A 2HJSA 1N2SA 1ZUD1 2IEBA 1KVUA 2YDYA 1TLTA 3KSUA 3DZFA 2I3AA 3E9NA 1Z7BA 1J6UA 4XQCA 3ZI0A 3Q9NA 2R00C 1QMGA 3U4CA 2JHFA 1WDKA 2WEKA 2Y68A 4EGFA 2NACA 3EW7A 1GPJA 4MP6A 2V6FA 2OUIA 3B1JA 3BTOA 4K26A 2WDZA 2RH8A 2FHSA 2VOJA 1F0YA 4J43A 5BNFA 3JQ7A 2X0IA 3FWNA 2EGHA 3P5SA 2FR8A 3CIFA 4N7RA 5FI3A 4D3FA 4CLRB 5I9LA 1JAXA 4N5MA 3VPHA 1NFQA 4BNJA 4LVUA 5GZ6A 1ONNA 5BQFA 3O4RA 4XR4A 4DWVA 2AQ8A 2C0CA 3ROPA 4PZCA 1Q0HA 1NNUA 1WDMA 4IJVA 1U5AA 4MVJD 3U49A 2J8ZA 3I83A 4XD2A 4YA6A 1TVEA 1HKUA 1DC5A 5DT9A 4U8GA 5KKCA 3DC2A 3UVEA 4ND3A 9LDBA 1E3JA 4J1SA 3ST7A 2VNAA 3O8QA 1KC3A 4BGEA 1ZCJA 1FDUA 3FNEA 1QR6A 2TMGA 3JQAA 5I7FA 2NVUB 3ZV3A 4R1UA 2HRBA 5G0UA 5A4DA 1LA2A 1UH5A 1V8BA 2GF2A 4YRDA 4FFMA 3ABIA 2P4QA 4OMUA 4LRSB 1ZXLA 3S55A 3B20A 4LISA 1SB9A 5JSFA 3I9JA 1EVYA 5L7TA 5THKA 3NTQA 3S2FA 3R3SA 5TF4A 4UVIA 2YYYA 4RVUA 4CMCA 4XA8A 4TKMA 4XZ3A 3Q1LA 3GC6A 1XDWA 1LDBA 3W4JA 1LQTA 1PR9A 2WYVA 1QLJA 2E4AA 3V1YA 3W8DA 4HP8A 4N5NA 4CMEA 1I3LA 4OKNA 1OZAA 2H1SA 1XA0A 4GLOA 1W73A 1GQQA 4CM7A 2QHXA 3ETGA 2X22A 3BHJA 3VH3A 2TMDA 2D1YA 1GQ2A 3PK0A 2OOSA 3WXBA 2NWQA 1RYEA 1Y6JA 3HNPA 1BTOA 4R69A 4BO7A 3IOYA 4AL4A 3U4IA 3AM3A 1SMKA 1NHGA 1GCUA 1KVSA 5G4LA 3O38A 3FCOA 3RASA 3VVBA 3GHHA 4BO3A 3HB4X 4PLPA 1C0LA 2VWGA 1U3TA 1YL5A 2X23A 3BHIA 4BNVA 2D4AA 1DBVO 2CF5A 4FR5A 4MIEA 4YJGB 3H9GA 3DAFA 5A05A 1Y8RB 1LUAA 4PFJA 3RVDA 3Q6IA 4CQLA 4WASA 3LT4A 4ROSA 3SJUA 1JN0A 5FEUA 4OL9A 4DBZA 1KY5A 4H16A 4NJOA 4LMRA 1LX6A 2ZK7A 4E2ZA 5EJ2A 3JD0A 1JAYA 4LSMA 2QRKA 4XYBA 3PYMA 2PWZA 4A26A 5ER9A 2EGGA 5CDSA 2UUPA 3AM4A 4U0KA 3RUAA 5IJZA 2WYWA 1GV1A 1EUCA 1RPNA 1WZIA 3WIEA 4BNHA 4HX5A 1EFKA 1CWUA 3PZBA 5FF9A 1RM3A 3SLKA 1DIRA 1VC2A 3OEYA 3ANNA 2CDCA 3TZHA 3MCVA 4J7CA 2Q2QA 1Z45A 5L95A 5BSEA 2OORA 3BA1A 4ID9A 5EL0A 5CDUA 2BI7A 5IDQA 1EE9A 3UHAA 2GR9A 4RZIA 1R16A 3TPCA 4LSWA 3L9WA 2F00A 4R3WA 3MJVA 3QVTA 1U4SA 2YJZA 4J9UE 4J4TA 4ZA2A 4IM7A 5G0SA 4GI2A 1NXQA 2PZKA 4LN1A 5KJ6A 1E3SA 1E1MA 3DTTA 1XQ6A 2IZ1A 2P68A 4ZICA 3GT0A 3JQ9A 2AW5A 1GL3A 3LF2A 1IZ9A 3L4BC 4NBUA 3TF5A 2Y66A 1RWBA 2DTXA 3R3JA 1ZSYA 2PLAA 5CEEA 2WD8A 4PIVA 4RCVA 4RO0A 2G82A 4MVJP 3PFWO 1EK6A 3RQSA 4JJIA 4Z0PA 3DWFA 2PH3A 3HZZA 4KQXA 4CUZA 2IXAA 4RLHA 1C1DB 1I8TA 1VI2A 4XWYA 5JAIA 4PGFA 3VOSA 5ITVA 2VYNA 4OSOA 1ADGA 1E6UA 4BNWA 3M1LA 3OP4A 3JQFC 3RIHA 1GV0A 4OHUA 3BIOA 1NPTO 1X14A 2CVOA 4RPGA 3H8VA 4IDEA 3EYWA 1HYGA 2ZB8A 1XELA 4NFYA 4W82A 4BOYA 4PLTA 1Y7TA 2H6EA 2X58A 2FN7A 2FRDA 1ZSNA 2W2KB 2X0NA 1L7EA 1PJTA 3C24A 4R68A 5DNAA 5T6BA 2AQHA 2FWMX 2BELA 2FR0A 5ILGA 4QO8A 1C0KA 1RKXA 2BI8A 4PRLA 4DPLA 2OBYA 2EWMA 3VZSA 3PXXA 3D0OA 3LYLA 4Y6RA 4C7KA 4IJKA 4CMBA 4CR7A 1PGOA 1TA4A 1U3WA 1JWBB 3KETA 3RUHA 3ON5A 1PZEA 2Q99A 2ZTVA 5GY7A 3L07A 3BZUA 2HKIA 2PD6A 3U62A 1C1XA 3I5MA 3H9EO 4IDGA 1GD1O 3CPSA 3VZQA 1VE9A 1ZEMA 4IMRA 4Z3DA 4BS9A 5L7WA 3NKLA 1FDSA 3TJRA 3KO8A 1HWYA 4XEHA 2V6MA 2Z5LA 1GYQA 4W7IA 5IXYA 1PGJA 4WECA 1IL0A 