2PFGA

Crystal structure of human cbr1 in complex with bigf2.
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
273
structure length
272
Chain Sequence
IHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbonyl reductase [NADPH] 1
publication title Glutathione traps formaldehyde by formation of a bicyclo[4.4.1]undecane adduct.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 103
structure length 272
sequence length 273
ec nomenclature ec 1.1.1.184: Carbonyl reductase (NADPH).
pdb deposition date 2007-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2pfgA00
3PLNA 1FMCA 1ZSVA 4JBHA 4FJ2A 1ENPA 1PQWA 4WASA 1AN9A 1TT7A 2EEZA 1R4NB 2FZWA 2WWRA 1KEPA 3S8MA 4CM6A 3O9ZA 3E9MA 4CPDA 1XELA 3I4FA 4CODB 1UR5A 3ORFA 4XYBA 3BHJA 3EAGA 1E1NA 3FWZA 1DXYA 3GUYA 4ZD6A 5COBA 1P0FA 3GT0A 4P22A 1NTOA 3RD5A 2I3GA 1NQ5A 1J49A 3FF4A 1U4SA 3OSUA 3ST7A 4LMRA 4JP3A 1RWBA 2J3JA 3V5NA 3OJOA 5U9CA 4E5KA 1M2WA 3WDSA 4BNHA 3AY6A 5JW6A 1X15A 1FDWA 1UXKA 3AOEA 3IUSA 3ICCA 3WGQA 1CQIA 2Z1MA 5KTKA 2CFCA 3GZ4A 2EGHA 4HADA 4TRRA 2NQ8A 6ADHA 4J1TA 5A9SB 5CPBA 1YQXA 4YEDA 2FHSA 1CEQA 2G0TA 5KVQA 1UH5A 1YB4A 1QLJA 4AG3A 4AJ1A 3ANLA 3OA0A 3CKYA 4U6SA 5CP8A 3ZW8A 2HJRA 4BV9A 1VL6A 4WCFB 4RDIA 3NGLA 4L9RA 2V6MA 2PD3A 1WDMA 4GBJA 4XGNA 1WAMA 2UUPA 3UUWA 4TMFA 5A05A 4CQMD 3MJVA 3WR5A 1WZEA 2PA3A 3G0OA 1X7GA 2HDHA 5EINA 4DPKA 2EERA 2PFGA 3VAZA 3SJ7A 4E2YA 1FDVA 4BIIA 1TLTA 4D0RA 5DDIP 4DC0A 4FC6A 3M1AA 4LCEA 4BO0A 4JXKA 3ZWAA 1A7KA 1YL6A 4YAGA 1HE4A 4EGFA 4Z6KA 9LDTA 5CEFA 1U4OA 1BSVA 4B8ZA 1U3VA 5KJ1A 1DC5A 3OF2A 4O63O 3UXYA 3VTZA 1LA2A 4GLOA 1E7SA 2RCYA 1U3UA 4ND5A 3KO8A 1TVEA 4DRYA 2D8AA 1J4AA 3D5QA 2BI8A 1GV0A 3HDHA 4PLCA 1NXQA 2ZB4A 5ER6A 5T6BA 3N58A 3R0IA 1M6HA 4GMFA 1PL6A 3H2SA 3JQ8B 1Q7BA 2GN4A 1Z73A 2FWMX 2J5RA 3WNQA 4BKPA 4FOSA 5TRTA 3ZWPA 1NVMB 3K73O 3CSDA 4FW8A 2O23A 3JQAA 2EJWA 2DVMA 1KVTA 1Y6JA 1N9GA 4G65A 4XYLA 4RVGA 5G0WA 4TZKA 2GPTA 2AQ8A 5KVSA 4KMSA 4JBGA 4A26A 2NACA 3VZPA 4D3DA 4PLFA 1O0SA 2PGLA 2W90A 1EVJA 1I33A 1PWZA 1ORRA 3HFGA 2EJVA 2E6UX 2RAFA 4LISA 1IZ9A 1SO8A 1BXKA 3E18A 4PLYA 4UAGA 5LCXA 2VNAA 2VNSA 1GZ4A 1LSJA 3OJLA 2YY7A 1PTJA 2Q2VA 3JD0A 4TKLA 1VL8A 1ISFA 4OXKA 3GNTA 3WYBA 1EVYA 2PZLA 4W4TA 1XYGA 4IQ8A 1SOWA 4LSMA 4YJDA 2OBNA 1DIBA 3BXXA 5ILOA 2PH3A 1FJHA 1IB6A 3WTBA 1GYPA 4PVDA 3ZU5A 3M2PA 2F1KA 3F1LA 3HG7A 2W2LA 2CVZA 4PN3A 1ADCA 1ZNQO 4XJTA 3HB4X 3ZWOA 3KM0A 3U5TA 3DBLB 3RUFA 3R6DA 3TL3A 1I36A 3OICA 4UULA 1H9AA 4IIVA 3S2EA 3HHPA 3RJ5A 3L6DA 2JJYA 3EMKA 1E77A 3H3FA 5B37A 4BV8A 1IPEA 2HK9A 3GDGA 3KEOA 5ITVA 1DLJA 1K6JA 2XAAA 5IXSA 2Q49A 1P45A 3B6ZA 3O8QA 5JCJA 1E3SA 1DHRA 2RHRA 3OMLA 3WS7A 3ZCXA 1H6AA 2ZTMA 4BNUA 4RZIA 4CMGA 4IDEA 3L4BC 4JX8A 2P68A 5G0UA 4R54A 4IBOA 1ZIDA 2W8ZA 3BMNA 1QORA 1KEUA 4XX0A 2F00A 3V1UA 1LTHR 3NDIA 1KC3A 4J49A 1ZCJA 1F8FA 3PXXA 5FI3A 4BNTA 1Q2XA 2P5YA 3RC2A 4NFHA 4IZIA 3L0DA 1EDOA 4J90A 4XCVA 1N1GA 1PR9A 3E6AA 3FD8A 2BHLA 4HFJA 3U3XA 4J4TA 5IZCA 1MXFA 5CDYA 4OH1A 3H5NA 4FR5A 4ZQHA 4QO8A 4IS2A 4WLFA 3CINA 4CV2A 3DFZA 4GWKA 3GMSA 1GCOA 1WP4A 4J16A 4Q3BA 4Z3KA 7ADHA 1C1XA 5ILGA 4DPMA 4M49A 5JCXA 4P38A 5L3ZA 3H9UA 5HS4A 4DQVA 4Y9DA 4RORA 4HXYA 1Y8QB 1YBVA 4XZ3A 3EY4A 1E1MA 1KBZA 3ZWMA 3OEWA 2DQ4A 3AOEC 1K5HA 5CG2A 3FHLA 4E5MA 2BFPA 2O4CA 1JW9B 5F3RA 4J91A 1ZO8A 3A28A 3OQ1A 2X0NA 4RPGA 1LDMA 2D59A 3I9NA 2FPGA 3C7AA 3DHYA 1WXDA 4YWJA 3CPSA 4K6CA 2FP4A 4YT2A 4BO9A 1ISJA 2VZ0A 5CDSA 2BMAA 5T64A 5L51A 4J7CA 1UAYA 3C8MA 5F1OA 2IZZA 1NBOA 4WLVA 5DF1A 1UJMA 3IOYA 4XYEA 1JTVA 1HYEA 1ZVMA 4LRTB 3TOZA 3ZV3A 3KETA 3V1TC 4YQYA 5T8KC 1CWUA 4CR7A 2D3TA 1DIRA 1ZK4A 5CDGA 4OXYA 5I8ZA 4JP2A 4F6CA 1E0DA 3JD1A 2OXIA 2VWQA 3D3EA 4N54A 2AEMA 1MFPA 2A94A 4L4SA 1EE9A 2TMDA 3PHJA 1E6EA 5GMOA 5IXYA 4YJGB 3Q9UA 1KC1A 1Y1PA 1U5AA 1BXGB 1IHXA 3PYXA 1ZJYA 1V8BA 2QZZA 4YB8A 3ASVA 4QFCA 3T4EA 1YBAA 4J2OA 1HDRA 3AFMA 1P77A 5AXBA 4E30A 3UICA 1HL3A 3GNQA 3L6OO 1S7CA 1MUUA 1QSGA 3MJTA 4BO2A 3ENKA 3FNEA 2ZATA 4MJLA 1WMAA 5T67A 3P19A 4Y67A 3GEDA 2D5CA 3RU9A 4Z9YA 3IP1A 1T1RA 3UGKA 1ZK2A 2I67A 4E21A 4DA9A 3PPIA 3DO5A 3WB9A 4QEDA 4RF4A 4CMCA 2EXXA 2O3TA 1UP6A 1H2HA 3ZWNA 2D0IA 1CETA 1DLIA 3ZW9A 1ONOA 3GGGA 3GNSA 1F06A 2GN8A 2E49A 4C7KA 3ADPA 2POQX 3C24A 3VPXA 2HRZA 4EDFA 5K0ZA 5DCUA 1M67A 3U4HA 2GYYA 2Z5LA 3ASUA 5KJ6A 3QVWA 2DAPA 4MIEA 3JQAD 1P1HA 3PHIA 4RVSA 3GAZA 4ND3A 4E32A 3F5SA 1HDZA 2EW8A 3JQ9A 1NR7A 2J6IA 3BMCA 1D8AA 1HDOA 1NHGA 3ENNA 1IPFA 3KSUA 4U7WA 3RFXA 4KDEA 1DFGA 4DQXA 1LSOA 3KSZO 4CLHA 3NT4A 4CMKA 4JGBA 3DB2A 3DMYA 2H5LA 1SPXA 4FCCA 4KOAA 1R0LA 4Z3DA 4B7UA 3GPIA 5IDWA 3DQPA 4MOWA 4CV1A 1WVGA 2FMUA 3NTQA 4DLLA 5F5NA 2X5JO 4EEZA 4CMBA 4O5OA 3NT5A 4WECA 1YDWA 4J1QA 3RUCA 3WXBA 4A73A 5L7WA 4FD3A 3U9LA 1FK8A 3DBHB 4ND4A 3VZRA 1VPDA 3O03A 4WE3A 3FTNA 3F47A 5A06A 1E7WA 1RM0A 3GN1A 4IPTA 2BGLA 3T7EA 4CV0A 5I8WA 3G49A 2PR2A 4WOKA 1SBYA 3NUGA 3JQFC 3JD3A 1OZAA 5IDXA 3JYLA 3WTCA 1PQUA 1LC0A 1R15A 4DL9A 1LDEA 4DREA 3WLEA 3ZV6A 1GUYA 1PS8A 3ZWBA 2PV7A 3I9LA 5A9SA 5JCJD 3JYNA 4JJGA 1NASA 3DR3A 4YRDA 4GX0A 1UXJA 2O2SA 4KTTE 3B70A 3SX2A 3MJ4A 4UVHA 2X6TA 