2PGCA

Crystal structure of a a marine metagenome protein (jcvi_pep_1096685590403) from uncultured marine organism at 2.53 a resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
206
structure length
206
Chain Sequence
MSNINYVILTVASVDFSYRETMARLMSSYSKDLIDNAGAKGTRFGSIGTGDHAGSLIFIQFYDDLTGYQKALEIQSKSSVFKEIMDSGKANIYLRNISTSLPTKFEQSYEHPKYIVLTRAEAAMSDKDKFLNCINDTASCFKDNGALTLRFGNLLTGSNVGNYLLGVGYPSMEAIEKTYDELLAHSSYKELMTFAKVNMRNIIKIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of uncharacterized protein (JCVI_PEP_1096685590403) from an environmental metagenome (unidentified marine microbe), Sorcerer II Global Ocean Sampling experiment at 2.53 A resolution
rcsb
source organism Uncultured marine organism
molecule tags Unknown function
molecule keywords uncharacterized protein
total genus 53
structure length 206
sequence length 206
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2007-04-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2pgcA01
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2pgcA02
3GZ7A 4OIXA 2QYCA 2LXFA 1KVJA 4QOTA 2BJDA 1AW0A 2W4CA 2VH7A 3CJKB 2W4PA 2XMJA 3FGVA 1WD6A 1FEEA 3WDOA 2ZDOA 2HLUA 1RJJA 1YJUA 1P8GA 1X7VA 3FMBA 2K1RA 1Q8BA 2XMKA 3KG0A 5B0FA 5B0AA 1Q8LA 1FE0A 2EW9A 2FIUA 1W2IA 4HH0A 2QIFA 2CRLA 2RU9A 1X8DA 2AJ1A 3MZIA 2ROEA 4FNHA 3HHLB 4FNIA 2KT2A 1GXUA 1FVSA 4YEAA 3LGMA 2PD1A 4YDXA 1N5VA 1YRXA 2HIQA 2RSQA 1ULRA 4EFAC 4DL0C 3LO3A 1Y9OA 1N5TA 1VQYA 2IYIA 5T7LA 1TZ0A 2BYCA 2QLWA 2XMWA 2IYGA 3BM7A 3BR8A 3KG1A 1TUVA 4Q2LA 3VTIA 2KKHA 1SB6A 3E8OA 1TL4A 2OKQA 2HFNA 3I9ZA 1SI9A 2RILA 1OSDA 4NPOA 1AFJA 1CC7A 2LQ9A 1GXTA 2LQBA 2XMMA 3HHLC 4NL5A 1TR0A 2XMTA 3DXSX 3TRGA 1Y0HA 2FHMA 5B0GA 4Y2MA 2PGCA 3BDEA 2OD4A 3FRYA 3HHLD 3KKFA 2LDIA 2KYZA 1YJVA 4OJ3A 1FD8A 2OD6A 2GCFA 1LQ9A 2JDJA 1YG0A 3BN7A 5B0DA 2OP5A 3BB5A 3CJKA 4A48A 1FESA 1Q53A 1MWZA 2AW0A 2XMUA 3F44A 3HHLA 1JWWA 2OMOA 2N7YA 4A46A 4A47A 5B0BA 1FE4A 4HI1A 2AJ0A 3TNVA 2HQIA 1FVQA 3HDSA 5T7LB 2BUNA 2GGPB 2L3MA 1KQKA 1URRA 3HF5A 2GV1A 3HFKA 4F67A 1R6YA 3QGPA 4Y2IA 4OJHA 2G9OA 4U9RA 1IUJA 5A6WA 5KAKA 5B09A 2K7KA 1VQSA 3K7RA 2FTRA 1Y3JA 4HI2A 5A6PA 5F0UA 2VV5A 2OAUA 2ROPA 4ZOSA 2ACYA 2FB0A 2KT3A 3BGUA 1YJTA 2GA7A 1Q4RA 4HH1A 3IWXA 2QLXA 3T9NA 2HFOA 2OFHX 2GGPA 2IFXA 3MCSA 1S6UA 3LGNA 3IWLA 1KVIA 1S6OA 1P6TA 1U7LA 2AP6A 4OJGA 1K0VA 1N5SA 5B0EA 5F0WA 1MWYA 2ROGA 2GO8A 4A4JA 3TOQA 1OPZA 1APSA 3UDCA 5B08A 2RMLA 1OQ6A 3KNGA 5K9FA 1X0PA 4DN9A 1SQEA 2BJEA 2GFFA 2Q3PA 4ZA1A 2K1RB 1JK9B 3HX9A 4HL9A 2K2PA 5B0CA 2K7JA 4OJ1A 2N4DA 2XMVA 3BF4A 2ASYA 1Y3KA 2N4CA 3QMQA 2W4DA 1YJRA 1XBWA 5IXUA 1CPZA 4Y2KA 1OQ3A 1QUPA 2BBEA 2ZDPA 3DCAA 4Q2MA 1N5QA 1V3ZA 1CC8A 4DPOA 1TL5A 1AFIA 2HLTA 2OFGX
chains in the Genus database with same CATH superfamily
4GVBA 1TK8A 4ZMMA 3L7UA 1NXIA 2U1AA 2YX1A 3CXCR 3M6XA 2E7VA 3RAQA 2MQ8A 3I0RA 4L3KA 4YB7A 4DL7A 3NS5A 1KFDA 3OFEA 2Y0SD 2MZQA 3ZZYA 2KZZA 3GJSB 4Z7CA 4U7UK 4DR6F 3ENAA 2H5EA 7FDRA 1Y7PA 1PYOB 3RAMA 1U6ZA 5F41A 5B0AA 5AXMA 5C25A 1J5EF 3BDPA 3CTRA 4P52A 4DQRA 1XMQF 2C3MA 1W2IA 3FSYA 4NXMF 2YNFB 4IG0A 2VD3A 4DV6J 1RT3B 4QYZJ 3LANA 1F2GA 2OI2A 4EO6A 1YJ7A 1RACB 2FPHX 1KWMA 4NLXA 5DJBA 5F8IA 4ZPCA 3PHEA 3QQCD 2CUYA 4LBHA 2BQ3A 4F4WA 1SBRA 3F41A 4BWMA 2OSRA 2XSJB 3D67A 3O3LA 1BQNA 3NNCA 2PT0A 4N8OA 1SJRA 5KT5A 1FKPA 3I9ZA 3MI7X 5H1SV 3CCLS 1D9FA 4W90B 4MJKA 2EK1A 2QV6A 3QATA 2KH9A 1KQGB 1XMOF 