5JC1A 1OMOA 1BGVA 3JD1A 4B79A 1LSUA 1GADO 4ND4A 1ZMTA 3WLEA 1PTJA 2OL4A 3S1LA 3SBOA 4YQYA 5TC4A 1W8DA 3PJGA 1TT5B 2BFMA 4CM4B 5TS3A 1JKJA 3WJ7A 3N74A 1F17A 1B2LA 3AW9A 1R66A 3CKYA 3W4IA 2Y67A 4RZHA 4E2WA 1X7HA 2DBRA 3KB6A 5JY6A 2FOIA 4AJIA 1AXGA 3AUUA 2J3IA 2R00A 2ZTLA 3CTMA 3EY4A 3NDJA 5BSHA 4KTTE 3C7DB 4XQEA 4PCVA 5A9RA 4YAGA 4AJLA 4A0SA 2VUTA 3TL3A 3FRJA 3F5SA 2AE1A 1IHYA 3OJ0A 1LLQA 1EVJA 3N58A 5JBIA 3ZNQA 2RH4A 4PRKA 1DJQA 1EUDA 1LSOA 1UXHA 4UREA 4I1IA 3WBFA 1KC1A 3UW3A 4GSLA 2JJYA 2JD2A 3R6DA 2ZKLA 3JQCA 1E7WA 1H6BA 2IDZA 1AHIA 4PVCA 1GEGA 5J23A 1O6ZA 2VUUA 5JS6A 2AA3A 1ZO8A 1Q7CA 1ZIDA 2O2SA 2I65A 1V3TA 1NX6A 3ICCA 4G65A 9LDTA 2Q4EA 2X1HA 3DL2A 3K2BA 3QJ5A 1KVTA 3H3JA 2AHRA 1SOWA 4YT2A 1CERA 4ZQEA 1IUKA 5I7EA 4CMJA 4GBJA 2CVZA 1K0UA 3H9UA 4J0FA 1U7TA 2Y1EA 2VN8A 4WLEA 3W8FA 2GN8A 3WB9A 1KVRA 3ENKA 2UYYA 3MTGA 3FBTA 3K31A 4I08A 3W6UA 5COAA 1J49A 3GPDG 1UDAA 4RF5A 2NVWA 2H5LA 2C7VA 4QFDA 1YO6A 4XX0A 4CQMD 3D3WA 4GWGA 4TMFA 3I9NA 4Z0TA 2BLLA 1IZ0A 3K6JA 2FY8A 3OECA 2X6TA 4GQAA 3RJ9A 5CEFA 4J90A 3IP3A 2JFGA 5EMHA 3ULKA 3QLJA 4FOSA 4BGVA 1IPFA 2RAFA 2YW9A 1GYRA 1VM6A 2Y1OA 5A9TA 4RPKA 3AU9A 4YR9A 2P2SA 3A1NA 4R1NA 4FSHA 2D8AA 4CMIB 1HDYA 1XKQA 4GKVA 1A27A 2CVQA 5H83A 5TSDA 3E8XA 3HFGA
chains in the Genus database with same CATH superfamily
3BTVA 2FN3A 4OATA 5BVGB 4M1KA 5CNJA 3SG0A 4DHEA 3LFUA 4YFVA 3VR6A 1GKIA 5EQTA 2NUTB 4O4IB 4DUGA 2QRPA 1BN7A 1SG0A 3LNTA 2GN2A 3DMRA 2Q7OE 2W6OA 3OC0A 4OFZA 1Z26A 4CMGA 5BWNA 1VE3A 2BRUC 2UXBB 2OBMA 3IP9A 4OUDA 5D3MA 3SF8A 1GR0A 1IRXA 4LMPA 4JNKA 4EGSA 3KWMA 4TXLA 3WBKA 1D6MA 4KQKA 2Z6VA 3HVJA 3R7WA 5ICGA 2KYRA 1KVQA 3IVXA 3K9LA 3L7NA 3AM1A 4KSCA 1BVRA 5LXTB 1Z17A 1M73E 1J8MF 3GRUA 1Y6FA 3ENVA 2WUGA 2P9QA 3GEDA 5FO0A 3BSYA 3OX1A 4WZAE 4BTVA 1Z5UA 2ZWIA 1MO6A 1FYWA 3S8EA 1TVKA 2JFHA 2PGLA 3M2PA 5EWJB 5FTLA 4PYKA 3IIIA 1MB4A 4MS4A 5I9MA 4Z0HO 3WISA 4D4IA 3P20A 1NWHA 4Q3LA 4TTQA 1BFDA 5CT4A 3SQOA 3ETNA 3L7IA 4L4RA 4MRPA 4NYIR 4ZYTA 1TK3A 4PYQA 1VKHA 2G7ZA 2D0IA 2KW5A 3EQ9A 3C3KA 4IKOA 5CJJA 1EXDA 3HDJA 3N7UA 4MKFA 2MMCA 2NMVA 4BO8A 3ZHYA 4RHTA 4AY2A 2O8CA 4KX5A 4DS3A 2P5YA 3QX9A 5AVVA 1RE1A 1T6YA 3OY7A 2EQ5A 2H3HA 4K3UA 1Y3CE 2A92A 2OXFA 5GWXA 3EIOA 1Z06A 1YR7A 3IC5A 3NAZA 3M3HA 3TTXA 1QJCA 1SD1A 1XVLA 2FSGA 3OFKA 1CS0B 4CQJA 1ZQ1A 2BY4A 1EFRD 2H2WA 1LZKA 3P94A 3QX7A 5F5XA 2ZUWA 1RLJA 2WM3A 1M2NA 4ODIA 3I30X 2GDZA 5EJGA 2HRRA 3U48A 1VLJA 4IS2A 5M2QA 1N5MA 3EK2A 1SXGA 4GR4A 5HBRA 2I71A 4QXOA 1WULS 2YN4A 5DXFA 1AM4D 5PGMA 2ZAGA 5IT9A 2GERA 4PTZA 4RBNA 1Y6QA 3AETB 1G2PA 1VPLA 1ZRSA 2AUMA 5KVVA 1LS1A 4KMOA 1AVTA 4BZWA 4LI3X 2GCOA 1IN4A 5TARA 2A0WA 2X7XA 4NU5A 4OHBA 1E2QA 4QBFA 2R7MA 1T5DX 4ENVA 4PAWA 1V7ZA 5AOBA 3AUJB 5EN4A 2ZIFA 3GDOA 5IAOA 1J0XO 3AHGA 3CCFA 4KL8S 1XTUA 4BMDA 3GJTA 4AWBA 1FYFA 2FVYA 3FMOB 4HX9A 3WK5A 2AZDA 2NXCA 2AX3A 4F45A 3PHHA 1SK8A 3R7NA 4E6PA 4Y0NA 3VKUA 1V7CA 2I3GA 3DYBA 1MR3F 1PT7A 