2PFYA

Crystal structure of dctp7, a bordetella pertussis extracytoplasmic solute receptor binding pyroglutamic acid
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
301
structure length
301
Chain Sequence
b'ATSWTMTAEQPDANYLTQNARQFADEVKAATAGALEIKVQSNSTLLKRPEVKRGVQQGVVQIGEVLVSALGNEDPLFEIDSVPFLASSFNESEKLWKATRPLLAQRLDKQGIVLVYGSPWPPQGIYTKKPVAALADLKGTRFRAYSASTSHMAALMGAVPTTVQTPEVPQAFSTGVIDAMLTSPATGVDSQAWDYVKYYYDAQAFIPQSFVIANKRAFQRLPAEVRQAVLDAGAKAEIRGWQTARAKTRELTDTLARNGMSVEPLPPQLAKELQAIGATMVSDWSKKAGADGQQLLDAYRKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative exported protein
publication title Crystal Structures of two Bordetella pertussis Periplasmic Receptors Contribute to Defining a Novel Pyroglutamic Acid Binding DctP Subfamily.
pubmed doi rcsb
source organism Bordetella pertussis tohama i
molecule tags Transport protein
total genus 113
structure length 301
sequence length 301
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2pfyA00
4NN3A 2V4CA 4PFRA 4NAPA 4MX6A 4MNCA 4OVQA 5IGAA 4YICA 2PFYA 2HZLA 4N17A 3FXBA 3B50A 2ZZWA 4N8YA 4NHBA 4YZZA 4NX1A 4XFEA 5LTCA 2PFZA 4NGUA 4P8BA 4N6DA 4MAGA 4PDHA 2HZKA 5IM2A 4MNIA 4PF8A 2ZZVA 4P1LA 4OVRA 4P47A 4PAIA 4N91A 4NG7A 2XWKA 2WYPA 4OVSA 4PGPA 4O8MA 4XF5A 4N6KA 4MHFA 5I7IA 4PGNA 4MNPA 5CM6A 4XEQA 4X8RA 4N15A 5IZZA 4MMPA 4P3LA 4DI3D 4PC9A 2WX9A 4PBQA 4PETA 2WYKA 4PF6A 4PFIA 4PE3A 2HPGA 2XWOA 4P56A 4UABA 4PAKA 4OVTA 4DI4B 4PAFA 4PCDA 2CEYA 4OANA 2XXKA 4PFBA 3GYYA 4N8GA 2VPOA 5I5PA 2ZZXA 4MEVA 2VPNA 4PDDA 4PBHA 2XWVA 4O94A 4OVPA 4LN5A 2CEXA 3U65A 4X04A 4MCOA 2XWIA 2XA5A 4MIJA 4NF0A 4N4UA 4O7MA 4P9KA 4P1EA 4OA4A 4NQ8A
chains in the Genus database with same CATH superfamily
1OVBA 1JEVA 2M8CA 5I56B 2UVJA 4RPNA 2H25A 1GV8A 4R6HA 1JVYA 1B3GA 5H8QB 4M1VA 4JVCA 1M5EA 4H5GA 5EHMA 2NUVA 5F1QA 4YZZA 3QMFA 4XFEA 1QUIA 1SYHA 1FPGA 2Y7WA 4F3PA 5K2XA 2Y7KA 1ZMGA 3T66A 5DVIA 2MKZA 3VXCA 1ZBMA 3LUZA 4OFLA 1FPDA 2DDKA 3BIHA 4FAJA 2WYPA 1LCTA 4ZEKA 4WKMA 1DPEA 1MM7A 1DBZA 1BIYA 1ZKBA 1B52A 2AL4A 1GTKA 2VT5A 1Y3NA 2GFEA 3EKIA 4P3LA 1N76A 2P0SA 4E0XA 3O66A 1B2HA 3K0VA 3IK6B 1YTVA 5IZ3B 3MVZA 3QIMA 2Z8FA 5AA2D 5I59B 2PX1A 4AS4A 4PE3A 2XWOA 1FBEA 1PBQA 4U4SA 3E79A 1GGGA 4ZDMA 4KFQA 1QGXA 3K1NA 2O1MA 3KJ7A 1N3WA 4H8JA 1NUWA 2XHDA 4AQ4A 1IMFA 2HQ0A 4JXIA 3C32A 4N8GA 1Y4TA 1QW0A 4O94A 2E0SA 5CMKA 4XTCQ 2I49A 3ONMA 4I40A 4MCOA 2Z22A 1OMPA 2DWAA 2Y7PA 1IQ7A 3T1BA 4PFRA 4N07A 4GLIA 3CRBA 1LAFE 3P7IA 1US4A 3QXMA 3TTRA 5EQ7A 4F31B 3OEKA 4R9FA 3PGFA 3TQWA 3VLWA 3KC0A 3G3FA 1B0LA 1IMCA 2XX7A 5LTCA 3Q27A 3KJTA 3ILUB 4R6KA 4F22A 2HZKA 1NL5A 2DS9A 2QMWA 1NNKA 1B1XA 1M5BA 2ZNSA 4ECFA 3MP8A 5L8DA 4DE8A 5H8HB 4LA9A 4IGRA 3A3CA 4HCYA 4AB5A 5IAIA 3FXQA 5FBPA 4XEQA 3PPQA 3E13X 4QF9A 5EQ9A 2DE2A 3FBPA 2A5TA 4G4PA 2R9JA 3OO6A 4IY5A 1QKBA 3N94A 4P0GA 3MW0A 1UIVA 1M5FA 4N13A 1UTHA 2ZYKA 5TP9B 5M2VA 3H03A 3K1PA 4LVQA 4OVTA 3LV0A 4KXPA 3OEMA 2PT1A 4RA1A 5ITPA 3CG1A 3TTLA 3QK6A 3O6HA 3FUZA 4MFIA 5DVFA 5ET7A 1TFDA 1NUZA 2VPNA 3K01A 4NF8A 1FCKA 2OBGA 3MVWA 4ESWA 4PE5B 3G3GA 1OLCA 5I3SA 2QS3A 4TLMB 3SZPA 3CIJA 2FHYA 2QS2A 4ISUA 3DM0A 1MXWA 4OA4A 5EHSA 3EQ1A 3CG3A 4DXBA 2F6PA 4IY6A 3HFUA 1NH8A 2UVIA 1FTAA 3T22A 4EDPA 3RTWB 1INPA 1H76A 4FBPA 5I2NA 3WAEA 4RJZA 4I62A 4I8CA 5ET6A 2UYEA 3EHUA 1FPJA 3F11A 4GWUA 1PBPA 2OWTA 1B1HA 1FBGA 1MRPA 3SERA 3PMVA 4M4GA 4N6KA 3GLBA 1MXYA 4YB7A 2AL5A 4F29A 2Y5LA 4QHQA 5ET8A 1JETA 2Q9TA 1URDA 4KI0E 1P1NA 5IZZA 3V5AA 4MMPA 1OLAA 3K2DA 4G8NA 1G0IA 4R72A 2WYKA 2DVZA 4HXVA 3O29A 4YKKA 4GWXA 1L5TA 4KHZE 4QFKA 2HXRA 1MPCA 3USDA 5I57A 2FBPA 3PU5A 2REJA 3OO8A 1SW1A 4GBVA 1FTKA 2OLBA 1I69A 3VXBA 2HAUA 1NV4A 4MIJA 2I4CA 4QSCA 3GBBA 1LEVA 1IMDA 4OESA 4OVQA 1US5A 2DXRA 3RTFB 1A40A 1KA0A 3PV0E 4FJPA 4KR5A 4X1BA 1LGBC 4UACA 1B58A 3CFXA 1MXVA 1FPKA 1T0KA 1FBCA 4NGUA 4P8BA 2AIXA 3K6UA 1B7ZA 3A3UA 3SEYA 4POWA 3U94A 2G29A 4HW8A 1YXIA 2P3VA 3TEPA 1EZ9A 1SW2A 4QFOA 1VE4A 3THIA 4JWXA 2B65A 3N6UA 4EF2A 5TPAA 4PGNA 2DOJA 4IO6A 3TAJA 4BDRA 1ZLQA 3D4CA 3OSRA 3U92A 4IO7A 4ELQA 2QFLA 3OELA 4N15A 2V3UA 3IFAA 1RYOA 4U23A 1LBZA 3ZS6A 4EXKA 2BJJX 2I3VA 1URGA 5L9MA 5ISUA 4NF4B 