2PGCA

Crystal structure of a a marine metagenome protein (jcvi_pep_1096685590403) from uncultured marine organism at 2.53 a resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
206
structure length
206
Chain Sequence
MSNINYVILTVASVDFSYRETMARLMSSYSKDLIDNAGAKGTRFGSIGTGDHAGSLIFIQFYDDLTGYQKALEIQSKSSVFKEIMDSGKANIYLRNISTSLPTKFEQSYEHPKYIVLTRAEAAMSDKDKFLNCINDTASCFKDNGALTLRFGNLLTGSNVGNYLLGVGYPSMEAIEKTYDELLAHSSYKELMTFAKVNMRNIIKIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of uncharacterized protein (JCVI_PEP_1096685590403) from an environmental metagenome (unidentified marine microbe), Sorcerer II Global Ocean Sampling experiment at 2.53 A resolution
rcsb
source organism Uncultured marine organism
molecule tags Unknown function
molecule keywords uncharacterized protein
total genus 53
structure length 206
sequence length 206
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2007-04-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2pgcA01
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2pgcA02
1YJVA 3E8OA 2XMJA 1S6UA 2EW9A 2XMMA 4OIXA 2HFOA 3TNVA 3BDEA 3HX9A 3MCSA 4Y2MA 4YEAA 1P8GA 1SB6A 1AFIA 2OKQA 3FGVA 2ROEA 2LQ9A 2VV5A 2XMUA 1X7VA 3GZ7A 5B0GA 3HHLD 4Q2MA 1N5VA 4NPOA 4A4JA 2XMKA 3HDSA 5B0EA 4OJGA 4A46A 2RU9A 5IXUA 1YG0A 1VQYA 1S6OA 3DXSX 2K7KA 1SQEA 3TRGA 5B0BA 2LXFA 1MWYA 2K1RB 2OP5A 4FNIA 2AW0A 3HHLC 4Q2LA 3QGPA 3I9ZA 1MWZA 3BN7A 4HL9A 1Y9OA 2VH7A 2FTRA 2AP6A 1FESA 4Y2KA 2ZDOA 1TUVA 4F67A 5T7LB 3MZIA 4A47A 1OSDA 3F44A 2IYIA 1YRXA 2BUNA 2ZDPA 2GCFA 1Q8BA 2CRLA 2HLTA 2FHMA 2RMLA 1TL5A 2IFXA 2N4DA 4HI1A 4DN9A 2OMOA 1URRA 3HHLA 2LQBA 3VTIA 3QMQA 5A6WA 2KT3A 2XMVA 2W4PA 3KG0A 1P6TA 2BYCA 2LDIA 4DPOA 2BJEA 1AFJA 1Y0HA 2Q3PA 4DL0C 1JK9B 2JDJA 1GXUA 3HF5A 2AJ1A 4U9RA 1YJTA 1Q4RA 2PD1A 1N5SA 3FMBA 4EFAC 1FE0A 3KG1A 2HFNA 5B0AA 1FVQA 3BR8A 1Q8LA 5F0WA 2OD4A 1N5TA 2FIUA 3BF4A 3FRYA 2L3MA 2GGPB 1R6YA 1U7LA 3KNGA 4OJ1A 5B09A 2ROGA 2KT2A 3HHLB 1K0VA 2QLXA 3IWLA 4QOTA 1FE4A 1OQ3A 2GA7A 1CPZA 2KYZA 4ZA1A 1CC8A 4YDXA 1N5QA 3T9NA 1IUJA 2K2PA 3TOQA 2K7JA 1V3ZA 2GO8A 1QUPA 2IYGA 1W2IA 2OAUA 3BB5A 3HFKA 5B0CA 1XBWA 2RILA 1FEEA 4HH1A 3WDOA 3LO3A 5A6PA 1FD8A 2BJDA 1X8DA 2HLUA 2G9OA 4ZOSA 1JWWA 2OFGX 2FB0A 2QYCA 5F0UA 2N7YA 1AW0A 2OFHX 2ACYA 1SI9A 3K7RA 2ROPA 1TR0A 1APSA 3BGUA 2AJ0A 3IWXA 1Q53A 2K1RA 1Y3KA 2OD6A 1VQSA 5B0FA 2KKHA 1OPZA 1OQ6A 4A48A 1WD6A 3DCAA 3BM7A 1YJRA 3CJKB 1LQ9A 2GGPA 2GV1A 1X0PA 3CJKA 4FNHA 1TL4A 1RJJA 1GXTA 1FVSA 2GFFA 2PGCA 2W4DA 1ULRA 2W4CA 2XMWA 3KKFA 5B0DA 1KVJA 5K9FA 5B08A 1KQKA 1Y3JA 2ASYA 2HIQA 3UDCA 4NL5A 4Y2IA 2N4CA 4HH0A 2BBEA 2HQIA 2QIFA 2QLWA 4HI2A 2RSQA 4OJHA 5T7LA 1CC7A 2XMTA 5KAKA 4OJ3A 1YJUA 1KVIA 3LGMA 3LGNA 1TZ0A
chains in the Genus database with same CATH superfamily
3E8OA 4OZ3A 3CVKA 4OIXA 3TVYA 2AKWB 3OVAA 2KH9A 3OTEA 4DR1F 5GMEA 4RUHA 3RB0A 1CSJA 2F7VA 3K89A 4F3MA 3PW7A 1YJNS 3RR8A 2RS2A 4NA2A 1LFPA 3ET6A 1HNXF 4PRFA 1S7IA 5KFJA 2ZOFA 4FS1A 1UWBB 2WW8A 1V3RA 4K4TA 1ROFA 4XK8C 2HFZA 4NI2A 2XY5A 1RT7B 3RB3A 3PYFA 2JZ5A 4ECSA 5E2QA 2DR9A 1CEZA 3TARA 2JLFA 4WK1A 3SIPB 2VQFJ 1RWPB 1HQEB 2CADA 1T9UA 4RNMA 3PVXA 2W2QP 4OX9F 4PXBA 1MWZA 2DRDA 3SCKE 4USJC 5C24B 1K47A 3FQLA 1Q7LB 1J5EJ 3X1LB 4Y2KA 2ZDOA 1ZS6A 4MKBA 3DGPA 1Y10A 1HWUA 3UO0A 2FYXA 2QE5A 2VC1A 4QWDA 2LYVA 1YRXA 2RUGA 3WBZA 3P6YC 1U1KA 3DRSA 4O0NA 1SCJB 3EDRB 4RNNA 3MXHP 1MROB 1TL5A 3IGVA 2J0WA 4DCJB 2F8HA 2C2OB 4NA3A 1JB0C 3V6KA 3PV8A 2UVVA 2CZVC 4KH1B 2XO6A 2UUAJ 1B4SA 3LOUA 3QNWB 1HWLA 3LAMA 2HS4A 1RT1A 2W4PA 3ISND 3J81U 3TEGA 2LU1A 1SJ3P 4DXLA 4DHVA 2X1GA 2OPSB 3H5SA 3GP9A 3ZTRA 1JK9B 2XCPA 2WB1D 5GADI 3NBPA 2PD1A 2HRYA 3MTJA 4DV5F 3ELHA 2W7AA 1SH0A 3DXBA 2XS5A 4ZVUB 3KHGA 2R7SA 1KHWA 1SH3A 4F0MA 5CYMA 2RQMA 5DG7A 1U7LA 2B9WA 2AQ4A 1CLFA 2CQBA 2BW7A 2O5DA 3FUYA 4CLKA 2AEMA 4EBEA 4D3HA 3DM2A 5C42B 5HQLA 2CUYA 3HHNB 4H4MA 2QL7B 4KGXB 4MIBA 4MK7A 4DV3J 3PKMA 1ZAWA 1X9SA 1KHVA 3GPAA 2CJKA 2CNOB 2DGUA 3BDPA 3QFHA 2ALZA 1IUJA 1RTHB 4HDGA 4HKQA 1QVGR 2ZH3A 4I64A 4YY3F 2JOQA 2MDAA 1HBUB 3OJSA 1U1LA 2KYXA 1CG2A 4PEOA 1FEEA 4PWDA 2C2DA 3WDOA 3VVTA 1YTYA 1TKZB 4FPRA 3HHKA 1UWBA 3IR5B 1JLAA 2AMCB 5DDRC 1UVLA 3DU5A 2MHNA 3P5TL 3ET6B 5E3QA 4CNYA 1I5OB 2WVCA 2MZ1A 3OUYA 2RRAA 1VC6A 4OX9J 1KSPA 3IR7B 3C46A 2FVRA 2E1CA 5M2RA 4ZIVA 2YQ3A 3TEHB 4YY3J 3QJLA 1APSA 3OQ2A 1QJHA 1WSRA 5DG8A 2QYGA 1TK0A 2HVIA 3MF5A 1PYTA 5RUBA 5I3QA 1OY8A 2QL9B 3GWCA 1AXQA 3C14B 3QWPA 2CPIA 2U1AA 2V67A 1EP4A 4MYTA 3DLHA 2DNYA 3MM7B 2FGOA 1XMOF 3BEGB 3DRSB 2UUBF 3NG8A 5KG3A 3V5RA 4AD6A 1FTCA 3NWRA 1YJRA 3Q22A 3CJKB 4IOCQ 1WSVA 2VBWA 2B9EA 3SV4A 1EHWA 3NKYA 4HHJA 4KV8B 5DLFA 2VPZB 1B3TA 4PYAA 2BRLA 2F1FA 4OI2A 3JSMA 2MKIA 2UUCJ 2HG4A 1S9GB 1H7XA 1NM2A 4J9PA 3D2WA 4DCPB 1BGXT 2C1EB 5I3UB 4F4YA 1LWEA 3CJ2A 4JYAJ 2MZTA 5EHHA 2I9SA 4UOHA 3A8JA 4OHXA 1YZ7A 3J7AN 1TZ0A 1UEKA 3IWLA 1M5VC 3PTWA 5JVHQ 3DLKA 5KFYA 1NUEA 2EW9A 3GIMA 3GIIA 1KBRA 2Q66A 1DY3A 1UVNA 4JP8A 3W3SA 4AUKA 3ZC4A 1SB6A 4I2QB 2L48A 5LMUF 1R43A 3TANA 4LF9F 2HVZA 1X5PA 4TQRA 2P9CA 4J7CA 3NGSA 4ZVEA 2CIMA 1D8ZA 4CH1A 2CZ9A 1YG0A 2P9EA 2ZE2B 3M1VB 5IM0B 5LJ5Y 4ED5A 5K20B 1FI4A 2E5GA 1RT5A 