5FOTA 2BEWB 4MKGA 4TWBA 5L4LA 1CYEA 5GVRA 3T7AA 4NYIQ 4ND8B 4ZHSA 3QUAA 3PKIA 4I50A 2P9BA 5AVJA 3GZNA 5CNIA 4L9AA 4S24A 4AN4A 4EQ6B 4F2WA 4OU5A 4YGXB 5EE0A 5FAKA 1LEHA 1M1UA 2OENG 3IQHX 3QFTA 4JI3B 2CZCA 1IK4A 3ASUA 4R1SA 2I4LA 3K8YA 3MZ0A 3R0IA 4UM8B 3OIUA 2QT1A 3F90A 1ZWLA 3MWFA 2BEUA 3KTFA 5K3OA 5HQ3B 1L4FA 3D7RA 4FGKA 5AI5A 2PL1A 2VT6A 3OF5A 1ONBA 1AV6A 2XIQA 1B3BA 1ZC3A 5DTEA 4EA7A 2OXEA 5AT1A 5LBIA 2D1TA 3WKCA 4HB4A 1IOLA 1SRRA 4BE4A 2EZ4A 1OX5A 1K4KA 2COEA 2YUIA 4G4SO 4IPTA 3CB2A 3WRYC 4BLOA 2G9QA 5C37A 3NBZC 4D0LB 2BIFA 3HR4A 1USGA 3INGA 1XRPA 3JQDA 3OZBA 2JZNA 4JCOA 4LOAA 4M9ZA 1NULA 3IUQA 2Z9DA 4GF5A 4QELA 7MDHA 3HM9A 3A06A 4PC7A 3CH6A 3FAKA 5I5GA 4KXYA 3MC1A 2JIPA 5KYUB 4G0VA 3B82A 4JU8A 4H7IA 2VK8A 4BPBA 3H9CA 2WM2A 4Y2RA 4J16A 3TZEA 4D6XA 1XU7A 3K0AB 4I9HA 4LNUA 4HXEB 4L4YA 4EELA 3OFND 1LBQA 4G5SA 2DHDA 4FQ7A 4UTRA 3A14A 4KBGA 4MV1A 3MAJA 4WNIA 1FUKA 5B3JC 1T5HX 1WZEA 4JJKA 1E61A 3EBOA 2B7BA 5J3JA 4LCJA 1EYZA 4EHKA 1SUSA 2YMLA 1T6ZA 4NI5A 3N8GA 4IXNA 5JJBA 3V2GA 2AIRA 3GYBA 1DU4A 2QWXA 3KZMA 1ULUA 2VPTA 3ZNNA 1ISIA 3QVLA 5LQSA 2CB0A 1HDEA 2FQ1A 2H54A 3GI1A 4YXFA 5BSWA 4WBXC 4B74A 4HNTA 5DNVA 3NIFB 3SBEA 4F8JA 2HBQA 1B6GA 3DYIA 3QZUA 5CPBA 5DP1A 3DNMA 1GPDG 3KT6A 4P4UA 4KR6A 4J2TA 4MUJA 3BAZA 4GAEA 3ZWKA 4EMBA 5LZ2A 2EG5A 4X6LA 4XSVA 3FNIA 4R2MA 1VJTA 3CPEA 4O2RA 4DBVO 5CEJA 1U5BB 3GWGA 2JFOA 4FGSA 1JZSA 1Z4IA 3MT8A 2DBQA 2REXB 3CZ4A 3ZD6A 2ET6A 2QAGA 1ZK1A 3KR0A 3NHKA 1JX6A 3CWQA 1M6VB 3FJYA 3HKBA 3MOIA 1MPTA 1IH8A 1R74A 5TR9A 1TTTA 5F4BA 2KM1A 5KZMB 3N2EA 4YB8A 4G5XA 1T4BA 3CKKA 2JGAA 3LHSA 1ISJA 4RD0A 1CBUA 4OXIA 4NENA 5CVUA 3WHIA 5ALWA 1EVEA 1T0UA 2WK1A 2XNHA 3BTSA 1DBIA 1Z0ZA 4KE9A 5EUMA 5IXSA 5BQPA 5JCJA 1WQ4A 2AMVA 2Q1SA 2YN0A 1TIBA 1IQPA 4L5BA 3TTVA 1ULSA 2PUTA 2WF7A 1Z82A 4JC0A 3DXZA 2AG6A 2DSNA 2WWWA 4Y2UA 1R6VA 4YRGA 1QQ7A 1N7HA 1QO7A 3T41A 4X0EA 5G4KA 2D2FA 3S29A 4AZ0A 5JROA 1LBEA 3IXMA 3PYXA 1EFVB 1QV6A 4DNQA 2Y1WA 2YYSA 5TJ9A 5I3CA 5FLXA 3ABZA 3L49A 4TV9B 3NVDA 5AW5A 3OHSX 3GEMA 1YS7A 1YRQA 4KO3S 1YL6A 2OCDA 4BWVA 4CKEA 1MRNA 2POCA 1PKEA 5C7IO 1COWD 2JFBA 3BG5A 5IM4F 4UAUA 2XIJA 3TW6A 1ZL2A 1K3FA 1M1YB 3WNCA 2GJ4A 4RKEA 3CXRA 2C4NA 2PU5A 5BR7A 1IJKA 1X2BA 3IJ5A 5HDQA 5A4IS 1TJPB 1VHLA 3CLVA 4OP2A 4R2WA 2ZITA 5HMLA 3FCXA 3T4EA 1TPZA 4JOSA 1GKUB 4IGIA 4ZXPA 3L7LA 1E4OA 1MGPA 1RXIA 5E7JA 1BH6A 1QTNA 3OEHD 4HO1X 1VGRA 1T5OA 1YJBA 2HLDA 2VTKA 4BVGA 2F9LA 2VFAA 1VG8A 5JVDB 3RUCA 1DINA 3I6YA 4WESB 1N0UA 3SMVA 5AUPB 3IB6A 3Q7EA 1CZRA 2O1WA 1T3GA 3D4OA 1P8AA 2OMKA 2QRVB 1HE4A 3KHKA 3LLSA 4FHFA 4P4GA 3V5NA 4J94A 1NFFA 4E5SA 3EYAA 5KQMA 5TV2A 1M2WA 1ISFA 2JJ2D 2JRCA 4QLAA 4REQB 3AIKA 5IYZF 5M7EA 2Z09A 4EX7A 1Q7EA 3JCZA 4GZ3A 4RWZA 4RXUA 4JWKA 4WOKA 2G1KA 3JQ7B 2ZUUA 2RKWA 3MLEA 1M0SA 2AGVA 2H52A 2ZJ1A 1Z36A 2VAMA 2ZIZA 4KLAA 3RROA 4BWFB 3FKJA 1I01A 2LUOA 1ZONA 4K6MA 1M67A 4MUMA 4OBEA 4Q21A 2AMJA 1K3UB 1T2FA 2Y93A 3FPBA 1ENOA 