4BNKA 3B20A 2ZTVA 3ZWWA 3I9JA 5BSEA 2VUUA 4OM8A 1Q0HA 4WCFA 5BSFA 1AE1A 2NVUA 4BO3A 5C37A 3DDNA 5I9MA 3OH8A 3PVZA 1Z7BA 1E7RA 1K2WA 2ZYDA 1PGJA 4MP3A 2X9VA 2UDPA 3BMQB 1IULA 1YVEI 2QYSA 1P3DA 3SC6A 1G0NA 3WIDA 2G82A 1K6IA 3GHYA 4PG5A 1ULSA 1LNQA 4E2XA 1RKXA 1XU9A 3LSYA 4D44A 3I9OA 1P74A 2LDBA 3NX4A 2VWGA 4PZEA 3DOCA 3GDFA 4MIOA 1C0PA 1B14A 2BFOA 3D7LA 2PD6A 3F4BA 1Z82A 4XQ9A 1RM4A 2Y93A 4UVDA 2PWZA 1T25A 1V35A 2D5AA 4WGGA 4AJJA 2JFFA 1A5ZA 4FGSA 1Y81A 4TWRA 1V3UA 2EHDA 3EC7A 1BTOA 2HQ1A 4E12A 1ZK1A 3GGOA 4HFRA 4AFNA 4A7PA 1HT0A 4I5FA 4B7XA 3LC7O 2RBEA 3ZV5A 1P33A 2PD4A 3QY9A 3E1KA 3JQ8A 4JROA 3WBFA 5JSFA 1V3TA 2C0CA 3E9NA 4L73A 5JYDA 1M66A 1PWXA 5G0TA 2VN8A 6LDHA 3QIVA 1HETA 1HYHA 3D4OA 4EITA 2Q3EA 3AK4A 5KVCA 3A14A 1IHYA 3QVXA 2CVQA 4XRGA 2EP7A 2NQTA 3LF1A 2CUKA 4MVJG 4M89A 3UCFA 4JIGA 4TZTA 3RVDA 1LX6A 1XQ6A 5TNXA 4M1QA 2FOIA 3AWDA 1PSDA 1T26A 3G1TA 1OC2A 4UUMA 2HMSA 4W9NC 2X5KO 3ZNQA 1Q1NA 2X1HA 4Z0PA 2QHXA 3JQGB 3ICPA 4CLRB 2WE8A 1D1SA 3WMXA 4JCOA 2Y1FA 4YT5A 1O8CA 4MVJA 4FFPA 2YDXA 3CMCO 5U1PA 1A27A 3QWAA 4YTEA 4CMIB 5JE8A 1D4FA 1QYXA 2J8ZA 1VI2A 2DC1A 3SVTA 3DBLA 2IEBA 1DDOA 3H65A 2RH8A 3FCOA 4MIYA 3QVOA 1DJQA 5CDTA 4DWVA 3PQFA 4QO7A 3RCBA 3AUUA 3X2EA 4RJTA 3RUEA 3JQ7B 1WNTA 3QWIA 2IDZA 4HY3A 4QTZA 1ARZA 3ONDA 1ENZA 1XDWA 4WLNA 1ULUA 2QRLA 1GD1O 5L7YA 1QKIA 5L45A 4PLPA 1HE2A 3OQBA 3QV1A 5A9RA 3VPFA 5G4KB 4URFA 4INAA 1DSSG 3GHHA 5FFFA 1JN0A 7MDHA 4R9SA 2EG9A 1B8PA 4ITUA 3NRCA 3RBVA 1HF3A 3DOJA 5BNIA 5KOIA 3FPCA 3IS3A 1QXSA 1R0KA 3VPGA 2P91A 1PGPA 1I3LA 1MG0A 4R5MA 4CMAA 4WEQA 4HP8A 3CH6A 4W99A 3NGXA 4B3JA 5BSGA 4BKOA 2X8LA 5JDCA 2JCXA 3WWYA 1Y9AA 1ZJZA 4ZQFA 1YE3A 1OOEA 4UEOA 4EJMA 3WQQA 1HE3A 4J1NA 5HM8A 1Y8QA 1YBMA 2YHUA 3TPCA 1JLLA 1T2DA 2PNFA 4FFLA 5DOVA 3JD2A 3WLFA 3H6KA 1HLDA 4NJOA 2ZTUA 4ZQGA 1QRRA 2CDCA 4BGUA 2J3IA 3FNGA 4JBIA 2NVBA 1VJ0A 2DPGA 4NBTA 4BO4A 4CM4B 3V2UA 1GU7A 1A7AA 4NK4A 2GNAA 1ISIA 1YJQA 4YJFB 4QECA 1I2CA 4OXNA 3BMOB 1UDBA 3I5MA 1ADBA 1PZEA 3PJGA 1LC3A 1BWSA 4WJZA 3GVHA 3HN7A 1DC6A 1XQ1A 3WMWA 2H1SA 2CDBA 3KUXA 1N7GA 2Y1GA 5A3VA 3O38A 1NYTA 1RYEA 3KEQA 4J9VA 2ZQYA 3GA0A 8LDHA 3E5MA 3L6EA 3OJ0A 1DIAA 2PZMA 3VTFA 1Y7TA 2WD7A 4DQUA 2CD9A 2ZQZA 1UDCA 2AQIA 4YJGA 5B4UA 2CMDA 1BXGA 4PGFA 4AICA 3GN2A 3AFNA 4E31A 5TX7A 3C1OA 3KYDB 3AUSA 1GPDG 4IJWA 3K2EA 3IUPA 5IDYA 1BG6A 1XIVA 2VUTA 4P4NA 3G1UA 4RQUA 2QIOA 1O94A 2B35A 2IRWA 1L7EA 3FR8A 2UVDA 1B0AA 1VSVA 3ZNNA 2H6EA 1EUZA 1QR6A 4FJ1A 1ADGA 3M6IA 4ZRMA 2Y0CA 5L9AA 2HRBA 5JC1A 1EQUA 4L4XA 2B37A 4PG8A 4DBVO 3K8ZA 5KKCA 1QG6A 2E82A 2XF8A 3VHRA 4NMHA 1MB4A 3F9IA 1LJ8A 1GYQA 2HMTA 2I65A 3B1KA 3K92A 5CAEA 4CV3A 5EERA 4E5NA 1O95A 1NWCA 4J9UE 4ZU3A 1I3NA 2GZ1A 2PH5A 3I83A 4OKNA 3PZBA 3NJ8A 3PI7A 4XA8A 3FSRA 2P5UA 2OUIA 2HU2A 3L9XA 1JU9A 2WM3A 3E82A 3LVFO 5IN4A 2UUOA 3RC9A 2P9GA 1PL7A 1B15A 2B0JA 1HKUA 2P4QA 2TMGA 2BFMA 2X5OA 1AXGA 2CDAA 3GFGA 3OJFA 5JDIA 1PJBA 2IZ1A 2DUUA 1SZJG 3WICA 1UUFA 3PFFA 2Q1UA 1KVSA 1B8VA 3CIFA 3DTTA 4XDZA 2GASA 1GZ3A 1VSUA 1BVRA 3EZLA 1VKNA 3DC2A 4KUGA 3RU7A 4AJEA 4S3MA 3I23A 4MVJD 1X1TA 2QRJA 3PDUA 3OIFA 4WLEA 1ZXLA 1ZK3A 3S2FA 2NVWA 5TQVA 3DBHA 1IY8A 4FDAA 1GL3A 3EZYA 4ONEA 3W4KA 4J7XA 5TF4A 4FQ8A 5IAAA 1CRWG 1LSUA 5EJ2A 3ZU2A 4ALNA 1E92A 1MC4A 1NQAO 1HLPA 1MC5A 4E5PA 4YRAA 5I9NA 4CLOA 4CM1A 3GQVA 5JAMA 2JFGA 3TZHA 1U8XX 5KKAA 1Q0LA 4D0SA 2QYTA 5HA5A 1X7DA 2NU7A 3FPLA 1I32A 1KIFA 1I2BA 4LMPA 5G0VA 5TLSA 4DVJA 4FFRA 1HE5A 2I6TA 5EPOA 4E33A 1BDBA 3U4IA 5DCWA 2Y66A 2DU8A 4DC1A 2G17A 1E6UA 1LUAA 3PQDA 1Y5RA 5JDCC 1EK5A 2GD1O 4L0QA 3JSAA 4OGWA 4BMVA 1YWGO 3BMQA 2VCYA 4A0SA 3SJUA 5JAIA 4J4HA 3ZNPA 1ISMA 3OIDA 3LK7A 3RBXA 3BYZA 1B3RA 3PQEA 1JWAB 4ALJA 2AE2A 1RJWA 2W2KB 3KVOA 5AYVA 4IIUA 3LT4A 4R1TA 4RCVA 1XHLA 3DZKA 3F4LA 1JVBA 5ENVA 1PGQA 3DAFA 4NPCA 2Q2QA 2JD0A 2ZTLA 3HADA 3L77A 4RVDA 3TRIA 1LSSA 1L7DA 3ONEA 2Y0DA 3LF2A 1R16A 4RF3A 3L07A 5EL0A 4GSLA 1LLDA 3D0OA 4K6FA 3F1KA 3GZNB 2R00A 2B4RO 4YCAA 4EBFA 5A9TA 1E5QA 4OOFA 4M86A 3FNHA 8ADHA 2AG8A 2UV8A 4W7HA 3ITDA 4B7CA 2O50A 3TFQA 3VVCA 4TRMA 5CEJA 4AJPA 4R5HA 2NM0A 1SCUA 1NWHA 5A04A 1E3WB 1ML3A 3P5SA 1UXHA 3Q2KA 1A9ZA 1O6ZA 2VHYA 3WGTA 4AL4A 3NTOA 3DTYA 3PWKA 1B16A 2P4HX 4OSPA 2R2GA 1NPYA 1TT5B 3ZWCA 4DIOA 4NNJA 1SMKA 3P2OA 1PIWA 4KWHA 3HZZA 1XCBA 3OM9A 3WX0A 3JQBC 4P4LA 5EESA 4B8WA 1PZGA 3EK2A 4CQMB 2LDXA 3LQFA 4K9DA 4NBRA 1P0CA 1YH3A 4II2A 4U6QA 1LLUA 3DBVO 5BNTA 3JQGA 1B2LA 4CQLB 1B8UA 3DFUA 3DMTA 4CM9D 5CG1A 4A2CA 3WG9A 2IYPA 1DOHA 1U5CA 2A4KA 3TWOA 1HDYA 3AJRA 4HFMA 3WYCA 2GGSA 2OHXA 4NG5A 5L95A 3O26A 4GGOA 4HWKA 4LVCA 4GI2A 4YJHB 2FR0A 2EKQA 2D4AA 5COAA 2FZEA 2Z95A 4MP8A 3I1JA 2EV9A 4RQTA 4BKUA 3I9MA 3TFOA 3WJAA 3U4CA 1CDOA 2O4UX 2O48X 2B4TO 1ZK0A 1FDUA 4CM8B 2VWPA 3EW7A 2NTJA 5KVVA 3RI3A 4LCJA 4EEXA 2ILTA 5G0SA 1VKOA 3OECA 3A1NA 1E3JA 2JD1A 1MP0A 2I5PO 3VKVA 4W6ZA 4ALIA 1IOLA 1C1DB 2VTEA 4IS3A 3MCVA 5ICSA 2X23A 4K26A 4KP7A 5JY6A 3R3SA 5G4KA 1Z7EA 1DFHA 4J43A 4KTVE 2IXAA 3HJAA 3X2FA 4WOJA 2O3SA 3R3JA 4XQGA 4BGIA 4WEOA 1YOVB 5A03A 1U8FO 2AQKA 3KLPX 5C5IA 1GUFA 2CVOA 1MV8A 1O89A 3WOHA 3HE3A 