1FDDA 3T6JA 3UFCX 2R7OA 1NB2A 1U0SA 2CPEA 1M1KT 1RTDA 3HFVA 3I9ZA 3TAMB 2RF2A 2A3JA 2BACA 3W2VA 3KK1B 3UW1A 5F41A 3LP2A 1TP7A 2O1PA 4X4PA 1F5CA 1RWOB 1C0UB 4NEYA 3WQPA 1RYSA 1GMUA 3M6WA 1X4BA 3AOBA 3LWLA 3DFEA 1ZM4A 5CXTA 4KTQA 2DNOA 2YPZA 2IPOB 1Y5IB 4ERDA 2FHKA 3CDUA 1G4CA 2LQBA 4OLOA 4RW6A 3UVJB 1S97A 1N6QA 1JLCA 4J9OA 4F02A 1RWMB 3IRXA 2HMIA 1X4AA 3KG0A 4JBCA 3ZZPA 2BJEA 2O66A 3N79A 1Y0HA 2VFSA 3OR1A 4NLXA 2RF2B 4TYAA 5J1NA 4JV0A 4TVAB 3V4MA 1H2VZ 4X64F 4DBQA 4TU8A 2CJ9A 1EETB 2YH1A 4DFKA 4UOGA 2IJRA 4PG7A 3FZ2A 5I42B 3TUIC 3ZZ0A 3B78A 4R25A 1GMWA 4J9UE 4ZN3A 2LXUA 1PJ6A 3HT3A 2UU9J 4LFCJ 4DQQA 1N5TA 2DH8A 2ATCB 1RAJA 2V94A 2XLKA 2V63A 1HBOA 1NK8A 1ZZFA 4DG1B 2V9WA 1H38A 1BD6A 1CBKA 3AJ2A 3TJ9A 2CKWA 1NPKA 5IOLA 3UD5A 2CPXA 2HQ3A 2HAFA 4OI0A 2Z30B 3R5GA 3BBFA 1GK8A 1X9WA 1RT6A 2ZZNA 3IBFB 3DLKB 3CDEA 3VQSA 2DHGA 5K5MA 4X4SA 3EJMA 3CGIA 3MM5A 3TOQA 1VHFA 2NYIA 2WTFA 2B6AB 4DV6F 4RW4A 1Q5YA 2G2ZA 3M4XA 3CCSS 2VFRA 1P1TA 4HH1A 5GAGI 1U6FA 2YNIA 4O4GA 2AZ1A 4IOBA 3RBZA 4ECRA 1YIJS 1VRTA 1B64A 1Y5NB 1X8DA 4PG5A 2RUSA 3CO0P 2AHOB 2JEGA 1JWWA 4X64J 1EZZB 5KFMA 2XM3A 3MAQA 1U48A 1K9MT 4CZCA 4CLSA 1TU0B 4HACA 4JI3F 3D0GE 4USTA 3NNCA 3QT5A 1FERA 2DY1A 3SEOA 1ZOTA 3KLIA 2IRXA 2G13A 2B5JA 3JQKA 1U1RA 2DEIA 1NH8A 3NOGA 2ZJRQ 5HMWA 1C0UA 2OLWA 3QZ7A 2P6TA 2IBKA 4JI2J 2BE7D 4J5OA 2IRYA 3EZ5A 2Y1LB 1NH7A 4TU7A 2FHJD 2Y9HA 2VB6A 4WZQA 3G8QA 5FD1A 4P52A 2JC0A 1S6QA 2NPIA 3H5UA 4ED4A 1LXJA 2Z8QA 2HNDB 3HD2A 3HZEA 3IO1A 2YKAA 2BE2B 3MM9B 3NCRA 4LRCA 3ZFVA 5MLCV 1JLBA 3DI6B 1HBMB 2UXBF 1QM9A 2PDAA 4NLWA 3U27A 1TKDA 1NK7A 2W2PP 2XBPA 2R7WA 4P73A 3V81B 4HDHA 1VBZA 5CD4H 3MD1A 4F0KA 1CQNA 1RT1B 2CQDA 3CPWR 3GR1A 2V6AA 3D28A 4CO1A 3OXLA 4OJ3A 1N8RT 1IWAA 4RBTA 3RRHA 3PDNA 2YXLA 1QLNA 1YRTA 2XMMA 3QGHA 5CYQB 2NREA 5KFGA 2F4FA 2V2KA 2B4VA 4LBPA 1JJ4A 1FJEB 1UKUA 2DKOB 2RT3A 2OTLS 4ECTA 3OJUA 3FBEA 4ZJOA 1L3SA 1AROP 3AOAA 3B54A 2EI5A 3D6FB 2FLLA 5KFUA 2FUG9 2IM2A 2QTWA 4OX6A 4OYAA 5D77A 2R2SA 1MWQA 4Y6IA 1UL3A 2KG0A 2E29A 3CDBA 3GCWP 4I0WA 4ZITA 5GADU 1J2VA 3DXSX 1RT7A 2MGZA 2PO4A 3KLHB 3BQ1A 1KLNA 2BE9B 2CQ1A 3SI8A 1HD0A 4CP5A 1X5SA 2FZKB 1FRJA 2D9OA 3QGPA 2GHWA 1S1XA 3C15B 1FRHA 4F4KA 3MM5B 3M6VA 1S49A 2PT0A 2XULA 2YKNA 3LA0A 4GKKJ 4A47A 1S99A 2FHJA 2OEKA 3F44A 5J1PA 4X4RA 1CQMA 3MCMA 2JRSA 5KFFA 4RNOA 2HW3A 1L5UA 2KJWA 5D6GA 1B70B 1C1BB 2PIIA 2C3PA 3CD0A 5KFHA 3V6DB 3GFXA 4ELVA 2NXNA 2CJQA 3HHLA 2VBYA 2W8LA 4DZ6A 4J9SA 2JFKA 2RHSB 1H74A 2Z0GA 2JNJA 3E01A 3MEEB 4LFAJ 2GMJA 3THTA 4N56A 1EKRA 3OTOF 5JVGQ 2LEBA 1Q7YT 2RJZA 1RTIA 3IA0A 3UWTA 5D4PA 4F2RA 4LRAA 1WEXA 4AE5A 1NZAA 3HF5A 2J9CA 2B5JB 2HYIB 1NDLA 2YKOA 3PNIA 1VQLS 1SQGA 1XMQF 3RUBL 5B0AA 5KFXA 1Q8LA 2RQKA 5F0WA 4ECZA 3KUHA 1VBKA 4NZ7A 3KHLA 1FNMA 3DLEA 4QW9A 2IY5B 1FF2A 3GFYA 2HHQA 3AT1B 2XZDB 4YN3B 4OX7A 1IKWB 2RAQA 3EPGA 2DNLA 2H51B 1O6XA 2IBOA 3GR0A 3I96A 5HK4A 4H4MB 5IWAJ 1VC0A 1HNWF 1CPZA 2HRTA 2VPYB 4GC7A 2MTLA 2D3OR 2OPQA 3T1AA 1VQ7S 7FDRA 4OZ1A 5EWEA 4FZVA 2XC9A 1VBYA 2UU9F 3EUNA 3D68A 1KOHA 1C2PA 4CO5A 1S5ZA 1YSJA 3P5BP 3L7UA 5B0CA 3AQOA 2YNIB 3P8BB 3MUTP 2ACMA 2RD5C 2JLGA 1X4EA 2E7VA 3PJ9A 2CDQA 3UD3P 5KFEA 3CJTA 2JWNA 4MMOA 4F8RA 4N47A 2M4MA 3HSGA 1QAXA 3OFFA 3MAAB 3I0RA 4DR2J 3OL9A 1RTJB 2MZSA 1JLQB 3NNHA 3HHEA 1MN7A 4E0DA 3NY0A 2JL9A 5CHCB 3BKFA 4DSEA 3M6XA 3R5DA 4MAKA 1NSQA 1QE1A 3DGVA 1X31C 3B8HA 1HR0J 3GJTB 3OL6A 4A8SA 1DFDA 2HNYA 3TAPA 2NUHA 3MAHA 1FXLA 1YX2A 2CPJA 4GO7X 2PI5A 1VJQA 2EPIA 3N01A 3CJ3A 3MR3A 1RA7A 4U95A 4O44B 2KKHA 3NS6A 2YWFA 4OZJA 4TKTA 1R8CA 2QMWA 2Q43A 4OI6A 3PXGa 4NLVA 4YR3A 3CF5Q 1M5PC 2HK2A 2FJXA 2VOOA 4ZK7M 3Q8PB 1S0VA 2IAJA 3V81A 1JLFB 1KTVA 3N6NA 2LEPA 4QU7A 2M7SA 2G0JA 2W4CA 5IFMA 3CXCR 3C2PA 3NL0A 5D4NA 3MPUB 1GH8A 3HP6A 3ADAC 1RBOB 1K0TA 4Z7YA 5HVFA 3HSZA 1XWLA 2A6MA 2HS3A 2MKJA 2QIFA 3M8QA 5GMDA 3S6EA 4C6AA 4QCLA 5I3PA 1HLWA 1NBEB 5KFVA 3IN5A 1WG4A 1SVDA 3SCJE 3OT9A 1OY6A 1HARA 3MTKA 4NZ6A 1M0SA 3BDEA 4C2MA 5IS2A 3MM8B 1ELOA 2MLYA 1Q82T 1Z4UA 3D66A 4NXNJ 3WX8A 2IDEA 1B0VA 3CO9A 3D0IE 3JB9k 2M52A 2ADBA 2NR0A 4M1KA 2IJNA 2E1AA 5G0RB 4RWXA 2UVWA 3H2VE 5A2QU 2CJXB 4ZP6A 2YX7A 2RU3A 4C4WA 1FJCA 2KVQE 3BO2A 2ZJQQ 3MM6B 2QV6A 4OYXA 2V69A 3C6UA 2ZE2A 3VCDA 4ETXA 3TRGA 2XO7A 1VQMS 1OIAA 1S72S 2WZ1A 2POKA 3J7A1 1H0HB 3CCVS 2BJ8A 2OI2A 4YHHF 1EKSA 4KQZA 4NLDA 4JI5J 4J91A 3BH6B 4KYZA 1TL1A 2Q6BA 1TUVA 3MOZA 4F67A 1KQGB 5KFPA 1LWCB 1OSDA 2AYBA 2ZDPA 4C8YA 4DSIA 2NS1B 3KFWX 2HBQB 3SSSA 4AQYJ 1K44A 4YP3A 2ZH2A 1A9NB 4LIWA 4DR5J 4H54A 5ETSA 2BKOA 3C6UB 5CCLA 4DF4A 3FEXB 1PC4A 4XO0A 1ZM3A 5I3UA 3VGVA 3RB6A 2Y1RI 4ZP9A 3RW6A 2EG1A 1TL7B 1KLMB 5GAGU 1BWEA 3FC9A 2X1FA 4DV0J 4WE1B 3PRBA 4DQRA 2AT1B 5KFTA 2B8PA 5HATA 1HIYA 2MQLA 3F73A 1LW0B 4ZHRA 1X4GA 2ZUAA 2FC8A 2OD4A 3LALA 2GVDB 3PM9A 4B3MJ 3KG4A 3AJDA 4ZJQA 4ZP7A 1UFLA 4XPEA 1WOOA 4EI2A 5AT1B 3NGKA 4HR2A 1KVKA 2D74B 4F2SA 1JLBB 5KG0A 2OPRA 4X65J 1FKPA 1UPMB 1OQ3A 1WDTA 1MMNA 2VPWB 1IJFB 3FFIA 2PEBA 2IVFB 1KLMA 5LMNF 3MOJB 2BKNA 5HLFB 1IVZA 5IT4A 1CC8A 4Q7AA 4J9MA 3OLAA 1HW9A 1UVMA 4USUA 4YS2A 4KV8A 5L46A 1FJ7A 4QYZK 3NRBA 3HFKA 2J0SD 4RUCA 2A6OA 1F60B 5AJ3J 1UA0A 1L3UA 3BYPA 1RADB 