2PFIA

Crystal structure of the cytoplasmic domain of the human chloride channel clc-ka
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
152
structure length
145
Chain Sequence
SHHVRVEHFMNHSITTLAKDTPLEEVVKVVTSTDVTEYPLVESTESQILVGIVQRAQLVQALQAGHQQCLQDILARGCPTEPVTLTLFSETTLHQAQNLFKLLNLQSLFVTSRGRAVGCVSWVEMKKAISNLTNPPAPKEFLEVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Structure of the Cytoplasmic Domain of the Chloride Channel ClC-Ka Reveals a Conserved Interaction Interface.
pubmed doi rcsb
molecule keywords Chloride channel protein ClC-Ka
molecule tags Transport protein
source organism Homo sapiens
total genus 43
structure length 145
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 2pfiA01
2D4ZA 3PC3A 5KS7A 2YVXA 3FV6A 5K23C 2RC3A 2QR1E 4GQYA 2YZIA 3FWSA 3SL7A 4ESYB 4L0DA 2QRCE 3ORGA 2UV6A 3FHMA 2NYCA 5K25C 3LFZA 3T4NC 3FNAA 2O16A 2P9MA 3KH5A 1Y5HA 5LXQA 3TDHC 3KPDA 3OCOA 3K2VA 4DQWA 4L27A 2EF7A 4FXSA 3KPCA 4L3VA 3L31A 4FRYA 3HF7A 3LV9A 4GQWA 3I8NA 4IY3A 2OOYE 3FWRA 2UV4A 4P1OA 2OOXE 1PVMA 3LHHA 2NYEA 3K6EA 3GBYA 4PCUA 3KPBA 2RIHA 2RIFA 3PC2A 2OUXA 4UUUA 3TE5C 2EMQA 4IY4A 4COOA 4HG0A 5MMZA 4GQVA 2YVZA 3DDJA 3L2BA 4IY0A 2UV7A 1XKFA 2YVYA 2PFIA 2UV5A 4O9KA 3PC4A 5K24C 4NOCA 1YAVA 4IYSA 4ESYA 2QRDE 2QREE 3OCMA 4L28A 5K22B 3KXRA 4IY2A 2YZQA 1O50A 4P1GA 3OI8A 1PBJA 5IIPA 2QH1A 3LQNA 2QLVC 2ZY9A
chains in the Genus database with same CATH superfamily
2D4ZA 2JA3A 3PC3A 5KS7A 2YVXA 3FV6A 5K23C 2RC3A 2QR1E 4GQYA 2YZIA 3FWSA 3SL7A 4ESYB 4L0DA 2QRCE 3ORGA 2UV6A 3FHMA 2NYCA 5K25C 3LFZA 3T4NC 3FNAA 2O16A 2P9MA 3KH5A 1Y5HA 5LXQA 3TDHC 3KPDA 3OCOA 3K2VA 4DQWA 4L27A 2EF7A 4FXSA 3KPCA 4L3VA 3L31A 4FRYA 3HF7A 3LV9A 4GQWA 3I8NA 4IY3A 2OOYE 3FWRA 2UV4A 4P1OA 2OOXE 1PVMA 3LHHA 2NYEA 3K6EA 3GBYA 4PCUA 3KPBA 2RIHA 2RIFA 3PC2A 2OUXA 4UUUA 3TE5C 2EMQA 4IY4A 4COOA 4HG0A 5MMZA 4GQVA 2YVZA 3DDJA 3L2BA 4IY0A 2UV7A 1XKFA 2YVYA 2PFIA 2UV5A 4O9KA 3PC4A 5K24C 4NOCA 1YAVA 4IYSA 4ESYA 2QRDE 2QREE 3OCMA 4L28A 5K22B 3KXRA 2J9LA 4IY2A 2YZQA 1O50A 4P1GA 3OI8A 1PBJA 5IIPA 2QH1A 3LQNA 2QLVC 2ZY9A
chains in the Genus database with same CATH topology
2D4ZA 2JA3A 3PC3A 5KS7A 2YVXA 3FV6A 5K23C 2RC3A 2QR1E 4GQYA 2YZIA 3FWSA 3SL7A 4ESYB 4L0DA 2QRCE 3ORGA 2UV6A 3FHMA 2NYCA 5K25C 3LFZA 3T4NC 3FNAA 2O16A 2P9MA 3KH5A 1Y5HA 5LXQA 3TDHC 3KPDA 3OCOA 3K2VA 4DQWA 4L27A 2EF7A 4FXSA 3KPCA 4L3VA 3L31A 4FRYA 3HF7A 3LV9A 4GQWA 3I8NA 4IY3A 2OOYE 3FWRA 2UV4A 4P1OA 2OOXE 1PVMA 3LHHA 2NYEA 3K6EA 3GBYA 4PCUA 3KPBA 2RIHA 2RIFA 3PC2A 2OUXA 4UUUA 3TE5C 2EMQA 4IY4A 4COOA 4HG0A 5MMZA 4GQVA 2YVZA 3DDJA 3L2BA 4IY0A 2UV7A 1XKFA 2YVYA 2PFIA 2UV5A 4O9KA 3PC4A 5K24C 4NOCA 1YAVA 4IYSA 4ESYA 2QRDE 2QREE 3OCMA 4L28A 5K22B 3KXRA 2J9LA 4IY2A 2YZQA 1O50A 4P1GA 3OI8A 1PBJA 5IIPA 2QH1A 3LQNA 2QLVC 2ZY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D4Z A;  3PC3 A;  5KS7 A;  2YVX A;  3FV6 A;  5K23 C;  2RC3 A;  2QR1 E;  4GQY A;  2YZI A;  3FWS A;  3SL7 A;  