3EDMA 1NX6A 5DBFA 2Y1EA 4Y6RA 1GQ2A 3GVXA 5IG2A 3GLQA 2H63A 4CMJA 1KVQA 4QFDA 3UF0A 4EJ0A 4GGPA 1KVUA 4PG6A 2Y05A 1LBEA 1LDNA 1VJTA 2P9EA 4R51A 3ZZNA 1ZSYA 4M54A 2BF7A 4RF2A 1GCUA 3PHLA 4NU6A 1PL8A 3GY0A 5BR7A 4MINA 3PYLA 4DXHA 2HMWA 3RFVA 4CM4A 1ONPA 4M55A 4N18A 2V65A 4NZ9A 1H5QA 2QZ9A 3RC7A 2FR1A 3I3OA 3BMOA 2YHIA 3PLRA 1J6UA 4OOEA 4I5EA 4ALLA 2GUGA 5TJHA 1TXGA 4E5YA 4BO8A 4YBZA 1TI7A 5B1YA 2BD0A 4PLHA 4QXMA 1KETA 5DBIA 1OFGA 4B3IA 2JFHA 3C85A 4BS9A 1P1JA 1Y5MA 4EZBA 3JQEA 2QX7A 1GAEO 4PFJA 4IQ0A 3TNLA 2DPHA 1YB5A 2ZYAA 4IJKA 2I99A 2NWQA 1T2CA 3CEAA 3RUHA 3VZSA 5BQFA 5ES3A 2NLOA 3H3JA 3JYQA 3KRTA 1U28A 1RPNA 3ROQA 3V8BA 3FRJA 2VZ9A 1KEWA 1V3VA 2WTBA 2OFPA 4L74A 4XIYA 4K1LA 1NR1A 3GGPA 1V9LA 3RSHA 3SEFA 4D42A 2EP5A 4R3NA 1H6DA 4Q9NA 4BB5A 4XR4A 1KERA 3ADOA 1U7TA 2J5KA 4RF5A 2DLDA 4Q3NA 3LC2O 1R4NA 1HWYA 4CMHA 3WIEA 1PZHA 1U2GA 3WBBA 3IDSA 3E03A 2C07A 4FBGA 3RJ9A 1GUZA 5JXWA 1KVRA 1M6WA 3UVEA 1B26A 3Q9NA 3IKTA 5FI5A 3QQPA 1NPDA 4JLWA 2IYOA 1PEDA 2Q4EA 4YXFA 4BMNA 3JCZA 3TF5A 4I1IA 1PQPA 1PU2A 4RGBA 2W2LD 4LN1A 4I5DA 3WNVA 4RZHA 2GN6A 5ITWA 3FBTA 2JHFA 5DN9A 1UXIA 4FS3A 5JBIA 4R3WA 1AUPA 2B83A 3HUDA 2NU6A 1YQGA 2GSDA 1PJSA 2HUNA 1WDLA 3STHA 4MKXA 1E1LA 3AU9A 3DMTC 3IMFA 1LEHA 1W0CA 5DP1A 5G2OA 4OO3A 4OAQA 1F0YA 1H0KA 5AOVA 3IKVA 3ON5A 1I24A 1AXEA 1UP7A 1XWFA 1I3MA 3G17A 3KBOA 1XGKA 2AE1A 2G76A 1ZKMA 5IZCC 1EBUA 5TGDA 4BNMA 3VDRA 1UP4A 1SOVA 2YQ5A 2HKIA 1PJCA 4JK3A 3PK0A 1ID1A 1SAYA 4XB2A 1OMOA 5JY1A 3B1FA 1BMDA 1XG5A 3PIDA 2VQ3A 4YPOA 4H15A 2YV2A 3A06A 3AM3A 5AXDA 2ZCVA 3GMDA 4NH4A 3TQHA 5FYDA 3BHIA 3QE3A 3TZQA 3NAQA 4JQCA 4MVJP 2WD8A 4BO5A 3VH2A 4FN4A 4S1VA 3P7MA 2YV3A 1U1IA 2J5QA 4BO1A 2E37A 1GDHA 3RQSA 4EJ6A 1Q7GA 3EGOA 1CYDA 2GF2A 4Z0TA 3PP8A 5F1KA 4AJKA 1G6KA 3GVCA 2ZK7A 4D3SA 2E48A 4NDNE 1GEGA 3RKRA 5B4TA 2NNLD 3JQAB 3LU1A 1U3TA 1N5DA 3KZVA 5K6AA 1I10A 3E8XA 4UEJA 4D46A 2AMFA 4DLAA 1NVGA 4NFSA 4CMEA 4DIFA 4R9RA 3BA1A 4M8SA 3HNPA 3TSCA 4EUEA 2QRKA 2Q50A 1Q0QA 4C7JA 5C7OO 4NBWA 4E4YA 3BIOA 4Q39A 4R69A 2W2KA 4NK5A 3GG9A 5DP2A 2IXBA 2FY8A 4Z9XA 3NTRA 4LW8A 3SLKA 3TL2A 4E3ZA 3D64A 1MA0A 3GRKA 1Q7CA 4UUNA 4W7IA 3S2GA 3LT2A 1T4BA 3DXFA 3D3WB 5JPIA 1EQ2A 1WWKA 3F6YA 1MXHA 4MDHA 3KB6A 3ONFA 1X7HA 1E1KA 4TQGA 3PZRA 5EMHA 5AQ1A 3ZH2A 1KS9A 4BL5A 4J2HA 3CXRA 2R6JA 1ZEJA 2VWHA 2HJSA 3H5RA 1E3WA 5CDUA 3DAPA 4AJ4A 1BRMA 2I3AA 2PKRA 2YFHA 3EYWA 4ROSA 2XOXA 1GV1A 4H16A 3PFWO 4NI5A 3TJRA 4G5HA 4YAJA 1Y8RB 5GZ1A 1TT5A 1SEVA 2AEJA 3BMNB 5JS6A 4EW6A 1GQYA 3IQDB 4XD2A 1GTMA 3PYMA 1EFLA 2FN7A 1A72A 1C0LA 1PJ4A 3LT0A 4AVYA 2DFDA 4BNJA 1EZ4A 4OKIA 1NHWA 1BW9B 1NQTA 1Z6ZA 4WCDA 3JQ9C 2GDZA 2WYUA 5KJFA 4PLVA 2ZB3A 3RUDA 4D43A 2DTEA 3Q11A 2BI7A 4ALKA 1JAYA 1YXMA 2CF5A 3CUKA 4YT8A 2GO1A 2HO5A 1GADO 3S1LA 1M75A 2C54A 4I5GA 2Y67A 4NBVA 4FFMA 2SCUA 3H9GA 1ZSNA 1C1XB 1U3WA 2NU8A 4UEKA 1BGVA 2P2SA 3I4CA 5I9LA 2DUWA 1I0ZA 2DTXA 2OBYA 4F6LA 4FJ0A 5IF3A 1HEUA 3ITKA 3G3EA 2X86A 4MKZA 4RVHA 2GN9A 3TN7A 2EKLA 2GERA 3UCEA 4YYZA 4DLBA 1ZMTA 1DRVA 4NFYA 3P2YA 1UDAA 3AI3A 3PRJA 3ROMA 5L40A 4CUKA 3AUAA 2EGGA 3MZ0A 2GZ3A 1GZ6A 1NAHA 3BHMA 4FFOA 4QSMA 4R1SA 4CM8A 1T2EA 3ANMA 1YGYA 2NADA 4KQXA 3PDJA 1G0OA 3MJCA 4HNHA 5AVOA 5FWNA 2BLLA 2JCYA 3GK3A 2CZCA 4IDFA 4YVFA 5U4QA 3C3XA 3RBZA 1NAIA 3MWDB 2PK3A 4ND2A 1CF2O 3QVTA 4OJNA 1DRWA 2ZB7A 2BGMA 3HB5X 2Z1NA 1QYCA 1HYGA 1F14A 3F5QA 3M1LA 4GX5A 4RDHA 4YA6A 5EQDA 1YONA 2IZ0A 4B3HA 3ABIA 3AM5A 1QYWA 1GQQA 4CM3A 3HSKA 4OHUA 4XEHA 1YL5A 2DM6A 4WCFC 1W6UA 2VHVA 2VTDA 4I8XA 4FFNA 3VH3A 4PLGA 1QP8A 1ZMOA 3V1YA 2EWMA 4Q3DA 3VVBA 3CZMA 1T1SA 4QQRA 1Z45A 3NYWA 1W4ZA 3LLSA 4QX6A 3OBBA 2BGKA 1RM3A 2VOJA 1ISGA 4TSKA 2EIHA 3KV3O 1DRUA 5DOZA 4F46A 1J5PA 3W1VA 4B4OA 3H8VA 1OI7A 1T2AA 3ETDA 4XGIA 2O7QA 3VZQA 1L1FA 3OJEA 4YAEA 4ND1A 2Q99A 3VC7A 5A5FA 4LSWA 1EVZA 3D1LA 3GRPA 4CR8A 2FSVA 2X0RA 4NJMB 5HTOA 1GEEA 3V2HA 3DONA 1D3AA 5CEEA 3TZKA 2DKNA 4O59O 1CERA 3MJEA 4OIMA 4G81A 3WGHA 3K30A 3RAJA 5K6AC 4ZHSA 1A4IA 1HDGO 4GH5A 3SBOA 1QV7A 3BTVA 2Y68A 3SXPA 4QT0A 4BNYA 1JWBB 4A5OA 3PJDA 3IC5A 4PRKA 2PY6A 5IDQA 3K31A 4ALMA 1QLHA 3LYLA 5KJCA 3BMCB 3C1AA 4GWGA 2V7PA 3L4BA 5GZ3A 5JYEA 4PG4A 3U0BA 4TVOA 4J7UA 1CIVA 1MG5A 1DO8A 4L4RA 4LGVA 2C29D 5H82A 5JMPA 3MWEB 2BELA 5A1TA 1G1AA 2CSUA 3FI9A 4OQYA 4IY1A 1DC3A 1SB8A 2HSDA 4YRBA 5CFZA 5JC8A 3ZU4A 1DEHA 3SC4A 4MO2A 3LDHA 3NT2A 2ZKLA 1NFRA 4RLHA 1HZJA 2UAGA 3IL2A 1E5LA 2AXQA 4BOYA 2JL1A 4EUFA 4PG7A 3U49A 2YFQA 4WPGA 4DUPA 1PGNA 2VHXA 1P1KA 2BKAA 2JD2A 1JKJA 4DYVA 4XYMA 2EW2A 2YQ4A 2B69A 1P44A 3GEGA 1LQTA 3IAHA 2QW8A 3EVTA 5IN5A 3ETGA 5COQA 3HN2A 4IXWA 1H2BA 3QHAA 4I9NA 4PIVA 3RFTA 3WFJA 4HUJA 2HCTA 3I52A 3DZJA 1H93A 1EVIA 4CL3A 1F17A 3DZFA 1DB3A 3W8DA 2NUAA 1EFKA 3W6UA 2EKPA 3DZIA 4J0EA 2BRUA 3U09A 2HLPA 3JTMA 2V6BA 3TZ6A 1O9BA 1N7HA 3QVSA 1YQDA 1E3EA 2C7GA 5HRUA 2VT3A 2B5VA 1I01A 2NVUB 3VOSA 2RHCA 3LLVA 4XJSA 2UYYA 1DIHA 3D5TA 5TC4A 2QQ5A 3DL2A 2CF6A 5TJ9A 3HFSA 5IFLA 4R68A 4CLDA 5T8KA 2Y0EA 1H6BA 5MDHA 2O3QA 2Q1SA 3T7CA 2JAPA 2OP0A 1E7YA 3PJEA 1LU9A 4X54A 5DT9A 1MFZA 1W8DA 1UAGA 5I7VA 4U8GA 2NU9A 4OSOA 4H3VA 3KHUA 