3SQOP 3OHAA 1TELA 2LP4A 2F63A 3DOMA 3BBBA 2EKNA 4L75A 2F8EX 2WHOA 1HBUA 3FEYB 5KG1A 4RW9A 4OZ0A 3T1YF 4UOFA 5ETKA 4IR1A 4PQUB 3HO1A 4N8NA 3A13A 3JTOA 5ETPA 1XR5A 4Z2XA 2BX6A 4OI3A 2GHVC 4WCEQ 4YQWA 4ECWA 4UZCA 5L9NA 4DQIA 1UJ4A 2M88A 5CYJA 2KL8A 2MHEA 3PO5A 2DXEA 3OW2R 3P49B 1FJGF 2VQEJ 4ZVOB 3O2IA 5ETRA 1FKAF 1AA1B 1FDNA 4X62F 3KK3B 2VHGA 5CH7B 4B9UA 1YVFA 4U7UD 2H9ZA 2JEFA 4KC5A 4U96A 2GV1A 3H25A 3R5AA 1NK4A 4LF4J 2HBZB 1DTQA 1WF2A 1R27B 1ZPVA 1M5KC 1SKRA 1U49A 1NSPA 4QBUA 3UN2A 1HWKA 1R3NA 2W4DA 1YBAA 1ULRA 2SXLA 3BGRA 2Z58B 3M9MB 3G86A 1Y3JA 5IWAF 1HI0P 3UNYA 3ITHA 3DM2B 4LF1A 2IC3A 3S8SA 2XY7A 1RLDA 2DGXA 2GQCA 5T7LA 4W90B 1SH2A 3HMJG 1PBUA 3K8WA 3WHIA 2VUGA 4NPOA 1CJUB 3O44A 3I4HX 3NGRA 2UXCJ 4ED1A 4M5LA 1DLOA 5J2PB 2CQ2A 2NXUA 1SC4B 3FEZA 2R7TA 1AFIA 4IR9A 4OQJA 2H1YA 3FGVA 5C42A 2LQ9A 1H3DA 2M9KA 2GX8A 4RJVA 1YJ7A 2MQMA 3GZ7A 3T9ZA 1HL6A 2LQJA 3CT9A 2BEFA 4NCGA 2V2VA 5KFSA 2AZ3A 3A8KA 2K06A 2MZJA 2P9GA 3L95X 1CS4A 3EVOA 3O6QA 4NRTA 3D54A 2ZH6A 2EFOA 3LPYA 1BY9A 2P2CB 3FFIB 4DI6A 4EBDA 4ED3A 2GJIA 2KRRA 2FJVA 1WKKA 2D9PA 1MWYA 4FNIA 4XTTA 1VQ4S 2BABA 3EGVA 3PFEA 2J6UA 4OYOA 2DGWA 2BZ2A 4TLQA 3Q23A 1FWLA 4HT5A 3W66A 4JV2A 2GHPA 2YX4A 4M5NA 4Q44A 4BC9A 2VODA 2BUNA 4DQPA 1MMDA 2G1HA 1S57A 3DI6A 1F9EB 2YWGA 1VR6A 3DOMB 4ZMMA 3UR0A 1U1MA 2E7WA 3QRPA 1I51B 2MKYA 2W2NP 4LFBJ 2FJEB 5THWA 1ZBTA 3GIJA 4RUBA 1WI6A 2MY8A 1F3VA 2HHUA 1PBAA 2JSXA 3NWGA 3W60A 2GMHA 4TY8A 1RT2B 4L72B 3ENQA 2Q3PA 3KUGA 4LIRA 3GV5B 4P7VA 1LW2A 1T94A 3KJNB 2RH3A 4Y2CA 2GNKA 3M8ZA 2GMLA 2GS8A 2HGNA 4KPYA 2G0IA 3PW2A 3PW4A 1HW8A 1HPZB 1EQMA 1HFEL 1SIWB 1KOOA 1WC5A 3TYTA 2OPPB 3BN4A 5C2GA 3H7HB 1IBLF 3GJQB 3HSJA 1TMMA 2PFDA 3CJRA 1KQFB 1W7WA 1YBUA 1H6KX 2C2KB 2V8GA 4ZCKA 4NLPA 3VF0B 4CLTA 5AE3A 3IMQJ 1N36F 1TVRA 4JI6F 3H42A 1NSAA 1RGVA 1WHWA 3N4WA 4M5GA 3T41A 1H98A 3T9NA 3POTA 3QJPA 1V3ZA 3QO9B 4ECUA 1R8HA 5U47A 1OY9A 3D5MA 4JI8J 4LJMA 3V6HA 1RTDB 5LSLA 2CJYB 4ECQA 5LXRA 4CLWA 4PG6A 2AU0A 2AYEA 2VFUA 4DG1A 1REGX 1U47A 4FP9A 3ZTPA 5KG7A 2WCXA 1RTJA 4WU3A 1O5JA 1KR4A 1L3TA 2FLPA 2V2ZA 3T3FA 1S9GA 2X1BA 4OYMA 1X0FA 4K4WA 1YDLA 2Y0SD 4OYWA 5FLXU 2XNQA 1RSCA 2WSFC 2RB7A 3AODA 2W1BA 3IWXA 3QYYA 4IH6A 4KFBA 2EFVA 1Y3KA 4DX5A 2MMYA 2EC0A 3UCZP 1OYEA 5B0FA 2W9AA 4DSKA 3W62A 1WD6A 5AXMA 1PJ7A 4NYZA 1U2FA 1LQ9A 4USWA 4CQ1A 3G71S 4HYKA 3Q2TC 4I1TA 3UQSA 1X9MA 4FDFA 2R4FA 4Q45A 1EP4B 2ASLA 4DSLA 4B3TJ 1GFWB 2XZWA 5KT7A 4R5PA 4DV4F 2U2FA 4NX9A 2QZ8A 5JJBA 4K7QA 2C2EA 1VRQC 2DHSA 2QSFA 3MEGB 4CLFA 2YNFB 3H0PA 4F36A 1VQPS 1SJ4P 3LWMA 2IRUA 2QLWA 3K2YA 2QSWA 2V4JA 3Q89A 1WOSA 3LGNA 3IXQA 4C0BA 3PHEA 4O0IA 2YNGA 4BWMA 5J2PA 4A8MP 4DPXA 1W26A 1T3NA 3MCSA 1YKWA 2XTJP 5AXLA 4B3SJ 2JJ4D 1S4FA 2VL1A 2BQ3A 1F2GA 1FDBA 3N9UC 2Z4PA 4K2JA 2ZKTA 3H59A 1SJRA 2F9JA 2XMUA 1D8YA 5B0GA 5EUHA 4X66J 2HFVA 2A2DA 2H4YB 3M2RB 3WC0A 4KKOB 4CLUA 4WKRA 3U02A 2DO0A 1TTHB 1JLCB 4PXDA 3TZZA 1K1SA 3EMTA 3TW0A 4GRSA 4WFXA 1U8SA 1Q1KA 4B9SA 3JTPA 1QTNB 4IFYA 4HL9A 1S1XB 2VH7A 2PA3A 3C15A 2QLBB 1V6HA 3B6BA 3UDLA 1IQZA 3Q2SC 3H4DA 3VAMA 2C2RA 2W8KA 1U1OA 2VDIA 3MZIA 4ZIWA 3M7VA 1KN6A 3D1OA 1FTRA 2W9BB 2B0GA 1JQGA 3JAMY 2ZHBA 4X84A 1VLOA 3TAMA 2NXEA 3W2VB 4RU2A 2A18A 1I94J 3IM8A 1JLAB 2GIRA 1U6BA 5IQ6A 3MM9A 1ACMB 1RHKB 2X3DA 4IRKA 2KFNA 1Z1ZA 3TX0A 4CLLA 4DPTA 5C25A 3RB4A 2OHDA 2C2ZB 4JI3J 1B0PA 4IQMA 3MEGA 4DL0C 4IFYB 4KT0C 1RDRA 3KJVB 2FVPA 4Y34A 4U9RA 2HZCA 1CJVB 1N5SA 1NU4A 1WDDA 4PXCA 3I31A 1N0UA 4EBCA 1FRIA 3S7RA 1JLEB 2HHXA 5E7OB 4N41A 1JIHA 5I42A 2ZM6F 2P8IA 3G2XA 1D9AA 4XAKA 3R2CJ 3R1LA 1N52B 4U8VA 2KYZA 3W61A 2KHCA 2NUUG 1D09B 1IKYB 2E5HA 3QPIA 4X65F 1O51A 1RAAB 1Q79A 1MMLA 2E44A 2Z57B 1IBMF 1RLCL 3CIZA 4NCBA 3GTYX 4PWWA 1DQ8A 2HHPA 5H9EK 5DGBA 1PCAA 4DV7J 1PG5B 1RT4B 4X4QA 3OL7A 2J8SA 5D8HB 5KT3A 1DRZA 3ULHA 4LR8A 4Q0BA 4KKOA 1SV5A 5DO2A 3Q8RB 7FD1A 2J9DE 4J9NA 1SI9A 1UETA 2RRBA 2EBEA 3B4DA 1VRTB 3HHDA 3QBCA 4FYWB 3SDEB 4WP8A 3W65A 5CA5A 5DLGA 1M5OC 4PUOB 2BJ7A 3HULA 3BGLA 4FVCA 2OIHA 2KFZA 1TV6A 3ZTOA 4DOZA 4DZDA 2QX0A 4DX8H 4K0KJ 2E66A 4J90A 1DAXA 3QFWA 3QIPB 3VZIA 1FNXH 1RWNB 3KWMA 3MMBB 4OHWA 4A48A 1YJWS 2N3LA 5EN1A 3D6MB 4FXVA 5A0YA 1U1NA 3UN5A 4J9QA 4KSEB 1E6YA 2WBRA 2VOPA 4WXWA 2R7RA 3PO4A 3UR3C 2NZCA 3O8WA 4RZRA 3H2UB 3DLLQ 1DQAA 3CMQA 4ZLPA 1VK3A 4FYVB 4KR0B 2JEJA 1TKTB 3G6YA 2M0GB 5ITHA 2HVEA 2XSJA 3EE3A 3IS9A 3UDCA 1I1GA 4DR4F 4LF8J 1D9FA 3QIPA 4OL8A 3VAGA 5D15A 1IKXA 1YGYA 3JYTA 4DPWA 3GYXB 1U24A 3CJQA 2EWHA 1R31A 1N34J 3P96A 2VU5A 2VV5A 1LWFB 4M5HA 2XHWA 3B4MA 3M05A 1VMBA 5GMKa 1UEUA 3U1LA 1BQNB 2DIVA 4JV5J 2G2YA 4LUBA 3FVYA 1JXLA 1TUWA 3QLHB 2PC6A 3KJVA 1WELA 4W4MA 2E9TA 4FKYA 1HWJA 4G1QA 3W9IA 4K4SA 3AB4B 3MPYA 3RRKA 2R7VA 2ZD1A 3HCXA 4EGLA 2VQEF 3VVUA 4C98A 5J2QA 3PYEA 2NXCA 3ILLA 5IC6B 1IBCB 5EX3A 1M1GA 2DNMA 2XYHB 2EXUA 3DLJA 4J37A 4KGKA 2KXFA 4O3OA 7AT1B 1AB8A 3ZZRA 5H9FJ 2HLTA 1N5YA 1FA0A 4LF4F 2VICA 4ZPTR 4FXWA 4GVBA 3VALA 1IKWA 2NPFA 2LECA 4J9VA 2L9WA 4QIEA 3I56S 4MKAA 1EAYC 1RCXB 2BQRA 2DNHA 3DU6A 3ITHB 3I9V9 2XY6A 1UW9A 2R7QA 2IC3B 2QL5B 4WFYA 3K57A 1U4BA 1S10A 4QYZJ 4ZVFA 2HHSA 4M5JA 3QT6A 4O44A 1Q8IA 2DJWA 2AYMA 1HHTP 2CPZA 4TYBA 1UJ5A 