3VV5A 3MZ9A 4KQPA 1Y1MA 4LZ8A 3C34A 4KD5A 4PAFA 1SDXA 3N26A 4I3YA 4XKQA 1JW1A 3MVXA 3M3LA 2P3NA 3HO7A 4R2BA 2XWVA 1JQFA 1O7TA 3H6UA 1FQAA 3TQLA 1DK4A 1SVXB 2NWJA 1DMBA 2KQZA 3T9UA 3PUWE 3MBPA 4DCXA 1BK4A 1URSA 2Q2AA 5H8SA 3RYDA 4FATA 4AS5A 4MF3A 5IGAA 4GWZA 2D5WA 3B50A 1JEUA 4PP0A 4N8YA 3EHTA 4UA8A 4NHBA 5CMMA 4IO3A 4F1VA 3PPPA 4OTEA 4DLDA 3S9LC 3MPKA 1LBCA 1EYJA 3KFMA 1XI6A 1B32A 3KN3A 4N81A 2F3DA 3KZGA 3T9VA 1B05A 1R9QA 4GX6A 1MQGA 1XHYA 3FGSA 2F8DA 3FIRA 4GBWA 2XX8A 5ET5A 4KCDA 4EUOA 4GFRA 3GBAA 3SDFA 5KZTA 1I6AA 2Q2CA 1B51A 2HEUA 4PFYA 5CRYA 3VLVA 5JTYA 2RF1A 4JWOA 4F1UA 2HAVA 3S9EA 5A5XA 1AWBA 4PTKA 1DOTA 2DQVA 1H3DA 3RPLB 2Q8MA 3C4MA 4JVDA 2F7AA 4NMYA 1USYE 3RY3A 1FRPA 2XXKA 4ZEBA 3GYYA 3MPLA 4XKRA 1SD3A 3K6VA 4MEVA 3MP1A 1MY1A 4FE8A 1DPPA 2DXYA 1B3FA 1S50A 1XS5A 2VD2A 3TFLA 1R6ZA 5FHNA 3U93A 1P1WA 2V4CA 1N7WA 4OQOA 2IA4A 4MNCA 1A8EA 4BLAA 3PPOA 4FORA 4N17A 1RKMA 3IOTA 4THIA 5FHMA 1B3EA 4KPTA 3T9XB 4C1TA 4I1DA 3W9WA 5H8NB 2Y5KA 4H8IA 1LAGE 1PEBA 1PB9A 1FQCA 3HHGA 5CBSA 1MXZA 3Q28A 5H8FA 4OFJA 4NF5A 1EYKA 4ZEIA 1MG1A 1SI1A 4O8MA 3G3HA 4U1ZA 4MLQA 1R1NA 2Q74A 2XX9A 2Z23A 2Z8DA 4I3EA 4NE4A 5I56A 4AB6A 2AYSA 4OETA 4OHNA 4PF6A 3QYTA 5H8QA 1USYH 4ONYA 3C9HA 3KOSA 4QFPA 3PMWA 5JK4A 1WDNA 2RCBA 1FTLA 3A29A 3OXNA 4NTLA 2BJIA 1O63A 2B4MA 4EXLA 3IO4A 1FPBA 1PDAA 4PDDA 1BP5A 3JYRA 4NF6A 1B4HA 2QMXA 1Q9DA 2ONKE 2PVUA 2Q88A 3H4ZA 3OMBA 1KWHA 1G0HA 4IGTA 2PFYA 3IB1A 3FJ7A 3PUXE 4ZS9A 4YB5A 3UORA 1RYXA 2Y7RA 3PPNA 2GRVA 1JW4A 2HHMA 4QSDA 5IZ3A 2I58A 4U21A 5I59A 4NX1A 1CB6A 3RPWA 1IIWA 1TWYA 3TDJA 4H46A 1QUJA 3RN8A 1RDXA 4P47A 3JZJA 4U4XA 4Q8RA 1I6BA 4ZZAA 4G2ZA 4OVSA 2R8TA 4PGPA 2WBBA 3C36A 1FBPA 3R6UA 2FA7A 3HPIA 1B3HA 4PQJA 2QVRA 1DTZA 3ECRA 5FTHA 3L6HA 4G68B 3V89B 1EYIA 4Q0CA 3IL1B 1Y3QA 5B7DA 1MH3A 2QVUA 3H3GA 4UABA 3BFUA 4WEPA 1B40A 1IXCA 5ICQA 2RC8A 3HSTA 1IXHA 2R6GE 3B6QA 1M5CA 1XOCA 2VPOA 3CI8A 3KSXA 2F97A 4RNSA 1EU8A 1LFHA 5BWJA 5H8HA 4XIGQ 2H98A 3SKPA 3H06B 1I6QA 1YAEA 3UA8A 3PUVE 1YZ0A 1AIVA 4I9DA 4H67A 4JSOA 1O64A 1A7LA 1ATGA 4MJOA 5TU0A 4Q5TA 2Q8JA 4R2FA 5I2KB 3FV1A 5KCJB 1NKXA 4OERA 4P0IA 3FVKA 2OX3A 2ZYNA 3KN8A 3WAFA 4TLLB 3VDFA 3KSJA 2ALUA 3UP9A 1MDQA 1OQGA 1N0TA 4IO2A 3ILTB 2NVUB 1IZ1A 3ZKKA 2VHAA 5CBRA 1B0HA 2NXOA 1JP4A 1NV7A 3EHSA 5AA3A 1QKAA 1LFGA 1FPIA 4PC9A 3JV9A 3G3IA 4RXLA 4F1YA 2O51A 2V84A 4G61A 2ABHA 1NV1A 1GR2A 3KOTA 2Z8EA 5A5LA 4KYDA 3N5LA 3RQTA 1PC3A 3RLFE 1ZU0A 2O84X 2W7YA 1P99A 3E9XA 3G3KA 3RT8A 2XXPA 5F24A 1DSNA 1XT8A 4X48A 4NF0A 3W15C 1NUYA 1A54A 4QFNA 2ZYOA 3OO9A 3QUFA 4OVJA 1B7UA 4NAPA 4BDQA 2HCAA 3HN0A 1OQHA 4IO4A 4YKIA 2V25A 1A55A 1ZJLA 4ND9A 2I0BA 2ANJA 3EPEA 3M3FA 4OMBA 2HZLA 1NV6A 3FXBA 3N6TA 5DVJA 3KEIA 4IR8A 3IOWA 4FIMA 3W9VA 5LDZA 3CFLA 3S4UA 1AL3A 4G8HA 3SEWA 4DZ1A 1Y20A 4PFWA 1CNQA 1ZTYA 3BBRA 4BDOA 2XXUA 3PTYA 1MXXA 1FBDA 2O68A 2OCUA 4NWDA 3SETA 1FSAA 3UGWA 2ONRA 3DLNA 3UIFA 3LC8A 4YB6A 2R71A 4DI3D 2WX9A 1SBPA 2LAOA 2X7PA 3PUYE 1N04A 5TPAB 4ZZEA 5I84A 1AMFA 1PB7A 2XXHA 4R9GA 3VVDA 1IXIA 2OJTA 4ZE9A 1WVJA 2THIA 4GXAA 2ZZXA 2DWIA 4PBHA 5DEXA 3TTKA 4P11A 4LZ5A 3U65A 3TKDA 4LQ2A 2D21A 4GX3A 1Z7NE 2B3BA 3OOAA 1MS7A 3IB0A 3U1OA 1MH4A 5KDTB 1RDZA 3TYHA 2ZXTA 5I58A 1Q1KA 2V93A 5FTIA 1UTBA 2YLNA 4JVIA 2GH9A 3DELB 5CMBA 5EYHA 5AA1A 2FNCA 1POY1 4BDNA 4MAGA 2YPNA 4NF4A 5AA2B 5EQ8A 2RCAA 1LBWA 2PT2A 4JWYA 3A09A 1NNTA 3EF7A 4GWYA 4HTGA 3HCQA 4HE0A 4F3BA 1M5DA 1SQYA 3HV1A 3ZSFA 5ITOA 3HHFA 1XVXA 2DWJA 1SYIA 3OD7A 2DE4A 3K4UA 1AH5A 4TOZA 3PUZE 2OWZA 4EQ7A 4R74A 2CZIA 2F7BA 1LCFA 1JW5A 2F7CA 1D4NA 2F34A 2QVVA 4F2OA 3PMXA 3QUJA 2ZMBA 4DI4B 1Y1ZA 1D9QA 3O6GA 3VLUA 1ELJA 1NMUA 4H65A 1FW0A 1II5A 1MPBA 3MZ1A 3VE1B 5L9OA 4X04A 4IB2A 3E78A 4YMBA 4ZE8A 4MLVA 3SEVA 3FVNA 1DCUA 4GIZA 3BKIB 2F3BA 4GF8A 1IMAA 3PD8A 3PPRA 3ISPA 1LAXA 4ZECA 1A99A 5HPQA 3TTNA 4N6DA 1NFTA 2XXWA 4O3BA 3B6TA 3RPLA 3TPAA 1MY2A 4N6PA 3V8XB 2QSXA 4OXVA 5ESYA 3NOHA 3I6VA 4NEDA 4FECA 3BIGA 4OEUA 2UYFA 4ELPA 5AA4B 1FJ9A 2QRYA 5HM4B 3LSFB 1PB8A 5CC2A 1NI9A 4MH5A 1H45A 1SW4A 4GWSA 1MM6A 3V83A 3CFZA 5LOMA 4R75A 1JVXA 1NV0A 3MYUA 2GHAA 4KYEA 2XXQA 2QS1A 1BTJA 3ODBA 2DE3A 4PFIA 1LFIA 4L17A 5J1DA 2NOOA 