4ESY B;  4L0D A;  2QRC E;  3ORG A;  2UV6 A;  3FHM A;  2NYC A;  5K25 C;  3LFZ A;  3T4N C;  3FNA A;  2O16 A;  2P9M A;  3KH5 A;  1Y5H A;  5LXQ A;  3TDH C;  3KPD A;  3OCO A;  3K2V A;  4DQW A;  4L27 A;  2EF7 A;  4FXS A;  3KPC A;  4L3V A;  3L31 A;  4FRY A;  3HF7 A;  3LV9 A;  4GQW A;  3I8N A;  4IY3 A;  2OOY E;  3FWR A;  2UV4 A;  4P1O A;  2OOX E;  1PVM A;  3LHH A;  2NYE A;  3K6E A;  3GBY A;  4PCU A;  3KPB A;  2RIH A;  2RIF A;  3PC2 A;  2OUX A;  4UUU A;  3TE5 C;  2EMQ A;  4IY4 A;  4COO A;  4HG0 A;  5MMZ A;  4GQV A;  2YVZ A;  3DDJ A;  3L2B A;  4IY0 A;  2UV7 A;  1XKF A;  2YVY A;  2PFI A;  2UV5 A;  4O9K A;  3PC4 A;  5K24 C;  4NOC A;  1YAV A;  4IYS A;  4ESY A;  2QRD E;  2QRE E;  3OCM A;  4L28 A;  5K22 B;  3KXR A;  4IY2 A;  2YZQ A;  1O50 A;  4P1G A;  3OI8 A;  1PBJ A;  5IIP A;  2QH1 A;  3LQN A;  2QLV C;  2ZY9 A; 
#chains in the Genus database with same CATH topology
 2D4Z A;  2JA3 A;  3PC3 A;  5KS7 A;  2YVX A;  3FV6 A;  5K23 C;  2RC3 A;  2QR1 E;  4GQY A;  2YZI A;  3FWS A;  3SL7 A;  4ESY B;  4L0D A;  2QRC E;  3ORG A;  2UV6 A;  3FHM A;  2NYC A;  5K25 C;  3LFZ A;  3T4N C;  3FNA A;  2O16 A;  2P9M A;  3KH5 A;  1Y5H A;  5LXQ A;  3TDH C;  3KPD A;  3OCO A;  3K2V A;  4DQW A;  4L27 A;  2EF7 A;  4FXS A;  3KPC A;  4L3V A;  3L31 A;  4FRY A;  3HF7 A;  3LV9 A;  4GQW A;  3I8N A;  4IY3 A;  2OOY E;  3FWR A;  2UV4 A;  4P1O A;  2OOX E;  1PVM A;  3LHH A;  2NYE A;  3K6E A;  3GBY A;  4PCU A;  3KPB A;  2RIH A;  2RIF A;  3PC2 A;  2OUX A;  4UUU A;  3TE5 C;  2EMQ A;  4IY4 A;  4COO A;  4HG0 A;  5MMZ A;  4GQV A;  2YVZ A;  3DDJ A;  3L2B A;  4IY0 A;  2UV7 A;  1XKF A;  2YVY A;  2PFI A;  2UV5 A;  4O9K A;  3PC4 A;  5K24 C;  4NOC A;  1YAV A;  4IYS A;  4ESY A;  2QRD E;  2QRE E;  3OCM A;  4L28 A;  5K22 B;  3KXR A;  2J9L A;  4IY2 A;  2YZQ A;  1O50 A;  4P1G A;  3OI8 A;  1PBJ A;  5IIP A;  2QH1 A;  3LQN A;  2QLV C;  2ZY9 A; 
#chains in the Genus database with same CATH homology
 2D4Z A;  2JA3 A;  3PC3 A;  5KS7 A;  2YVX A;  3FV6 A;  5K23 C;  2RC3 A;  2QR1 E;  4GQY A;  2YZI A;  3FWS A;  3SL7 A;  4ESY B;  4L0D A;  2QRC E;  3ORG A;  2UV6 A;  3FHM A;  2NYC A;  5K25 C;  3LFZ A;  3T4N C;  3FNA A;  2O16 A;  2P9M A;  3KH5 A;  1Y5H A;  5LXQ A;  3TDH C;  3KPD A;  3OCO A;  3K2V A;  4DQW A;  4L27 A;  2EF7 A;  4FXS A;  3KPC A;  4L3V A;  3L31 A;  4FRY A;  3HF7 A;  3LV9 A;  4GQW A;  3I8N A;  4IY3 A;  2OOY E;  3FWR A;  2UV4 A;  4P1O A;  2OOX E;  1PVM A;  3LHH A;  2NYE A;  3K6E A;  3GBY A;  4PCU A;  3KPB A;  2RIH A;  2RIF A;  3PC2 A;  2OUX A;  4UUU A;  3TE5 C;  2EMQ A;  4IY4 A;  4COO A;  4HG0 A;  5MMZ A;  4GQV A;  2YVZ A;  3DDJ A;  3L2B A;  4IY0 A;  2UV7 A;  1XKF A;  2YVY A;  2PFI A;  2UV5 A;  4O9K A;  3PC4 A;  5K24 C;  4NOC A;  1YAV A;  4IYS A;  4ESY A;  2QRD E;  2QRE E;  3OCM A;  4L28 A;  5K22 B;  3KXR A;  2J9L A;  4IY2 A;  2YZQ A;  1O50 A;  4P1G A;  3OI8 A;  1PBJ A;  5IIP A;  2QH1 A;  3LQN A;  2QLV C;  2ZY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...