3VZHA 1DARA 1RTJB 1KRPA 2CXEA 1XR7A 3CIZA 2XNQA 2UUWA 2PGCA 2HHTA 1RT1B 1QE1A 3ADAC 3QO9B 2HHSA 3HSZA 1HQUA 2LDIA 4OFZA 4P72A 2HMIB 2KYZA 1S0VA 1E6YB 2MYFA 4OJ3A 2ZWPA 1WWHA 3ZZZA 1FD8A 3VAHA 4CTAB 3R2DJ 1DRZA 2HQ3A 3MAAB 1ZM9A 4HKQA 1U0HB 4ES1A 1JKHB 1N33J 2MGZA 2YNHB 1R8AA 3CD0A 3D3CJ 3KXDA 5HL7Q 3Q8PB 2BQUA 1RYRA 3HCXA 1QTMA 2HRTA 1P27B 5T7LB 1Q81T 1F3VA 1FXLA 4DZDA 2HFZA 1RWMB 1VRUA 1C1CA 3I4PA 5ETOA 1FX2A 1N0VC 1NPKA 3W2WB 4CLYA 5LSRA 4DS5A 3ILIA 5CCLA 3ZFVA 3GG0A 3LH2S 5KAKA 2DRDA 1M5KC 3N4WA 1VQ6S 1I6JA 1S72S 2DIVA 4DR4J 2NXUA 4C98A 2PFFB 2CQ0A 4Q7AA 4ZOSA 3EICA 3KLGB 1S5ZA 4K50A 1NB7A 1IBKJ 1Q4RA 2UXCF 3EVMA 3T9NA 2E29A 1CSJA 1HLWA 3IR7B 1H2UX 1AT1B 5IT0A 1XC9A 1HQUB 4L73A 3DU5A 1FO1A 4MYTA 4OV6A 3M9MB 3KLGA 2W8LA 4OI6A 3O6QA 1BQMB 4FPRA 4J9UE 4QIGA 3N0VA 3SXLA 4Y2AA 3N79A 3SIPB 4DX6A 5F9NA 4JI7J 4I56A 4DN9A 1S77D 3KMQA 5D0GA 2ADCA 2FJEB 3TAMB 5JJBA 3M8SA 1AUDA 4IO1A 3QGHA 2V9WA 1MN7A 2K7JA 3CCTA 4X65F 4F4YA 1FKAF 3CJTA 3FMWA 4DR7F 1PILA 2XI2A 2E5HA 4O4RA 1CJTA 1SUQB 5A76A 4ZCIA 1GTEA 3WQPA 2E1RA 2K3KA 4RWXA 3W8GA 3MFHA 1IM6A 1Z4UA 3PFOA 2OTLS 4UY8T 5F8NA 3GILA 1KOHA 3CC2S 4PXDA 2UVVA 4LFCJ 2W2QP 3KJNB 5EWFA 1P9YA 2M0GB 1VRTA 4OIXA 5KG1A 3MR3A 3KK2B 4KGMA 4NMLA 4QOTA 4BWJA 3I82A 1W26A 4ETXA 3SYZA 5IQQA 3IR5B 4DZ6A 2R42A 5LSLA 4NCGA 4Y34A 4ETZA 3V2UC 1NAQA 4M63A 4NLOA 1GFWB 2E1PA 1XMQJ 1KC8T 4AE5A 2H51B 1N6QA 4DR1F 2FHJD 3DLEB 4KGXB 1NKBA 5B0FA 5KFAA 3R2CJ 1FDBA 5BJRA 2BJ9A 2VG5A 1UETA 1UVJA 1HNIB 3R1LA 2YY3A 2B6AA 2HQFA 3D1OA 4J9VA 4KKOA 4LR9A 4NWBA 4OX7A 5D4LA 3EGVA 3W66A 3M8QA 2HBRB 1LOUA 1IKXB 5LM7E 2KRBA 3C46A 4X4QA 2PMWA 1T03A 4IOCQ 1Y5LB 2W8KA 4OHYA 3DC2A 1EQMA 1H7XA 1KBRA 2F9DA 3SQOP 1N5TA 4V19J 2UXCJ 1PAEX 4Q5VA 3C8YA 2XMWA 3IC1A 1UEVA 2NXJA 3BM7A 3IO1A 3R5AA 4M5IA 5J2MA 3ELHA 3TUZC 1SB6A 3DMJB 3E8OA 2JEFA 1MU2A 1B0PA 4O3RA 4HR2A 2B7CB 2QMWA 2RHQB 1HHQA 1R43A 2WVFA 4HTJA 5KFVA 1SKRA 3SSQA 1GXTA 3CJ4A 4LRCA 1XIQA 2CQGA 4OZNA 1UA1A 4KO0B 3Q8QB 3HT3A 2CQHA 2C2MB 5C7PA 5C2CA 1UZHA 1REVA 1F5AA 3MCNA 2B4UA 2ZKTA 4Y2MA 2OLWA 3G96A 1CS4A 4Q0BB 4WBFA 3C66A 2P6SA 3ILJA 1TP7A 4I1TA 1DJ0A 4DCOB 2XGPA 2QFIA 4J5OA 4KH1B 3RB3A 2DHSA 4IDKB 3V6DA 3PTWA 3K58A 4OI1A 3TUJC 4A48A 1RQ0A 2QTWA 3M1VA 5HMXA 5HMZA 4DSKA 4MIBA 3IA0A 2YKMB 3JQMA 4HTIA 1HNIA 1J2VA 3JTNA 2CPFA 2HS3A 2YKQA 2OJ3A 5THWA 4Z2XA 2ZEJA 5FD1A 2I0XA 3I55S 2FY1A 1A7GE 2HQIA 2W2PP 1M90T 1FVQA 4KHRA 4L74A 2VBWA 5J1NA 4F67A 2V50A 4FF4A 4IG0B 4C8MA 2ATCB 1UZDA 2MKKA 3C2PA 4W92B 1IKVB 4H4OB 4NCGB 3SCJE 4CTAA 5GAEI 3MR5A 2ZM6J 4Y2CA 2GVDA 4JI1F 1DTQB 2BKOA 3OHAA 3KUEA 1QVGR 2LKZA 1Y3JA 2O66A 1UMJA 3RJMB 4LVOP 3GG1A 2OAUA 2QC3A 3MDFA 1LXNA 2QGFB 3SFGA 5K8PA 3K5NA 4KJIA 3Q8VA 4P2SA 5K20B 4OZ3A 5JVGQ 4F4XA 1B7YB 2X7IA 3DLKB 3H2VE 2BX6A 2AJ4A 3W62A 5KT7A 2PSZA 4KGKA 1RCXB 2C3UA 2ZE2B 2FGCA 3CNQP 4I7FA 5D4PA 3ZZPA 3QIPB 4QWAA 4FS1A 1ZETA 3L09A 4FBTA 1K0VA 4F0KA 3BQ0A 2HHUA 2XTJP 3OD2A 1GQEA 4NMXA 1NKEA 2OEKA 3M05A 1HNWF 1WF2A 2JLEA 4NLRA 1APSA 4A8SA 1OQ6A 4ED6A 3CC4S 3QFWA 3M1VB 2IVYA 2W7OA 3TAMA 4DUZJ 4IO9Q 2LXUA 2MXYA 2QSWA 2DPJA 1MLAA 2JLGA 3PRVA 4RLEA 2PMZD 1RBAA 3HM9A 4HL9A 1UA0A 5KFFA 1NK9A 2RU3A 1REGX 2UZAA 4RR5A 4FZVA 2UUTA 3B6BA 2QO3A 2E1MC 5M2RA 2KM8B 1LW0A 1FNMA 2LQ5A 3KLEB 5EWGA 5E7OB 1H74A 3FSIA 1WF0A 3CPWR 1NDLA 4X66F 1N5QA 3FBFA 1X0FA 2FLPA 1S1VA 3GJQB 1QE1B 1SH0A 4TLQA 3X3UA 5E33A 1RT5A 3X1LB 2DISA 5C24B 1PSDA 4DI6A 1HBOB 