4BDLA 1N84A 1FJ6A 4JB7A 5J16A 2WBDA 4PCDA 5H8NA 2H99A 4DXUA 1B3LA 2KR0A 3SEUA 3D1RA 1FQDA 4LN5A 3IX1A 3MZBA 1HSJA 5DYHA 1LBYA 3TTMA 3E3KA 3BFTA 1P1OA 4MX6A 1D9VA 1LBBA 1VR5A 1FPFA 1K9YA 3U8QA 1DTGA 4ZEFA 2F35A 3O9PA 2VOZA 2V3TA 4OEVA 2ZZWA 3R7XA 4NF6B 3IO6A 3SESA 1MXUA 1S9TA 3OENA 3GXAA 1MQHA 4Q30B 3KGCA 4GL0A 1EZPA 3FXRA 1ANFA 2WEFA 1POTA 2O69A 3Q29A 4G77A 2Y84A 4F18A 2I0CA 2ZZVA 4LP2B 4HE1A 3CR9A 4GWOA 1Q35A 1MY0A 3AXFA 5ICTA 4H45A 2V3QA 5CMCA 4XF5A 2I4BA 2I6EA 5JEIA 4MHFA 3B8BA 1LB9A 1UIUA 1FQFA 3DP8A 4O7IA 3O6IA 1AOVA 4GXSB 1S7YA 3K02A 5HBCA 4PBQA 2QPQA 3DP6A 1NNFA 1B6HA 4LONB 2I3WA 1N3XA 1NUXA 2HPGA 3FASA 3KG2A 5EYGA 2L5VA 1LBVA 5EYFA 1UQWA 3K6XA 2UVGA 2XD2A 2YJPA 4IO5A 1IITA 3PD9A 1FQBA 2CEXA 1A8FA 3LBSA 3RNNA 5T3JA 1LSTA 1NV3A 1SI0A 4GD5A 1JNFA 1FTOA 3L6GA 1NNPA 3MQ9A 1IEJA 4NQ8A 2A5TB 1VDWA 3H6VA 4NN3A 2PYYA 2GHBA 3IR1A 1QUKA 4YICA 1YYZA 4QSEA 1UTHB 2XXYA 4G68A 4GWWA 3TCHA 1N7XA 1LLSA 3RGYA 1MQIA 4QRZA 2RC9A 3KBRA 3FATA 3IB2A 4WXJA 2PFZA 1F9BA 1IXGA 5K2YA 4YMAA 4QBAA 1QJMA 2VD3A 2CZLA 2RINA 1BLFA 3K1MA 4PF8A 3K00A 4NF8B 2VGQA 4ELRA 1TT1A 4U1OA 2JJKA 3OSQA 2DYXA 2XWKA 1MQDA 2CZHA 2FIEA 3CSBA 1MY4A 2RKMA 3TELA 1ZIUA 2E1SA 4OENA 1H43A 2DVCA 4F3GA 2X7QA 4HCWA 5TP9A 1YPNA 4GQOA 5B70A 4KCCA 3LSLA 3TZAA 4LATA 4HS7A 1FBHA 4OYVA 5I2NB 4C0RA 4ESXA 5DTBA 4MBPA 3ROJA 3I3VA 4PAKA 5I2KA 1LB8A 5KCJA 2HFBA 3CSGA 3OO7A 4Z7EA 4R6YA 2G93A 3FVGA 2XXVA 5BUUA 1MY3A 4PFBA 3Q25A 3S2VA 2O1LA 3K6WA 2RC7A 4LZ7A 2HXWA 2QL3A 3G7WA 1B9JA 3FV2A 1J1NA 2O6AA 2XA5A 1MDP1 2VP1A 2REGA 3C31A 5L9SA 3MVYA 4P1EA 1IMBA 1GVCA 3QAXA 1SPIA 2OK2A 4F19A 2IEEA 4WEDA 2P1SA 2XXIA 2UXAA 2H4IA 1LBXA 3IOVA 1NV2A 2DSFA 3UK4A 3DP4A 5I57B 4X9TA 1FPEA 3B7DA 3RUMA 4F3SA 4TQUQ 2OZZA 3T9HB 1VFEA 2FYIA 3FJMA 2ONSA 3FZVA 4K3FA 4P1LA 1IUDA 3FJGA 4PAIA 4N91A 4NG7A 3LSXA 5F7VA 1P1QA 1QULA 4EF1A 5I7IA 3H6WA 5CI5A 4POXA 2FVZA 3Q26A 4PETA 1YCJA 4F2QA 3IOUA 4GRKA 1QVSA 1B7HA 4X1DA 2OWSA 2PBWA 2Y7IA 2F36A 1EH3A 3VVEA 3CVGA 3FD3A 4GX4A 5AE4A 4OFOA 1Y3PA 4O3CA 3MJNA 4O3AA 2P2AA 1XC1A 4RPOA 4EQ9A 3KC1A 3MP6A 4ELOA 4FEBA 3UN6A 2WKYA 3H6TA 2B4LA 3LR1A 5FHOA 1FTMA 2XWIA 4GVOA 3KN7A 4N4UA 4ZEDA 4P9KA 2QS4A 3MAMA 5DEXB 2D3IA 5ELVA 2A5SA 1B5JA 3MUQA 1B4ZA 3LSWA 4GL8A 3CHGA 2GQ1A 3MC2A 2PCRA 3MWBA 2ESNA 4U22A 1OIBA 3B6WA 4PDHA 5I58B 1H44A 5IM2A 4MNIA 4RK9A 4C1UA 2H5YA 1R9LA 4R73A 3T0JA 2KLFA 1P1UA 2UVHA 1EZOA 4OZ9A 4JBZA 1UTBB 1FBFA 4FEDA 5IZ1A 2F5XA 3M3KA 4QFLA 1MQJA 4F39A 5CM6A 2O7IA 2H9BA 3FXUA 4MNPA 2F78A 1TFAA 4Z0IA 4DIGA 3SEXA 3TCFA 1Y4CA 1VSOA 3O28A 4XKPA 1MPDA 3S9MC 5KDTA 3E4RA 2ZYMA 2FIXA 2I48A 3KBZA 2ZNUA 4LUBA 3O97A 3S9NC 4U2RA 1LAHE 3I5OA 4BDMA 4QXDA 1IMEA 3ZKLA 2CEYA 3TCGA 4OANA 3U72A 1D3KA 5AA2A 4PFTA 2B3FA 4H0WA 3VVFA 4G8MA 2X26A 1TXFA 5IKBA 4OVPA 3TUSA 3VFJA 2QJEA 2F6GA 3TODA 4GOTA 4O7MA 1WODA 1B5HA 5DW8A 1NV5A 3IAZA 1VFDA 4DCYA 2CMOA 3D4GA 1NH7A 2DWHA 4YKJA 5JTYB 4DXCA 3T96B 3C35A 4OWDA 5A5XB 3MSTA 1Y9UA 2XXTA 1D9YA 1FQEA 4KYSA 3FVOA 1BKAA 3H7MA 3IFCA 4HE2A 4H1XA 5DT6A 3T93B 3R26A 1Z7ME 2XXXA 4RK2A 3LUYA 1HSEA 4OVRA 3M8UA 4YU0A 2ZNTA 4LQ5A 3QSLA 1OVTA 4DDDA 4YAHX 4JDFA 4RY1A 5EQAA 1HSLA 2CZKA 1RDYA 3G3JA 4X8RA 3C33A 3IJXB 4EQBA 4H5FA 2Q89A 2O7UA 4RYAA 4XXUA 1FPLA 4JSDA 4YKPA 3O2AA 1CE2A 3RT6B 4P56A 1FTJA 2XD3A 4XKNA 1KA1A 4G68C 3EN3A 5H8FB 3TMGA 3GZGA 4NF5B 4H6DA 4NWCA 1B46A 2XXRA 1B5IA 5I5PA 1KZ8A 1K9ZA 3IJOB 1XVYA 2PMSA 4PFUA 3IORA 2DP8A 4E0WA 1SW5A 5AA4A
chains in the Genus database with same CATH topology
4NN3A 4NAPA 4AS5A 5IGAA 4YICA 1YYZA 4GWZA 2HZLA 1NV6A 3FXBA 4GWWA 3B50A 4N8YA 4M1VA 4JVCA 4NHBA 4IR8A 4YZZA 3QMFA 4F1VA 4XFEA 3W9VA 5LDZA 2PFZA 1FPGA 4QBAA 1EYJA 1XI6A 2MKZA 4PF8A 4N81A 1CNQA 2F3DA 3LUZA 1FPDA 2DDKA 3BIHA 2JJKA 2XWKA 4GX6A 3PTYA 2WYPA 1FBDA 2CZHA 2FIEA 1DBZA 4GBWA 4HCWA 1FSAA 2VT5A 5ET5A 3EKIA 4P3LA 4DI3D 2WX9A 5IZ3B 1FBHA 4AS4A 4F1UA 4PE3A 1AWBA 2XWOA 4PTKA 1FBEA 3ROJA 4PAKA 3RPLB 2Q8MA 3E79A 4JVDA 1QGXA 1FRPA 2XXKA 4PFBA 1NUWA 3GYYA 1IMFA 4N8GA 2ZZXA 4MEVA 4PBHA 4O94A 3U65A 4GX3A 4I40A 4MCOA 2XA5A 4P1EA 1IMBA 3T1BA 2V4CA 4PFRA 1SPIA 4MNCA 1RDZA 5EQ7A 4F19A 4N17A 3KC0A 1LBXA 4JVIA 1NV2A 3W9WA 1IMCA 