3QP9A 3AW9A 2DBRA 2JHGA 3OA2A 4Q3EA 5THKA 4GLLA 5IZ4A 1VC2A 4IDDA 1P1IA 2OOSA 1UZMA 4GL4A 2WYWA 3QWFA 4GVXA 1PJ3A 1KYQA 3KYCB 3WGOA 4JNKA 1T4DA 4GAEA 4AJLA 5F1PA 2FRDA 2X9GA 4U0KA 4B4UA 4DIBA 4HV4A 1E7QA 1C14A 3ZV4A 1HTBA 5JNLA 4IINA 1IZ0A 4DMMA 1DAPA 2CNBA 4U0JA 4Y98A 1Z74A 1LLCA 3COSA 3GH3A 5ICMA 1EBFA 1WDKA 3ZWYA 1P31A 4PZCA 1KEVA 2C20A 2EF1A 1JA9A 3WGGA 2OORA 4F3YA 4I9UA 1KY5A 4YAKA 5GZ6A 1HRDA 4EI2A 1YDEA 1N2SA 1D7OA 3QSGA 1AHIA 1K0UA 4O1MA 4BNNA 3NKLA 3CMMA 3UH1A 1VE9A 4WLOA 2AW5A 3RWBA 4ZN6A 4E2ZA 4XKJA 4I08A 3IP3A 1R12A 2GZ2A 1LRJA 2NTNA 3WGIA 2VZ8A 1DBVO 5ENDA 3HDJA 5KJEA 3H9JA 2PGJA 2X9NA 4FGWA 1F12A 2D1YA 2PKQO 3VKUA 2V6GA 5THQA 1LI4A 3B1JA 5A02A 3UN1A 3D3WA 1AHHA 3Q1LA 5CHEA 4BGVA 3WSWA 2VYVA 3BAZA 5DCYA 2C7VA 3GVPA 3Q6IA 1NFFA 2BFAA 3FWNA 5AXAA 4CLRA 4ZRNA 3U62A 4D79A 1EE2A 1EUCA 2XXJA 3C7CB 1OBFO 3FN4A 3PHGA 1WLYA 4CMIA 3MTJA 4N5NA 3MOGA 2H9IA 1XSEA 4KUHA 4XR9A 1CJCA 3AUTA 5ER9A 3R1IA 5B4VA 1XEAA 1QV6A 3JQFA 3I9KA 3W8FA 4F45A 3NDRA 4NHEA 3NV9A 4RPJA 1P1FA 2B4QA 1TEHA 5JAZA 3INTA 1D1TA 1Y8RA 2PTGA 4BKRA 4BNFA 5I7FA 1UZLA 3KXDA 4GPD1 4R41A 5TT0A 3ROPA 2Y1CA 3F46A 3JQ7A 5TSDA 5L4NA 4IMPA 5H83A 1I8TA 2C2XA 3PGJA 5KCZA 1E3LA 3PWSA 4JJFA 3V2GA 2O3RA 4UREA 3ZNOA 4IDGA 1BW9A 1JVSA 3S2IA 3N7UA 5KNLA 1HSZA 1FXSA 4MVJM 4P8RA 5C7LO 1PR3A 3ZWVA 1XU7A 2I76A 4D45A 4DGSA 1X0VA 4ID9A 1JAXA 1T2FA 3KLMX 4Q3AA 5JDIC 4GKBA 1TB4A 5A3JA 1PJ2A 1K3TA 3RUIA 4OYRA 4IDCA 5HS6A 3ZN2A 3K6JA 3MEQA 1EEHA 3GOHA 3GPDG 2P9CA 3M2TA 4FOOA 4J4BA 3ANNA 1I5RA 4Z0HO 2YDYA 4MVJE 1SEPA 4DMLA 4BKQA 2X7HA 2OO5A 4RVUA 4IZHA 1HDXA 1LDBA 2CY0A 4XQCA 1A4UA 3QLJA 4XIJA 4MKRA 4ZQBA 4XWYA 3JV7A 2ZCUA 2IE0A 2J3HA 2DT5A 4ESOA 5LDGA 1PS9A 4J1SA 4HKTA 4RLSA 1FDSA 1R37A 2W98A 1H9BA 4NR0A 1LXCA 1SC6A 2D2IA 1J0XO 4R16A 3Q3CA 1ZW1A 2FR8A 4UVEA 2C82A 4WNIA 4BNIA 1QYDA 4CM5A 3PEFA 1ENYA 1OAAA 4CLEA 1N1EA 3C1TA 2VRBA 2OL4A 4TRNA 4TKMA 4AJNA 4R4JA 4MVJH 4YJFA 1R66A 3RC1A 3DBRB 3UAGA 1SB9A 1IYZA 3VH4A 3W8EA 4XRRA 1SNYA 2WD7B 3PJFA 3GEMA 1KY4A 4BMSA 3GC6A 1AGNA 3ZHZA 5BSHA 4MVJI 1DJNA 3LT1A 2I66A 3DZHA 1VL0A 4NIMA 1R4MB 1X14A 4B4VA 2PKQP 4BQRA 2BH9A 2IEDA 4TROA 1YS4A 3JD4A 4BNXA 2Q1TA 2Y1OA 1PJQA 3OQ6A 4W9NA 3ETEA 3JYPA 4O6VA 4CM7A 3QJ5A 1U9JA 5HBRA 4RO0A 4FIZA 1DAOA 2PZKA 5T5QA 5FEUA 1MX3A 4EUHA 3KYDA 2DTDA 2VHZA 3ZHBA 3W4JA 2DBZA 4YT4A 5DULA 2HK8A 5FF9A 1W73A 2YV1A 1LDYA 3BTUA 1X0XA 4H7PA 1X13A 4ZGWA 1A9YA 3T4XA 3ZU3A 3ZDFA 4FPXA 1GFSA 3INGA 4II3A 1GPJA 4MPDA 2YJZA 4NJMA 4WUVA 3PWZA 2JCVA 1V0JA 2GR9A 3IJRA 3QW2A 4PZDA 2IODA 4LVUA 3UW3A 4U5QA 2R00C 3RIHA 4XYGA 1A71A 1HDCA 2XXBA 2YW9A 1MGOA 2PZJA 5F21A 5JAQA 3OFSA 3GR6A 2VT2A 2A9FA 5L4LA 2DFVA 4XB1A 5C7IO 2VYNA 1PS0A 1YRLA 1ZXBA 2JAHA 3EHEA 4PCVA 5BT9A 3RUAA 5A5EA 4GQAA 3GAFA 3F3SA 5JLAA 4Y6PA 3WQSB 3WGYA 3K2BA 3K96A 3L4SO 1VM6A 1NQOA 4A10A 1PJLA 3INRA 1DHTA 1PGOA 1PZFA 4YDRA 4GSKA 3E9QA 3MOIA 2C5AA 3HDYA 4ZICA 2VRCA 5I7EA 3RKUA 3UHAA 2Q1WA 4KZPA 2O2YA 3GF4A 2WSBA 4M87A 2ZIZA 3AY7A 1JDJA 4RV9A 1N92A 3JYOA 2DBQA 4WKGA 2WJPA 3DAGA 4PVCA 1E6WA 3ZHYA 3QWHA 3KSDO 3KOUA 4YACA 3W4IA 3DOOA 2GLXA 4YR9A 4BQPA 1LQUA 1UZNA 4A03A 3GDOA 2VYVD 5DNAA 1H6CA 2B36A 4DTIA 4JJIA 2Q46A 3RROA 1VLLA 2AQHA 1S6YA 2B5WA 1XR3A 2OGUA 5B12A 2X22A 3AOGA 3DHEA 3AU8A 2O3JA 1Y9EA 2QG4A 1YKFA 4BNZA 4CLOB 1I2ZA 4Q3CA 4E13A 4BUCA 4IUYA 4RVFA 4O0LA 5L7TA 4P4GA 2A92A 2YUTA 2GRAA 3QA9A 3TDKA 3ZGYA 1C0KA 3I6IA 5F5LA 4BVAA 2Y99A 5HWSA 1BDMA 2E4AA 3OP4A 4IJVA 4R1NA 5AXCA 3KTDA 1U7HA 4CUJA 3K5PA 3L9WA 2X58A 3FNFA 3OHSX 3DEYX 4KQWA 3ULKA 3OIGA 4J6FA 1NM5A 2YYYA 1XLTA 1YO6A 4TVBA 4L8VA 2ZJ1A 4GVLA 4HFNA 1LRKA 2Q4BA 3N74A 3DZBA 1R6DA 4UVGA 4C4OA 1QMGA 1MLDA 4IDAA 1B3BA 3W6ZA 4FSHA 4IDBA 2VUSA 1N9GB 3HDQA 4UUOA 3D4NA 3FR7A 3WQRA 4ZVVA 1ADFA 3NEPX 4I9HA 2HMUA 4J3FA 5TT1A 5A4DA 4IGFA 1ZBQA 1YL7A 2X4GA 4ILKA 4J0FA 2NTVA 3PGXA 4CL8A 2WYVA 4EYEA 1B7GO 1F8GA 3DWFA 5L4SA 1OC4A 4WNCA 1X1EA 3KYCA 4IJUA 2C5EA 4ZJUA 1HZZA 1XKQA 4PLWA 3AY3A 3D4PA 4R01A 4RL6A 3IIEA 4YAIA 4HNGA 1FF9A 3HQ4O 1N8KA 1EUDA 2HAEA 3KYBA 3VH1A 4D41A 5TIIA 1DC4A 4N5MA 4L75A 4GX2A 1YJ8A 1XA0A 4LRSB 5LDHA 1NPTO 1EK6A 3GVIA 4IXTA 3CE6A 1EDZA 2C2YA 4PLZA 1DFIA 1T24A 1BHSA 3ROKA 2HK7A 2RIRA 2JKVA 3TZCA 3UFXA 2FPIA 4YQZA 4UVIA 3H2ZA 4B79A 3OEYA 4DYDA 4ZQEA 1WPQA 4Z9FA 1IL0A 3FTPA 3QRWA 3GZNA 3QWBA 4W82A 2NV6A 1K89A 1QYVA 1TA4A 3O4RA 2OP1A 1P1RA 1GY8A 2XPCA 1ZZEA 3WYEA 3GFBA 1JKIA 3A9WA 5JFOA 3JQ6A 3O8QB 2PLAA 4OL9A 4DBZA 3EUWA 2AA3A 2ZYGA 1K6XA 2I9PA 2Q2WA 3NDJA 4RPHA 5MGBA 3S55A 1PX0A 5DBGA 1JKFA 3MJSA 3AI2A 1BXZA 3WSVA 4BHTA 4LK3A 4NU5A 1HXHA 1PJTA 2ET6A 4E2WA 3RASA 5EN4A 1YB1A 4ZA2A 4CQMA 2WE7A 3IJPA 3ZWXA 4XGKA 1ONNA 4R1UA 1EMDA 2A35A 3ZI0A 4OQZA 1H94A 3H4VA 4CR6A 1HSOA 4CQLA 2FPPA 5LC1A 5ADHA 1E7MA 5KWEA 4MVJF 3PHHA 4HBGA 4A27A 4JN6B 5I7SA 3I6QA 4IQGA 4BB6A 4TRJA 4KUEA 1C3VA 2O7SA 4YJHA 3EVNA 5EQFA 2AHRA 5TS3A 3WFIA 1DIGA 2ZB8A 3BZUA 3E5RA 1WW8A 3H9QA 3LZ6A 4QUKA 4RPLA 4UUPA 4E0BA 1LLQA 3NJ4A 3BTSA 1ZEMA 4D7AA 3GG2A 5CPFA 2OZPA 2VYND 2O3UA 1NNUA 4IM7A 1LRLA 2G1UA 3OETA 4E6PA 5KIAA 2RH4A 3LC1O 4GKVA 4HX5A 3A4VA 2X0IA 4BNGA 