2R2RA 2V8DA 3ISZA 5HO4A 3AHPA 1SL0A 5IFMA 3RB0A 3D6HB 5GMEA 1AW0A 2E5IA 3NS7B 1IKYB 2CPEA 4X84A 3I56S 1IBMJ 3CCSS 3TI0A 2BANB 2YKOA 1ROFA 3D4JA 3QBCA 3KHRA 4RUCA 2JC1A 5AXNA 1RYSA 1O0PA 4NLQA 2ZJQQ 1XJWB 3L3CA 1NU4A 3CJ2A 4ID5B 1TELA 4OX6A 4CDIA 1X8DA 1BQMA 1CJUA 4NYPA 1B7FA 3GYGA 4FNIA 1S1TB 4JI0F 2Z30B 3G2XA 3R1HA 2F3JA 5HI7A 1VC6A 3OVBA 3DKDA 4LRDA 1YQHA 1G3OA 1Y9OA 2FHOB 1RP5A 1PAUB 5FLXY 4FF1A 4ZIWA 2IYIA 1S57A 1FFSB 2QLWA 3AQPA 4KHMA 2DH8A 3TA2A 4CWBA 3T19A 5HJXA 3LP2A 2RF2A 4QQBA 5GAGU 4RUAA 1S0OA 3SFUA 2HQGA 5JUMA 3WIUA 1HI8A 1CG2A 2MZRA 4KFBA 4CP5A 3T1HF 1QSLA 1CJTB 4G65A 4NL5A 2CQDA 2YPYA 4ILRA 1RTIB 1IQZA 4M5NA 4EYIB 2Q6BA 1YRTA 4NLPA 2KVQE 3QT5A 2XHWA 2Y8YA 3MXHP 2DNZA 3GFYA 4ECRA 2HNZA 5HBMB 2HBQB 3A13A 3MD3A 4CO5A 2OHDA 5IV3A 2UUBJ 1LQ9A 1M5SA 3KLEA 1UCNA 3DRPA 3FZ2A 5CZVA 3N5FA 5IC4B 3POTB 2ZOGA 1TKZA 2CA9A 2IRXA 3Q89A 4HHHA 4DHVA 3ZC4A 3VGTA 3LP0A 5HMWA 5KFPA 2K3IA 4ECQA 1D1UA 2HAFA 2KZMA 4PG5A 2J9DA 4WYWA 4WP8A 3S8SA 4CCHA 4LVNP 5FDLA 4PG8A 2QL9B 3SBMA 2GGPB 4PG4A 2HYIB 4JI1J 1FJ7A 4HACA 2CNNB 2MPUA 3MUVP 3BQ1A 2XHCA 2DNOA 4KGVB 3D6FB 3R5GA 1KFSA 1C1BB 2O01C 3OL6A 4RBTA 1EKRA 3UN5A 5KFXA 3T1YF 2UUAJ 2NYIA 2RS8A 2FHJA 3WX8A 1U1QA 3LF0A 2SXLA 5F0UA 5IWAF 5ETNA 5L39A 3QNWB 2R2UA 1DHMA 2POKA 1GX6A 1RZMA 4HH1A 4JI2F 3KLIB 4DF4A 3NEKA 4LSLA 4JUZA 3A8KA 4RO0A 1TUWA 3MCSA 3NNHA 2HWIA 1FRHA 4ZIVA 1S6UA 1KVIA 2D9OA 2VF3A 2XEXA 1JLFA 3AJ2A 5DG9A 2JVOA 3OT9A 2C3PA 1B0TA 4CM2A 3I0SA 4CO4A 2ZVIA 1EARA 1DTTA 2HZVA 1KDNA 4DQPA 2YKNB 3JQKA 1RHKB 5CYQB 1SQFA 4YB6A 1SQEA 1RSCA 2BJEA 5F8HA 4HHJA 3PW2A 4RUBA 4GKJJ 3IAM9 3AT1B 1LV5A 4M1KA 3HJFA 2DGVA 2QT7A 1KD1T 3QGGA 3MMAB 5FDLB 2N4DA 4YB1P 1Q7YT 3N6LA 2FVSA 2DRAA 1NSAA 1JJHA 2MKHA 4WFZA 2KXNB 2OEMA 3ENQA 2BBEA 4K59A 3T5LA 4HEA9 3LAMA 2W01A 1ZA1B 4DR3F 2VBYA 2MQQA 4NLVA 1PJ6A 4DUYJ 4JI5J 2AKWB 3HK2A 1FA0A 4RW4A 3RBDA 3ZZUA 1S1WA 1ZA2B 4CLZA 1TFWA 3HKZD 1N34F 5EHHA 4OHXA 4WYLA 3FDSA 4FF3A 2DXFA 4RW6A 1JXEA 2JNJA 3NP5A 5HLFB 2B7BB 2KJWA 3GB0A 4ECYA 1IKWB 3RW7A 3WDOA 2VPYB 4O23A 3OSNA 1P8GA 3FBEA 1KLMB 3NXZA 3MAHA 4NRUA 4R0EA 2RQCA 3H25A 1RWVB 2YPZA 3A4TA 1OYEA 4LF8F 2D1CA 1EX8A 1PG5B 1RT5B 3BR9A 3K5OA 3UWTA 4RZRA 2FIUA 2V9KA 2CQ2A 2PDAA 2ZWOA 2RNEA 4HH0A 4OZ0A 1XWLA 2CRLA 3N28A 3ZTSA 4MK9A 1EZZB 3HFZB 2CZ9A 4XIUA 1GXUA 1FVSA 3LTOA 5GAGI 1YRXA 2RSQA 1X4HA 2F5GA 2GJ2A 3ICLA 1C0TB 5EX0A 5KFJA 3PR5B 2ZNYA 4FVCA 3OLAA 4IH5A 2JOQA 3OJSA 4JI2J 1WHVA 4IH7A 3IP0A 1F60B 1N88A 3EJMA 2COLA 4B9MA 4C8ZA 1JLFB 2CJAA 2PI5A 2DNLA 3ISND 3VAFA 4F4AA 4I64A 3V4IA 2CNLB 3GFHA 3AD8C 2J9CA 1VC5A 3IFEA 1N0UA 3BYPA 1TR0A 3GR0A 1JLAB 2XMTA 3UD3P 2QL7B 2OPRB 1UPPA 3OFGA 3VALA 2IRUA 1B0VA 2WOMB 3D0HE 3DOKB 2XZDB 3CMES 2YVSA 3HMJG 2V4JA 2IJNA 4KIAA 4P6QA 3W61A 2E9TA 4C9DA 1WC4A 2MKCA 3KJVB 4M5DA 1T3NA 2LLZA 1TL1A 2V34A 4J91A 3B4DA 2VA2A 1CLFA 3BBBA 3AOBA 3DMJA 2AJ0A 2EC2A 1UFKA 2RD5C 4URSA 4JV1A 4X4UA 3AB4B 1UJ6A 1WI8A 3BBCA 3W65A 3I0RB 4PZVA 1NJXA 5CD4A 3U1NA 1F9EB 2MQNA 3Q22A 3A3PB 1SUQA 4DXLA 1FKPB 2ZBPA 3A1YG 3JB9k 5DQGA 5HLFA 2CDQA 1M5PC 1YRUA 2ZKUA 1B70B 4KV8B 2M2BA 4DG1B 5JVHQ 2BJ3A 2F8HA 4EBCA 5IT9Y 1A0OB 2CFXA 2ROPA 3EVWA 3TYTA 5LSOA 4TU8A 2XS7A 2ACYA 2I38A 2XG8A 4NI2A 2ZH5A 3V6DB 1M5OC 4LMZA 3BPSP 3CDAA 4ZN3A 1GNKA 5C42A 3V6KA 2HNDB 5I3UA 2RJZA 2VFRA 1N56A 2HRYA 1TVRB 4M5MA 3Q8SB 3FFIB 4TY8A 1YLXA 2WW8A 1N4LA 3DOLB 1U7LA 1WKLA 1JLGA 2DYAA 4MH8A 5D0HA 3G82A 2PEBA 