5EYHA 4X9TA 5LTCA 2Y5KA 1FPEA 4MAGA 2HZKA 5EQ8A 1LBWA 4P1LA 4PAIA 1EYKA 4N91A 4GWYA 4NG7A 4HE0A 4O8MA 4HCYA 5FBPA 5I7IA 4XEQA 2Q74A 2DE4A 5EQ9A 2DE2A 2OWZA 3FBPA 4I3EA 2FVZA 2CZIA 4PETA 4PF6A 2QVVA 5JK4A 4GX4A 4OVTA 4DI4B 3LV0A 4KXPA 3A29A 1D9QA 2BJIA 2B4MA 5ET7A 3KC1A 1FPBA 1NUZA 2VPNA 4PDDA 2B4LA 4X04A 5I3SA 2XWIA 3SZPA 4N4UA 2FHYA 4P9KA 3E78A 4OA4A 1Q9DA 1DCUA 1G0HA 2PFYA 2F3BA 1IMAA 3HFUA 3ISPA 3CHGA 2GQ1A 2PCRA 1FTAA 2HHMA 5IZ3A 1INPA 4NX1A 4FBPA 4N6DA 4PDHA 5ET6A 3RPLA 5IM2A 4MNIA 1FPJA 4H46A 4GWUA 3T0JA 1RDXA 4P47A 1FBFA 1FBGA 5ESYA 3NOHA 5IZ1A 2F5XA 4OVSA 4PGPA 2R8TA 2WBBA 3BIGA 4N6KA 1FBPA 1FJ9A 5CM6A 4MNPA 1NI9A 2Y5LA 5ET8A 4GWSA 2Q9TA 2QVRA 5IZZA 4MMPA 1G0IA 1EYIA 1NV0A 3MYUA 2WYKA 2DVZA 2FIXA 4HXVA 3KBZA 2DE3A 4PFIA 4GWXA 2QVUA 5J1DA 4UABA 2HXRA 4QXDA 1IMEA 1FJ6A 5J16A 2WBDA 4PCDA 2FBPA 2CEYA 4OANA 2KR0A 2VPOA 4GBVA 4OVPA 3D1RA 4LN5A 1NV4A 4MIJA 4O7MA 1LBYA 5DW8A 1YZ0A 1NV5A 1LEVA 1IMDA 4MX6A 4OVQA 1FPFA 1K9YA 4MJOA 1KA0A 2ZZWA 3MSTA 1FPKA 1FBCA 2OX3A 3IFCA 4NGUA 4P8BA 4HE2A 2WEFA 4F18A 2ZZVA 4HE1A 4OVRA 1YXIA 2P3VA 4H45A 2V3QA 4XF5A 5EQAA 4MHFA 1JP4A 3B8BA 2CZKA 4PGNA 1NV7A 1RDYA 4X8RA 2QFLA 4N15A 4O7IA 1FPIA 3IFAA 4PC9A 4PBQA 1FPLA 2QPQA 1LBZA 4G61A 1NUXA 1NV1A 2HPGA 4P56A 5A5LA 5EYGA 2L5VA 1KA1A 1LBVA 4PAFA 4I3YA 5I5PA 1KZ8A 2P3NA 1K9ZA 2XWVA 5F24A 2CEXA 1DK4A 2KQZA 5T3JA 1NV3A 4NF0A 1NUYA 1BK4A 3RYDA 4NQ8A 1VDWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NN3 A;  2V4C A;  4PFR A;  4NAP A;  4MX6 A;  4MNC A;  4OVQ A;  5IGA A;  4YIC A;  2PFY A;  2HZL A;  4N17 A;  3FXB A;  3B50 A;  2ZZW A;  4N8Y A;  4NHB A;  4YZZ A;  4NX1 A;  4XFE A;  5LTC A;  2PFZ A;  4NGU A;  4P8B A;  4N6D A;  4MAG A;  4PDH A;  2HZK A;  5IM2 A;  4MNI A;  4PF8 A;  2ZZV A;  4P1L A;  4OVR A;  4P47 A;  4PAI A;  4N91 A;  4NG7 A;  2XWK A;  2WYP A;  4OVS A;  4PGP A;  4O8M A;  4XF5 A;  4N6K A;  4MHF A;  5I7I A;  4PGN A;  4MNP A;  5CM6 A;  4XEQ A;  4X8R A;  4N15 A;  5IZZ A;  4MMP A;  4P3L A;  4DI3 D;  4PC9 A;  2WX9 A;  4PBQ A;  4PET A;  2WYK A;  4PF6 A;  4PFI A;  4PE3 A;  2HPG A;  2XWO A;  4P56 A;  4UAB A;  4PAK A;  4OVT A;  4DI4 B;  4PAF A;  4PCD A;  2CEY A;  4OAN A;  2XXK A;  4PFB A;  3GYY A;  4N8G A;  2VPO A;  5I5P A;  2ZZX A;  4MEV A;  2VPN A;  4PDD A;  4PBH A;  2XWV A;  4O94 A;  4OVP A;  4LN5 A;  2CEX A;  3U65 A;  4X04 A;  4MCO A;  2XWI A;  2XA5 A;  4MIJ A;  4NF0 A;  4N4U A;  4O7M A;  4P9K A;  4P1E A;  4OA4 A;  4NQ8 A; 
#chains in the Genus database with same CATH topology
 1OVB A;  1JEV A;  2M8C A;  5I56 B;  2UVJ A;  4RPN A;  2H25 A;  1GV8 A;  4R6H A;  1JVY A;  1B3G A;  5H8Q B;  4M1V A;  4JVC A;  1M5E A;  4H5G A;  5EHM A;  2NUV A;  5F1Q A;  4YZZ A;  3QMF A;  4XFE A;  1QUI A;  1SYH A;  1FPG A;  2Y7W A;  4F3P A;  5K2X A;  2Y7K A;  1ZMG A;  3T66 A;  5DVI A;  2MKZ A;  3VXC A;  1ZBM A;  3LUZ A;  4OFL A;  1FPD A;  2DDK A;  3BIH A;  4FAJ A;  2WYP A;  1LCT A;  4ZEK A;  4WKM A;  1DPE A;  1MM7 A;  1DBZ A;  1BIY A;  1ZKB A;  1B52 A;  2AL4 A;  1GTK A;  2VT5 A;  1Y3N A;  2GFE A;  3EKI A;  4P3L A;  1N76 A;  2P0S A;  4E0X A;  3O66 A;  1B2H A;  3K0V A;  3IK6 B;  1YTV A;  5IZ3 B;  3MVZ A;  3QIM A;  2Z8F A;  5AA2 D;  5I59 B;  2PX1 A;  4AS4 A;  4PE3 A;  2XWO A;  1FBE A;  1PBQ A;  4U4S A;  3E79 A;  1GGG A;  4ZDM A;  4KFQ A;  1QGX A;  3K1N A;  2O1M A;  3KJ7 A;  1N3W A;  4H8J A;  1NUW A;  2XHD A;  4AQ4 A;  1IMF A;  2HQ0 A;  4JXI A;  3C32 A;  4N8G A;  1Y4T A;  1QW0 A;  4O94 A;  2E0S A;  5CMK A;  4XTC Q;  2I49 A;  3ONM A;  4I40 A;  4MCO A;  2Z22 A;  1OMP A;  2DWA A;  2Y7P A;  1IQ7 A;  3T1B A;  4PFR A;  4N07 A;  4GLI A;  3CRB A;  1LAF E;  3P7I A;  1US4 A;  3QXM A;  3TTR A;  5EQ7 A;  4F31 B;  3OEK A;  4R9F A;  3PGF A;  3TQW A;  3VLW A;  3KC0 A;  3G3F A;  1B0L A;  1IMC A;  2XX7 A;  5LTC A;  3Q27 A;  3KJT A;  3ILU B;  4R6K A;  4F22 A;  2HZK A;  1NL5 A;  2DS9 A;  2QMW A;  1NNK A;  1B1X A;  1M5B A;  2ZNS A;  4ECF A;  3MP8 A;  5L8D A;  4DE8 A;  5H8H B;  4LA9 A;  4IGR A;  3A3C A;  4HCY A;  4AB5 A;  5IAI A;  3FXQ A;  5FBP A;  4XEQ A;  3PPQ A;  3E13 X;  4QF9 A;  5EQ9 A;  2DE2 A;  3FBP A;  2A5T A;  4G4P A;  2R9J A;  3OO6 A;  