4Y6SA 3VDQA 5DZSA 2W4QA 3CZRA 2AEFA 4CJXA 4AJIA 2NSDA 1C1DA 5G4LA 3JQCA 3UKOA 5GY7A 1GR0A 1I30A 3U4DA 4CLXA 3C7DB 2VRCD 4KDFA 1ZFNA 2J3KA 4K28A 2C59A 3H9EO 1Z75A 2PGDA 2VOEA 2Y1DA 4FB5A 4XDYA 4AJ2A 3CTMA 4BGEA 3JQDA 5EIOA 4BO6A 1YOVA 1O5IA 3BTOA 3DZGA 5IJZA 1IUKA 5JO0A 2GCGA 4KWIA 3UCXA 2WMDA 3UOGA 5J23A 1R0SA 3GUCA 4N7RA 1FDTA 1M76A 4RPKA 3K9QO 3FBGA 3Q2IA 4GX1A 4WK6A 3ZHXA 4MP6A 1U2DA 1V6AA 3TOXA 1GYRA 1RM5A 3H5AA 5K9ZA 1ZH8A 1C0IA 3WGZA 1CQJA 1JQBA 4NQZA 1NVTA 3Q0EA 5JMWA 2YHIB 4D3FA 2G5CA 3AI1A 2OMEA 4PRLA 2YZ7A 5T57A 5L53A 3SLGA 4OMUA 3HWRA 3WJ7A 1E3IA 1ZUD1 2WEKA 3AM4A 3MTGA 4BNWA 5JO9A 4AJHA 2X0JA 4PLTA 5BNFA 3WWZA 2VHWA 1P9LA 1WZIA 1IE3A 2V6FA 4IGEA 3VPSA 5H81A 4DPLA 1VJ1A 2FSSA 9LDBA 1WMBA 3DBRA 3H7AA 4Y8VA 4WLUA 1UXGA 2HMVA 3G79A 4XQEA 1RYDA 4IMRA 1ISHA 4AJOA 3PIIA 4BO7A 2ZJ0A 3VPHA 4NBUA 4L76A 2AG5A 4B4WA 4G2NA 4BNLA 4CMEC 2DBVO 5C3MA 1I3KA 1R4MA 2Q45A 3PTZA 1VRWA 1KOLA 1NP3A 3DHNA 1ENOA 3JQBA 4FC7A 4CM9A 2WDZA 1NFQA 4CUZA 1BVUA 4BNVA 4N5LA 4GMGA 3E48A 1LDGA 1DPGA
chains in the Genus database with same CATH superfamily
4DWJA 4ZKDA 4PO9A 1MAUA 2FUKA 1JIJA 5EI5A 1R0YA 1FTSA 1QIFA 4FGLA 4JBHA 3Q7PA 4M0CA 1AN9A 4MV1A 4QJIA 5A71A 4B4KA 5B6JA 2Q5LA 1ECGA 2EEZA 1R4NB 1QNFA 2QRUA 5ALKA 3ZS8A 5AKIA 3O9ZA 4UHDA 5LA6B 3TYXA 4CPDA 3UHJA 3I4FA 4QDTA 1XLVA 4CODB 1UR5A 1XYVA 2CJPA 3BHJA 3NM5A 1JR2A 4U9UA 3TJZA 2IBMA 2JS7A 5CA0F 2FEAA 1ATIA 3NWEA 4F3KA 3TIIA 2IYRA 1PFUA 2AYZA 3O47A 3A1TA 3OQIB 4FWTA 1P0FA 4Z4FA 1Q3KA 1PNVA 1Y0BA 2OKCA 3BZBA 3Q41A 5LMUB 4F96A 3QKTA 4XTCS 4HVAA 3OSUA 3EXHA 1P6QA 3BXOA 3EULA 4LF7B 2CLOB 4MLDA 1Y9ZA 4KREA 3NR2A 5DE3A 1C9NA 3SZUA 1II8A 2PA0A 1M2FA 4JJ6A 3EC2A 1WU8A 4AY3A 1TYBE 1KQNA 1OLSB 1CQIA 2JJ2D 3B2NA 5KTKA 3GZ4A 4HADA 4V0SA 1LF5A 5A9SB 5CPBA 4O33A 5DGCA 1NVDA 4AJ1A 5KVQA 3MCAA 2ZFUA 3ANLA 1F5SA 2F9LA 2P8JA 1FYEA 2TYSB 4EY3A 4U6SA 3ZW8A 1WUIS 2FWBA 1L4YA 3IO5A 5BR8B 1VL6A 3LRXA 4WZZA 4A82A 4RDIA 2GM9A 5DJ5A 1AN0A 2AK3A 1QX3A 5FJJA 1R5BA 3UYLA 3FOEC 2UUPA 3ZOZA 3DVAA 4WHMA 3MC1A 1NZJA 5GVRA 3NYIA 2HLNA 3NBXX 4C76A 1A7UA 1IXZA 2NPFA 4JQOA 2HDHA 4KW7A 4DPKA 5K6RA 1HMPA 1I5OA 4JIMA 3SJ7A 1FDVA 1H2AS 2AXNA 4D0RA 3CG0A 5HK8A 1KZ9A 1PDWA 4FC6A 2ISCA 3E5HA 3PXEA 2TSYB 4GBMA 1ZCBA 4LCEA 4BO0A 2OA0A 1EJ0A 3ZWAA 4YAGA 4KPEC 3A3OA 1NQWA 1FOEB 2JRCA 4DLRA 2PS1A 5CCXA 2QVGA 1S96A 2Q4OA 1JXMA 3DDHA 3USZA 3W2TA 2PYDA 2IV7A 3S6JA 4Z6KA 1O2DA 4YASA 1WHTA 3R7LA 2E2WA 2GK3A 2VG8A 3GBPA 1Y3DE 4XVHA 5DLPA 4WFQA 3M4XA 2QTMA 4LOAA 2CVPA 4UEWA 2JFWA 4Q02A 4O63O 3WL3A 1Y4AE 4Y0NA 3UXYA 1CR4A 3OPXA 2RCYA 3BKWA 1FDRA 3KO8A 4R2MA 4X44A 4D8WA 2PAAA 4DRYA 4L27A 4MHOA 4E4RA 2AJCA 3WQHA 4IMJB 2Q07A 5TVKA 4PLCA 5JD5A 4OH7A 1IG0A 2FW1A 1BCSA 3H2SA 4ZZ0A 1QS0B 3WLKX 2J5RA 1BDJA 3HCNA 5CA1B 3L7IA 1JDBB 5I48A 2FWIA 5DT2A 1NVMB 3K73O 3EPPA 3CSDA 1P7YA 3K0AB 2I2DA 3MWKA 2Y1WA 3NHRA 4P4SB 4IJ6A 4O8ZA 3TTTA 2EJWA 3O84A 2DVMA 1XJWA 5B1HA 4ZAZA 1Y6JA 1F1BA 2GRJA 1NXSA 4NEHB 2QJRA 4E2FA 4RVGA 1QX4A 1GUDA 3R7WB 2GPTA 2AQ8A 3DW1X 2YRFA 2C8JA 3WWPA 2RONA 5KHLB 3OZDA 4KV7A 4PLFA 4HQLA 4LYDA 4BRSA 1ORRA 3HFGA 3OZXA 4ZPXA 3CXUA 2RAFA 4PLYA 3D1JA 3MOSA 2KI5A 4UAGA 2VNAA 4AKGA 2VNSA 3P9CA 1LSJA 3BT7A 2YY7A 1K9SA 3FVWA 3GNTA 3WYBA 4LSGA 4B31A 2AZDA 1KK1A 1RS0A 1PKXA 1SOWA 2XCOA 2VF8A 3BGDA 3D7RA 4NCHA 4K9OA 1W4RA 2PH3A 1FJHA 1IB6A 2QI9F 3WTBA 4EATA 5KUTA 2HNAA 2ZKIA 3FSGD 3M2PA 2F1KA 1YK1A 2CVZA 3LCCA 4PN3A 1ZNQO 3ZKWB 3HB4X 3DBLB 3MYYA 3V34A 3BH7A 4ARIA 1L5VA 1H0SA 2FRXA 4MI9A 5EIXA 4JI7B 4L4ZA 4IIVA 2A78A 3S2EA 1CDDA 2B2NA 1Y6FA 1J1IA 3EMKA 2YR0A 2GPWA 3ODPA 1IPEA 3Q7QA 1UM9B 2HK9A 2K7ZA 2MMCA 3MD9A 4KQ9A 4KRYA 4MR7A 4FBMA 4OP2A 1HEYA 4MS3A 1K6JA 2ZXFA 3TQQA 1R27A 5AK5A 2Q3CA 3A27A 3BQMB 1E3SA 1D6SA 2RHRA 4IXNA 3WS7A 4C3ZA 1H22A 1H6AA 3DTVD 2BV3A 3QW4B 4RESA 3W5IA 3NI2A 3UM9A 1ECPA 2D2EA 5BW4A 1UBKS 1ZA1A 1N34B 1Y34E 4N5IX 5I7AA 3RIEA 3N2EA 4K03A 3SHTA 4BX9A 3G02A 1AKTA 5AUQA 2C8VA 3O2NA 4I4IA 3ETHA 3MN1A 1CQPA 4ZHQA 3B89A 4D96A 1YI1A 1ZCJA 4RIHA 1U8YA 5FI3A 3RC2A 4YCLA 4Q4HB 2GESA 3EIHA 2BC9A 4NKRA 4UBIA 1F20A 5KOHA 2PWAA 4URYR 4H1WA 3PFIA 1MTZA 4MUBA 5C5DA 5KX5B 2DMRA 2EX4A 1EFHA 1PR9A 3E6AA 1XRSB 1YVRA 1UODA 1UANA 3RQIA 5CFMA 3VJRA 4NMXB 1AKWA 3Q1KA 2XDQB 4IS2A 3R5XA 3CINA 2I62A 3P0EA 1U04A 3Q9SA 4WLFA 5IYZF 1EYZA 4GWKA 4BFYA 3GMSA 1WP4A 3R44A 4R8SA 4Z3KA 4BN0A 1XMQB 2IYEA 5LOVA 4ZI7A 4HLNA 4K1XA 2ZJAA 4V0RA 4C4YA 3ANTA 5L3ZA 1BD4A 3QPWA 5DPMA 4LQDA 4DQVA 2IQ5A 4HXYA 4JOBA 4XZ3A 1J25A 2REQA 3OEWA 2DQ4A 5FH9A 3AOEC 2GXAA 3COPA 4TV8A 2N42A 4UTXA 1NY6A 2O4CA 4EW2A 1N77A 2FP3A 2CUTA 2Q8PA 4J91A 4IVRA 1JX6A 3KS9A 5ALJA 3U9SA 5AVRA 4L5BA 4RPGA 1OD6A 3WMGA 3S8YA 2P9BA 3I9NA 3AZOA 1J1ZA 5H0IA 1PW5A 4HDNB 3CPSA 5CIQA 4YWJA 2HO4A 1PEKE 2BRUC 4I2VA 1D04A 2BKLA 4NCJA 3BOSA 4O4IA 3CLSD 3A2MA 2E5FA 2CDRA 5L51A 4J7CA 1Z2DA 2J0UB 1TZCA 3LXRA 3AR8A 1H2FA 2W6QA 4ZYLA 2QAJA 3LDUA 4MWBA 1RAIA 3DP9A 4FUTA 4Y2UA 3KP1A 5DF1A 5HTKA 4XYEA 5HILA 1ZVMA 3Q15C 3TOZA 2R5FA 1L9XA 1ZH4A 3E7PA 2WU0A 3NHWA 3BN3A 4GG1A 4RL4A 4YQYA 5D1NA 4JJ4A 4OV6B 1CWUA 3CEPB 4KE8A 3WLPA 2HHHB 3PDHA 