4LW8A 1UJ5A 2XMGA 2B3DA 4NNPA 3EH2A 3FMVA 4WI1A 4TQ9A 1XX6A 2ZJ5A 4XYLA 2HQBA 5IDXA 3TI7A 3U9SA 4IDHA 5HTKA 3GPCA 3GLQA 4L4XA 2XDWA 1S8FA 4LECA 3OH8A 3KFVA 4AS3A 3VYVA 1EEXB 3A4TA 1H6CA 3UKDA 3PNBA 5TQVA 4R7ZA 1I2MA 4OHYA 1HO3A 1N6LA 1ZM3A 3UQZA 4B4KA 1YDHA 1VBMA 3D3QA 3TQCA 4LI0A 3WQSB 1U0BB 2GT1A 3O92A 4L3VA 2QUZA 3ZE6A 4A8TA 1R3DA 4UVGA 2QQGA 2P1ZA 3G8DA 2VS1A 4JV5B 4FMCF 5CD9A 1KSFX 3CBQA 3WAGA 2VPZA 1TXGA 3ROXA 2C31A 1MQ9A 4DLPA 2V1UA 4AJNA 2OO5C 4Q19A 3T9AA 4MI3A 3TEJA 3NTRA 2NM0A 6REQB 2ALJA 3K70D 1T9DA 4BNUA 1U2DC 4KNYA 1QGOA 4OGWA 1P0MA 4P3OA 2DHRA 2BFFB 4DPKA 5D00A 4LF7B 2A84A 3PPIA 1OFUA 1PK7A 1YRHA 2QY6A 1S6YA 3R6WA 3PI7A 3DBHA 4Q47A 3KEGA 4XCQA 3U37A 3CY6A 3DUWA 4M87A 4UUAA 4HN4B 4RGVA 1YDGA 1NVAA 5FRDA 3GJ3A 4TYWA 4MRMB 2MT9A 4RL4A 4EFMA 1KTIA 5JASA 4GGOA 4CT0A 2K2QB 2PKYX 2GAOA 3GAFA 4I4TA 3X2FA 1DCKA 3NANA 3T7DA 1DXHA 3TKAA 1CUUA 1A69A 1UINA 2HDWA 5FJIA 2ZPTX 1T0IA 2JFQA 4R5MA 3ID6C 4DCJA 3DXXA 1T26A 5JO9A 3ZXIA 4W9NC 4LK3A 3PC8A 3ZY5A 1RQNA 4RMNA 5BRAA 4ZGWA 1P2FA 1OZHA 2X41A 5ESXA 5EWMA 1DAFA 2I7TA 1VHDA 5J1TB 1XNQB 3KQNA 3ENNA 2RH5A 5T3UA 3LGSA 1KNQA 4JXJA 1ARZA 4DADA 1FFXA 1FJXA 4LE0A 3JXEA 4PNEA 1BQ3A 5COBA 2EOAA 5DBHX 2I7XA 3LVRE 4GVPA 1QYRA 1ESMA 2AZTA 2XB9A 4P84A 3R74A 1VECA 3RYHA 1XZ8A 4B87A 2PLWA 3PL1A 1SKUA 2HU2A 3OZCA 1N6PA 3IS3A 2H2DA 4BO2A 3FYUB 2QUBA 1A8HA 2Z95A 3IT3A 1IOZA 5H59A 2FSSA 2O2EA 3QNWA 3SFVA 1E2PA 1XTBA 2H7YA 1L4YA 1JTVA 5FBQB 1R37A 4D45A 4KDFA 2BKEA 3C4JA 1VCOA 2FA9A 4ZU1X 2IVZA 4RVNA 4L78A 2JFNA 4QVKA 5AK6A 1QWOA 1VJCA 4UDXX 1DT3A 5L6MB 2QJOA 1Y8RA 4ZMRA 2DAPA 1QCZA 5CCDA 4AUKA 4BU0A 4CV1A 2QPLA 4W5RA 4BKOA 3AVTA 1QOPB 3DKPA 1VJ1A 2O0JA 4L07A 1SUDA 1G7CA 4LXTA 3RK4A 2PKQO 2VPWA 2ZB4A 4YIKA 1JFTA 3PL5A 1VGQA 4KFSA 3AH8A 4P5EA 1QRUA 4FFOA 1Y1KE 4TKZA 2WICA 1DWOA 4WNCA 1S1CA 3BQMB 1II8B 3KZVA 5DHSA 5AXBA 3SVLA 1KK2A 1W47A 2WTNA 3A3NA 2HQOA 1KERA 1QB7A 3BIJA 4F9GA 5I7AA 3LCJA 5EZ6B 2D5AA 4PIPA 3GZTB 1P45A 2Q7XA 2RCYA 5EPOA 3A25A 3EQ8A 1G2IA 1EG2A 2JLAA 2P3LA 1ZX1A 1NDQA 3FIJA 5IAEA 4F2DA 5C32A 1GGEA 3LGXA 1TJ4A 1KE2A 3H4VA 3M5PA 2Z8YM 4O4LA 5FQNA 1PJLA 3N7AA 5KHAA 4FGZA 3W7BA 1BC5A 3W90A 4DB2A 2C3UA 2P2CA 2X3UA 3UH1A 3MTIA 2KSQA 4XPZA 2VHVA 4BBAA 5JS1A 2VSFA 4EUSA 1DJOA 1RYFA 1GTVA 4HCJA 4Q7LA 1TM7E 4NHEA 1OI4A 1RQ7A 2V6GA 3WWPA 4J1TA 3U61B 4I8XA 4FUTA 4PWYA 3AI1A 1CRZA 1CY8A 1QHYA 2O7RA 3KJQA 2OFXA 2EKQA 1DRVA 3LYHA 1IY0A 3MRVA 4MAAA 3O83A 4ZDIA 4ZJUA 1TCCA 4R7GA 3CBGA 3K8ZA 5CVCA 1SBNE 4TVBA 2NO0A 3UF0A 3TG2A 5DV9A 3MGAA 5A03A 2UYCA 1EM8B 1M8FA 1YUNA 1C41A 4M38A 4TLEA 5DSZA 4ZRMA 1SVNA 1DCFA 2GCPA 3PR2B 5JHGB 2YWFA 3RTBA 2IZZA 3P7MA 2GK4A 4DA8A 1RYMA 1VI6A 1L7DA 3DNPA 2AEJA 3HCBA 5KNCH 1SVOA 2YFYA 1FRZA 5DZSA 5F3DA 1RAIA 3M9XA 4AN1A 4J0KA 3L6RA 5G0TA 4UMVA 3A3YA 4JLUA 3TL6A 1XRMA 5JEDA 2N42A 3LHDA 1Q5PA 4YWHA 1NMYA 1FDTA 1DG1G 2DFPA 5E1DA 3BSSA 1H6AA 2Z8XA 3I4FA 1E3QA 3LT2A 3QHPA 4K8RB 3UANA 