2ZH8A 2F4VJ 3MM7B 3T3FA 3PKMA 1FKOA 3PJXA 1TKTA 3UDCA 3JSMB 1RBOB 3KNGA 3IWNC 1UFLA 2AZ1A 3TP2A 5H9FK 3LWLA 4USVA 2FJBB 2BE9B 3KDNA 3OXFA 1IR0A 2GHWA 3C16B 1S76D 3TW0A 1JK9B 4DV2F 4JI7F 2YX4A 4QWBA 4CO2A 1KEKA 3M6UA 3PW5A 2FVQA 2RH3A 3BF4A 2OPRA 1WKJA 1XR5A 3PW0A 1YJRA 4NZ7A 4IG3B 2X1BA 2B4OA 2LP4A 4DUYF 1NK7A 2DXEA 3T9ZA 3IM9A 4X65J 4NA3A 3HHKA 2XCAA 3HPOA 2L9NA 3K89A 4A8YA 3UW1A 2XZWA 3RRKA 5T14A 4XPCA 2I2YA 2G2OA 1EAYC 1SKWA 4DX8H 4R8UB 1S6QB 2EI5A 2G0IA 4OI3A 4CLPA 2R7UA 3M6WA 3DLEA 4YY3J 1JKHA 2VKRA 4USJC 2CPJA 5D4NA 5AE2A 4ANDA 2DK2A 2P8IA 2M4MA 2VH7A 3F0NA 5KFEA 3DN9A 4PQUB 1DLOB 2PA8D 1X9SA 3CCES 2ZDOA 2DHXA 2W9AA 3M2RA 4ENOA 3KK2A 4IUFA 4K4YA 2HMIA 4ECUA 3A8JA 2A6OA 2JL9A 1TQLA 4OYBA 1O5JA 1RT2A 1Q8KA 3I0SB 5ETKA 4U96A 3K0JA 2D74B 2FZGB 4PXCA 3GIMA 2L9WA 1RWKB 3D54A 4YDXA 5EDWA 4RW6B 2XMAA 4QIWD 3ZTQA 2R9LA 3HHNB 3D1QA 3ENVA 5ETTA 5T7LA 3VTIA 3V4IB 1FRMA 1H7WA 4DPXA 3M7VA 4DR5J 4DR6J 4RX6A 5IV4A 2NUUG 3TEGA 1NDKA 3H7HB 2IMWP 2MY8A 1OY9A 1NK8A 1D9AA 1RT3A 1VCTA 1J5EJ 2DGXA 4WFNQ 2DR5A 1ZOTA 2XO6A 4UUXA 5LT5A 5F8GA 1RWWB 3JYTB 3HHLD 1WTBA 2H48B 3KKFA 1JXLA 1VR6A 3DRSA 1RA7A 2BACA 2EK6A 5IT4A 4OZJA 4OZ1A 1U1PA 5AT1B 2F8MA 3CVKA 4KB7A 3WC0A 2GCFA 4M5DB 4DV7F 2LQJA 3DOMB 3VAJA 4QPTA 1VQOS 4USWA 2XNRA 2UVUA 2IM2A 5AJ3J 4OHVA 3D28A 4ICLB 2RQMA 3MCMA 4A47A 2HEKA 3GE9A 1YITS 4CO0A 1MSWD 1QAXA 3QJPA 2VJUA 5ETVA 2FUG9 2R8GA 2R7VA 1D3WA 2CVIA 4PUOB 3IG1A 3NRBA 4GRSA 1FCAA 1NH8A 3UDLA 5GADU 2IVMA 1B3TA 2DCUB 4Q8FA 4YY3F 4I6WA 2NSBA 1JNRB 1H72C 1XN9A 2GHPA 3I6PA 2D41A 1P1TA 1D9DA 4TLRA 3CF5Q 1FNOA 2XBPA 1L3TA 2HVIA 1XNQF 3IXQA 1U0HA 1RK8A 1UAWA 3D5MA 4OX9J 2KJVA 4R0JA 1VC0A 3UVJA 1NJWA 2KG1A 4N41A 4I69A 4ZVGA 1D8YA 1SV5A 4C6AA 4DEZA 4NXMJ 3CCZA 4JI8J 4F8RA 2ZZMA 2V63A 4WE1B 4DV1J 2MLYA 3EGNA 3Q8UA 4IR9A 4GC7A 2XM3A 2WCXA 1NK4A 2ZJPQ 1Z2ZA 4W98A 2HHQA 9RUBA 3CCUS 5KFCA 4RU2A 5CZXA 2EWHA 4O3OA 4DR4F 1NHVA 4C0OC 3RRGA 1G6BA 3O8WA 5MLCV 4DUZF 1XTZA 3H5SA 4JI0J 2B6AB 2JX2A 4YN3B 3KJQB 1QLNA 3NKYA 5EX3A 4A8MP 1J5OA 1Q16B 3KNAA 1S1UA 4H4MB 1L5UA 3AXKA 3KLFA 1S6PB 3E3XA 5DDRC 1I94F 2Z8QA 3CMAS 2B9XA 2KHCA 4OMFG 1LW2B 3UN3A 3DLKA 2DNHA 2DIUA 4JI6F 3OSPA 4RBVA 2OH2A 1E6YA 2MZ1A 3T1HJ 1J27A 1R89A 3PJWA 5IQ6A 4F7VA 4X2BA 3SEOA 3OFFA 1TMMA 2EEYA 4ZVPB 3IM8A 3EZ5A 3BS9A 1T94A 1JIHA 3EXYA 2V94A 2XMJA 3OTOJ 1OY6A 5I42A 5SZTA 1CULB 3G9CA 2C3OA 3CE8A 1YK9A 2AWZA 3RUBL 4CH0S 2JH3A 5I3UB 3FMBA 3C6TB 5F8JA 2CZ4A 1Q8BA 3R5BA 3V6JA 1FFWB 3CGIA 3RYLA 4ZHRA 1H38A 2RS2A 1WOSA 1RBLA 3M8QB 5J1EA 4X4NA 5L38A 3C3LA 5IT9U 4FNHA 5E5NA 1XNQJ 4RW8B 2MLXA 3A12A 3M8RA 3MEDA 4YEAA 1MG7A 1EP4B 5HN0A 2AX1A 2W9BB 3IMQJ 1U1RA 4B3MJ 2F8EX 4OHWA 3W5XA 4J7CA 1SVDA 4XK8C 2RKIA 1N6QB 3HSDA 2HKEA 3BR8A 3OXLA 1XK8A 5DG8A 2QA4S 4WU2A 4LF6J 2E9RX 3M2UA 2ZBQA 4MFBA 4ZP8A 4OYXA 4DR1J 1PIEA 4IKAA 2W24A 3NBPB 3ZZTA 3UE2A 1WC5A 3THVA 2FJAB 1SL1A 1ICEB 4KAIA 4AL7A 1N36J 5D8HB 5KFRA 3MEGA 2GJFA 3G82B 3VWSA 5T41A 5IM0A 3BDEA 2UUCF 4DU8A 3J7YI 1PJ5A 3DLBA 1C0UB 1FDDA 2R7OA 2EPIA 3IBWA 3TX0A 4H4KA 5I4MA 4USIA 1VQLS 2I5JA 2M52A 1OS5A 1HWLA 2ZD1A 3KTQA 3TVZA 5D6GA 4AD6A 3CW2C 1KTQA 3R6GB 3UPFA 1K73T 5HANA 3J81U 1FESA 1U0SA 1V9OA 4OZ2A 3PZPA 5JXSA 1QD1A 1S1WB 2QX0A 4Q45A 3GR1A 3G8TA 4YP3A 2QL5B 5HVFA 4PUOA 1Z1ZA 1YWXA 4AQYJ 2UXBJ 4DF8A 3PJ9A 2O5DA 4B3SF 3PW4A 2DEJA 4NCBA 1S0MA 3G6YA 4Q0BA 3PACA 1WC3A 1FRJA 5D15A 1ZPWX 3P5TL 2E9ZA 5HP1A 4Y2IA 1RTDB 3G6ES 