4NYMQ 3C3PA 4W5QA 3OUUA 1MU0A 3H0EA 1W0KA 2VJAA 4FSXA 4JP2A 4P5PA 5DXFA 4F6CA 3UAVA 4BX8A 2AEMA 4ABTA 2D4HA 2V58A 3F8WA 1VGQA 3QMPA 2WW8A 5JZMA 2WMNB 4L4SA 3CTPA 1LWNA 4JUIA 3WYFA 3PCXA 2AG0A 2BMFA 2WFMA 4IWYA 2JLYA 5BQ5A 4UTNA 1GTRA 4B9EA 2XNJA 3ASVA 4QFCA 4O25A 1N6HA 1XXHA 1HDRA 3AFMA 1MPTA 2WU3A 5IBPA 1AZWA 3GLFB 1D2RA 3GNQA 3N6XA 1S7CA 1H3FA 2Y0PA 1QPBA 3MJTA 3TQSA 1FUUA 1V45E 3ENKA 4HNAB 3X1ZA 4AKSA 2X7JA 4MJLA 4NJEB 5JS2A 4EJFA 1PN3A 4Y67A 1Z6TA 2JCGA 2YC4C 4UTVA 2D5CA 2AXEA 4Y6QA 4CFSA 2X0KA 1T1RA 1H5UA 2E4ZA 2FFRA 2PX6A 2Z57A 3MRXA 3MINB 5UKDA 3ZY4A 4E21A 2BMEA 4RF4A 4FOLA 4BIMA 2QN7A 3E22A 3VHQA 1QU3A 1O9HA 1CETA 1PD0A 3DW3X 1N4AA 5KYXB 1ONOA 5FBQB 3WDLA 4B0OA 4F2HA 2YCBA 4CKBA 1BGWA 4HDSB 2A9JA 1O77A 2POQX 3VPXA 4O2BA 4S1NA 4EDFA 1AVTA 2YY5A 3OBIA 4RTMA 3EOAI 3MT7A 3IQWA 3Q4GA 1R7RA 4H7DA 4ZVOA 4ENWA 1YNOA 1RKUA 1J39A 2GYYA 1RLIA 2FCAA 4HLUA 4JBNA 1PG2A 3T7IA 4WXEA 5FWXB 2DAPA 4J0IA 3COVA 3HGTA 3KQPA 4CDGA 1I1NA 3IB3A 4RAOA 2BKXA 1JEJA 2A8YA 3K4PA 3F5SA 3CLTC 2J59A 3V4LA 4ETNA 4IRUB 4LZOA 4YJ3F 4WGFA 1C7RA 1Y80A 4CNQA 2J6IA 1HDOA 1G3QA 3M0EA 1FFXA 3GFVA 2REOA 1Q7TA 1L5RA 2ODWA 2XDAA 3OY7A 4KN6A 4URZR 1RHJA 4R1PA 1HNXB 4DQXA 3NIDB 1LSOA 2NX2A 3OPVA 2KM1A 1I4DD 1V48A 4FEGA 3TGWA 2NO4A 4JJ8A 3DB2A 3BGVA 5U9CA 4HDAA 3MMZA 4FCCA 2MWMA 1R0LA 4M2LA 3WSTA 4Z3DA 4HDRB 4JKOA 5F1YA 4I6JA 2GM5A 1RZRA 3H0KA 2W83A 3HP4A 1AT1A 1T9HA 2QLBA 5F5NA 1H66A 3ADDA 3GJ5A 1T8PA 2UZAA 3O82A 2AG1A 2F1IA 3RUCA 1SU6A 5C81A 5HCUA 1OILA 5JSZB 1FK8A 3DBHB 3VHXB 3VZRA 2IYTA 1VPDA 1MO6A 1W1WA 1XYYA 3O03A 1T3LA 4J0HA 4ZC8A 3GJRA 1MRZA 1E7WA 2JGDB 3DEAA 5LA6F 1RM0A 3GN1A 1NBME 5FAXA 4BYMA 2ZXUA 4CV0A 3CW9A 4NESA 1FTWA 2P0YA 4LRYA 4WOKA 1SBYA 5F7JA 3EUAA 2QQ0A 3JQFC 3JD3A 3NUGA 4NCXA 1OZAA 2GHIA 4F5ZA 5AUNB 1PVDA 4W5OA 1YVDA 4RYDA 5T41A 3LP5A 2H07A 3SE0A 3DFIA 1LGYA 3OFKA 2HZBA 2QT1A 2VPXA 3NC4A 4BATA 4Y2VA 4EJ2A 1BDIA 1QRUA 2PV7A 5A9SA 4YV1A 1CULC 2Q9CA 2R9VA 3DMRA 2I80A 2B34A 3CU5A 2JFXA 3DR3A 3K94A 3P0HA 4GX0A 3NP9A 1Q0UA 2O2SA 1G98A 5K0TA 1SUBA 2KLBA 3B70A 1P5HA 3HV2A 2GPYA 4G0XA 5LD2C 3ZWWA 1FUEA 4FZ5A 4F9TA 1DI0A 1FDIA 1Q0HA 1DXHA 1XZPA 1YU6A 2AOWA 2KW5A 4BO3A 3VSCA 5E6RB 2H7CA 3LGXA 1P1CA 3EIFA 1CSEE 2O2ZA 2FEPA 2HU5A 3O8LA 2XBUA 4QTXA 4X7MA 4YALA 4DSOA 2R1ZA 2ZYDA 1ZIPA 4PYOA 3K9FC 1LV7A 2BJVA 4MP3A 2A3NA 4N0QA 5K2OA 2ONZA 1FSZA 2UDPA 3BMQB 1L4BA 4TMVA 2GN1A 4TKZA 4ZAVA 5AW6A 4C6RA 2XWBF 4UMEA 1YF3A 1RNLA 4BQQA 1USVA 1AC5A 3A1EA 3FUVA 4G63A 4MAFA 4IIJB 5EWLA 1U6KA 3DDOA 1W6RA 3SC6A 2G82A 3K7EA 3P20A 2X1VA 4PINA 3GHYA 4PG5A 4DY6A 1LNQA 1YMVA 4TMWA 4LXHA 1RKXA 3W9SA 5FBVB 4B5KA 2NT4A 5FULA 3ZKAA 2OZEA 2VWGA 3NX4A 4PZEA 1J7JA 2H8KA 3DOCA 4YFYA 3VGJA 4EMBA 4MIOA 5FTMA 3GBVA 1B14A 4AZVA 3ZVKA 1G3IA 1S9HA 3ABSB 3BWBA 4YPFA 4UAVA 1PEAA 1SUPA 3LZCA 2Y93A 4XQ9A 5FBRB 4ZVRA 3S40A 4DWOA 2KPOA 3EGXA 3L0YA 7REQA 1GZHB 1KH1A 1ZQ9A 3GP3A 3NBAA 4EZEA 3JS5A 4HQFA 4QOSA 3BIJA 1JBEA 4TWRA 4CDNA 2EHDA 3I42A 5FWAA 4CEHA 5AW0A 1ST3A 1EVKA 2HQ1A 4J0JA 2IZ6A 4MUYA 2Q5QA 5HE8A 3GGOA 1KF0A 4GYWA 2HEGA 1J8YF 2FW8A 1YRHA 5EIBD 4A7PA 3RYIA 4LJ5A 4D57A 3OQNA 1DTEA 2WNHA 3A3KA 1QDLB 1CP2A 1P33A 3T99A 3QY9A 3E1KA 5CK5A 3MCWA 4WOBA 4TTVA 3K8QA 5JSFA 3HFJA 1VLHA 1M66A 1N0VC 2GXQA 1SZPA 1N2JA 2J46A 1MDFA 3K9NA 3T41A 3IIJA 1KQ3A 3LFHA 3QU7A 3AK4A 1XF9A 3WBJA 2I3ZA 3BVPA 4PCAA 2DH6A 1KPIA 4UM5A 5K0CA 1NIJA 2NQTA 3EOBI 2ADMA 3WISA 1Z7WA 2PWPA 2VSFA 4O4JA 4MVJG 2HX1A 4RS3A 3W5VA 5BR4A 4M89A 4LGMA 5HMMA 3DDCA 3M3DA 3RVDA 1FLNA 1OXTA 4MWZA 1LX6A 2X76A 3RVRA 5CA1F 5TNXA 4HNSA 4RK6A 2B2XA 5F64A 3AWDA 2FEWB 2WIAA 4V0LA 1OC2A 2I6GA 3KT6A 4DY4A 4Q82A 2PQ0A 1DOAA 3GDWA 4W9NC 4FDLA 4X00A 3TVYA 1SXIA 1Q1EA 2GAJA 2X5KO 3O91A 4PAQA 2X1HA 2CLMB 4FXPA 1IJEA 4Z0PA 3X1MA 2IHUA 3JQGB 3ICPA 5A6SB 2WE8A 4CLRB 4JCOA 1G4UR 1V2GA 2Y1FA 1O8CA 2F9FA 4QQKA 3W7AA 1TEZA 4MPPA 3ROZA 2DULA 3A0RB 3G2QA 3AEKB 5U1PA 1JHMA 5J43A 3PRKE 1WXEA 5JPCA 2WSSA 1E79D 1IJKA 1JJ7A 2ABWA 3BJEA 3QG5A 4KJZA 4MWOA 1IN7A 3AC0A 4IQFA 3KKNA 4CMIB 5LM3A 4ZCPA 3MLBA 4L7VA 4ARSA 4E5DA 4ARAA 1NC3A 4NQRA 3FETA 4U2GA 5GPBA 1K7EB 3RC3A 3SVTA 1DXQA 2F3PA 3DBLA 2IEBA 2V7TA 4D5GA 3QVOA 1Z7YA 2YOFA 1GCIA 5G40A 3OOEA 4ZT5A 1ZH2A 2DX7A 3MTQA 5I9BA 2XYRA 3AUUA 4LY9A 2XCTB 3RUEA 3GGDA 5BQ3A 5LYYA 2VSOA 3TTUA 1WNTA 3AXTA 4WXHA 1WL8A 1X1QA 3FWYA 3FVTA 3F6EX 1HX7A 3LPAA 3AHDA 4M0EA 4F1WA 4QTZA 1C1YA 1W9MA 2XUDA 3O73A 2IHNA 2P9YA 3MCUA 5HF9A 3FF1A 3G9XA 2O2DA 5LKRA 5L7YA 4D1YA 2Q3LA 1QKIA 5ITZA 5L45A 3OQBA 5A9RA 4KNVA 2AKEA 1RU3A 3IVXA 4URFA 1DSSG 2ZE6A 1Q1BA 4I6GA 1PT7A 3AF6A 1TCCA 1V37A 2DZDA 2JAXA 5ED0A 3IODA 1DZ3A 2EG9A 1B8PA 4NE9A 3P8ZA 4AN4A 3MMXA 4IL5A 3RBVA 2HTEA 4N9WA 4CEJB 4LJLA 1L4NA 3FPCA 3AF2A 2H18A 3ET4A 4X60A 4AMZA 2Q8NA 4CMAA 4I5IA 2XDQA 3RAEC 2J0SA 3CH6A 2QRVB 1NUHA 1TRHA 4UHHA 2JCXA 2PSHA 3IE0A 4LRWA 4DQ0A 1ZJZA 1CXZA 1TOAA 1YE3A 3BGSA 4ZQFA 3LGAA 1HURA 3IVGA 1YZLA 2EAUA 5FLXA 1XJ0A 4UEOA 4OLAA 4YV7A 3OU2A 4UUAA 3WQQA 1HE3A 2PXXA 1GPMA 3PQ6A 4J1NA 1JDTA 1R6AA 5HM8A 5KX5F 1Z29A 2ODTX 1XTTA 2E87A 4EQZA 1YBMA 1B0UA 1NONA 3NBUA 3OF5A 4B3FX 4U9HS 