3DT9A 5LMZA 1H2BA 2V7VA 1A8UA 2JGFA 1F3LA 1RRVA 2Q3BA 2BGRA 2H4ZA 4FNGA 5EJ6A 3QBTA 2WWYA 4B3GA 3A9RA 5K6RA 1L8QA 3B6MA 4UDOA 1SWVA 1DKRA 4Q1AA 3OOWA 1XE3A 4WFJA 1J21A 4GP6A 2CJYA 1A1VA 4D92A 2JLWA 1MC8A 1F2TA 1AKNA 2EBUA 2VSOA 3BJEA 5KYYA 4IHJF 4C6TB 3RS4A 3LOPA 4U7GA 1OY1A 4B6PA 2Q5JA 3V8MA 4E6EA 4AUEA 1ETUA 2IPLA 3PHCA 4GQIA 2ZT6A 4IOLA 4YV0A 1K4YA 2CMHA 3Q98A 3GWZA 4F5YA 3Q8XB 1YFLA 1YJQA 3GFBA 3LQ4A 2WDPA 3H5VA 3ZE0B 4CM8B 3H1AA 1KE1A 3Q8MA 1Y9JA 2ZRPA 2V7TA 3WK4A 1F8GA 2WWTA 4ETWA 4II2A 1HC7A 4MWOA 4EG5A 2G5GX 1BMFD 3O0TA 4LXUA 3DE4X 2OCLA 2FG7C 3AJAA 4QDKA 3PR3A 4ZYWA 1HDZA 1NN0A 5A5GA 4UQLA 3R9WA 1X9HA 4JJAA 4C5CA 1J00A 3QLVA 1JSLA 1JZTA 1ZAKA 1W5FA 1JVSA 3GLFA 5EYPA 5SV2A 4ES6A 3SCZA 2AG5A 3IEPA 3QF7A 5A3QA 4P4SB 5KC8A 1P3DA 4OO3A 1NNEA 1W94A 1Z8HA 3W6NA 3KOWA 3U5ZB 2ECOA 3BFPA 4X92A 2VDVE 1YR2A 4H7PA 3IQXA 4P7BA 1FQKA 1N8NA 5KQLA 1K6IA 1WD5A 3C48A 3E05A 3H13A 1QCYA 2C0PA 4GXQA 4BP1A 1L5OA 3C16C 3ZJTA 1GAXA 5FIUA 2HUNA 4IWXA 1KDTA 2LTAA 3MIZA 2X5JO 3PU6A 3O47A 4ZXFA 3CRMA 2VSQA 4ALMA 1IE3A 2LIVA 2XPCA 3I6ZA 1TU3A 5JXHA 4ZO6A 1FL9A 1N7IA 1NBMA 2W2OA 2PBLA 3HU3A 2HN9A 1G0NA 4HH1A 3G0DA 4JLVA 3AKDA 2KI5A 4P4TA 4BNYA 1AZSC 4UQOA 2C2ZA 4MIOA 1JT2A 3RFXA 1RM5A 3VR6D 3CMCO 3T7IA 1J2TA 5E7QA 1F0PA 1TT5A 1Z88A 5BYAA 3D7NA 3M4NA 4FW8A 3JASB 2BHNA 3OEWA 5CDHA 2O2GA 3R9KA 2J3KA 4HTFB 3ROTA 4D5EA 3FA2A 4UW9A 5AWFC 1KP3A 4JI6B 1IHDA 4M8IA 4XJSA 4ARBA 2XOKA 5EGNA 1P2SA 3MM4A 1U0HC 1AUXA 2O2CA 2OYRA 4B33A 1JEAA 3ZQ4A 4A03A 5KJCA 2O8FA 3W9SA 2O8DA 1GUFA 2R1UA 2XYRA 3V8PA 4YMWA 1E58A 1KOGA 2GPWA 4JYCA 1J9GA 1PBNA 1JHRA 4BKQA 1X42A 5HQTA 3KKMA 4DCCA 2JJ1D 1A5AB 1UDCA 2OAP1 2FX2A 3FR7A 3K0CC 3R7BA 4ALLA 2WRZA 1W36B 2XYQA 2ZRMA 4PS0A 1W0KA 3NCTA 3D3EA 1PQWA 2OVFA 3EFEA 4PZ0A 2Z43A 1B41A 2XMSA 4P34A 3OEEA 3PDWA 4YUYA 5HF5A 3B48A 3UOAB 2LDXA 2H2IA 4RJIA 3K35A 2CD7A 3H3FA 3Q3CA 1XZHA 2B21A 4G89A 2QQ5A 5DI3B 3OICA 3SC4A 3QEBZ 3GLHA 3E9CA 2BFCB 3ILXA 3X1KA 5KYGA 3V4ZA 3RUHA 5JT1A 2I7VA 5ED0A 4CTJA 4UC0A 3LS2A 2R5FA 4QWWA 3CH4B 3TD6A 1RACA 2C5AA 2J3QA 1XKXA 3FTNA 1SCUB 2K2WA 4D4LA 1OILA 1EK1A 3IR7A 4HPJB 3WLPA 5JQGA 1QHEA 4ZWNA 2CMFA 3ZTWA 1XZLA 4BUZA 5HYVA 2VDPB 3NWPA 3MLBA 5PNTA 3PDUA 2NXWA 4WY8A 1PDWA 2AR9A 2GRJA 4RORA 3V32A 1NP7A 4JKYA 3ZOKA 1ODSA 3ZDQA 3FOFC 4DA4A 1QDEA 3WQBA 4Q37A 1KQFA 3AVXA 5JI2E 1R9GA 1R0YA 1DTWB 2O8NA 1VPEA 4GKJB 1PJ2A 2FE1A 1RQRA 3BB4A 3KOMA 4BVKA 4KR3A 2FJ0A 2YHAA 4IUBS 2BGLA 1D1PA 4BJHB 4GPIB 4ZQHA 1ZCAA 4A8PA 4KDEA 1X0XA 1FSGA 3FPAA 2L42A 5L40A 1N92A 4L02A 4EJ6A 3KZ1E 3HKEA 4IXMA 3WGIA 3OCCA 1HQCA 3OE5A 2V98A 2JHCA 4W1SA 3LQFA 2Z6QA 3LBFA 1S89A 2NADA 3T9FA 1HNZB 3MGCA 4HS4A 4ZGGA 2RHTA 2REQB 4EMUA 2QYOA 1A4UA 2ECQA 2VWPA 1THZA 2J09A 1BU5A 2J48A 3BXGA 1DDIA 2YMPA 3HYTA 2FPKA 4OLFA 5B53A 1NQAO 5BT9A 2UUCB 1Q57A 1THTA 2P8SA 3NJ4A 1ZVVA 4Y2XA 4II7A 4B3TB 1SXJA 3Q8WA 3DMFA 4BGDA 5K09A 1OV6A 2YOGA 1XMXA 3QLEA 1O95A 2B61A 3W06A 3REOA 