4ITSA 2Z2MA 3TR5A 2ASJA 4F2SA 3MMBB 4V1Ak 4GO7X 2O1PA 3QPIA 1JLBA 4TNOA 3ZZ0A 4CZCA 3CCJS 2JEIA 3PYDA 4O44A 5D3GA 1N52B 2FB0A 5HQMA 2RB7A 2WONB 4NLYA 4PG7A 1HW9A 3C15B 4I2QB 1NDPA 2OFHX 4L75A 1LFWA 2E5JA 2H3EB 2BJ8A 2B4VA 2QLBB 4DSFA 2X1FA 4M5HA 2V0NA 3UQSA 1EETA 3TO8A 4LF9F 1FJGF 1FDAA 4XDCA 5HK4A 5ITHA 2FVCA 3FBBA 4IH6A 4BC9A 5C2GA 1IBLJ 2EFGA 3MUMP 4X4VA 1OPZA 2DH9A 3EZUA 1U1MA 5K9FA 2HGNA 3TQ1A 3MECB 1A9NB 2CWXA 2M88A 2Z4PA 4M5JA 4WK3A 2Z57B 2WVCA 1TAQA 3M8YA 4HDHA 4N8NA 3WZ0A 3IR6B 4ZVQB 2R8IA 2ASDA 1QJHA 3K2YA 3FNNA 2QA2A 1H73A 3BGFA 1Y4ZB 4Q8EA 2JFKA 5CYJA 3EDRB 3EM1A 4F3QA 1MROB 2DGQA 1SPBP 1Y3KA 2ASYA 2AD9A 3OL9A 1HBMA 2DO0A 3DHWC 4TVAB 5J2QB 4CRJA 1OJ4A 1FRXA 4KO0A 1TL1B 1K9MT 4J9QA 3PRBA 4E98A 1UW9A 1SJ4P 2OUGA 2J7KA 2YH0A 3H42A 1FWKA 2UVRA 1AFIA 1N48A 5LOQA 4X64F 1S7IA 3PCOB 2QSFA 2W1BA 4B3RJ 2LXFA 1UEKA 3PO5A 1TKZB 1K47A 4FS2A 1S6QA 1P1LA 4F3OA 5G4DA 4E8UA 1KHWA 3HVTA 2AYBA 5KFOA 4RNMA 1T3OA 4MKAA 3AH6A 3HI9A 1LXJA 4FYDA 1S7HA 1FEEA 1H2VZ 2FZCB 2BE2A 2KO1A 3M2VB 2GW8A 4KSEB 1RJJA 4ZPBA 3W2VA 4UT4A 1HI1A 3G87A 4WJBA 1FERA 1HL6A 4JBCA 2JVRA 1HPZB 3K59A 4C3MA 4IG3A 3UD4P 2Q79A 4ZJOA 4X66J 4B3TF 3OR1B 4C48A 2AQ4A 1R8HA 4B3MF 1IQTA 4L6V3 4AT1B 1CJKA 2G2YA 2YKAA 2EFOA 2EKNA 3CJSA 3I32A 2VC0A 3ITHA 4IFVB 3KK1A 2CYYA 2ZH7A 4I2QA 2PD1A 5C25B 2VG6B 3GPAA 3GIJA 1IBMF 1QDUB 4EFAC 4KTQA 1Q82T 3MPUB 3ETOA 4C3LA 4F26A 1RKJA 4DLEA 1H6KX 3Q86A 4Q2LA 2GAHC 1JJCB 2DR8A 4PQUA 2PO4A 4OYPA 3SDEB 2CNKB 3L95X 1RAEB 1T02A 2UUCJ 4UF4A 2RQKA 2OELA 1OSDA 1VS3A 3HHDA 1CC7A 2YKNA 4UOCA 3KLFB 3KLVA 1VMBA 1EB0A 4ANEA 5E3AA 2HNDA 3J7Z5 2R7XA 2AGOA 2OD4A 5A8RB 4ZCLA 1S0NA 1WDTA 2WBRA 2VICA 1A6LA 1S9GB 1YJVA 2Q43A 2LCWA 1T9YA 1U25A 4LSLB 2GQ2A 1VFJA 1NSQA 1EKSA 4DQSA 3FEZA 5BYQA 3E51A 1UL3A 4Y0FA 2AJQA 2B3TB 4ID8A 2ALYB 2VQEF 4IRKA 1JWWA 1CULA 4JV0A 3VF0B 5B0BA 4JI4J 3PG9A 2UP1A 3CT9A 3KG4A 5IM0B 2Z2YB 3W7BA 4ES3A 2L3MA 2YWKA 1RCOB 2CVEA 1KQKA 2GAGC 3HFKA 3D3BJ 3R7BB 4WTYA 4OYMA 2QYGA 3MMBA 4BS2A 2DJWA 4CI0B 1T9UA 3I5AA 8RUCA 4I68A 1RAOA 3HO1A 4ZN1A 2OGUA 3JAMU 1JXVA 2V69A 4P74A 4HI2A 4R8UA 3QRPA 3W9JA 2YTCA 4BDPA 3DYAA 1MWQA 1RHQB 1I5OB 3DOKA 4IOAQ 4LRBA 2V67A 1NUEA 4MKBA 1HBNA 5I3PA 3NOGA 4B3TJ 4FYYB 3KUHA 1CBKA 1GTHA 2J9DE 1BHNA 4PYDA 7AT1B 1TL3A 3DRYA 2OO4A 5L1KA 1FD2A 5F0WA 1S12A 3S6EA 2MGZB 2F65A 5E3PA 2R7TA 3U7JA 1C0UA 1ZM4A 5IC6B 3EDQB 1LWFA 1RTHB 3R6LB 1VQ4S 2GFFA 3EX7B 3CCQS 2WONA 2WSFC 1Q79A 1S4EA 2JZ5A 4CYUB 2JRSA 5J2PA 3BH7B 3MM8B 3UI3A 3Q23A 2IDLA 5A8WA 4TYBA 4DDFA 2VOPA 3JSYA 2XMVA 4RJVA 1VQPS 5ADZA 3CULA 2N4CA 2VG7A 2ABYA 2DITA 2VASA 1RT1A 2QLJB 2W4DA 4NCAA 3TA0A 3W8PA 3L4BC 1R0AA 5BYRA 4ZPAA 2HHWA 4NZ0A 4X62J 5DDOC 2D3ZA 2YKPA 3MMCA 2YWFA 2JEGA 1I3OB 1VYAA 1T9VA 2XSJA 1QAYA 3MPYA 6FD1A 3I5BA 2DXDA 4ZPVR 2N3LA 1KNZA 4J9KA 2LQ8A 2QMUB 1OIAA 2BJDA 1GMUA 3MM9B 2FJXA 3OXGA 1IR1A 5ETLA 2KYXA 3IBFB 4MMOA 2Y3YA 4I6AA 3HD1A 3TZYA 4ANCA 2OEJA 2O3DA 1TTHB 1RWUA 3MGJA 3HFVA 4KFBB 4PPZA 4PWWA 4RUHA 1VQ5S 3GIRA 3GJRB 4USHA 4R5PB 1L3UA 5F3ZA 1QVFR 3DLGA 2AX0A 1RI7A 2IIHA 5E2QA 2WSEC 1AYEA 3H2LA 3TZZA 1TK5A 3KJVA 3MZIA 4JI5F 2UXDF 3OPKA 2VG6A 4F4KA 2ZHBA 2KRRA 1WEYA 3TJAA 4G1QA 4I6YA 2IM1A 1WEZA 2CPIA 4CQ1A 2KXHA 4LRFA 3M6VA 2R8HA 3PX6A 2IM0A 2D3OR 3ZXWA 4F2RA 1TVRA 2CJ9A 4IR1A 1G1XA 2KFNA 2GJIA 1GH8A 3LAKA 1TKXA 3CCWA 3D9BA 5GAHI 1HPZA 2DNYA 3AB2B 3OHBA 3SI8A 1BXNA 1X5SA 2V2ZA 1U02A 3UR0A 4KV8A 5F8MA 1UJ4A 1X31C 