3CDAA 4DR2F 1CJVA 3KJQB 4EYIB 1RBLA 1T11A 2H65B 4NLYA 1CULB 2LDYA 4QYRA 1GX5A 3BR8A 3CSKA 4G3IA 2NCKL 3V6JA 4C8OA 3JS9A 1JNRB 2LU2A 3DRXA 4A8KA 5A0YB 4MJKA 1AUDA 1AT1B 3H98A 4OJ1A 4B3SF 5B09A 3WZ0A 5KFBA 1Z2LA 4DR4J 3LW5C 1S48A 4NOHA 1U02A 2CJAA 2VBZA 3TUZC 3OL8A 2ZVIA 1RXOB 3PYGA 4IFVB 1RTIB 2DH9A 4DDFA 1RK8A 2X3GA 1TKXA 5DG9A 4DV2J 4DSJA 2DGVA 2GC8A 3IWNC 1IBLJ 3N5BA 2V8HA 1NPPA 4P10A 1U1QA 3LP1B 4LMZA 1LWEB 2R8KA 3FSXA 2G1DA 3M2VB 4MK9A 4ZLNA 3GV7B 3TX8A 3PX4A 1J27A 2DR8A 2DR7A 4MYUA 4YHHJ 2R9LA 1S9EA 2DEJA 5IT0A 3DOKB 3K5LA 3OSPA 2XYPB 5D0RA 2D7SA 5J1EB 4B08A 4DLGA 3VZHA 2HFUA 2OFHX 1ZM2A 1VCTA 3SCIE 2XS7A 4JV1A 2J7KA 2ROPA 4C8NA 2C3MA 3QWUA 2OJ3A 1WC1A 2HWIA 1XNQF 3MPDA 4ILLA 2NSCA 1UJ6A 2IMOA 4NI2B 1L3VA 1XNRF 3I6PA 4NXNF 1NLKL 4UF4A 1RQ0A 4OYIA 4QR1A 1YRUA 4CYUA 4P9SA 3ZNUA 3PR4A 3HFZB 1DBDA 2M5YA 5LSOA 2YKNB 3CJKA 4EK2A 1T8EA 4IDKA 5ETNA 3KK2A 2CG8A 4WIIA 2V8PA 1R89A 1RJJA 3MR7A 4RW9B 5J2MB 2XGQA 2QC3A 2L9NA 2MJNA 5ETMA 5KT5A 2E1RA 1NZ8A 2ZKUA 5MAOA 3ISNC 1VISA 3DKDA 2ZH7A 3W64A 2H3EB 2IM1A 3EXYA 5HANA 5C25B 5KG2A 3OUYB 2DCUB 3DGPB 4ECXA 2BJ9A 1CULA 1R0BG 1TMJA 4NWBA 4CNZA 5H9EJ 2F9DA 1BQXA 3C19A 5HBMB 1FK9B 2XMJA 4EO8A 3VV2B 4KHRA 2D3UA 1GNKA 2UV8A 3FRZA 3OFGA 1KNZA 1S1VA 3JSYA 1TFYA 1LWCA 3TZYA 3OD2A 1YBTA 2KG1A 2XG8A 3L7OA 4W92B 2AX1A 2F4VJ 4TXSA 2MLXA 4DV1J 4H4OB 5M2UA 1S1WA 1T9WA 4BHQA 4A4JA 4IO9Q 2ZBIA 2OMLA 4KO0B 4DR3F 3D6TB 3DOKA 2C28A 1OMSA 4WXOA 5IXUA 4M94A 3DRYA 1PILA 3M8YA 4I4BA 4DU8A 3NGDA 2UUBJ 2CVEA 5B0BA 4JI0J 2K1RB 2H4WB 3CDWA 5G0RA 2OPSA 2RDIA 1IR2A 3EVMA 4F26A 2RQCA 5DGAA 2HHVA 3DN9A 3C3LA 4LF7J 3ILOA 4BCAA 3IAM9 4ZS6A 3UD4P 1J5OB 1V5IB 2R8GA 4B3RJ 2UXDF 3ZTQA 1ITPA 2XZTB 1MSWD 3H5XA 1DTTB 1VFJA 2HQCA 4QWBA 2FHMA 2RMLA 2WBMA 1KS2A 2I38A 3MEDA 4LBHA 4ANEA 1S9EB 2JHEA 4FBTA 5C2CA 1VIXA 2GVZA 2VC0A 2VFTA 4NA1A 4OV6A 1S1UB 4WYWA 4JI0F 4LQ9A 1C0TA 4IRCA 2DGTA 5B7WA 3DRPA 4ANCA 4CTAB 3QJJA 3G82B 4WTYA 3ISZA 3RBEA 3I82A 3SZ2A 5CAAA 1HR0F 5KFDA 5D0GA 1RTHA 1Q4RA 1LW2B 4C3MA 4UQTA 1PYOB 1VQOS 2R7UA 1X4CA 4ZVHA 1BLUA 1TL7A 4HVZA 4JI6J 4PQAA 2OGUA 8RUCA 2FIUA 3PKYA 3FBBA 5HROB 3H90A 2V9KA 2F65A 3TZWA 3CCZA 5CD4A 3WIUA 2XWXA 3OLBA 3BS9A 5J2NA 5HVHA 2VPXB 1S0OA 4QOTA 4B3RF 4B17A 5HVGA 1UFKA 5F3TA 1BMQB 3PACA 5K8MA 2R8HA 1BXNA 4YDXA 5T14A 3MPWA 3L09A 2H5JB 1YWXA 3LP1A 2VDHA 1Y7PA 2E1MC 1YZ6A 2K7JA 3QIDA 2XQCA 4B9NA 2CQGA 1D3WA 1W2IA 4WP3A 3DLBA 2APOA 3OPKA 1U26A 4CI0B 1NKEA 2LA6A 3GE9A 1EETA 3LO3A 4DUYJ 2GAHC 4DMZA 3X3UA 3TZXA 4HEA9 2RNEA 4PWUA 1CS4B 2DGOA 3W63A 1YHQS 2FLOA 3A3OB 4MIAA 3DC2A 2RIJA 4FYXB 3MMAB 4G6VB 2QN6B 4P2XA 5E33A 1FNOA 1RUSA 4WP9A 5ETQA 1FFGB 3C6TA 4YMEA 3NXZA 2DNPA 4C7QA 1Q53A 5EDWA 2J8AA 2QA4S 2YWKA 3KLGB 4AL5A 1ICEB 1GAOA 4K2XA 4TY8B 4DR1J 3SMZA 1QDUB 1ZAXA 4NZ0A 1WHVA 5BJRA 2ZJPQ 1VS3A 2RKIA 3BSAA 2YWWA 3I87A 3HD1A 1A0OB 3LP2B 3PJXA 4K59A 4TY9A 5DDQC 4GC6A 2AGPA 1YI2S 3GFZA 4B9MA 2DD8S 2GJFA 2GQQA 1XNQJ 2MKCA 4P2MA 4WTOB 1N36J 3QAEA 4O4GB 1RT5B 3QT7A 3T6BA 2WK4A 1RT2A 1U45A 4DR5F 4A8QA 4KY3A 2FGCA 4IH7A 2XGPA 1T7PA 5JXSA 2ASYA 4PXEA 3AH6A 1FHTA 3KUEA 2N4CA 3VGSA 4KHPJ 2BBEA 2HQIA 1A7GE 1AYEA 2DCLA 2DB1A 3DOLB 3MEEA 1WG1A 5K14A 4TU9A 2F5GA 2UUWA 3GYNA 3MMCA 3KK3A 1N48A 3UPFA 4OZ2A 4Q8EA 4LF9J 3TNVA 1GMWD 4U7UK 2BM1A 4JI7J 3VHQA 4ENOA 5F8GA 2DTJA 5J2NB 2AEJA 2XHCA 3I4PA 4ECVA 2CPYA 4ZPCA 2E5IA 2WVEA 3NEKA 4I2PA 1RU1A 2L08A 4NMLA 1F5BA 2BANA 4RBVA 1KRPA 1PJ5A 5KOWA 1MU2B 4CM2A 1NB7A 3HDSA 5B0EA 4HLBA 5H1SV 4CIOA 2KM8C 4I2QA 4UZBA 1S6OA 3UI3A 4DV0F 2W24A 1T95A 3CW2C 3ICLA 2MGZB 2PFFB 3G6ES 1PAUB 4NCGB 2R42A 5ETVA 3FNNA 3HVAA 3RBXA 2UP1A 1Y9OA 3PEHA 4WWSA 2G4BA 2IDLA 3IFEA 4H4KC 2KU7A 2EK6A 3DMJB 3MDFA 5CQGA 3CEDA 4WFAQ 3GIKA 2R2TA 3AB2B 1VBXA 3V4IA 1JX4A 2IYIA 2ZBQA 1U0HB 3ZNJ1 2KRBA 5SUHA 4M5MA 4DS4A 4CLPA 1TAQA 5DJBA 3M9OB 4P6QA 4FF4A 4C11B 4OHZA 1Q86T 1WC3A 3M2RA 1C1BA 3RU0A 1SC3B 2FVCA 4Q0BB 5D3GB 1URRA 1FT8A 2KVIA 1RB0A 4CT8A 3CCWA 3VTIA 2YVSA 3A3PB 3MUVP 2HAIA 2XMVA 4CTAA 4KBIA 2OEJA 3DYAA 2N82B 1HA1A 2YWEA 3H40A 2HURA 3JXOA 1RT3A 4B3TF 1AFJA 1RHJB 4C9DA 2HVHA 1FKOA 2FZCB 3NS5A 4TNOA 1GXUA 2QT7A 3CCES 2BDPA 4GVLA 1JLGA 2EBGA 2W01A 4HHUA 4KIAA 3CUNA 4RW8A 4PWDB 4G1PA 4QQBA 3U7JA 3HJVA 1U09A 1JJCB 4GMKA 2AYGA 2KT2A 4LVNP 4C3KA 3KNAA 4ZLLA 1HQUA 1H2TZ 3TA2A 4ZPVR 4DPUA 3KLIB 5DQGA 1JLEA 4ZP8A 5BR8F 2VIHA 1BHNA 2HQGA 5KFCA 3G8SA 1D0EA 6FDRA 5E3AA 4LF6J 2MKHA 4HACB 1LK5A 2ZBCA 1IXKA 3RAXA 4QIGA 2MZRA 9ATCB 1HI8A 1HQUB 1E6VB 2KN4A 4QJVA 3HM9A 1H7WA 4JI4J 1YJ9S 4DF8A 3R6LB 4EMDA 2BW2A 4RW8B 5E41A 1FD2A 3W2WB 3ETOA 3MHYA 2RRNA 4ZPDA 3MECB 1UW4A 2JVOA 3AY0A 2UV8G 3GJRB 1NJYA 2ZUGA 1FD8A 1FWKA 2BJDA 2FY1A 2CA9A 3OFEA 3TQ1A 3JTNA 1NHUA 2VASA 4DL6A 2LMIA 1VK8A 2KXHA 2LVWA 1WACA 1HWIA 1T9YA 2ALYB 3ENVA 3O5TB 2HK3A 4PKDB 1ZTWA 1I6JA 4LRBA 3R9LA 5BXIA 2HGLA 2K1RA 2XSFA 2OD6A 2AEFA 2ZNYA 1ZTTA 1U0HA 3A1YG 1P9YA 2PMZD 5AXNA 2ZOMA 1S6PB 3PRDA 2PN6A 5D4LA 2L9DA 5HQ8A 4WJBA 4XDCA 2ILZA 4ID5B 4WBFA 3D0HE 3U1NA 2IM0A 2E7XA 3GMGA 2ZH1A 2OUGA 5IQQA 2EFGA 2VA2A 1WJ9A 1GXTA 2C2MB 1JNZB 3AOCA 3PEJA 3F41A 4NYOA 6AT1B 2PGCA 3KKFA 4ANDA 3RAMA 2UVRA 4WIQA 3PJWA 3ONQA 1GMVA 3IGNA 1S6QB 