4JLMA 5IJ0B 8ABPA 2QRHA 3DM5A 4UASA 3S5JA 3STHA 1TM3E 2OG1A 3INTA 2PPLA 5CUQA 1MC5A 1Y1QA 3AF0A 5IT4A 3LVQE 1N6OA 3GLIA 2F62A 4ZANA 4AG5A 4GM1A 4CM6A 3V4FA 4B3SB 3HO1A 3R9XB 1ITZA 3OWXA 4JVLA 4TL7A 2PZJA 1BXGB 1U1DA 3R7LA 2PBFA 3F7TA 2E4VA 4L0MA 2R11A 4L8VA 2NXJA 4ARZA 3Q0TA 1Z0SA 1H66A 2DHEA 2BKLA 5KWIA 1PEAA 3HZOA 2RHLA 1TCAA 1YCFA 2ZDGA 4BYMA 2V5UA 1VL5A 4L27A 2AN1A 1C14A 1ISHA 4U7PB 3FTDA 2X0DA 5JW6A 1EHIA 1GT91 2GHTA 4QYIB 4KQWA 2L17A 3MW8A 2AFHE 3W1WA 1F8XA 2ZI7A 4M0FA 1B0UA 2CUTA 2GOYA 3DP9A 1RABA 4NY1A 4K9NA 3NS7A 1NIPA 1JYSA 3BCSA 1ZI6A 2Q2WA 4UE2A 3NASA 4FJ1A 2EZ9A 3JWPA 3QU7A 1U9ZA 4MULA 2PJUA 1XCPA 1Y37A 2ZQ5A 5IKEA 1P9WA 4BP9A 4E4TA 5JBQA 2UDPA 2WYHA 4JP2A 5BSFA 1JDZA 5CA1A 3SIRA 4G3XA 4WD3A 3SC2A 1S2NA 2A0UA 1PW5A 2EL9A 2ISQA 1UM9A 2J3EA 2PX6A 2WKRA 1A96A 3I9V1 3N2KA 4QIHA 1LJLA 5EXXA 3TRKA 4B47A 2PT6A 1Y9AA 1T2EA 2WE7A 3ZZ0A 1XEAA 1OTXA 4GGMX 1JIVA 1UODA 1YQWA 3CW8X 3JAKB 2MSWA 3JVEA 3LTEA 3PA8A 3R5SA 4IX1A 1VCNA 3PDJA 2QTMA 4LC0A 4E12A 1FLDA 1R5JA 2D1RA 1W7AA 4L8WB 4FYHA 4LNAA 2BDUA 1GPBA 4XGKA 5FUWA 4AY4A 1B4DA 1QRAA 4GFDA 4C7OA 2WPNA 1YZLA 1YBMA 2G9UA 4JB8A 1MOSA 1HFKA 4HR7A 2Y0EA 4PCUA 4YMSA 5JCJD 1FFYA 4NDZA 2OBBA 2LGJA 1O5TA 3H05A 4BEWA 3OQ6A 2WKPA 1JJBA 1S02A 1WF6A 4FD2A 1ZH6A 3EZXA 1RYDA 1LW6E 2F6RA 2XMPA 2PXAA 3OSUA 4LDAA 4OXNA 2XDAA 3RD5A 3OQ1A 2NUAA 3IAS6 4K9QA 1U0TA 3TEMA 3NVKI 3FNHA 3EJWA 4UU7A 1E2IA 3RT1A 1O4WA 4L16A 2I76A 2WAMA 2XUGA 3O8DA 4HRYA 2D54A 4F86A 3DFZA 1PS9A 2GYUA 3WV5A 3V8BA 1CUAA 1GU1A 2OHVA 2HA2A 1GVHA 4BO6A 2PMKA 2BGGA 3QOYA 4BNLA 3R9IA 2IODA 4ICIA 4J1TC 2OFFA 4EPVA 3IAHA 1VG1A 3TCNA 3I2IA 3P0IA 1V96A 4EB6B 1SVWA 1HFWA 2Y1FA 4QBIA 3AU8A 2D2XA 2QN8A 2I4NA 1HMPA 4GM0A 3KAKA 3ONWA 4TTIA 3RFTA 1YRYE 1CK4A 3E48A 3EPRA 1HYEA 1L4KA 1VKRA 3P4UA 4GLLA 4UDNA 4XLLA 2R5WA 1OYVA 4EDHA 1O4VA 2IBSA 1L5HB 2CEKA 5ES3A 5FPHA 1EVKA 4O4IF 5B6JA 1CG6A 1OAOA 1GCAA 4JWTA 5ELLA 3UJ8A 2P4EA 2WWHA 4X71A 4D25A 1W4AA 2A78A 2B5VA 3K6KA 4D4KA 2VT7A 1TT7A 5IFKA 3CGGA 1ISGA 5E3HA 1Q22A 1Z63A 3PC2A 3RLFA 4NQRA 2C9YA 3FETA 1RHMA 5D01A 3TD2A 4FILA 5JALA 1Y4SA 3SNHA 5ILOA 2WKQA 5LXTF 1GPAA 3H5RA 1OLXA 2PFGA 4LJRA 2HPAA 3IMKA 4AG3A 1KARA 3H3XA 4V0ME 1QUEA 3GPBA 3LUPA 1LU9A 4L85A 4MP8A 1ZNYA 1L7AA 3UMJA 3N0XA 1B43A 3QSYA 3N6RA 1R5BA 1Z47A 4CVNA 2EXXA 1E2FA 3BL8A 5FI1B 1P2VA 1MV8A 3GDGA 5I7UA 4B0OA 4F7WA 1ZUIA 2PX4A 2RGXA 1HL3A 2JCGA 1DBPA 2VTBB 4DV6B 5DGTA 3FWPA 1JTEA 1WY7A 1LVUA 1BYIA 5K0NA 2PV0A 4XJXA 1QQ5A 4K1LA 3X2EA 2FQXA 4ZV4A 1NTRA 3MA0A 4BLUA 1ZIXA 2BDTA 4A6XA 2OZVA 5U9CA 5EKSA 3A32A 4RLFA 2EFEB 5C1OA 1ZC4A 4LHEA 4MI6A 5H81A 5HKKA 1B42A 2DEUA 3K09A 1G7RA 1WXEA 5AH0A 2JJMA 5JAMA 1LSSA 4NZOA 4UNIA 3X3HA 4AQ7A 1Z22A 1QF9A 3DEZA 4M53A 3ESAA 4PO3X 5DX8A 1DFIA 3LQ2A 3MUFA 3HRIA 4G6ZA 4A1FA 2PGDA 5BSVA 1Z0KA 3WZ2A 1HLPA 3BEDA 3MMPA 2D5CA 1RC0A 1GOTA 3LBNA 5CDFA 2EW2A 1QFJA 2BFEB 2ZRCA 3P96A 1OGJA 3BWMA 4PLVA 1TNDA 4MRRA 3UJDA 