2FHMA 2NZCA 4J9MA 2N7CA 4AFFA 1M1GA 1TKXB 4ZHRB 4K0KF 1Q86T 4KT0C 1RAJA 2G1HA 2Z2LA 1KTVA 3H59A 4ICLA 3FCWA 3EYZA 1JLCA 1VLOA 2CJBA 5AXKA 1HWJA 1YVFA 3CB4A 2JDJA 1IWGA 4HT5A 1HNVB 5ETSA 4YMEA 2ZHAA 2I9SA 3RTVA 4EK2A 2OIHA 4NXNJ 2OP5A 3ULHA 2BE7D 4M8LA 5DDPC 4NA2A 2B9YA 2CDRB 2HS0A 5LMNF 2NPFA 4A46A 1DQAA 1LKZA 1DQ8A 2HFUA 4NLTA 4X62F 3UCUP 2GO9A 4QR0A 4WKYA 3I96A 1HNVA 1FT8A 2MEWA 3Q8RB 1RXOB 2RQ4A 3CD6S 3MR6A 4TY9A 3NMAA 2DEIA 2GV1A 4M5GA 2H1YA 3RGIA 1R6YA 2BOAA 3RG6A 2WRMA 1GT8A 1U6BA 1C4AA 4GVBB 4LF1A 4ED8A 4DMZA 4U9RA 3PW7A 1F5BA 2G13A 3T5HA 4ZVUB 5CCMA 4DQIA 2DHAA 2G1DA 1JLEA 2APOA 4ZITA 2QZ8A 2XWXA 4DLGA 3OR2A 2NQPA 3ILLA 4ILMA 3LW5C 1CEZA 2XSFA 4CLLA 4LFCF 4UQGA 4AXJA 3WX4A 1ZM3A 2K8GA 2XLJA 4U67Q 4P2XA 3PRDA 5DM6Q 3TQEA 5I42B 1I1GA 2YX7A 5DS7A 5BR8F 4LF4J 1UVNA 5AXLA 1P6TA 4CLWA 2M8HA 5HATA 4DQQA 2GHVC 3M4XA 3TX8A 3GIIA 4HACB 1T05B 4DSIA 1K0TA 2IBKA 5DLGA 3AA9A 2VONA 2DCLA 1LWCA 3U1MA 4CYUA 5J2PB 2HHVA 3J7AN 4K4XA 2GQQA 3DU6A 2RDDA 1CJUB 3AOCA 1SKSA 1RAHB 3IS9A 2WHOA 4DOZA 2GIQA 4PXEA 1JJ2R 4XO0A 4J9OA 2LDYA 4H4KC 3NGDA 2NXCA 3US5A 4ECTA 1GMVA 2BKPA 1KR4A 5J2NA 4X4OA 3SCIE 1JLAA 1UVMA 2ZDPA 3SV4A 3IRXB 1UVIA 1V3ZA 5SUHA 4C3KA 4DPOA 2BEFA 3GONA 3JS9A 3HVWA 3FC9A 4HVZA 5AE3A 2VQFF 1KONA 4MTPA 1RTIA 2DRBA 4K4VA 3OTEA 4DU7A 3C6TA 4C8YA 2MKJA 2B43A 2DR7A 4B9SA 3D6MB 2IC3A 1L3VA 1XNRF 3AODA 3LP1B 4ERDA 1NM2A 1S1VB 3AFGA 2C2NA 4WP3A 2IA0A 1WD6A 1RHJB 3OL8A 2E44A 2J8SA 1KN6A 4WK1A 4WU3A 2UXDJ 4TKTA 2K1RA 1MMNA 2DNKA 2R7QA 2ZNZA 3W5YA 2IC3B 1KLMA 5J2QA 2JHEA 2AEFA 3SCLE 2RKIB 4OLOA 4O0NA 4M95A 3RW6A 3LQVA 1C4CA 3MEEB 5KFMA 4HYKA 1PBAA 2ILZA 3OR1A 4U8VA 2OPQA 3HHLB 1U1OA 3MHYA 4PWUA 1FF2A 4GVLA 5D77A 3N9UC 2KL8A 3BV8A 4BCAA 1OSCA 1UPMB 1Q0NA 2QMXA 1WI6A 2CG8A 4NOHA 2HNZB 3M30A 2QLFB 5HBMA 1HHSA 3VGUA 4ZJQA 1WHXA 5J1EB 1ZH5A 2FY8A 3KG1A 2P9EA 4DV6F 4MAKA 4DSLA 2DH7A 2CJQA 2OKQA 1VQNS 3ZZRA 4L72B 6AT1B 4YS2A 3HVRA 2F4VF 2ZJRQ 1R0AB 2XMMA 1G4CA 4LSNB 4ECWA 4JV5F 1HYSB 2L9DA 5IZHA 2BA9A 3NGKA 2XYPB 4G1QB 4RBUA 3JAMY 2RAQA 2ZBIA 2C3YA 1IR2A 1TKTB 1HQEA 3I31A 4DSEA 3PX0A 1VJQA 1S1XB 2AT1B 2PN6A 3FVYA 2YQ3A 3AD9C 1NHKL 1LW0B 4ED5A 4C8KA 2HFSA 4K4UA 1HR0F 3J7ZT 3F44A 5U47A 4DR5F 2DNPA 2DGTA 4GMKA 1RA6A 2IBOA 2XLIA 3GYNA 5KG7A 2WTFA 5E41A 4LR7A 2IJRA 3MPDA 4WPAA 2NS1B 2RHSB 4ZVFA 2Y1IA 1RDRA 1D0EA 3TNVA 5CXTA 2VU5A 3DLJA 4ZCKA 4DV4F 3RBZA 3M2VA 2ZUAA 3OFHA 3W64A 3FK4A 2DNMA 2DGSA 2VPWB 1YBAA 4F4ZA 2B56A 2D3O1 4B3SJ 1IUJA 2GS8A 2RT3A 5A6WA 4AXIA 4F0HA 5LJ3Y 2K7KA 2HWHA 1VIXA 5L46A 1U6FA 2EFQA 5KFIA 3FRZA 4KQZA 4LBPA 5KFQA 2V2KA 2W7PA 1JNZB 1WC0A 2NCKL 1ELOA 3BGUA 1WG4A 2D3UA 1C1BA 2RUGA 3M2RB 4QWEA 3NAHA 3GYXB 3NY0A 1JLBB 3CO0P 1M0SA 4UW2A 3E2EA 1JLQA 3MURP 4LF2A 1S6OA 3PM9A 3DLGB 4QW9A 2GVZA 2VC1A 8AT1B 2MHEA 4URGA 4CIOA 3ZTOA 2DVIA 2AYMA 3F56A 1HFEL 4MIWA 1PYTA 3R5CA 2DTJA 4QR1A 3OL7A 3S1TA 5KT2A 1GXLA 2EXUA 3NWRA 3R8YA 3GFXA 3FEXB 3NCRA 4J9NA 1U2CA 1RT4A 4U95A 2K2PA 2J9EA 4NX9A 2FQQB 1S9GA 1VDHA 4OYZA 2DNGA 3N6MA 4CNYA 4ED2A 4CH7A 1Q8IA 4LF5F 3VVTA 2J0XA 3D0GE 2UV8A 4CLSA 3AAWB 4KPCA 2VG5B 4JI8F 4DCPB 3VHQA 4ECVA 1S49A 3G4SS 4E0DA 2ZC4A 3AY0A 3ET6A 2E1CA 2FVPA 3NGRA 2HQCA 1Y5NB 2HHHJ 2ZOMA 4FXWA 2FD2A 2VUGA 3HJVA 3RR7A 1V3RA 2AJ2A 4FYVB 4OV1A 3G8SA 3MCOA 2OFGX 1FJEB 2EC0A 2DR6A 2NLWA 3EE3A 2RF2B 4LIWA 4QYRA 1FKOB 3ZNJ1 2IPOB 4K4WA 4I67A 2DD8S 1YZ6A 2KFZA 3GCXP 3KHHA 3NBPA 2MJNA 5K14B 3A8EA 3NGTA 