4LRFA 4ETZA 5AE1A 2RDJA 4YR2A 3EVWA 4YFUA 1JXEA 1UEVA 4QU6A 2FPHX 5J2QB 2EEYA 2ZM6J 4ZCIA 1NEEA 1EARA 3CD5A 3HKWA 2GIFA 2M8HA 3AHPA 3Q24A 4ZVQB 2MQOA 1N4LA 4K4VA 2I0XA 3CTRA 4QR0A 2FHOB 1HNZF 2Y8WA 2J6SA 1P8GA 2ZZTA 1RISA 1T3OA 4CLYA 4I6WA 4NE9C 4CM0A 1N5VA 5LSRA 1L3KA 1QY7A 2XMKA 2XWYA 4S0MA 5HI7A 1REVA 3PRVA 3VGTA 3ZZZA 5HMXA 3BQ2A 3KDOA 3BR9A 4P74A 3CC7S 2YQ0A 4LF2A 5FDLA 4OHYA 4URQU 3JYTB 1FRMA 1SJQA 1UZDA 3KLEA 1XMOJ 2QGFB 1D1UA 3TA0A 1MG7A 5HJYA 4ZN1A 1UVJA 2NZ4A 3FBFA 1SV5B 4BLGA 1UZHA 1TUGB 2MY7A 2YKMB 1PKUA 5L1IA 4RUAA 3T5JA 2Y8YA 3CD6S 5A8WB 1S4EA 2CRLA 3BBCA 4C11A 1TFWA 2CQ0A 1RAGB 2DVIA 2DNNA 4HI1A 5KFIA 3G4SS 2HQDA 3EXCX 5L1JA 1RCOB 3R8YA 3P45B 2AGQA 4B3OB 5F8NA 1E6YB 1U6ZA 2YKMA 4DR6J 3HLUA 1R8PA 1NMEB 2KT3A 3TUPA 1RZMA 3R3TA 1NPRA 1CVJA 1R0AA 3DHXA 3KLEB 4WFZA 1BQMB 3LP0B 2AJ1A 4ZPWR 1UCNA 3GV8B 2V50A 1VGYA 4NLTA 2Z56B 2HFNA 4C3LA 1N56A 2K3IA 2PMWA 1VC5A 2F8MA 3HPOA 4CWBA 1TL3A 3BSNA 3JQMA 4DX6A 3W5YA 5A76A 3ZO7A 3CJSA 4LSLB 5KT4A 1XK8A 2CDRB 3MAAA 1H72C 3HHLB 1JMTA 3QAUA 3VR1A 1OS5A 2HNYB 2QLXA 3L3CA 4DL7A 1CJKB 3VAHA 4E98A 1X4FA 4ELUA 4F0HA 4PR6A 1HNZJ 2IHR1 2ZHOA 4I69A 1QE1B 2MKKA 1QSSA 3R2DJ 1RWKB 1RKIA 1VYAA 4UUXA 4ED6A 1F5AA 2FVSA 4M8LA 2K2PA 2DNRA 2VBXA 1S79A 1DURA 3H2LA 4FF3A 1BC6A 4RWWA 1LWFA 2QEXS 1XBWA 1B0TA 5E3CA 2IIHA 1FFWB 4EYHB 1DLOB 3CCQS 3W8GA 3CCTA 4O23A 1X4DA 3AD8C 2OPPA 1SL1A 1JLFA 2F3JA 4LF7F 3OFHA 4L6V3 3H4BA 4EZ6A 4OZLA 2XLJA 4ILRA 1NDKA 3DRPB 4LF5F 5GAHI 3AA9A 3U1MA 1RU2A 2MYFA 3BGUA 2ATLA 1HNXJ 2XNRA 2BRKA 2FDNA 2AD9A 3WC2A 4F4WA 4B3MF 2CQ3A 4RR5A 4TLRA 2FY8A 1G3OA 4DV1F 2NXJA 5DETA 3KLFB 2W7PA 4R0JA 5CYMB 4ZPAA 4WF9Q 3BPSP 1Q0NA 1VHIA 1AZSA 2PA8D 4K5RA 1IN0A 1WUUA 4A8XA 5LMNJ 3PFOA 1D9DA 1Y11A 3VGUA 2DHXA 2OPRB 4NASA 4UUWA 5ETOA 4C8KA 2QMXA 4Q8FA 5J2MA 2DT9A 2VG5B 1BUXA 3MEDB 1HMVB 1TKZA 2BOAA 1T9TA 2LEAA 3D1HA 5K9FA 2Q79A 4Y3CA 1KVJA 2Y1IA 4CO3A 2LQ8A 3CB4A 4HH0A 2CNLB 3IG1A 4HI2A 4MTPA 4OJHA 1NSKL 2A10A 2RSQA 4PQUA 2J7UA 4YOEA 3Q8QB 5IT9U 5F8LA 4RBUA 1YJVA 4AXIA 3PYDA 4AXJA 3IS9B 2YX1A 2DR6A 4NYPA 3GILA 4GKJF 3NAHA 4PZVA 1MNEA 4RL1A 4LSNA 4HTJA 1OO0B 2YNHB 3R7SB 2HEKA 2ROEA 3PW0A 4LRDA 1KONA 2N3OA 2N7CA 1C1CA 3DRRB 5A2QY 1VQ9S 4IUFA 1SPBP 3TQEA 2OTJS 1FO1A 3MWBA 3RTVA 2RU9A 5E3PA 3E01B 1SBRA 2RVJA 3TP2A 2VZ9A 1FKPB 3AXMA 3JSMB 4I6YA 3M2VA 3T5KA 4Q2LA 5CABA 4X4NA 1FK9A 4LR7A 2QA1A 1WOPA 4MH8A 1RBAA 2OSQA 1M90T 1N54B 2YQ1A 2FTRA 4ZVSB 3VQTA 2KHDA 1CJTB 3PW5A 4OV1A 4DN0A 4LSNB 3EYZA 4ZHRB 2X1AA 3CCLS 2COLA 4F4XA 1IR1A 4CRJA 4CYUB 1Q8BA 1K8AT 3DDNA 2KB2A 1KFDA 4CO0A 2CPFA 3CNQP 5AE2A 3OVBA 1WC6A 2OMOA 4HHHA 2CPHA 4YB5A 2J7WA 5SZTA 1UVKA 2WONB 4KAIA 1SUQB 2CWXA 5A6WA 4AL7A 5HAOA 1P6TA 2ZC3A 2MKSA 1IKVA 2LDIA 4QWEA 2WW4A 1MN9A 2CJBA 4DV5J 2VFVA 4A8WA 4ER8A 4ZDNA 2MLZA 1YJTA 2PE8A 2Z2LA 4EFAC 4WZMA 1XR7A 5F8HA 2FJWA 4DUZF 2ZC4A 3OHBA 5DZ6A 3MCOA 5KOXA 3FSIA 2E5LF 4OYPA 3K17A 5K8NA 1W25A 1R6YA 4ZCMA 5C7PA 2W9CB 1F0XA 2BANB 3HVWA 1UAWA 3D9BA 4B02A 4IO1A 1XC9A 5H9FK 4UOCA 4LREA 1JXVA 4EUVA 3HT0A 3FCHA 1LOUA 3L4BC 2M2BA 3O3LA 3TJ8A 4RW4B 5HBMA 5KFOA 1X60A 2CFXA 3UNGC 4MKYA 2QLFB 2GO9A 4M5DB 3BGOP 2JH3A 4F4ZA 1DTQB 2EVZA 1QUPA 2DGQA 2IYGA 3CJ4A 3DOLA 3NCQA 4U8YA 3R97A 6FD1A 3I5BA 5JMNA 2ERRA 2MSTA 1VQ6S 2C3YA 2IA0A 4NMXA 2QA2A 4RX6A 4JI1F 4DV6J 2DITA 1IWGA 2QFJA 5FJ4A 4NXMF 2BE2A 3GG0A 2DNZA 4KPCA 4DCOB 3MURP 3KHHA 1AW0A 2V4JB 4P72A 2ACYA 3NGUA 3DYAB 3EGWB 1FDAA 3LH2S 3NCPA 4MFBB 3J80Y 2A1BA 5EGYA 3V2UC 2HWTA 2FLNA 4KFBB 1URNA 3KK2B 3T5LA 5A8RB 2CVIA 3I55S 2I2YA 4NXMJ 2E9RX 3PX6A 1U8WA 4F25A 3PX0A 1NO8A 5DRKA 5LT5A 4EZ9A 4IQXA 2V68A 3R27A 4X4UA 5J1EA 5A8RA 1C4CA 1SXLA 3OXFA 4KE5A 3UDEA 3TI0A 1VQ5S 2QA4G 1Y00A 1GX6A 1KTQA 2X7IA 5HJXA 2KJVA 5B0DA 2DHHA 1RHQB 3A4TA 2CWKA 3JSRA 4I6AA 2VG6B 1N6QB 2I5JA 1LK7A 2CQ4A 3M8WA 1KVIA 2ABYA 4C48A 3FDSA 1Q8KA 2HPUA 2VG6A 2YY3A 3EWGA 2MJUA 4AYBD 4I7FB 3MFHA 4NLRA 1RAFB 1UP1A 3F0NA 1DTTA 3M30B 2W7OA 1DZ5A 3MMCB 2V8DA 1G2EA 1Q81T 2DH7A 2A0FB 3D7SB 1X7VA 1N32J 1S59A 4JB8B 3HHLD 4O3PA 3BKTA 4Q5VA 4MK8A 1FJGJ 5ETLA 4OJGA 3T1HJ 1TKTA 4W98A 1VQYA 2DBBA 2DGSA 3BGFA 4WU2A 2NYHA 3G96A 4X4TA 2IJFA 2XCAA 4OX8A 1F1BB 4FF2A 1S1WB 1S12A 1CJUA 4KO0A 2C3OA 4QPXA 3DDKA 4C8MA 3H20A 1G1XA 1HPZA 2B4OA 3EICA 1FESA 4WK3A 2CQHA 5KG4A 3PY8A 2F4VF 1DHMA 2CQPA 2FVQA 2BXJA 1R8AA 4P7TA 3D3BJ 3Q8YA 5AJ3F 3OSNA 5T41A 3PR5B 2EFQA 3ENAA 3JAMU 4YDDB 1RYRA 2QMUB 4KHPF 4DV7F 2XMAA 3GSDA 3AQPA 2MPUA 4DN9A 3K5MA 3RYLA 2PSZA 4P71A 2FJBB 3IM9A 1N0VC 2MSSA 1ZA1B 2ZFHA 5HLFA 4PCQA 1R6VA 3M8PA 4U6PA 1Q95G 3N0VA 3CWJA 4G1QB 5I4MA 2JDJA 4DL2A 3W9HA 3R7NB 3IBCB 4P75A 4QIVA 3J7Z5 1ZH5A 2XB2D 3K5PA 4DU7A 2XEXA 3G82A 3TVZA 5F8MA 5HP1A 3BF4A 2ILYA 2WOMA 3SDEA 5GAHU 4ZVPB 2HFSA 3DDIA 3MUMP 4DV3F 2EC2A 3PIPQ 3NP5A 2YBVA 2P6SA 1GQEA 3ZZTA 1WF1A 5L1KA 3AAWB 5IV3A 2J0QD 3MI7X 4GO5X 3BQ0A 1N33J 4M5IA 1N5QA 3I5CA 5KFLA 4OYZA 3MCNA 4M5DA 4DV2F 1PYSB 4NLGA 3M9NB 1F3FA 3CJ8A 2VA3A 2GO8A 4CLZA 1I94F 3TUJC 1WHYA 2BQUA 4IKAA 1B7FA 3D3CJ 1GTHA 5KFAA 3OTOJ 2ZNZA 2YKQA 4RW7B 4FS2A 1UVIA 4FF1A 4LFBF 4ZLJA 3MECA 4AFFA 4JV5F 5AXKA 3JSBA 3QGGA 4ZOSA 5IV4A 2LQ5A 2V4RA 1SC1B 3NOCA 1F9HA 3RG6A 2PMHA 4PG8A 