3PXDA 3ROMA 1IBKB 4N1AA 2GD6A 4Q48A 1TECE 1W85A 1DQNA 4DRYA 3DZGA 3AY7A 4O29A 5LKRA 1DKQA 3WYGA 3EDOA 3WK6A 3T7TA 5KOHB 5LP6C 3HCWA 3M6UA 4FCWA 3ROEA 1U1FA 1KYZA 4QRIA 1IHUA 3ZWCA 3IPAA 3RFVA 4LYYA 3OZUA 3KPYA 3A05A 1FMLA 5BV0A 3MJDA 5B12A 3UK2A 3ZZUA 1X15A 3RYTC 4XUEA 3ZI4A 3IE1A 1N3LA 2HCRA 2ZQZA 3B2NA 2E37A 3E9RA 4TTAA 5IARA 1LK7A 1N6KA 2JS7A 3KDPA 4FFLA 1LWOA 4B43A 4DYDA 2A5GA 3ZE2B 2QNIA 4KDCA 1GZSA 3BDAA 1EIWA 2CVFA 2AJCA 1PQUA 2A57A 3FVRA 5E3JA 2QYSA 2B6NA 4MI1A 2OKGA 3R0JA 5LQUA 2JI8A 2R79A 4TL8A 2ONJA 1E1RA 3C5EA 3D4BA 2YVAA 2R86A 1V8DA 5CJ2A 4CF4A 4S1OA 4MS3B 2O3RA 3PNYA 1FNNA 4ZZ0A 4QPZA 3E1KA 3SYKA 1XA3A 4DV3B 3F97A 4UEJA 3CFYA 3G0OA 2QPAA 3N75A 4S12A 2G77B 4B6OA 4QL3A 3UGQA 5I6DA 3QMMA 1BMDA 3ILYA 3RVQA 1NYLA 4MINA 5TXGA 2LV8A 2H18A 1UFQA 1AKYA 1SVUA 3CW2A 4FJ0A 4AJEA 5JZSA 4HDNB 4Z99A 5IVKA 4OQLA 5H9WA 4R2JA 3OQIB 1OA0A 5AVTA 4L50A 2ZI3A 4NX2A 3T7RA 2YOFA 1G19A 1TI7A 3FYSA 3TIFA 5KREA 3NHYA 4R8VA 3LY5A 4ON9A 4FZ5A 3MQ2A 2GZ3A 3FLEA 5BN3B 5CIWA 3EB9A 4K86A 4LJYA 4INAA 1DT5A 2OXCA 3OOJA 2CDBA 4IJ6A 5KEIA 4QEDA 2C1EA 2AFIB 2P9JA 1TZ2A 2FU5C 5T7BA 1GGMA 2DCUA 3V2UA 1TKAA 3VO8A 4EZIA 1XAGA 2WT9A 3WVNA 4D99A 5A9SB 2I2CA 4MVXA 2XJ4A 3RYIB 4M6WB 1QB8A 3IP6A 4U7JA 3I9KA 3GG2A 1SUCA 2G9RA 1N6RA 4IJWA 4BBJA 1NXOA 3C1AA 2CXTA 2OAQ1 3ONVA 4NWIA 2R84A 2MR5A 5FUYA 5K8UA 5AM2A 2QF7A 1H42A 4ID3A 1RTTA 5EJIA 1E8DA 1DEKA 3CEPB 6LDHA 1YDEA 4X1IA 4ZTBA 2H1IA 4KXXA 1WPXA 5WRFA 4HI0E 3N8DA 3AY0A 3TDKA 4X1YB 1TJ3A 4JYZA 1NF3A 4FEGA 3E7PA 3O8OA 1DAKA 4Y67A 2FUCA 3NG1A 2BFPA 2GNPA 2PNFA 3AY3A 4LBYA 3V6LA 3VVMA 3CVWA 2NVUA 3RS2A 2QRQA 5ECYA 1K7EB 1OXTA 4XDZA 1N2JA 4WJLA 1UMDB 2XMZA 3KS9A 1JR4A 2R1TA 3I4CA 3BGIA 4D02A 2E4ZA 2Q1YA 2NQ8A 2G1AA 5ALZA 1GHTA 3V8VA 2HLNA 2X8AA 3RC9A 4GLJA 2L0XA 3B8EA 4MIKA 4LJ5A 3W3AH 3WL3A 2BW0A 4YRIA 5H4GA 4QXRA 1XTSA 2PZBA 1XHLA 3LPDA 1HF3A 3TB6A 4XVUA 5JJKA 1ENPA 1LPBB 3LG2A 5KJ1A 5MGNA 1AN9A 4H0NA 3ZHZA 1M1YE 4D44A 4H0CA 4NAUA 3JYPA 4P80A 1E8NA 3OQBA 5JNUA 3PQ5A 5FXMA 3FTQA 1T8YA 3NNNA 4XIYA 5A2GA 1P5JA 2BYTA 4QXMA 3M1IA 3RJMA 2ODEA 2XA2A 4UTNA 2WD7B 4KFUA 2GGSA 4QXPA 4LDQA 1QZTA 1RNLA 3GVHA 2VPXA 2X77A 1OA1A 1Y89A 3I5XA 2X5NA 1Z0UA 2Q07A 1YFJA 2Z5FA 1TMYA 2OO7A 3H9QA 4DNOA 2I29A 1U2TA 3S7ZA 1IQ0A 1NGSA 4Q1CA 4FHDA 5A4AA 2VT3A 1I6LA 4AP9A 1JLRA 4O1MA 1SXJC 4UCQA 1M72A 1N78A 1P4HA 2J3JA 3Q87B 2I3DA 1PK8A 4KNVA 3W9UA 3IBGA 1O95C 3Q2KA 3G2JA 2QN1A 2YN2A 4D79A 1M2GA 1J8DA 1EDBA 5LOVF 1FJ2A 3BE5A 4PLZA 5AVUA 1YB7A 1MXHA 2XAAA 1UXJA 3N2ZB 1GWNA 5HJ2A 4ESHA 3EPKA 4IFBA 3OM8A 4BY9E 1OBFO 4F92B 2FMXA 5JVDF 4UHJA 3LVFO 1MX1A 4B0PA 1GL6A 1F6BA 4IXDA 4WOPA 4PLYA 3HUDA 2M9MA 4G8BA 2CN1A 4IV8A 4KVFA 4G0PA 1Z7WA 3CMMA 4LZPA 2J4FA 2HR1A 2Q3FA 1WVGA 1XYGA 2B1QA 1VSUA 4HY3A 3OAAA 4NABA 5BSMA 2QLMA 5EZ5A 3W1EA 1NM5A 1P0IA 3NIGB 1TK9A 4OK3A 5M3BA 4B7XA 3FHTA 3KG2A 4KVAA 3DMTA 4M22A 4WKBA 4EBFA 1KZHA 2WFLB 3RGWS 1ZKMA 1Y5RA 4M0PA 4ZI3A 