4IY5 A;  1QKB A;  3N94 A;  4P0G A;  3MW0 A;  1UIV A;  1M5F A;  4N13 A;  1UTH A;  2ZYK A;  5TP9 B;  5M2V A;  3H03 A;  3K1P A;  4LVQ A;  4OVT A;  3LV0 A;  4KXP A;  3OEM A;  2PT1 A;  4RA1 A;  5ITP A;  3CG1 A;  3TTL A;  3QK6 A;  3O6H A;  3FUZ A;  4MFI A;  5DVF A;  5ET7 A;  1TFD A;  1NUZ A;  2VPN A;  3K01 A;  4NF8 A;  1FCK A;  2OBG A;  3MVW A;  4ESW A;  4PE5 B;  3G3G A;  1OLC A;  5I3S A;  2QS3 A;  4TLM B;  3SZP A;  3CIJ A;  2FHY A;  2QS2 A;  4ISU A;  3DM0 A;  1MXW A;  4OA4 A;  5EHS A;  3EQ1 A;  3CG3 A;  4DXB A;  2F6P A;  4IY6 A;  3HFU A;  1NH8 A;  2UVI A;  1FTA A;  3T22 A;  4EDP A;  3RTW B;  1INP A;  1H76 A;  4FBP A;  5I2N A;  3WAE A;  4RJZ A;  4I62 A;  4I8C A;  5ET6 A;  2UYE A;  3EHU A;  1FPJ A;  3F11 A;  4GWU A;  1PBP A;  2OWT A;  1B1H A;  1FBG A;  1MRP A;  3SER A;  3PMV A;  4M4G A;  4N6K A;  3GLB A;  1MXY A;  4YB7 A;  2AL5 A;  4F29 A;  2Y5L A;  4QHQ A;  5ET8 A;  1JET A;  2Q9T A;  1URD A;  4KI0 E;  1P1N A;  5IZZ A;  3V5A A;  4MMP A;  1OLA A;  3K2D A;  4G8N A;  1G0I A;  4R72 A;  2WYK A;  2DVZ A;  4HXV A;  3O29 A;  4YKK A;  4GWX A;  1L5T A;  4KHZ E;  4QFK A;  2HXR A;  1MPC A;  3USD A;  5I57 A;  2FBP A;  3PU5 A;  2REJ A;  3OO8 A;  1SW1 A;  4GBV A;  1FTK A;  2OLB A;  1I69 A;  3VXB A;  2HAU A;  1NV4 A;  4MIJ A;  2I4C A;  4QSC A;  3GBB A;  1LEV A;  1IMD A;  4OES A;  4OVQ A;  1US5 A;  2DXR A;  3RTF B;  1A40 A;  1KA0 A;  3PV0 E;  4FJP A;  4KR5 A;  4X1B A;  1LGB C;  4UAC A;  1B58 A;  3CFX A;  1MXV A;  1FPK A;  1T0K A;  1FBC A;  4NGU A;  4P8B A;  2AIX A;  3K6U A;  1B7Z A;  3A3U A;  3SEY A;  4POW A;  3U94 A;  2G29 A;  4HW8 A;  1YXI A;  2P3V A;  3TEP A;  1EZ9 A;  1SW2 A;  4QFO A;  1VE4 A;  3THI A;  4JWX A;  2B65 A;  3N6U A;  4EF2 A;  5TPA A;  4PGN A;  2DOJ A;  4IO6 A;  3TAJ A;  4BDR A;  1ZLQ A;  3D4C A;  3OSR A;  3U92 A;  4IO7 A;  4ELQ A;  2QFL A;  3OEL A;  4N15 A;  2V3U A;  3IFA A;  1RYO A;  4U23 A;  1LBZ A;  3ZS6 A;  4EXK A;  2BJJ X;  2I3V A;  1URG A;  5L9M A;  5ISU A;  4NF4 B;  3VV5 A;  3MZ9 A;  4KQP A;  1Y1M A;  4LZ8 A;  3C34 A;  4KD5 A;  4PAF A;  1SDX A;  3N26 A;  4I3Y A;  4XKQ A;  1JW1 A;  3MVX A;  3M3L A;  2P3N A;  3HO7 A;  4R2B A;  2XWV A;  1JQF A;  1O7T A;  3H6U A;  1FQA A;  3TQL A;  1DK4 A;  1SVX B;  2NWJ A;  1DMB A;  2KQZ A;  3T9U A;  3PUW E;  3MBP A;  4DCX A;  1BK4 A;  1URS A;  2Q2A A;  5H8S A;  3RYD A;  4FAT A;  4AS5 A;  4MF3 A;  5IGA A;  4GWZ A;  2D5W A;  3B50 A;  1JEU A;  4PP0 A;  4N8Y A;  3EHT A;  4UA8 A;  4NHB A;  5CMM A;  4IO3 A;  4F1V A;  3PPP A;  4OTE A;  4DLD A;  3S9L C;  3MPK A;  1LBC A;  1EYJ A;  3KFM A;  1XI6 A;  1B32 A;  3KN3 A;  4N81 A;  2F3D A;  3KZG A;  3T9V A;  1B05 A;  1R9Q A;  4GX6 A;  1MQG A;  1XHY A;  3FGS A;  2F8D A;  3FIR A;  4GBW A;  2XX8 A;  5ET5 A;  4KCD A;  4EUO A;  4GFR A;  3GBA A;  3SDF A;  5KZT A;  1I6A A;  2Q2C A;  1B51 A;  2HEU A;  4PFY A;  5CRY A;  3VLV A;  5JTY A;  2RF1 A;  4JWO A;  4F1U A;  2HAV A;  3S9E A;  5A5X A;  1AWB A;  4PTK A;  1DOT A;  2DQV A;  1H3D A;  3RPL B;  2Q8M A;  3C4M A;  4JVD A;  2F7A A;  4NMY A;  1USY E;  3RY3 A;  1FRP A;  2XXK A;  4ZEB A;  3GYY A;  3MPL A;  4XKR A;  1SD3 A;  3K6V A;  4MEV A;  3MP1 A;  1MY1 A;  4FE8 A;  1DPP A;  2DXY A;  1B3F A;  1S50 A;  1XS5 A;  2VD2 A;  3TFL A;  1R6Z A;  5FHN A;  3U93 A;  1P1W A;  2V4C A;  1N7W A;  4OQO A;  2IA4 A;  4MNC A;  1A8E A;  4BLA A;  3PPO A;  4FOR A;  4N17 A;  1RKM A;  3IOT A;  4THI A;  5FHM A;  1B3E A;  4KPT A;  3T9X B;  4C1T A;  4I1D A;  3W9W A;  5H8N B;  2Y5K A;  4H8I A;  1LAG E;  1PEB A;  1PB9 A;  1FQC A;  3HHG A;  5CBS A;  1MXZ A;  3Q28 A;  5H8F A;  4OFJ A;  4NF5 A;  1EYK A;  4ZEI A;  1MG1 A;  1SI1 A;  4O8M A;  3G3H A;  4U1Z A;  4MLQ A;  1R1N A;  2Q74 A;  2XX9 A;  2Z23 A;  2Z8D A;  4I3E A;  4NE4 A;  5I56 A;  4AB6 A;  2AYS A;  4OET A;  4OHN A;  4PF6 A;  3QYT A;  5H8Q A;  1USY H;  4ONY A;  3C9H A;  3KOS A;  4QFP A;  3PMW A;  5JK4 A;  1WDN A;  2RCB A;  1FTL A;  3A29 A;  3OXN A;  4NTL A;  2BJI A;  1O63 A;  2B4M A;  4EXL A;  3IO4 A;  1FPB A;  1PDA A;  4PDD A;  1BP5 A;  3JYR A;  4NF6 A;  1B4H A;  2QMX A;  1Q9D A;  2ONK E;  2PVU A;  2Q88 A;  3H4Z A;  3OMB A;  1KWH A;  1G0H A;  4IGT