3LGHA 1FX2A 3PHTA 2VD3A 1C1CB 3DRRA 1KC8T 2EK1A 3FBCA 1QAYA 3BPDA 2J6TA 2Y3YA 5DQIA 2HHHF 2HWHA 2AV5A 1RTZA 2LLZA 2RS8A 3L9ZA 2EFNA 4QR2A 3BZQA 1LKZA 1RI7A 4F7VA 5A8KB 1UPPA 1T03B 4N76A 2B7CB 1MLAA 4K8RA 4B9LA 2R7XA 3RGIA 3MMJA 1PAEX 2QG9B 4JI1J 3S1TA 1NDCA 1VQSA 3CJ5A 1T05A 1XNRJ 1OPZA 2WVDA 5E0OA 3TVKA 5KFKA 3G6XA 2DPIA 1RAHB 3FKBA 2JVRA 5L8RC 1RHMB 3MM8A 1JLGB 2HS0A 4UT4A 2B43A 1T05B 4KGVB 1GXLA 1QAIA 4DPYA 2JC1A 1QVFR 2DRAA 3ZXWA 2XMWA 1SL0A 1RT3B 2RDDA 3N28A 2Y1JA 1KQKA 2HIQA 3QT8A 4NL5A 4M95A 3MFIA 5GAEU 4O3RA 4UQGA 5D0EA 2R3VA 1NNDA 1HQEA 2DK2A 1N5YB 2B4UA 4K5SA 2E5LJ 4RO0A 1RKJA 4LF8F 4N8OA 3BREA 3GFHA 2ZWPA 3BJYA 1UTAA 4V19X 1PIEA 2C42A 2X51A 2OKQA 4ES3A 3THVA 4B3OA 2M70A 3MGJA 2J9DA 4QIFA 2ZEJA 3FZBA 4DR7J 1HHQA 4LT6A 1EB0A 4ITSA 3VWSA 3OV7A 2AF6A 2WB4A 1NCLA 3EGZA 3MR5A 1G6BA 1WG5A 2DIUA 2K3KA 5CZVA 5HQMA 2VJVA 3NAIA 2K7KA 1SJFA 2BJ1A 3BH7B 2UUTA 4WFBQ 3QSYB 2I6WA 1HYSA 2HRUA 2OP5A 3HHLC 1EJ7L 4DR6F 2AJQA 1H2UX 1U1PA 5A8KA 1HNWJ 3IP0A 3M2UB 2G2OA 2FJDB 5BR8J 2ZH4A 1P27B 2DNKA 2VG7B 2ZVSA 3M8QB 4IG3A 5FDLB 4R8UB 3OTBA 2EFPA 3SSQA 2Q1LA 3K59A 2UXDJ 2DNGA 1GEHA 3D4JA 4LFAF 4GVBB 4ZCLA 3CCRS 1BWVA 3DHWC 4ICLB 4Y00A 4NEZA 2B51A 2W9BA 3LTOA 1B99A 3T5HA 3RBDA 1N33F 4OYBA 2HNZB 1SC6A 2VKRA 1MW7A 2VF3A 1JJHA 3FQKA 5IC4B 2D41A 3J7YI 3PIOQ 1NJWA 3HSDA 1DJ0A 4OLPA 1U25A 2VQFF 4HTIA 2HBYB 2HQFA 2B3TB 3EZOA 1S1TA 2HSEB 4USIA 2YWHA 3T19A 1C4AA 2EG2A 3DLEB 1I3OB 2B9YA 2RKIB 3CIMA 3KMSA 5LMUJ 1NJXA 1QTMA 3GU0A 2LA4A 3KHRA 1VQNS 4DUZJ 1TL1B 1HHSA 1RWUA 3BSCA 4C97A 3J81Y 2KO1A 1K0VA 1XMBA 4L73A 1XN9A 2P5VA 3DLGA 3Q8UA 5IM0A 1N34F 5LL6d 2BOPA 4IFVA 1LNQA 1HMVA 2KZZA 3VAIA 3HVTA 1OWXA 4YB7A 1BQMA 3DLGB 3LP0A 2FQQB 1TK5A 4IG0B 2I5JB 4X4OA 2NSBA 2W2OP 3OTCA 1VRUB 3C14A 1P9QC 2OAUA 5HMYA 3BSOA 2DXFA 1WC0A 2MQQA 2V34A 3AD7C 3PZPA 2RE1A 3TR5A 1KQSR 4I7FA 5KFQA 5K8OA 3IBWA 4O3SA 2BMBA 4DWIA 5A6PA 1SJ1A 2GZOA 2VG7A 4R8UA 2VJUA 1REVB 1UFWA 4KB7A 2XYGB 5GAEI 1JLQA 4WFNQ 4IYQA 5IT9Y 4NLQA 3I5AA 3K7RA 1HYSB 1Q5VA 1KFSA 4I67A 4A8OA 8AT1B 4D3GA 4UY85 4ICLA 1WTFA 3D6HB 1WORA 3CCUS 3R5JB 4K4UA 1LXNA 2AJ0A 2C2NA 2XS2A 4DEZA 1NRKA 4MIWA 5HO4A 4RPFA 3LUYA 4KRWA 4PUOA 3FCWA 3F56A 3I0SB 3CMAS 3I32A 2KTQA 2ZD1B 2LXIA 1X0PA 4IG3B 4FBUA 3W5ZA 1S76D 4MKVA 1QD1A 3QSIA 4ED0A 2UXBJ 3G9CA 3R6GB 2DO4A 3BKUA 3J7ZT 3K58A 1BE4A 1RACB 2AJ4A 2OEMA 2O3DA 3LF0A 1GT8A 4CO4A 3FMWA 5KFWA 2D1CA 3TAQA 5B08A 3N5FA 4FYYB 5L1LA 1J5OA 1IM4A 1TQLA 3Q83A 2ASJA 2FZGB 3AXKA 3OXGA 4OHVA 2R2UA 4WYLA 1T02A 4Y2AA 4RLEA 1TL3B 1HNIA 5CCMA 3CCMS 2OO4A 1HQ2A 1LEOA 2HFOA 3G6VA 3HX9A 3IRWP 3MEKA 1AZSB 4KHMA 2KFYA 3R1HA 4YEAA 4DL5A 2HKEA 3SFGA 2WVFA 4BWJA 2UXCF 1WHXA 3RW7A 5D78A 1PO6A 9RUBA 2Z2ZA 3LPEA 4DUYF 4WPAA 4F04B 3CCJS 3N6LA 5L38A 3V6DA 4MT1A 2LCWA 1RA6A 2QO3A 2HZAA 4OFZA 2XSJB 2J76E 2L41A 3BGRB 4A46A 2YPYA 5BYRA 3UN3A 5A8WA 4RW6B 3KTQA 1UMJA 1SQEA 1IM6A 1XJWB 3QQCD 2YKPA 4NLUA 4USMA 3MD3A 2VKZG 4QWCA 4DUTA 3BN7A 4U7CA 2W9CA 4FXDA 5T7LB 4QPTA 4JI8F 4ES2A 3D67A 3GG1A 4B9VA 1XIQA 4RW7A 4BBYA 2GCFA 3CMES 3OBIA 2YH0A 2W25A 5L9XA 2XI3A 2CQIA 2FJAB 2O67A 4RNHA 4K4XA 4FVMA 1RAIB 3EGNA 3M6UA 2OELA 1SKSA 4X2BA 3QMQA 1AUSL 1RAEB 3M1VA 1O0PA 1QUVA 1SUQA 3K5NA 2BYCA 4H4OA 1VLYA 3LQVA 3MM7A 2JX2A 2KI2A 3D1QA 2G0CA 4PABA 5EWFA 4YB1P 3Q0AA 1FRXA 4QZVB 5DM6Q 3NBPB 3W7BA 5M2PA 3J80U 3ETMA 4CO2A 1HBOB 4Q43A 3AFGA 4EEYA 2EKYA 4I56A 1FEHA 4G1IA 4L3NA 1RT4A 2QJ3A 3LAKA 3IC1A 4Y65A 4CCHA 5KT2A 2IMWP 3I0SA 3FRYA 4ED7A 1ZA2B 5LM7E 3TJAA 1LWXA 5ETTA 4P2FA 4DFMA 2MB0B 1RWVB 2GAGC 4X66F 3GLJA 3KLVA 3BO3A 2YNHA 1HBNB 3A3NB 1X5OA 3QATA 5D3GA 1NHKL 1FE4A 4ECYA 3SFUA 1SQFA 3KLHA 2FD2A 2O01C 1R0AB 4RNFA 1S0NA 4ZA1A 1WNEA 1RABB 4NLOA 2RHQB 1HNIB 2Z2MA 2DPJA 1HBNA 1WI8A 2J9EA 4IOAQ 3A8IA 3Q8VA 4M63A 4Y0FA 4IDKB 4YUDA 3VAFA 1ZETA 5EX0A 1PC5A 3R5BA 1NJZA 3H8YA 4GKKF 4OI4A 2BM0A 2RILA 1IQTA 2ZITA 4ZVRB 2CYYA 3T1YJ 1X5TA 4LBIA 1YLXA 1XTZA 2AJ2A 1LFWA 5E5NA 2HLUA 3E51A 3EDQB 4IH5A 1QSYA 2OFGX 2HNDA 3NLCA 2FB0A 1KWMA 2V2QA 4DSFA 4I2PB 1WEZA 4I68A 4ZVTB 2QFIA 2NLWA 4LVOP 1M1HA 2H5IB 1FXDA 4PAAA 4ZKAA 3HXMA 2DYAA 5BYSA 4UY8T 5F8IA 4KGMA 1NK9A 5G4DA 2CAJA 2I1RA 5IZHA 3SV3A 2ZZMA 1RHRB 1IKXB 1KP6A 3M8RA 2R8IA 2AWZA 2GGPA 1X4HA 2WAQD 1GTEA 2M8DB 2PEHA 4TN2A 1JKHB 4KH0B 1S77D 3KLFA 4Y28C 3G8TA 3Q8SB 3EX7B 1MROA 2CNKB 5HSPA 1HKAA 2GFFA 1V3SA 3S01A 1KDNA 1HNVA 1PSDA 5KFZA 2RQ4A 1XR6A 4C0HA 5HMZA 2CNNB 3MM6A 1XQIA 2MXYA 5CYQA 3RZAA 4LF6F 3H5YA 4LFCF 1NJIT 1WKLA 2KDOA 2ASDA 4FKXA 3QO9A 1CC7A 1H73A 3DNCA 5KAKA 1RP5A 2W2MP 4FNHA 5K14B 3MR2A 1K73T 1TAUA 3KG1A 1RT6B 2D69A 5GVQA 3K5OA 4QWAA 3BO4A 4C8LA 4ILMA 4JI2F 1N32F 3ENWA 4Y2MA 1EIYB 2ZH5A 2B6AA 2HBRB 3RR7A 3WIVA 3NMAA 1C0TB 1YITS 1FFSB 4O3NA 3MMAA 2FC9A 4LSLA 2C3UA 3GONA 2QLJB 2WOMB 1ZM9A 2GQ2A 4JUZA 2GJ2A 3J7YU 2PI4A 3FCVA 3GJSB 1RWXB 4LF5J 1K1QA 2HVDA 2YNFA 2H54B 3OTDA 2GIQA 1Y4ZB 2K8GA 4URSA 2LXFA 2IM3A 3KLGA 2ZHAA 1T0TV 2AW0A 1FX4A 1Q16B 1U2CA 3OR1B 4KGZB 3ZZOA 1FXRA 3MR6A 3KOAA 4ED2A 5HROA 1TVRB 3KMQA 2Y0BB 2CQCA 5F9LA 5LJ3Y 4F3OA 3O1LA 3UVJA 2E9ZA 3C8YA 1W2BR 3KJFB 2V4QA 1ZZNA 5FLXY 3W2WA 2KXNB 3ILJA 5KT6A 2IFXA 2IVMA 2MEWA 3MPVA 4RKUC 1OPIA 5JUMA 