4K6CA 4M8SA 3LXUX 2XW6A 2Y99A 3A4VA 3R3UA 5IVIA 1DJPA 4YHHB 3ZH9B 3BF8A 4QOEA 3I0ZA 1WB9A 3E3OA 1C7ZA 4D0SA 3UPDA 2BJVA 2CHUA 1YZYA 2XUJA 3IEUA 3IP7A 2J0UB 1TJ5A 3C6ZA 1T29A 3IAEA 3TFQA 4ZK2A 1SHUX 1I0ZA 2OCIA 4UVEA 1OWPA 4U2GA 4L51A 4M99A 6Q21A 1L7OA 2GCGA 4WEOA 5C7YA 1DO0A 1C0EA 1W88A 2J41A 1GTG1 4NZ9A 5JLJA 2BFOA 1T0BA 1NBMD 2O0LA 1LNZA 3C3AA 3TBHA 1EVIA 2OY0A 1JQEA 1GITA 3TFOA 1GFIA 2I4OA 5EA2A 4P2BA 2CNWA 1RWWA 2DECA 4I66A 1RC1A 3IIMA 1BXZA 4I9NA 3LTNC 3F4KA 1KIFA 2HQ1A 4RFSB 4JVNA 3T7EA 3QFRA 3LVBA 1C50A 1WMAA 1LV7A 1LDEA 1XVIA 4QOFA 2W6IA 4Y2QA 1H4VB 5CT5A 3IDFA 3TUIC 4S2EA 4IUYA 5LFAA 3HH8A 1FSZA 5EXSA 3VR0A 3GYGA 2IH5A 4D3SA 1KF0A 2VRCA 5CA0A 1I1HA 4FYWA 1LFAA 1LBTA 3S6JA 3ZGVA 2F4VB 1UQTA 6CHYA 1DC6A 2RK6A 4RIGA 2NUPB 1KOJA 2XOKD 5CD1A 1C1DA 2QL9A 2VHXA 4OGFA 1KEEB 3RRZA 3RSQA 3WTBA 1ZXBA 4CLOB 3BH6A 1M0EA 3H7AA 2RB5A 2PWYA 2NSYA 2OT3B 3LC1O 4NV3A 3UK1A 2P5UA 4EECA 2GXSA 4X6YA 4HDMA 2B99A 5GONB 4XWTA 3RI3A 3OIDA 1DAGA 4DLUA 4TRJA 3ZBTA 1NN3A 2PRSA 2UVDA 2OXTA 4B81A 1G42A 5EJ4A 1RAGA 5LZ9A 4EG8A 1I2CA 1Y3AA 1ZLYA 3BGVA 4HBGA 2AC4A 1VDMA 2FJPA 2GN1A 3CURA 4L0CA 3R7FA 1UUFA 1W0KD 4YLYA 2W2KA 1R0SA 5LMCA 2R44A 1LI4A 2EL7A 3WLMA 2Q5EA 4IIXA 5G3YA 2VQ3A 3EPPA 1Q2XA 5FNZA 4BLPA 2V3WA 4TMXA 1LJ8A 2JBAB 2ZJAA 2QN6A 2JLBA 1U4OA 2KMLA 2V5AA 3ZC3A 2AN3A 3DT8A 5FYDA 1ISMA 1E69A 2VI5A 3CSUA 5TQ2B 4RY8A 3UAOA 2P7IA 3HJAA 2I34A 2AVNA 1MJGM 2JLRA 3BK7A 1L0BA 1L4NA 4MR7B 1E0KA 4JU9A 1PWYE 2AKEA 2XAUA 5FWYA 2IIPA 4CIDA 2VAWA 3GJ5A 1I2ZA 3RHSA 1FDVA 3BJIC 3WLHA 2PD4A 2NTVA 5DJ5A 3DEAA 2CV0A 4H59A 4K1XA 2AOUA 2ZRAA 3ICPA 3TXXA 5CDGA 4K05A 2VUIB 5AI6A 2W00A 2ZJOA 2VJCA 3MT0A 4NOLA 1O9HA 3LT1A 4IP0A 3I6BA 1HLDA 5JD3A 4DLLA 3FX2A 4PNPA 2I66A 2JAPA 2DQZA 1FPQA 2NSJA 1HNWB 3ETHA 4JEUA 4QU9A 3T5PA 3LUKA 2VH2A 3RWBA 4ZDKA 1KBQA 4CG0A 1ZGBA 1IMJA 1OPRA 3D7MA 4YRPA 4F46A 1HY3A 5KWJA 1U8FO 1ULZA 3GLSA 3KSRA 4D4JA 4TUYB 1EHYA 3B6EA 5DASA 2YIMA 3EUAA 1D2RA 2XB2A 4MVJF 4M8LA 2I5PO 2JA1A 4OHKA 4F4CA 4Y9DA 5B4UA 5JH7B 4OHMA 2BBSA 1ZHOA 3QG1A 2I4IA 4NF2A 3D3KA 3K09C 4V03A 5T41A 4BO4A 1IXRC 4EG1A 1XYYA 2PZMA 3AHIA 4RH3A 2GZHA 2YHUA 3A36A 3P1JA 2QJTA 1H8ED 3BMCA 3B13B 1SVKA 4FVTA 4WOBA 2Z3VA 5HRUA 3J81k 4ZVPA 5G53C 1PP4A 4CIXA 1R0BA 4RTQA 4UFOA 1SC1A 1NAHA 5J2TF 1XRJA 1Z8FA 3QOWA 4DEXA 2GD0A 1X87A 5KVAA 3GBPA 3KVRA 3BH0A 1FYXA 2C7BA 1R0CA 2RCNA 4YJHA 2A5JA 2AOTB 3EZLA 4I2VA 3VSBA 3ZKWA 4B46A 1RP1A 1Z5VA 5D8DA 2IDMA 3KLMX 1UMBB 4LMAA 1RXYA 1XZMA 2ZT8A 3W5CA 3T1HB 1SXJD 1V9SA 4MUEA 4P38A 4P5PA 1ZVKA 5E6RA 3DF7A 1T1GA 3OTHA 1ECFA 1C29B 1O95D 2QVYX 3MHPA 1V4VA 1DPFA 5K3CA 4JN6B 2D0DA 1JU4A 4PAGA 1VHTA 3NAGA 4US0R 5ARDA 3E70C 3SC6A 3L84A 3K32A 4NBVA 5ICMA 3WJAA 1G5QA 1KDVA 1IIBA 2EJWA 5FLEX 4FONA 1V71A 4ZQFA 2P30A 5JTTA 4BFLA 4IIYA 5K2MA 1X8LA 1Z6AA 4L5JA 4PCAA 5GADl 4MQMA 3VPXA 1BE0A 1ZK4A 5JXWA 3QEMB 3COZA 3CX6A 5JNWA 2DQYA 1HZZA 1H3FA 1HORA 2CL7X 1M33A 1HUQA 1Q1QA 1YWGO