A;  2PFY A;  3IB1 A;  3FJ7 A;  3PUX E;  4ZS9 A;  4YB5 A;  3UOR A;  1RYX A;  2Y7R A;  3PPN A;  2GRV A;  1JW4 A;  2HHM A;  4QSD A;  5IZ3 A;  2I58 A;  4U21 A;  5I59 A;  4NX1 A;  1CB6 A;  3RPW A;  1IIW A;  1TWY A;  3TDJ A;  4H46 A;  1QUJ A;  3RN8 A;  1RDX A;  4P47 A;  3JZJ A;  4U4X A;  4Q8R A;  1I6B A;  4ZZA A;  4G2Z A;  4OVS A;  2R8T A;  4PGP A;  2WBB A;  3C36 A;  1FBP A;  3R6U A;  2FA7 A;  3HPI A;  1B3H A;  4PQJ A;  2QVR A;  1DTZ A;  3ECR A;  5FTH A;  3L6H A;  4G68 B;  3V89 B;  1EYI A;  4Q0C A;  3IL1 B;  1Y3Q A;  5B7D A;  1MH3 A;  2QVU A;  3H3G A;  4UAB A;  3BFU A;  4WEP A;  1B40 A;  1IXC A;  5ICQ A;  2RC8 A;  3HST A;  1IXH A;  2R6G E;  3B6Q A;  1M5C A;  1XOC A;  2VPO A;  3CI8 A;  3KSX A;  2F97 A;  4RNS A;  1EU8 A;  1LFH A;  5BWJ A;  5H8H A;  4XIG Q;  2H98 A;  3SKP A;  3H06 B;  1I6Q A;  1YAE A;  3UA8 A;  3PUV E;  1YZ0 A;  1AIV A;  4I9D A;  4H67 A;  4JSO A;  1O64 A;  1A7L A;  1ATG A;  4MJO A;  5TU0 A;  4Q5T A;  2Q8J A;  4R2F A;  5I2K B;  3FV1 A;  5KCJ B;  1NKX A;  4OER A;  4P0I A;  3FVK A;  2OX3 A;  2ZYN A;  3KN8 A;  3WAF A;  4TLL B;  3VDF A;  3KSJ A;  2ALU A;  3UP9 A;  1MDQ A;  1OQG A;  1N0T A;  4IO2 A;  3ILT B;  2NVU B;  1IZ1 A;  3ZKK A;  2VHA A;  5CBR A;  1B0H A;  2NXO A;  1JP4 A;  1NV7 A;  3EHS A;  5AA3 A;  1QKA A;  1LFG A;  1FPI A;  4PC9 A;  3JV9 A;  3G3I A;  4RXL A;  4F1Y A;  2O51 A;  2V84 A;  4G61 A;  2ABH A;  1NV1 A;  1GR2 A;  3KOT A;  2Z8E A;  5A5L A;  4KYD A;  3N5L A;  3RQT A;  1PC3 A;  3RLF E;  1ZU0 A;  2O84 X;  2W7Y A;  1P99 A;  3E9X A;  3G3K A;  3RT8 A;  2XXP A;  5F24 A;  1DSN A;  1XT8 A;  4X48 A;  4NF0 A;  3W15 C;  1NUY A;  1A54 A;  4QFN A;  2ZYO A;  3OO9 A;  3QUF A;  4OVJ A;  1B7U A;  4NAP A;  4BDQ A;  2HCA A;  3HN0 A;  1OQH A;  4IO4 A;  4YKI A;  2V25 A;  1A55 A;  1ZJL A;  4ND9 A;  2I0B A;  2ANJ A;  3EPE A;  3M3F A;  4OMB A;  2HZL A;  1NV6 A;  3FXB A;  3N6T A;  5DVJ A;  3KEI A;  4IR8 A;  3IOW A;  4FIM A;  3W9V A;  5LDZ A;  3CFL A;  3S4U A;  1AL3 A;  4G8H A;  3SEW A;  4DZ1 A;  1Y20 A;  4PFW A;  1CNQ A;  1ZTY A;  3BBR A;  4BDO A;  2XXU A;  3PTY A;  1MXX A;  1FBD A;  2O68 A;  2OCU A;  4NWD A;  3SET A;  1FSA A;  3UGW A;  2ONR A;  3DLN A;  3UIF A;  3LC8 A;  4YB6 A;  2R71 A;  4DI3 D;  2WX9 A;  1SBP A;  2LAO A;  2X7P A;  3PUY E;  1N04 A;  5TPA B;  4ZZE A;  5I84 A;  1AMF A;  1PB7 A;  2XXH A;  4R9G A;  3VVD A;  1IXI A;  2OJT A;  4ZE9 A;  1WVJ A;  2THI A;  4GXA A;  2ZZX A;  2DWI A;  4PBH A;  5DEX A;  3TTK A;  4P11 A;  4LZ5 A;  3U65 A;  3TKD A;  4LQ2 A;  2D21 A;  4GX3 A;  1Z7N E;  2B3B A;  3OOA A;  1MS7 A;  3IB0 A;  3U1O A;  1MH4 A;  5KDT B;  1RDZ A;  3TYH A;  2ZXT A;  5I58 A;  1Q1K A;  2V93 A;  5FTI A;  1UTB A;  2YLN A;  4JVI A;  2GH9 A;  3DEL B;  5CMB A;  5EYH A;  5AA1 A;  2FNC A;  1POY 1;  4BDN A;  4MAG A;  2YPN A;  4NF4 A;  5AA2 B;  5EQ8 A;  2RCA A;  1LBW A;  2PT2 A;  4JWY A;  3A09 A;  1NNT A;  3EF7 A;  4GWY A;  4HTG A;  3HCQ A;  4HE0 A;  4F3B A;  1M5D A;  1SQY A;  3HV1 A;  3ZSF A;  5ITO A;  3HHF A;  1XVX A;  2DWJ A;  1SYI A;  3OD7 A;  2DE4 A;  3K4U A;  1AH5 A;  4TOZ A;  3PUZ E;  2OWZ A;  4EQ7 A;  4R74 A;  2CZI A;  2F7B A;  1LCF A;  1JW5 A;  2F7C A;  1D4N A;  2F34 A;  2QVV A;  4F2O A;  3PMX A;  3QUJ A;  2ZMB A;  4DI4 B;  1Y1Z A;  1D9Q A;  3O6G A;  3VLU A;  1ELJ A;  1NMU A;  4H65 A;  1FW0 A;  1II5 A;  1MPB A;  3MZ1 A;  3VE1 B;  5L9O A;  4X04 A;  4IB2 A;  3E78 A;  4YMB A;  4ZE8 A;  4MLV A;  3SEV A;  3FVN A;  1DCU A;  4GIZ A;  3BKI B;  2F3B A;  4GF8 A;  1IMA A;  3PD8 A;  3PPR A;  3ISP A;  1LAX A;  4ZEC A;  1A99 A;  5HPQ A;  3TTN A;  4N6D A;  1NFT A;  2XXW A;  4O3B A;  3B6T A;  3RPL A;  3TPA A;  1MY2 A;  4N6P A;  3V8X B;  2QSX A;  4OXV A;  5ESY A;  3NOH A;  3I6V A;  4NED A;  4FEC A;  3BIG A;  4OEU A;  2UYF A;  4ELP A;  5AA4 B;  1FJ9 A;  2QRY A;  5HM4 B;  3LSF B;  1PB8 A;  5CC2 A;  1NI9 A;  4MH5 A;  1H45 A;  1SW4 A;  4GWS A;  1MM6 A;  3V83 A;  3CFZ A;  5LOM A;  4R75 A;  1JVX A;  1NV0 A;  3MYU A;  2GHA A;  4KYE A;  2XXQ A;  2QS1 A;  1BTJ A;  3ODB A;  2DE3 A;  4PFI A;  1LFI A;  4L17 A;  5J1D A;  2NOO A;  4BDL A;  1N84 A;  1FJ6 A;  4JB7 A;  5J16 A;  2WBD A;  4PCD A;  5H8N A;  