4YR0A 5F8JA 2WSEC 3NNAA 1IR0A 2Z2YB 1E6VA 2DISA 3IR6B 3QLHA 3IRXB 4CH7A 5KFNA 1LV5A 5E3RA 2HMIB 1FCAA 4ID8A 2VONA 5DZ7A 3QZ8A 2R8JA 2AIRB 1HNVB 2GVZB 1Z2ZA 4N77A 3SBMA 1WKJA 3UCGA 3VAKA 1FRKA 1IBKF 4L3KA 3HKZD 1M5SA 3LANA 3R7BB 2V0NA 4G65A 5DQHA 4URGA 3TA1A 3FMBA 1FE0A 3CULA 1DQ9A 1JKHA 1FVQA 4DLEA 1RAOA 3HJFA 3HK2A 5KFRA 3ZZYA 2L3MA 1OYDA 2GGPB 2C22A 3PG9A 2LKZA 3KNGA 5DDPC 4NRUA 1VIOA 2B4PA 2ROGA 2UUCF 1S1UA 2OPQB 3ILIA 3P3DA 4EO6A 1JJ2R 4DFPA 2HZVA 4ZVGA 2F40A 2GA7A 1NK0A 1IKVB 1VQ8S 2ZBPA 4A8FA 1XEZA 1FRLA 2V8VA 1NK5A 4JI4F 1S6PA 4BS2A 3M8SA 1WWHA 4EU0A 3SQGB 4CT9A 2WRMA 3GB0A 1XERA 1UWAA 5D4OA 4C8ZA 1R7IA 4R0EA 4H4KA 4DFJA 2JLEA 1XMQJ 4DL3A 2IVYA 2XI2A 4ATNA 4KJIA 2JEIA 4PYDA 5C5JA 3FK4A 5F3ZA 4NLSA 2QYCA 1TV6B 4J9KA 4M5KA 5LOQA 2HNZA 4Z7CA 2LFVA 4DQSA 1TK8A 3GYGA 1IKYA 3BYRA 1WC4A 3MMBA 3J81j 1QSLA 5ADZA 4X62J 2MQPA 2J0XA 4V19J 3KDNA 1A6LA 1Y5LB 2CZ4A 4F50A 4K4YA 3AJ1A 1PGZA 2UVUA 2KZMA 2J5AA 4OI1A 3PCOB 3TO8A 4F4AA 4MFBA 4U67Q 2KM8B 1OQ6A 5D0HA 2JFDA 4L74A 2GVDA 4UTGA 1CJTA 4C0OC 3M2UA 3G87A 3SCLE 3TWZA 3W8PA 4PPZA 1RE1B 4ED8A 1TL4A 1YQHA 1ZAVA 1YK9A 5LXYA 3US5A 1IBMJ 2OH2A 3B82A 1HBMA 3NS7B 3T1HF 4J9LA 4PG4A 1FVSA 2ZOGA 3UE2A 1S7HA 3A8EA 3HI9A 1SL2A 2MQNA 3M8PB 1VJWA 2HIYA 2KT5A 4O3QA 3FSYA 3GCXP 3DMJA 3CD7A 4E8UA 2DXDA 2XMTA 3C66A 2AGOA 1NKCA 1Q78A 1V5VA 2BKPA 1QAJA 4F3QA 4Y2IA 4BDPA 4IRDA 3M32B 4FYDA 1S6UA 4AT1B 2BR0A 1DARA 2NQPA 3BV8A 1NHVA 1EQ0A 4USKA 5L39A 2H5EA 3AD9C 2ZWOA 2I8EA 3K8VA 4OZ5A 2A2CA 1UA1A 4GKJJ 4XIUA 2DHAA 3QRQA 4K50A 5KG6A 1SKUB 3EZUA 3FJ2A 4B9TA 4P2SA 1NAQA 4Q2MA 4QIWD 1OSCA 3NGTA 3RJMB 1M5HA 4ID5A 1WTBA 4JOUA 4LQ3A 1EX8A 2V5HG 1IBKJ 4USHA 2DNQA 3W1YC 3W9JA 1R0CB 1B7YB 2AX0A 1HD1A 1FKOB 4QW8A 4N7TA 1NK6A 1KKHA 2M3DA 3OR2A 4WE1A 5C24A 4ES1A 2BVZA 4PPDA 3SQGA 2AP6A 3SXLA 4WKYA 4IG0A 1VOMA 3M30A 3P4UB 4XDDA 4LSZB 1WF0A 4V1Ak 1CJKA 3OR2B 2CXEA 2YNGB 2IA6A 2N4DA 2E5JA 1MU2A 2WVBA 4OZNA 5DDOC 1BQNA 5BYQA 1F6TA 4RU9A 3E2EA 2DY9A 4UW2A 3V4IB 1T03A 4NCAA 2WSCC 1RWWB 2ZH9A 4DX7A 2DR5A 3W5XA 3EM1A 3GSIA 1HI1A 2ZBRA 3HZGA 3E3XA 3IAS9 4DPOA 5F9NA 2R2RA 4L76A 2B8QA 4AL6A 1F9FA 4USVA 4ELTA 3HVRA 4XPCA 1U2RA 3CC2S 4DR7F 1S9FA 4A8YA 1R8BA 3M32A 4Z37A 4N5SA 4K0KF 2OSRA 4TQSA 1NDPA 3C16A 2MQ8A 4OMFG 3GIRA 1IJEB 4EWTA 5CZXA 2HHHJ 4J9RA 1VI7A 1V9OA 2D3ZA 1FWPA 3R5CA 4FN5A 1T9XA 1NXIA 4DS5A 2HHWA 3ZZUA 3GQCA 4ZJLA 1SIZA 3KK1A 3THPA 3Q86A 3UDVA 3IG1B 4CDIA 1S0MA 5K8PA 4JI5F 3BB5A 2CG4A 3I0RB 4ALZA 5HN0A 1LW0A 5HP1B 1WEYA 2VG5A 3EPIA 3K0JA 3JQJA 2G9OA 1VRUA 2AJFE 4YB6A 3CE8A 4R5PB 5F0UA 2IAJB 3KYLA 2N7YA 3RRGA 3QRRA 3RAQA 3OVSA 3CC4S 4K4ZA 1ZPWX 2E1PA 1VQKS 1RHUB 3HVTB 1TR0A 4DL4A 1VDHA 2B9XA 4BC7A 4DJBA 2BV3A 3SYZA 3VAJA 3KXDA 2QRRA 4FPIA 5FIIA 3N6MA 4E2FB 4X4VA 4DR3J 3L7PA 2BJ3A 2GW8A 2HGMA 4HT7A 1KEKA 5KG5A 4AQYF 1ZYQA 2UUAF 4JI7F 3NMRA 2HHTA 1N88A 4JYAF 3DCAA 3BM7A 1O8BA 3UCUP 1F2HA 4LR9A 1P1LA 5EWGA 4DV4J 2D3O1 5HL7Q 2Q6CA 1S1VB 2UZAA 1S1TB 2XLIA 3SSRA 1NKBA 2ZH8A 2BA9A 3A12A 5DM7Q 1SKWA 2H48B 3QGIA 1T9VA 1J5EF 1TKXB 8ATCB 3C16B 1G7CB 3WX4A 2B56A 1OJ4A 5KTQA 3C6TB 3CJ0A 3ZTSA 2MZQA 1KD1T 3AA8A 2WONA 2YTCA 2DRBA 4CH0S 4O4RA 2B7BB 5DS7A 2CPDA 3POTB 2ADCA 1YJUA 3LGMA 4ZPBA
chains in the Genus database with same CATH topology
3E8OA 3CVKA 4OIXA 3TVYA 3OVAA 2KH9A 3OTEA 4DR1F 3RB0A 4RUHA 1CSJA 2F7VA 4F3MA 3PW7A 3RR8A 1YJNS 2RS2A 4NA2A 1LFPA 1HNXF 4PRFA 5KFJA 2ZOFA 4FS1A 1UWBB 2WW8A 1V3RA 4K4TA 1ROFA 4XK8C 2HFZA 2XY5A 3RB3A 1RT7B 4JV5F 1CEZA 2JZ5A 4ECSA 5E2QA 2DR9A 3TARA 2JLFA 4WK1A 3PVXA 1HQEB 4RNMA 2R7SA 4OX9F 4PXBA 1MWZA 5C24B 3SCKE 4USJC 3FQLA 1Q7LB 3X1LB 4Y2KA 2ZDOA 4MKBA 3DGPA 1HWUA 4QWDA 2QE5A 2VC1A 2LYVA 1YRXA 2RUGA 3WBZA 3P6YC 1U1KA 3DRSA 4RNNA 3MXHP 1MROB 1TL5A 3IGVA 2J0WA 2F8HA 4NA3A 1JB0C 3V6KA 3PV8A 2UVVA 2CZVC 3LOUA 1HWLA 3LAMA 2HS4A 1RT1A 2W4PA 3ISND 2LU1A 1SJ3P 4DHVA 2X1GA 2OPSB 3H5SA 2XCPA 1JK9B 2WB1D 5GADI 3NBPA 2PD1A 2HRYA 3MTJA 4DV5F 2W7AA 1SH0A 3DXBA 2XS5A 3KHGA 1KHWA 1SH3A 5CYMA 2RQMA 5DG7A 1U7LA 2B9WA 2AQ4A 1CLFA 2CQBA 2O5DA 4EBEA 4D3HA 3DM2A 5C42B 3HHNB 4H4MA 4MIBA 4MK7A 3PKMA 1ZAWA 1X9SA 1KHVA 2CJKA 2DGUA 3BDPA 2ALZA 1IUJA 1RTHB 4HDGA 4HKQA 1QVGR 2ZH3A 4I64A 4YY3F 2JOQA 2MDAA 1HBUB 3OJSA 1U1LA 2KYXA 1CG2A 1FEEA 4PWDA 2C2DA 3WDOA 1YTYA 1TKZB 4FPRA 3HHKA 1UWBA 3IR5B 1JLAA 1UVLA 3DU5A 2MHNA 3P5TL 5E3QA 4CNYA 2MZ1A 3OUYA 2RRAA 1VC6A 1KSPA 3IR7B 3C46A 2FVRA 5M2RA 3QJLA 2YQ3A 1APSA 3OQ2A 1QJHA 5DG8A 2HVIA 3MF5A 5I3QA 3QWPA 3GWCA 1AXQA 2CPIA 2U1AA 1EP4A 4MYTA 3DLHA 2DNYA 3MM7B 2FGOA 1XMOF 3BEGB 3DRSB 2UUBF 3NG8A 5KG3A 3V5RA 1HD1A 1FTCA 4IOCQ 1YJRA 3Q22A 3CJKB 2VBWA 3NKYA 4HHJA 4KV8B 5DLFA 2VPZB 2BRLA 2F1FA 4OI2A 3JSMA 2MKIA 2HG4A 1S9GB 1H7XA 4J9PA 4F4YA 3D2WA 1BGXT 5I3UB 1LWEA 3CJ2A 2MZTA 5EHHA 2I9SA 4OHXA 1TZ0A 3IWLA 1M5VC 5JVHQ 3DLKA 5KFYA 3GIMA 2EW9A 3GIIA 2Q66A 1UVNA 3W3SA 4AUKA 3ZC4A 1SB6A 4I2QB 2L48A 5LMUF 1R43A 3TANA 4LF9F 2HVZA 1X5PA 4TQRA 2P9CA 4ZVEA 2CIMA 1D8ZA 4CH1A 2P9EA 1YG0A 3M1VB 2ZE2B 5IM0B 5LJ5Y 4ED5A 2E5GA 1RT5A 1FDDA 3T6JA 3UFCX 2R7OA 1M1KT 1RTDA 2CPEA 3I9ZA 3TAMB 2RF2A 2A3JA 2BACA 3W2VA 3KK1B 3UW1A 5F41A 3LP2A 1TP7A 2O1PA 4X4PA 1F5CA 1C0UB 1RYSA 3M6WA 1X4BA 