3FQLA 3NOCA 4KBIA 2W4PA 1VQMS 1HHTP 2XS5A 4B3OA 3CIMA 1D8ZA 2W25A 5HSPA 4ZPWR 3HP6A 4KC5A 4DBQA 4DV4J 2NUHA 3KK1B 2HLUA 4B9VA 1X7VA 3FCVA 1X9WA 3NGUA 3GLJA 1BE4A 1H2TZ 3MMJA 2EKYA 1U1LA 3BGLA 4WXWA 2LVWA 3P8BB 5I3QA 5HVHA 5GVQA 2R2SA 5HROA 4N77A 2QIFA 2FJDB 4O3PA 3H4BA 1HNZJ 1X4FA 2MTLA 4N5SA 2BE2B 3W2VB 4KHPJ 3OQ2A 1RT4B 1S9EA 1BMQB 2KT2A 3R9LA 3UN2A 4YR3A 4EU0A 1G7CB 2HIQA 1QSYA 4N56A 3OV7A 4WZMA 3GV7B 4EWTA 3RBEA 1NK6A 3D68A 5A6PA 1O8BA 5DZ7A 2BOPA 1TUVA 2HQDA 4WF9Q 4QU6A 3FCHA 1PKUA 1XEZA 2HFNA 2UUAF 1X60A 2RILA 2DR9A 3MM8A 1SJ3P 3WC2A 4OLPA 3QZ7A 4UUWA 1NZ8A 1EIYB 2CAJA 2Y0BB 2WVEA 4RNFA 2UVWA 4ELTA 1SC4B 3A3OB 1WHWA 3TAPA 1RGVA 2KFYA 2HBYB 5D4OA 3QJJA 1WORA 4RKUC 1FEHA 3RZAA 3W3SA 1ZZFA 4DV1F 3W5ZA 5EN1A 3HSJA 1YG0A 4WFAQ 1R8PA 5A2QY 4D3HA 3V81B 2IAJA 3CDUA 3H90A 2A10A 4ZJLA 1HMVA 1DBDA 4MKYA 1O6XA 4G1PA 1YKWA 1H0HB 2OMOA 2MY7A 4ZP6A 3KMSA 2R7SA 1UW4A 3LGHA 5L1JA 2YWGA 4ILLA 3J81Y 2QJ3A 1ZPVA 2HVHA 4H54A 2GMJA 3HF5A 4KY3A 2G4BA 4DN0A 1GAOA 2J8AA 4F50A 1NK5A 3MM5A 1BLUA 2A2CA 2JLFA 3QGPA 2AIRB 4PCQA 5G0RA 5C24A 1REVB 3R3TA 4F04B 1YBUA 5IOLA 4A8XA 4B3OB 1NLKL 2P9CA 3E01B 2YNIB 4FN5A 4DPYA 2LYVA 4O44B 1IBCB 3HD2A 3NS6A 4ZVHA 3QT6A 2MKYA 4LFAF 2HK3A 1L3SA 2NXEA 3RRHA 4CT8A 2BDPA 1Q78A 2GA7A 3DHXA 5D0EA 2QLXA 1FXDA 3TA1A 4OYIA 3RU0A 2VFTA 1WUUA 1TU0B 5H9EK 2OPSB 4J37A 5MAOA 1YHQS 1U45A 2IMOA 3IWLA 2RRBA 2VJVA 2VOOA 1NMEB 3OVSA 4ED0A 3T5KA 2MQMA 4ZLPA 1N5SA 2JEJA 1S97A 1SJ1A 1Q5YA 1XR6A 1FX4A 2A0FB 4C4WA 2ZM6F 1NHUA 3V4MA 2I6WA 4ED3A 4QR2A 1WELA 1N33F 2IAJB 3KK3A 4LRAA 2BMBA 5CD4H 2V2QA 3ONQA 3L7OA 3K5LA 2BANA 2M8DB 4EUVA 2QEXS 2PE8A 1R8CA 3T41A 5J1PA 5B0CA 4AL6A 2C2ZB 1T8EA 1FK9B 4OJ1A 3IS9B 4ECZA 1N36F 1MNEA 4YR0A 2X1GA 1OO0B 2GVZB 5CABA 5IXUA 5KFGA 2C2RA 1N8RT 1HBUB 3PIOQ 3MEGB 4X4RA 2MHNA 1MU2B 3I4HX 1HWUA 4OYWA 3BQ2A 4S0MA 2XY5A 1IKVA 4H4OA 1WOPA 1LW2A 2MDAA 4MYUA 3GZ7A 2V4RA 4TY8B 4PABA 5ETMA 1F9FA 4Y6IA 4O3QA 5M2UA 2MQPA 3SV3A 3PVXA 3HT0A 3HHEA 5LMUF 1TL3B 2RIJA 3PYFA 3B54A 3MOZA 2KXFA 4BBYA 2JWNA 4TU7A 1JQGA 2W9CA 1VQ9S 2UXBF 5FJ4A 1JLEB 5GMDA 4CLKA 2XS2A 2CKWA 4ZLNA 2LU2A 2HGLA 4PEOA 4WZQA 5HROB 2MZJA 5J2NB 2EW9A 2ZBRA 3QT8A 4Y28C 2QFJA 2YH1A 4C11A 3P6YC 1IVZA 3MOJB 2DPIA 1N32F 2FLLA 4NEYA 2ROEA 3B4MA 3IBCB 3MM6B 1JMTA 4WFXA 3P45B 6FDRA 1VIOA 3TWZA 3WBZA 4B3RF 2PMHA 4DR7J 1G2EA 5DETA 4LFAJ 3K17A 1X4DA 4NLSA 1NB2A 1WJ9A 2LMIA 2MMYA 4DL0C 3RR8A 1T05A 3GV8B 1TZ0A 5B7WA 1K44A 2XZTB 3QO9A 4MK7A 2W7AA 2WSCC 1VOMA 2D7SA 4ZCMA 3PV8A 1FJGJ 1SI9A 2EBGA 1JLCB 4QCLA 2GNKA 1ZS6A 3ET6B 3DXSX 3IGVA 3KOAA 1OYDA 4TQRA 1NJYA 3D1HA 1WTFA 3FRYA 3MD1A 1SCJB 2Q66A 4DS4A 1T95A 4LSZB 2JFDA 2MB0B 4EBEA 2AGQA 3OTCA 1U2RA 1UWBA 1NJIT 4NLGA 4IOBA 2BXJA 2OD6A 5BR8J 2CQ3A 3JTOA 3KHLA 1EJ7L 1LK5A 3BKTA 5KT4A 4DV3J 4LF4F 3CDBA 1RHMB 4CO3A 5IWAJ 2P9GA 2I5JB 1DQ9A 5GMKa 2X1AA 1TL7A 4XDDA 3EGWB 4ZKAA 1AA1B 4DUTA 2C28A 3THPA 2YNFA 1U48A 3QGIA 3GSDA 4DX5A 5K8OA 1U47A 4ZVSB 3WHIA 2WAQD 2K06A 1URRA 4B17A 2V8HA 4X64J 3IRWP 2YNIA 3P5BP 2XGQA 2Y9HA 3G6XA 4PG6A 1UTAA 3U02A 3UFCX 2HNYB 2XYGB 3VCDA 3K5MA 2FTRA 2I8EA 1ZTTA 4W4MA 1KQFB 3DRPB 3VR1A 2LXIA 3IAS9 4O3NA 5JMNA 5KFBA 1VK3A 3H40A 1T03B 4O4GA 3SQGB 4X4TA 2IFXA 4FBUA 2W2NP 4DL2A 1U1NA 2BVZA 4QBUA 1T9XA 2BRKA 2QA1A 3LGNA 1GMWA 2XULA 5A2QU 1N32J 1V3SA 1U09A 1UJ5A 4K2JA 3DRRA 3KDOA 4JYAF 3PEHA 4A4JA 3TOQA 2HIYA 5KFYA 4QWCA 1T9WA 4I0WA 5K8MA 2NPIA 3LPEA 3MAAA 3FBCA 4DCJB 