3JD2A 4JI4B 3H6KA 2C7PA 2IP4A 1FFAA 1CCWA 3LQYA 3LX4A 3PV0A 2XMQA 4BGUA 1XVLA 3I53A 1RABA 2YWHA 2J3IA 2ZJ7A 3N28A 4C6SA 5H68A 4D8TA 3UK1A 3WC4A 1L5NA 2PL1A 2HBYA 4NBTA 1TX4B 4Q1DA 3EUEA 1SXJC 4CM4B 4NS4A 4PGMA 4NK4A 4QAQA 3W5SA 3SS9X 4DCNA 4F92B 2OAGA 4JI5B 2C7BA 1ZIYA 4ZARA 2G9UA 5L8VA 2GCPA 5JPDA 2ZSFA 5HGJA 2O2CA 3RK0A 4R2KA 2JFBA 1Q12A 1N2CA 1UDBA 2J0UA 3I5MA 2FMFA 3QV2A 2NO6A 2IDJA 1ISRA 2W6PA 4P7GA 4ZO9A 5FTJA 5LBUA 3PJGA 2A1UB 1Q95A 1VHWA 4FYYA 3AQ4A 5ELLA 3HN7A 3BREA 1DC6A 5EE0A 2HFJA 4EA8A 2EFEB 1R5JA 3KUXA 4M4SA 3TUIC 1N7GA 2PSDA 2Y1GA 2EDCA 3JPYA 1UWCA 5A3VA 3UPDA 3M5CA 1DJOA 1K9VF 3KKQA 3E5MA 4QNNA 1DIAA 2PZMA 2XKKA 2CD9A 3ZQUA 5JECA 1UDCA 1RQ2A 2AQIA 2C0QA 2OXRA 2P6OA 2CMFA 2XUGA 2J08A 2CMDA 3HBLA 4F84A 1QJCA 3O8NA 3H2YA 5B6PA 3AFNA 1PI3A 5EZYF 1EPUA 1ZMBA 2R1VB 2R44A 3KYDB 2QLJA 4FZRA 2JIPA 1QBKC 3FMOB 1KMIY 3MUEA 4XJXA 4P4NA 1DCFA 2VUTA 1G8SA 4UATA 2M32A 3G1UA 4KWCA 3EBOA 2B35A 3NW9A 4G5OA 2IYLD 3ZXXA 5IH7A 2ADOA 1JJAA 4PZ9A 4R6WA 4NJEA 3ZNNA 3VI4B 3DPSA 3JARB 2H6EA 1AS0A 5ICGA 1MOPA 1OXSC 4RJJA 5NULA 2NV2B 4FJ1A 4MWTA 3SK0A 3MWGA 3TXXA 1Y8ZA 3WVNA 2ZZKA 3MINA 1E9AA 1WOYA 3UYKA 1OQAA 3NIGB 5LLDA 2IOHA 2V7VA 3GOQA 1SHTX 1I2MA 4G9EA 4OBWA 1FMTA 3CF4G 4GP9A 1MB4A 2PMFA 2PZBA 1FMJA 4HDSA 2E89A 2I65A 1U7UA 1TJ4A 2FE1A 3OCJA 4E5NA 3AIIA 5HIJA 3LUCA 1WW2A 2ZP1A 3GXBA 5D3MB 5JZSA 1ONBA 4TWZA 2PH5A 3I83A 5IKPA 3ZLBA 4M98A 3H1PA 3PI7A 1VMDA 5K3CA 2P5UA 3BORA 2YZNA 4IIHA 4ND7A 5CYFA 5EP2A 5E9AA 2ES4A 3DDUA 3EA4A 1FSFA 3HB7A 3K8YA 4G97A 2PVCA 2WM3A 4OBBA 5AJXA 3LVFO 1OX4A 2UUOA 3IESA 3RC9A 4AO8A 4BV3A 5IN4A 4I4NA 2BWJA 3G0CA 3I2IA 3NXSA 1B15A 4D9MA 1N1DA 4TTPA 2XX3A 2CFRA 1LBTA 3O83A 1RLUA 3F8SA 2CXQA 3PF8A 4UZFA 2G71A 4ZCQA 1PFQA 1SR8A 3QVGB 2QPTA 1A0OA 1NR5A 4ENSA 1PJBA 4ABYA 2IZ1A 4YS6A 2DR3A 3LECA 3GAAA 3PFNA 1RJ9B 1B8VA 1UMKA 4HCJA 4KIGA 2GASA 3L43A 4E1BA 1HK7A 3DEKA 3EZLA 4RM3A 3SG0A 3ZQJA 5I51A 4KUGA 4HHEA 4S3MA 2ZSEA 4Q6WA 3T0FA 3X43A 3JU3A 4JDPA 4OUDB 4RJKA 1YD7A 4BAUA 4AX4A 3ER8A 4MV5A 3NATA 2VJBA 3SOPA 2W5UA 1ZXLA 4WLEA 4G01B 1ADYA 1RLMA 4YP0A 4KLZA 1R5NA 2WSSD 3TD2A 5JSZA 4I66A 3AVPA 5TQVA 3DBHA 1IY8A 2ADFA 5DNDA 3VHXA 1GL3A 3NTXA 5EE5B 2W6CX 4ZOLF 5FKJA 2OCIA 2IIQA 3EXG2 4J7XA 4U2EA 1CRWG 1GN9A 2WTEA 1OIXA 1SWWA 2RI1A 2Y1KA 3BL6A 4LXIA 4PX3A 5EJ2A 5GV7A 3VTKA 2VBCA 1L7RA 3AMVA 1EP1B 3LNTA 4LJSA 4Y2TA 4CG1A 2C2ZA 4BFZA 5JADA 2ZR0A 4RUKA 2VH1A 3M49A 4CLOA 1JSZA 3BHNA 3I37X 3LYAA 4RYLA 4TYNA 2JFGA 1BE8A 1XVVA 4NV0A 1T1GA 4KXVA 2DWPA 4RULA 4OP3A 4AS2A 1BKDR 1N8NA 4IKEA 3ENZA 1WZUA 1F6BA 4D0SA 1X80B 1VXOA 1L4UA 5HA5A 1TA9A 4PSCA 2GA9A 2V54A 4LZWA 1SIOA 4JI8B 4ND6A 1PV1A 3K4QA 4FFRA 2I6TA 3WL8A 3NBMA 3HTXA 3BFXA 2GHQA 3U4IA 4WV3A 5EYPB 4HYYA 4DC1A 4ZWNA 1BFUA 4DDVA 3LUHA 4PSVA 1EDEA 1X1CA 5IT0A 5JDCC 1H4QA 3EN0A 1ZN7A 1EK5A 2QL5A 3MD0A 1IQUA 4M60A 3JSAA 3AIOA 4HN9A 4RK1A 2QVLA 3BMQA 1R6XA 2VCYA 2E1RA 1SVWA 3T4UA 2R5NA 5JAIA 3UAWA 4J4HA 3ZNPA 3I2KA 1MVLA 1FFBA 4IIJA 1ISMA 1M2HA 3DFMA 1QF9A 4Q66C 1EUDB 3BYZA 1L7VC 1K7FB 8ABPA 4H27A 2DJIA 2AE2A 1VCNA 2DFLA 2W2KB 3KVOA 5IRCD 3LT4A 2O5CA 1VPEA 4OAPA 3WV4A 5CB4F 3F4LA 3OTIA 2NP6A 1PGQA 5ALLA 4DCVA 3AFHA 3LDGA 5BXYA 3UH0A 2JD0A 3KWMA 3HM2A 3GRAA 2L42A 4Q4AB 1X6VA 1L7DA 4X1YA 1FX1A 4COOA 3QMWA 4DUGA 2HIAA 4GSLA 1LLDA 1SXJE 3BK1A 1ZR4A 3PDIA 2Q3JA 3AP3A 1M1ZA 1QHIA 1TUIA 3AHFA 3L7DA 3OCUA 2K6GA 4YCAA 4OOFA 1E2HA 3FNHA 1N0UA 3GUHA 1TE2A 3ITDA 3TFQA 1FS6A 1TGYA 4NL4H 2CXRA 4IHQA 5CEJA 2NM0A 1G9SA 3LWDA 1IEXA 2HLDD 1UXHA 2QUKA 1CFZA 4JU9A 1A9ZA 4D9NA 4ZTUB 1XA4A 1ZN2A 4C43A 3WGTA 2C78A 3ZXUB 4F4HA 5HJEA 4AL4A 2VDLB 3TG8A 3NTOA 3DTYA 4DMHA 5HCNA 2PYZA 2R2GA 3VGPA 3THOA 1NPYA 2ZU0C 4EY7A 5KNDA 1SMKA 4RZXA 1PIWA 5HF6A 4JI2B 4KWHA 1FYVA 3BWXA 2X7XA 3OM9A 5H3HA 1OFUX 2VRWA 2FGKA 1AMUA 3WX0A 2I54A 1JJFA 2ZUUA 3DNFA 4Q4DA 1XLUA 1W46A 4CKYA 3AESB 2JGNA 4DXDA 3VI3B 2AFIE 3HJFA 1K86A 4ZOAA 4QM7A 1EDDA 2XYQA 1M5RA 6AT1A 1A9RA 2ORWA 2XH8A 2PUDA 5BNTA 3E2IA 4CCYB 2XCSB 3JQGA 2ID9A 4F3NA 1OPRA 4B3TB 4BJHB 1M1YE 1KI9A 3MCTA 2XYHA 3OWOA 1NULA 4RKWA 3R7DA 2QZSA 3TLEA 2A4KA 5I8PA 4MPRA 1XTIA 1LS6A 3AEKA 3CZ4A 3H05A 4HFMA 4L0CA 4BFCA 4P33A 2GGSA 5BPFA 4NG5A 5L95A 4HWKA 4GI2A 2JK1A 2FR0A 2YIDA 4YJHB 3H1AA 4LQ4A 1KO5A 4X20A 3VX4A 3WL7A 5BSVA 4DG9A 1OBOA 5C4GB 3AHCA 2EV9A 5IC4A 4RQTA 3CEMA 1L8LA 2IPNA 2WAAA 4MRRA 4OQDA 2C9MA 1PT9A 1EVEA 2H1RA 2X1LA 3BB4A 3HV0A 3MWFA 1I2AA 4KEAA 1CDOA 2FN4A 4M9SA 2WWTA 4E1AA 1IB0A 1JYFA 2HWXA 1SUAA 2HWUA 2PRZA 3SQWA 2O8BB 4UBJA 2ZRJA 1UQUA 4JEIA 4RMIA 4YK7A 5EGSA 4V0NA 3RRMA 5AW1A 3EW7A 2F3RA 4I0WB 4F5WA 1HT1E 5AHWA 3W3ZB 4LCJA 5G0SA 3NVMB 2OK8A 3OECA 3A1NA 3OQMA 1SA0B 2NN3C 1QGUB 4KQ6A 1XDBA 4W6ZA 1YZTA 1IOLA 1C1DB 4PRZA 8AT1A 4G36A 4B73A 1QCCA 2VTEA 4DMFA 2LBPA 5ARBA 1ML4A 4NEGA 3MCVA 4J1TC 2AMVA 2X23A 3ORYA 5HOQA 2Z6QA 5JY6A 1T9GR 2XBLA 3R3SA 1E2MA 1G3UA 2RE8A 1JDSA 4RTQA 2GPSA 3IDZA 1Z56C 1YJXA 3EDQA 2EOAA 1WS6A 5K4AA 2IXAA 2QL6A 3CB2A 3PKZA 3ABZA 1AV7A 3QPUA 3QXXA 3X2FA 1JH9A 3K1TA 3RV3A 1AKEA 1QOQB 3QLUA 3DKIA 1YOVB 4L3WA 2R47A 1R0ZA 5A03A 3P9SA 2AQKA 3KLPX 2JA2A 1EFPB 