3LWLA 3DFEA 1ZM4A 5CXTA 4KTQA 2DNOA 1Y5IB 4ERDA 2FHKA 3CDUA 2LQBA 4OLOA 1S97A 4RW6A 4F02A 1N6QA 1JLCA 4J9OA 3IRXA 2HMIA 1X4AA 3KG0A 4JBCA 3ZZPA 2BJEA 2O66A 3N79A 1Y0HA 2VFSA 3OR1A 4NLXA 2RF2B 4TYAA 5J1NA 4JV0A 3V4MA 1H2VZ 4X64F 4DBQA 4TU8A 2CJ9A 1EETB 2YH1A 4DFKA 4PG7A 3FZ2A 5I42B 3TUIC 3ZZ0A 3B78A 4R25A 3HT3A 2LXUA 4DQQA 1N5TA 2DH8A 1RAJA 2V94A 2XLKA 1HBOA 1NK8A 1ZZFA 4DG1B 2V9WA 1H38A 1BD6A 3AJ2A 2CKWA 2CPXA 2HQ3A 4OI0A 1X9WA 2ZZNA 1RT6A 3VQSA 3DLKB 3CDEA 2DHGA 5K5MA 4X4SA 3CGIA 3MM5A 3TOQA 1VHFA 2NYIA 2WTFA 2B6AB 4DV6F 4RW4A 3CCSS 3M4XA 2VFRA 1P1TA 4HH1A 5GAGI 1U6FA 2YNIA 4O4GA 4IOBA 4ECRA 1YIJS 1B64A 1VRTA 1Y5NB 1X8DA 4PG5A 1JWWA 3MAQA 5KFMA 1U48A 4CZCA 3D0GE 3NNCA 1FERA 3SEOA 1ZOTA 3KLIA 2IRXA 2G13A 2B5JA 1U1RA 1NH8A 2ZJRQ 5HMWA 1C0UA 2OLWA 3QZ7A 2P6TA 4J5OA 2IRYA 3EZ5A 4TU7A 1NH7A 4WZQA 2FHJD 2VB6A 3G8QA 5FD1A 2JC0A 1S6QA 2NPIA 3H5UA 1LXJA 2Z8QA 2HNDB 3HZEA 3MM9B 3IO1A 2YKAA 2BE2B 3NCRA 3ZFVA 5MLCV 1JLBA 3DI6B 1HBMB 2UXBF 1QM9A 2PDAA 4NLWA 3U27A 1TKDA 1NK7A 2XBPA 2R7WA 3V81B 4HDHA 1VBZA 5CD4H 3MD1A 1CQNA 1RT1B 2CQDA 3CPWR 3GR1A 3D28A 4CO1A 3OXLA 4OJ3A 1N8RT 4RBTA 3RRHA 3PDNA 1QLNA 1YRTA 2XMMA 3QGHA 5CYQB 2NREA 5KFGA 2V2KA 2B4VA 1JJ4A 1FJEB 2OTLS 1UKUA 2RT3A 4ECTA 3OJUA 1L3SA 1AROP 2FLLA 2EI5A 5KFUA 2FUG9 2IM2A 4OX6A 5D77A 2R2SA 4Y6IA 1UL3A 2KG0A 2E29A 3CDBA 4I0WA 5GADU 1J2VA 3DXSX 1RT7A 2MGZA 2PO4A 3KLHB 3BQ1A 1KLNA 2CQ1A 3SI8A 1HD0A 1X5SA 1FRJA 2D9OA 3QGPA 2GHWA 1S1XA 1FRHA 4F4KA 3MM5B 3M6VA 1S49A 2PT0A 2XULA 2YKNA 4A47A 1S99A 2FHJA 3F44A 5J1PA 4X4RA 2HW3A 1CQMA 5KFFA 2JRSA 4RNOA 1L5UA 2KJWA 5D6GA 1C1BB 2PIIA 2C3PA 3CD0A 5KFHA 3V6DB 3GFXA 4ELVA 2CJQA 3HHLA 2VBYA 2W8LA 4J9SA 2JFKA 5DDRC 3E01A 2Z0GA 3THTA 3MEEB 4N56A 3OTOF 2GMJA 4K4SA 1Q7YT 2LEBA 5JVGQ 4F2RA 2RJZA 1RTIA 3IA0A 3UWTA 5D4PA 1WEXA 4AE5A 1NZAA 3HF5A 2J9CA 2B5JB 2HYIB 2YKOA 3PNIA 1VQLS 1XMQF 5B0AA 5KFXA 1Q8LA 2RQKA 5F0WA 4ECZA 4NZ7A 3KHLA 1FNMA 3DLEA 4QW9A 1FF2A 3GFYA 2HHQA 4OX7A 1IKWB 3EPGA 2DNLA 3I96A 2IBOA 3GR0A 1VC0A 1CPZA 4H4MB 1HNWF 2VPYB 4GC7A 2D3OR 2OPQA 3T1AA 1VQ7S 7FDRA 4OZ1A 5EWEA 4FZVA 2XC9A 1VBYA 2UU9F 3EUNA 1KOHA 1C2PA 4CO5A 1YSJA 5B0CA 3AQOA 2YNIB 3MUTP 2JLGA 2RD5C 1X4EA 2CDQA 3UD3P 5KFEA 2JWNA 4MMOA 4F8RA 4N47A 2M4MA 1QAXA 3OFFA 3I0RA 1RTJB 2MZSA 1JLQB 3HHEA 4E0DA 2JL9A 5CHCB 4DSEA 3M6XA 3R5DA 4MAKA 1QE1A 3B8HA 1DFDA 3OL6A 4A8SA 2HNYA 3TAPA 2NUHA 3MAHA 1FXLA 2CPJA 4GO7X 2PI5A 2EPIA 3N01A 3CJ3A 3MR3A 1RA7A 4O44B 2KKHA 3NS6A 2YWFA 4OZJA 4TKTA 1R8CA 2QMWA 2Q43A 4OI6A 3PXGa 4NLVA 4YR3A 3CF5Q 1M5PC 2FJXA 4ZK7M 3Q8PB 1S0VA 2IAJA 3V81A 1JLFB 1KTVA 3N6NA 2LEPA 4QU7A 2M7SA 2W4CA 3CXCR 3C2PA 3NL0A 5D4NA 1GH8A 3HP6A 1K0TA 1XWLA 2MKJA 2HS3A 2QIFA 3M8QA 3S6EA 4QCLA 5I3PA 3IN5A 5KFVA 1WG4A 3SCJE 1HARA 3MTKA 4NZ6A 1M0SA 3BDEA 4C2MA 5IS2A 3MM8B 1ELOA 1Q82T 1Z4UA 3CO9A 1B0VA 3JB9k 3D0IE 2ADBA 2M52A 2NR0A 4M1KA 2IJNA 2E1AA 5G0RB 4RWXA 2UVWA 3H2VE 4ZP6A 2YX7A 2RU3A 4C4WA 1FJCA 3BO2A 2ZJQQ 3MM6B 2QV6A 3VCDA 3C6UA 2XO7A 2ZE2A 4ETXA 3TRGA 1VQMS 1OIAA 1S72S 2POKA 3J7A1 1H0HB 3CCVS 4YHHF 4KQZA 4NLDA 1TL1A 2Q6BA 1TUVA 3MOZA 4F67A 1KQGB 5KFPA 1LWCB 1OSDA 2AYBA 2ZDPA 4C8YA 2NS1B 3KFWX 3SSSA 4YP3A 2ZH2A 1A9NB 4LIWA 4DF4A 4H54A 5CCLA 3C6UB 3RB6A 1K9MT 3FEXB 1PC4A 4XO0A 1ZM3A 5I3UA 2Y1RI 4ZP9A 3RW6A 2EG1A 1KLMB 5GAGU 1BWEA 2X1FA 4WE1B 3PRBA 4DQRA 5KFTA 2MQLA 3F73A 1LW0B 4ZHRA 1X4GA 2FC8A 2OD4A 3LALA 3PM9A 3KG4A 4ZP7A 1UFLA 4XPEA 3NGKA 2D74B 4F2SA 1JLBB 5KG0A 2OPRA 1FKPA 3NNHA 1OQ3A 2VPWB 1MMNA 3FFIA 1IJFB 3MOJB 2IVFB 5LMNF 1KLMA 5HLFB 5IT4A 1CC8A 4Q7AA 4J9MA 3OLAA 1HW9A 1UVMA 4KV8A 1FJ7A 3NRBA 3HFKA 2J0SD 4RUCA 1F60B 1UA0A 1L3UA 3OHAA 3DOMA 2F8EX 2WHOA 1HBUA 3FEYB 5KG1A 4RW9A 4OZ0A 3T1YF 4IR1A 4PQUB 3HO1A 4N8NA 3JTOA 4Z2XA 1XR5A 4OI3A 2GHVC 4WCEQ 4YQWA 4ECWA 5L9NA 4DQIA 1UJ4A 2M88A 5CYJA 2MHEA 3PO5A 1FJGF 3OW2R 3P49B 3O2IA 1FKAF 4X62F 1FDNA 3KK3B 5CH7B 4B9UA 1YVFA 2H9ZA 2JEFA 4KC5A 3H25A 2GV1A 1NK4A 3R5AA 1DTQA 1WF2A 1R27B 1ZPVA 1M5KC 1SKRA 1U49A 4QBUA 1R3NA 1HWKA 2W4DA 1YBAA 1ULRA 2SXLA 3BGRA 3M9MB 3G86A 1Y3JA 5IWAF 1HI0P 3ITHA 3DM2B 2IC3A 3S8SA 2XY7A 2DGXA 2GQCA 5T7LA 4W90B 1SH2A 3HMJG 3K8WA 2VUGA 4NPOA 3O44A 3I4HX 4ED1A 1DLOA 5J2PB 2CQ2A 2NXUA 3FEZA 2R7TA 1AFIA 4IR9A 4OQJA 5IFMA 3FGVA 5C42A 2LQ9A 1H3DA 2M9KA 2GX8A 2MQMA 3GZ7A 3T9ZA 1HL6A 2LQJA 3CT9A 4NCGA 5KFSA 3L95X 2MZJA 3O6QA 2P9GA 2ZH6A 4NRTA 1TK0A 3D54A 2EFOA 3LPYA 1BY9A 4EBDA 3FFIB 2FJVA 4ED3A 2GJIA 2KRRA 2D9PA 1MWYA 4FNIA 1VQ4S 2BABA 3PFEA 2J6UA 2DGWA 2BZ2A 4TLQA 3Q23A 4HT5A 4JV2A 2GHPA 2YX4A 4Q44A 4BC9A 2VODA 2BUNA 4DQPA 1MMDA 3DI6A 4ZMMA 2YWGA 3UR0A 1U1MA 2E7WA 2FJEB 5THWA 1ZBTA 3GIJA 1WI6A 2MY8A 2HHUA 2JSXA 3NWGA 2GMHA 4TY8A 1RT2B 4L72B 3ENQA 2Q3PA 4LIRA 3GV5B 4P7VA 1LW2A 1T94A 4Y2CA 2RH3A 2GNKA 4KPYA 2GMLA 2HGNA 3PW2A 3PW4A 1HW8A 1HPZB 1HFEL 1SIWB 1KOOA 3TYTA 2OPPB 3BN4A 1IBLF 1KQFB 2V8GA 4ZCKA 1H6KX 4NLPA 3VF0B 5AE3A 1N36F 1TVRA 4JI6F 3T9NA 1RGVA 1WHWA 3G6VA 3N4WA 1H98A 3POTA 3QJPA 1V3ZA 3QO9B 4ECUA 1R8HA 5U47A 3D5MA 4LJMA 3V6HA 1RTDB 5LSLA 4ECQA 5LXRA 4PG6A 2AU0A 2AYEA 2VFUA 4DG1A 1U47A 4FP9A 5KG7A 2WCXA 1RTJA 4WU3A 1O5JA 1KR4A 1L3TA 2FLPA 3T3FA 1S9GA 2X1BA 1X0FA 4K4WA 2Y0SD