2H99 A;  4DXU A;  1B3L A;  2KR0 A;  3SEU A;  3D1R A;  1FQD A;  4LN5 A;  3IX1 A;  3MZB A;  1HSJ A;  5DYH A;  1LBY A;  3TTM A;  3E3K A;  3BFT A;  1P1O A;  4MX6 A;  1D9V A;  1LBB A;  1VR5 A;  1FPF A;  1K9Y A;  3U8Q A;  1DTG A;  4ZEF A;  2F35 A;  3O9P A;  2VOZ A;  2V3T A;  4OEV A;  2ZZW A;  3R7X A;  4NF6 B;  3IO6 A;  3SES A;  1MXU A;  1S9T A;  3OEN A;  3GXA A;  1MQH A;  4Q30 B;  3KGC A;  4GL0 A;  1EZP A;  3FXR A;  1ANF A;  2WEF A;  1POT A;  2O69 A;  3Q29 A;  4G77 A;  2Y84 A;  4F18 A;  2I0C A;  2ZZV A;  4LP2 B;  4HE1 A;  3CR9 A;  4GWO A;  1Q35 A;  1MY0 A;  3AXF A;  5ICT A;  4H45 A;  2V3Q A;  5CMC A;  4XF5 A;  2I4B A;  2I6E A;  5JEI A;  4MHF A;  3B8B A;  1LB9 A;  1UIU A;  1FQF A;  3DP8 A;  4O7I A;  3O6I A;  1AOV A;  4GXS B;  1S7Y A;  3K02 A;  5HBC A;  4PBQ A;  2QPQ A;  3DP6 A;  1NNF A;  1B6H A;  4LON B;  2I3W A;  1N3X A;  1NUX A;  2HPG A;  3FAS A;  3KG2 A;  5EYG A;  2L5V A;  1LBV A;  5EYF A;  1UQW A;  3K6X A;  2UVG A;  2XD2 A;  2YJP A;  4IO5 A;  1IIT A;  3PD9 A;  1FQB A;  2CEX A;  1A8F A;  3LBS A;  3RNN A;  5T3J A;  1LST A;  1NV3 A;  1SI0 A;  4GD5 A;  1JNF A;  1FTO A;  3L6G A;  1NNP A;  3MQ9 A;  1IEJ A;  4NQ8 A;  2A5T B;  1VDW A;  3H6V A;  4NN3 A;  2PYY A;  2GHB A;  3IR1 A;  1QUK A;  4YIC A;  1YYZ A;  4QSE A;  1UTH B;  2XXY A;  4G68 A;  4GWW A;  3TCH A;  1N7X A;  1LLS A;  3RGY A;  1MQI A;  4QRZ A;  2RC9 A;  3KBR A;  3FAT A;  3IB2 A;  4WXJ A;  2PFZ A;  1F9B A;  1IXG A;  5K2Y A;  4YMA A;  4QBA A;  1QJM A;  2VD3 A;  2CZL A;  2RIN A;  1BLF A;  3K1M A;  4PF8 A;  3K00 A;  4NF8 B;  2VGQ A;  4ELR A;  1TT1 A;  4U1O A;  2JJK A;  3OSQ A;  2DYX A;  2XWK A;  1MQD A;  2CZH A;  2FIE A;  3CSB A;  1MY4 A;  2RKM A;  3TEL A;  1ZIU A;  2E1S A;  4OEN A;  1H43 A;  2DVC A;  4F3G A;  2X7Q A;  4HCW A;  5TP9 A;  1YPN A;  4GQO A;  5B70 A;  4KCC A;  3LSL A;  3TZA A;  4LAT A;  4HS7 A;  1FBH A;  4OYV A;  5I2N B;  4C0R A;  4ESX A;  5DTB A;  4MBP A;  3ROJ A;  3I3V A;  4PAK A;  5I2K A;  1LB8 A;  5KCJ A;  2HFB A;  3CSG A;  3OO7 A;  4Z7E A;  4R6Y A;  2G93 A;  3FVG A;  2XXV A;  5BUU A;  1MY3 A;  4PFB A;  3Q25 A;  3S2V A;  2O1L A;  3K6W A;  2RC7 A;  4LZ7 A;  2HXW A;  2QL3 A;  3G7W A;  1B9J A;  3FV2 A;  1J1N A;  2O6A A;  2XA5 A;  1MDP 1;  2VP1 A;  2REG A;  3C31 A;  5L9S A;  3MVY A;  4P1E A;  1IMB A;  1GVC A;  3QAX A;  1SPI A;  2OK2 A;  4F19 A;  2IEE A;  4WED A;  2P1S A;  2XXI A;  2UXA A;  2H4I A;  1LBX A;  3IOV A;  1NV2 A;  2DSF A;  3UK4 A;  3DP4 A;  5I57 B;  4X9T A;  1FPE A;  3B7D A;  3RUM A;  4F3S A;  4TQU Q;  2OZZ A;  3T9H B;  1VFE A;  2FYI A;  3FJM A;  2ONS A;  3FZV A;  4K3F A;  4P1L A;  1IUD A;  3FJG A;  4PAI A;  4N91 A;  4NG7 A;  3LSX A;  5F7V A;  1P1Q A;  1QUL A;  4EF1 A;  5I7I A;  3H6W A;  5CI5 A;  4POX A;  2FVZ A;  3Q26 A;  4PET A;  1YCJ A;  4F2Q A;  3IOU A;  4GRK A;  1QVS A;  1B7H A;  4X1D A;  2OWS A;  2PBW A;  2Y7I A;  2F36 A;  1EH3 A;  3VVE A;  3CVG A;  3FD3 A;  4GX4 A;  5AE4 A;  4OFO A;  1Y3P A;  4O3C A;  3MJN A;  4O3A A;  2P2A A;  1XC1 A;  4RPO A;  4EQ9 A;  3KC1 A;  3MP6 A;  4ELO A;  4FEB A;  3UN6 A;  2WKY A;  3H6T A;  2B4L A;  3LR1 A;  5FHO A;  1FTM A;  2XWI A;  4GVO A;  3KN7 A;  4N4U A;  4ZED A;  4P9K A;  2QS4 A;  3MAM A;  5DEX B;  2D3I A;  5ELV A;  2A5S A;  1B5J A;  3MUQ A;  1B4Z A;  3LSW A;  4GL8 A;  3CHG A;  2GQ1 A;  3MC2 A;  2PCR A;  3MWB A;  2ESN A;  4U22 A;  1OIB A;  3B6W A;  4PDH A;  5I58 B;  1H44 A;  5IM2 A;  4MNI A;  4RK9 A;  4C1U A;  2H5Y A;  1R9L A;  4R73 A;  3T0J A;  2KLF A;  1P1U A;  2UVH A;  1EZO A;  4OZ9 A;  4JBZ A;  1UTB B;  1FBF A;  4FED A;  5IZ1 A;  2F5X A;  3M3K A;  4QFL A;  1MQJ A;  4F39 A;  5CM6 A;  2O7I A;  2H9B A;  3FXU A;  4MNP A;  2F78 A;  1TFA A;  4Z0I A;  4DIG A;  3SEX A;  3TCF A;  1Y4C A;  1VSO A;  3O28 A;  4XKP A;  1MPD A;  3S9M C;  5KDT A;  3E4R A;  2ZYM A;  2FIX A;  2I48 A;  3KBZ A;  2ZNU A;  4LUB A;  3O97 A;  3S9N C;  4U2R A;  1LAH E;  3I5O A;  4BDM A;  4QXD A;  1IME A;  3ZKL A;  2CEY A;  3TCG A;  4OAN A;  3U72 A;  1D3K A;  5AA2 A;  4PFT A;  2B3F A;  4H0W A;  3VVF A;  4G8M A;  2X26 A;  1TXF A;  5IKB A;  4OVP A;  3TUS A;  3VFJ A;  2QJE A;  2F6G A;  3TOD A;  4GOT A;  4O7M