1O89A 5TY0A 1YR6A 3HE3A 3EDMA 1NX6A 2NXNA 4X1KB 1QGED 4CIYA 1CC1S 2A5LA 1P8JA 4G89A 3U7RA 5MN4A 3KHKA 4EWLA 1V71A 5IG2A 2VFAA 1YIOA 2IYNA 3D6UA 4B6QA 2B5OA 4GXNA 4R9VA 3UC5A 5FAKA 3R09A 3EZ9A 5JHHB 5EY5B 1KVUA 4WK0B 4FFDA 3GFSA 5KDDA 1LBEA 5G53C 4R51A 1WEHA 1LJUA 2RAPA 1GNSA 3L1IA 3OZGA 4KGZA 1MA3A 2ZULA 4M54A 3HBMA 3HY4A 4GOJA 1GCUA 3M6VA 4ZALA 1EB8A 3EB9A 2DUMA 2VF5X 3R2JA 3FSEA 3BJIC 4JYZA 2XEDA 2MMGA 1RRKA 2YXPX 4MINA 1D9XA 4M1OA 3RFVA 3RTEA 3ZHQA 4CM4A 3HCBA 1R0CA 3BCSA 4N18A 3JAWA 5CVUA 5JXHA 3U4QB 1H5QA 2O8FB 1L3BA 4C87A 2V98A 1OSNA 3ND5A 4FILA 3RC7A 3WLNA 2FR1A 4M6WB 1TJ5A 4DLTA 4A2PA 5CYOA 2ST1A 1M7GA 3E3AA 3PLRA 2SKDA 1SIBE 1XNJA 2P62A 3EDYA 1K92A 4ALLA 1SXHA 1YQUA 3PNPA 4L78A 2W9XA 5TJHA 4RSHA 1KQFA 1WV0A 4E5YA 1KE1A 4BUJA 1K7CA 3KXLA 5CRIA 3VSAA 5LIRA 3VNVA 3N70A 4E11A 4F86A 3KOMA 3THYB 4QXMA 1KETA 5DBIA 1O4WA 1J2JA 1IOZA 1UKYA 5MFZA 2IK8A 4K3UA 3S4YA 1C3JA 5M3BA 4BS9A 4NCNA 2HDWA 3JALB 4IQ0A 3TNLA 1ITZA 1VI5A 5HDBB 3AM1A 2ZYAA 2WJ4A 3D4LA 4MJ3A 2VJPA 3ESYA 1K8QA 1V9SA 4G41A 4MDYA 3JXEA 1VYHA 4PPGA 3VZSA 5C8XA 1SG9A 2UZ3A 2NLOA 1X9IA 3LTNC 3H3JA 1PYDA 3S27A 3FRJA 2R1VA 1V3VA 2CXXA 3K0SA 1NKVA 2C1XA 1GG8A 2OFPA 5AUPB 3SWWA 1ONSA 2PRYA 3EHDA 1QFXA 2Z56A 1PR0A 3RSHA 4D42A 1C9EA 1XROA 2IUYA 2L19A 2VSNA 2EP5A 4AQDA 4YGXB 4R3NA 5JROA 4QTYA 3JARA 2CFOA 3I8SA 1LPBB 4XR4A 3TRKA 3ADOA 2J5KA 5FI1B 5DTQA 1K63A 2OB1A 2GPBA 3PENA 2OCLA 2UYQA 1QNLA 3GP5A 2IPLA 4OVKA 4B6RA 4CE6A 3TCXB 4CMHA 1PZHA 1NJGA 3AKEA 4DQLA 1U2GA 4DUGD 5KTMA 2A86A 4FBGA 1NMZA 2YICA 3ZYCA 1OCEA 2YV5A 3PUWA 1KVRA 5HZGA 2XF2A 5JXWA 3S81A 2EDAA 3A32A 1R6BX 3TAUA 3I8OA 1LPAB 1WJGA 4YMSA 2GCOA 4N12A 2PCLA 3FYCA 4G2TA 3CKLA 2OGZA 3W04A 5IM5A 2X0EA 5LU9A 5DWQA 1UBMS 2BGRA 2C8KA 3LYUA 4ZEXA 5REQA 4RGBA 2W2LD 4LI0A 1PBNA 1ZU5A 3KAPA 4I5DA 3VU9B 3ZVLA 4X8MA 1AKMA 3TX2A 2R2AA 2VKQA 4XCQA 4HG2A 4Z51A 3AEQA 1YQGA 2O1WA 3MRVA 4Z49A 1QYRA 3TM5A 1TAHA 5KNDD 2ETXA 4YO7A 3Q0TA 4QNRA 2LP4Y 3B3JA 3F2VA 3WWDA 5BN4B 3RKSA 2O1EA 1G59A 2GX6A 5B53A 3UJBA 4PZPA 5CLJA 1X8JA 4JL5A 4RHTA 2PUGA 1KYIA 3EGDA 3KDSE 2O52A 4P7KA 1EEXB 4NNPA 4O2AB 3M4JA 1JMVA 1I3MA 1XWFA 2JLUA 4BNDB 4OUDA 2DPLA 1D03A 1XZ8A 4URHA 1E2FA 3VDRA 1GGNA 2J32A 3WIUA 1U0BB 3MJFA 1T5SA 3NOOA 2NZUG 4JK3A 3QUBA 4H7FA 2OY0A 4DS3A 1ID1A 1Q11A 4EI7A 5KS2A 1VHJA 1Y3IA 4IOKA 3DR5A 4MMYB 1ODKA 5LP6C 4WN9B 3WLIA 1NLUA 5BUCA 2FFAA 3TQHA 2KE5A 4UBMA 5JFTA 3GMDA 4XUGB 4XD7D 5DN6A 3MK31 4ZDJA 3IO3A 2KBEA 3GQBB 1P0QA 3NAQA 4JQCA 4BRWA 2XCLA 4HDOB 3CGWA 4MICA 1DP4A 1WKBA 3LFUA 3VPCA 4D9FA 1AH2A 2DT8A 3W5DA 1AK9A 2J5QA 4V2UA 5JATA 4WA8A 2CCJA 1TPYA 2RJ3A 4BO1A 3LBYA 2Q3DA 1G20B 2Z9BA 1TEXA 1GDHA 1WQ1R 3PQ5A 1Q7GA 2NUTA 4COKA 2GF2A 3RU2A 1L7AA 5F1KA 1SH7A 1X80A 2SBTA 2H29A 1MTOA 3DE0X 3L84A 4NDNE 5DHUA 3F5MA 2J07A 4FMBB 1GEGA 4N39A 3RKRA 4C0SA 3JQAB 2N75A 4LYEA 1IONA 1BMQA 4FX5A 2PGAA 3NNSA 1NL3A 3BD9A 3BFJA 4D46A 3F8TA 5CLQA 2XUZA 2WTMA 1HNZB 4R9RA 1DKUA 1J56A 1Y1KE 4NS1A 3S8EA 4EG4A 1BKSB 4M8SA 1JDNA 1KMNA 5D85A 4EUEA 3D6AA 3NDBB 4ZTBA 4LOIA 1CJUC 3O4GA 2J6BA 3OZUA 1JQAA 2W71A 5ARCA 4OG2A 1BA3A 2ARKA 3FUUA 2BUBA 1KH3A 3BIOA 4HAIA 3ROPA 4CDMA 5D3KA 2W2KA 2XMBA 4JSRA 3AF0A 3QBVA 3BULA 5NLLA 2IXBA 3AFIA 3Q5GA 1E18A 5JJCA 1L7PA 4FVTA 4PPYA 4U3JB 2Q0HA 4TWAA 4MVXA 1PW7A 3H5OA 4Z9XA 1NGSA 3TL2A 3UAOA 3UT6A 4O4LF 3QFFA 3CVOA 1F7VA 3L6CA 2WJGA 4W7IA 1T4BA 1EP3B 3PHCA 2X40A 4GKAA 3D3WB 4Q4AA 5K0GA 1P3Y1 2BFWA 1QC5A 5JPIA 1ORDA 1CZKA 3I0ZA 2MSCB 5CLHA 3F6YA 2QEQA 1MXHA 1TD1A 3T35A 3T5CA 3ONFA 2AW3A 4WBNF 1X7HA 3KTAB 2F8TA 1Q1AA 2I6XA 4HATA 3RSSA 4L8YA 5EWMB 2Z2JA 3KQSA 2LCFA 3CKKA 3K9CA 5AQ1A 5HR5A 1KS9A 2AKAB 1P0MA 4F0JA 4XM1A 1QHHB 4W8HA 3AWIA 3OC0A 3KV1A 3ZG6A 2HU7A 3QX7A 4G9BA 5KYWB 3KJNA 1BRMA 2I3AA 3EYWA 5GONB 3UW1A 1V2HE 2JGMA 1EM6A 4GQIA 1OFIA 2JANA 4UD6A 2AX4A 1ZOOA 1Y8RB 2ZVDA 1XEWX 1SEVA 3Q3IA 1BX3A 3O21A 1R9JA 1QFJA 4EW6A 1SVNA 4LZAA 1RWQA 4Y18A 3SJZA 5KTPA 5CCDA 4MUAA 4PWYA 2FUEA 3W2FA 4RC9A 3LT0A 4AVYA 2DFDA 4BNJA 3PC3A 5LD2B 1AA9A 1NHWA 2HA3A 1NQTA 2G72A 2FF5A 3IA2A 1SPBS 4UM9B 2HWWA 3VYUB 4HBZA 2OFXA 1KOGA 1AA6A 3G5AA 2QQEA 2ZOSA 1XTPA 2J67A 2DTEA 4EKIA 2IHZA 3Q11A 1RQRA 4X92A 1YXMA 3ITNA 4RHYA 5DVZA 5E7IA 2GO1A 2OESA 1GADO 1RPTA 3VYTB 4YT8A 3FFAA 5K7SA 2HCJB 2Y67A 2I7VA 2PGNA 3H9GA 2EJBA 1ZSNA 1C1XB 1TKRA 1U3WA 4JLJA 1PR4A 1BGVA 2IHYA 3I4CA 2DTXA 3QX8A 4MGZR 4N6NA 4W5TA 2EJTA 1U7OA 4IUCS 3QKWA 2PUBA 4RVHA 3IEVA 4MYSA 4X1IB 1K4KA 4EG3A 4WMLA 3UCEA 3N3AC 2E21A 4EQ6B 4ROTA 4EFNA 1DRVA 4RH3A 4Z4HA 1TFRA 4RY9A 4CIDA 2V4MA 3O93A 4DV2B 3OTGA 1FTQA 2O8BA 3MZ0A 4Q01A 4QSMA 1FTNA 1HEIA 4QBTA 4C5AA 4LI3X 3ZTYA 4N3GA 3LOPA 4ZIRB 2QT9A 3N5KA 4HNHA 1ODSA 2VDWB 4YJ2B 3BL5A 2JCYA 2CZCA 4FDVA 4B3DA 3AF4A 3C3XA 3LQQA 3DD5A 1NAIA 3DLAA 3MWDB 3NIFB 5HYVA 3V4OA 4MA0A 5JI3E 3D6JA 3FM9A 3NHLA 1BX0A 5ESWA 4GGMX 3WGJA 3F5QA 3M1LA 1FBNA 3FYUC 4RDHA 4YAFA 1YONA 1NUAA 4FHGA 1XZMA 2LZ0A 4AJ9A 2W6ZA 6ABPA 3ABIA 1M54A 3K1AB 4CM3A 4MQFB 4N0PA 4BBPA 4FFSA 3HSKA 4FYKA 4EY5A 1K27A 1D5CA 1N2BA 1YL5A 1JHXA 2WM2A 1P9NA 2XIJA 3CS3A 4XEHA 4ZT7A 1HH4A 2YOHA 1H2WA 3T1QA 4JLPA