A;  1WOD A;  1B5H A;  5DW8 A;  1NV5 A;  3IAZ A;  1VFD A;  4DCY A;  2CMO A;  3D4G A;  1NH7 A;  2DWH A;  4YKJ A;  5JTY B;  4DXC A;  3T96 B;  3C35 A;  4OWD A;  5A5X B;  3MST A;  1Y9U A;  2XXT A;  1D9Y A;  1FQE A;  4KYS A;  3FVO A;  1BKA A;  3H7M A;  3IFC A;  4HE2 A;  4H1X A;  5DT6 A;  3T93 B;  3R26 A;  1Z7M E;  2XXX A;  4RK2 A;  3LUY A;  1HSE A;  4OVR A;  3M8U A;  4YU0 A;  2ZNT A;  4LQ5 A;  3QSL A;  1OVT A;  4DDD A;  4YAH X;  4JDF A;  4RY1 A;  5EQA A;  1HSL A;  2CZK A;  1RDY A;  3G3J A;  4X8R A;  3C33 A;  3IJX B;  4EQB A;  4H5F A;  2Q89 A;  2O7U A;  4RYA A;  4XXU A;  1FPL A;  4JSD A;  4YKP A;  3O2A A;  1CE2 A;  3RT6 B;  4P56 A;  1FTJ A;  2XD3 A;  4XKN A;  1KA1 A;  4G68 C;  3EN3 A;  5H8F B;  3TMG A;  3GZG A;  4NF5 B;  4H6D A;  4NWC A;  1B46 A;  2XXR A;  1B5I A;  5I5P A;  1KZ8 A;  1K9Z A;  3IJO B;  1XVY A;  2PMS A;  4PFU A;  3IOR A;  2DP8 A;  4E0W A;  1SW5 A;  5AA4 A; 
#chains in the Genus database with same CATH homology
 4NN3 A;  4NAP A;  4AS5 A;  5IGA A;  4YIC A;  1YYZ A;  4GWZ A;  2HZL A;  1NV6 A;  3FXB A;  4GWW A;  3B50 A;  4N8Y A;  4M1V A;  4JVC A;  4NHB A;  4IR8 A;  4YZZ A;  3QMF A;  4F1V A;  4XFE A;  3W9V A;  5LDZ A;  2PFZ A;  1FPG A;  4QBA A;  1EYJ A;  1XI6 A;  2MKZ A;  4PF8 A;  4N81 A;  1CNQ A;  2F3D A;  3LUZ A;  1FPD A;  2DDK A;  3BIH A;  2JJK A;  2XWK A;  4GX6 A;  3PTY A;  2WYP A;  1FBD A;  2CZH A;  2FIE A;  1DBZ A;  4GBW A;  4HCW A;  1FSA A;  2VT5 A;  5ET5 A;  3EKI A;  4P3L A;  4DI3 D;  2WX9 A;  5IZ3 B;  1FBH A;  4AS4 A;  4F1U A;  4PE3 A;  1AWB A;  2XWO A;  4PTK A;  1FBE A;  3ROJ A;  4PAK A;  3RPL B;  2Q8M A;  3E79 A;  4JVD A;  1QGX A;  1FRP A;  2XXK A;  4PFB A;  1NUW A;  3GYY A;  1IMF A;  4N8G A;  2ZZX A;  4MEV A;  4PBH A;  4O94 A;  3U65 A;  4GX3 A;  4I40 A;  4MCO A;  2XA5 A;  4P1E A;  1IMB A;  3T1B A;  2V4C A;  4PFR A;  1SPI A;  4MNC A;  1RDZ A;  5EQ7 A;  4F19 A;  4N17 A;  3KC0 A;  1LBX A;  4JVI A;  1NV2 A;  3W9W A;  1IMC A;  5EYH A;  4X9T A;  5LTC A;  2Y5K A;  1FPE A;  4MAG A;  2HZK A;  5EQ8 A;  1LBW A;  4P1L A;  4PAI A;  1EYK A;  4N91 A;  4GWY A;  4NG7 A;  4HE0 A;  4O8M A;  4HCY A;  5FBP A;  5I7I A;  4XEQ A;  2Q74 A;  2DE4 A;  5EQ9 A;  2DE2 A;  2OWZ A;  3FBP A;  4I3E A;  2FVZ A;  2CZI A;  4PET A;  4PF6 A;  2QVV A;  5JK4 A;  4GX4 A;  4OVT A;  4DI4 B;  3LV0 A;  4KXP A;  3A29 A;  1D9Q A;  2BJI A;  2B4M A;  5ET7 A;  3KC1 A;  1FPB A;  1NUZ A;  2VPN A;  4PDD A;  2B4L A;  4X04 A;  5I3S A;  2XWI A;  3SZP A;  4N4U A;  2FHY A;  4P9K A;  3E78 A;  4OA4 A;  1Q9D A;  1DCU A;  1G0H A;  2PFY A;  2F3B A;  1IMA A;  3HFU A;  3ISP A;  3CHG A;  2GQ1 A;  2PCR A;  1FTA A;  2HHM A;  5IZ3 A;  1INP A;  4NX1 A;  4FBP A;  4N6D A;  4PDH A;  5ET6 A;  3RPL A;  5IM2 A;  4MNI A;  1FPJ A;  4H46 A;  4GWU A;  3T0J A;  1RDX A;  4P47 A;  1FBF A;  1FBG A;  5ESY A;  3NOH A;  5IZ1 A;  2F5X A;  4OVS A;  4PGP A;  2R8T A;  2WBB A;  3BIG A;  4N6K A;  1FBP A;  1FJ9 A;  5CM6 A;  4MNP A;  1NI9 A;  2Y5L A;  5ET8 A;  4GWS A;  2Q9T A;  2QVR A;  5IZZ A;  4MMP A;  1G0I A;  1EYI A;  1NV0 A;  3MYU A;  2WYK A;  2DVZ A;  2FIX A;  4HXV A;  3KBZ A;  2DE3 A;  4PFI A;  4GWX A;  2QVU A;  5J1D A;  4UAB A;  2HXR A;  4QXD A;  1IME A;  1FJ6 A;  5J16 A;  2WBD A;  4PCD A;  2FBP A;  2CEY A;  4OAN A;  2KR0 A;  2VPO A;  4GBV A;  4OVP A;  3D1R A;  4LN5 A;  1NV4 A;  4MIJ A;  4O7M A;  1LBY A;  5DW8 A;  1YZ0 A;  1NV5 A;  1LEV A;  1IMD A;  4MX6 A;  4OVQ A;  1FPF A;  1K9Y A;  4MJO A;  1KA0 A;  2ZZW A;  3MST A;  1FPK A;  1FBC A;  2OX3 A;  3IFC A;  4NGU A;  4P8B A;  4HE2 A;  2WEF A;  4F18 A;  2ZZV A;  4HE1 A;  4OVR A;  1YXI A;  2P3V A;  4H45 A;  2V3Q A;  4XF5 A;  5EQA A;  4MHF A;  1JP4 A;  3B8B A;  2CZK A;  4PGN A;  1NV7 A;  1RDY A;  4X8R A;  2QFL A;  4N15 A;  4O7I A;  1FPI A;  3IFA A;  4PC9 A;  4PBQ A;  1FPL A;  2QPQ A;  1LBZ A;  4G61 A;  1NUX A;  1NV1 A;  2HPG A;  4P56 A;  5A5L A;  5EYG A;  2L5V A;  1KA1 A;  1LBV A;  4PAF A;  4I3Y A;  5I5P A;  1KZ8 A;  2P3N A;  1K9Z A;  2XWV A;  5F24 A;  2CEX A;  1DK4 A;  2KQZ A;  5T3J A;  1NV3 A;  4NF0 A;  1NUY A;  1BK4 A;  3RYD A;  4NQ8 A;  1VDW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...