4WFBQ 2MZTA 2Y1RI 4YDDB 3HZEA 5KG3A 3ETMA 2C2DA 1TMJA 3RB6A 2QRRA 5C5JA 2B9EA 1YDLA 4OHZA 2GVDB 2IDEA 4FVMA 2CWKA 4OYOA 3V5RA 4F36A 2J6UA 3LP0B 1JLGB 2ADBA 5K8NA 4LF7J 3PHTA 2C2OB 1ZAVA 4OZLA 1QUPA 4Y2KA 3RB4A 3RAXA 1YX2A 2M9KA 1F1BB 3QAEA 4CH1A 4C97A 3O5TB 1KSPA 5LMUJ 3H98A 1BWEA 1U4BA 3CEDA 3MM9A 4HHUA 1MMLA 3NL0A 3CJ5A 2DKOB 1NBEB 3M8WA 3M8PA 5EGYA 1HIYA 2R3VA 4ECSA 1M5VC 1KLNA 4WIIA 2VQEJ 3I87A 1RHRB 3PYGA 3TJ9A 2U2FA 3DI6A 3FGVA 3DLLQ 2ALZA 4TXSA 1LK7A 1W7WA 1U8WA 2ZC3A 1LWEB 3NLCA 3K5PA 3QT7A 3S7RA 3KK3B 1YI2S 2BZ2A 4ES2A 3KHGA 1LNQA 4X4SA 2XMKA 3TAQA 3M8ZA 2FVRA 4RL1A 3CJRA 4LIRA 5CA5A 4DR3J 4XTTA 3Q2TC 2M70A 1AZSB 3RBXA 2ZH3A 3TZWA 3W1YC 5HVGA 3CCRS 4DL3A 2AJ1A 3ISNC 1Q1KA 1VHIA 1KQSR 3E01A 2GQCA 4NEZA 3BBFA 3H5UA 4DR2F 4Y3CA 1ZAXA 1N5VA 2CPZA 5CYQA 2H9ZA 4LR8A 1HW8A 4LSNA 4QZVB 5IS2A 4FDFA 4ZVOB 1T0TV 4DL6A 4ECXA 2RRAA 1F3FA 3TVYA 1YJNS 4Y00A 4URQU 1TL4A 4ATNA 1SL2A 4Z37A 1RWPB 3EVOA 3H2UB 3OBIA 4L76A 2ACMA 4YHHJ 1SQGA 4ED4A 1MMDA 2GMLA 1C1CB 4A8QA 3V6HA 4OX9F 4IDKA 3MPVA 3R27A 2ZH1A 4PPDA 3BSCA 4GKKJ 2Q6CA 2FJWA 5KG4A 2DNNA 2GIFA 3R5DA 3ZZOA 1AB8A 1X4CA 1JB0C 2J76E 2WZ1A 1ACMB 1WF1A 3GWCA 4P2FA 5K5MA 4DV0J 3T5JA 1WSVA 3BO2A 4KGZB 3NCQA 2C2KB 3BN7A 1CJVB 2QE5A 2Y1LB 3TZXA 1MWZA 2B0GA 2FLOA 3JTPA 4LF7F 2JJ4D 4KR0B 1YJWS 4PQAA 1SIWB 5CH7B 5DGBA 2ZZTA 3AJDA 1HR0J 1TFYA 1IN0A 3DOLA 1HYSA 3UCGA 3T1AA 1ZM2A 3MAQA 1K8AT 2C42A 3FUYA 3KJFB 1RTJA 2GZOA 3EXCX 4WCEQ 2A2DA 3CWJA 2QG9B 3QWUA 1SC1B 4PWDB 1Y00A 1RWNB 1PO6A 4I2PB 3DI6B 3UDEA 2C2EA 4RNHA 4PXBA 4O3SA 1X9MA 1MW7A 3NWGA 4P7VA 3OR2B 1YGYA 3DGVA 2PC6A 3BKFA 4C8NA 2KN4A 2YKMA 1X4GA 4ZP7A 3SCKE 2BRLA 3KUGA 4CM0A 4EZ6A 3L9ZA 3CD5A 4O4GB 3SQGA 2G0CA 4JI6J 4PWDA 1FDNA 1R0BG 3BGRB 2P6TA 3UNYA 5BXIA 4OX8A 1QAIA 4WTOB 1DZ5A 2FJVA 2MKSA 2A3JA 4RWWA 2AF6A 3S01A 4QJVA 5ETPA 1S10A 4U7UD 1FJCA 3MMCB 5E3CA 2HG4A 3GCWP 1CS4B 4PAAA 4UOFA 1HD1A 1NSPA 2AV5A 1SJQA 2AP6A 3LP2B 4OJGA 5FLXU 2DY9A 1RB0A 4B9LA 2E7WA 4DR2J 1RT7B 4F25A 5KFHA 4C2MA 1VK8A 2XQCA 1XQIA 2Q3PA 5LXYA 3UVJB 1NRKA 1CJKB 3ITHB 4R25A 2E1AA 4IFVA 2OPPA 3HX9A 1AXQA 1ZBTA 3Q2SC 1FWLA 2QA4G 2MLZA 4C0HA 1AROP 5GAEU 1CQNA 1RABB 2CADA 2D69A 3D7SB 3J80Y 3DRRB 3MECA 2NREA 1WSRA 1HBNB 1UKUA 4QW8A 3W63A 4UZCA 3CUNA 1Y5IB 2BW7A 4HDGA 1NEEA 1ZYQA 3N6NA 2MQOA 3CDWA 3GV5B 1QSSA 3AJ1A 3NMRA 5AE1A 3FZBA 2RVJA 4K4TA 2N3OA 1BWVA 5KFTA 3VAMA 1CQMA 2AYGA 4FXVA 4PYAA 2DNQA 4K4ZA 2HNYA 4LQ3A 4AUKA 3CJ8A 3DFEA 1NDCA 1RHUB 2J0SD 1P9QC 1ZAWA 3DM2A 1ITPA 2OSQA 4IFYB 3M32B 5A8WB 3NCPA 5DO2A 1SH3A 2HBZB 1PGZA 2YQ0A 1HQEB 3EPIA 1SIZA 2PEHA 1JX4A 3Q8YA 2EFVA 1Q8LA 1UWAA 1VRQC 1DAXA 1SC6A 2H5JB 1U24A 1RLCL 2RU9A 2VQFJ 1TV6B 4C11B 4YQWA 1TK0A 1MN9A 4HLBA 1X4BA 3BZQA 1RU2A 3SSSA 3PFEA 1R27B 1YTYA 3G86A 4KH0B 4NRTA 3W60A 4RNNA 2KTQA 3MTKA 1M5HA 4JV2A 3R97A 5DZ6A 8ATCB 4DV7J 3HVAA 2BYCA 2WBMA 1NPPA 1X4AA 3CJ0A 1C2PA 3VGVA 2E5LJ 2AYEA 1TUGB 1URNA 1OY8A 1RT6B 3L7PA 2UU9F 4K5RA 5KFDA 5AJ3F 3EPGA 3FEYB 4B9UA 4LFBF 3KLHA 3C19A 3MTJA 1LWXA 1AFJA 2LQ9A 4U7CA 3QAUA 3K57A 3SMZA 2R4FA 3TRGA 3P49B 2DBBA 1S99A 2LA6A 4RPFA 2WK4A 4F3MA 1VJWA 1PC5A 3SDEA 4WFYA 4DWIA 2QN6B 3DRXA 4FKXA 4NLWA 4EEYA 1T11A 1GMWD 1RAGB 1VRTB 2BJ7A 4IFYA 1YZ7A 3OVAA 2HGMA 3O2IA 1HBMB 2YXLA 1RADB 4RW7B 3BB5A 2HSEB 4EMDA 2HVDA 1WHYA 3BKUA 5F9LA 3VQTA 1IBKF 4TU9A 3MPWA 4ID5A 1FE4A 5HJYA 1RLDA 4NI2B 2MKIA 1UFWA 3VAKA 4BC7A 1PCAA 1RUSA 2D9PA 2H4YB 2WW4A 3HDSA 2BUNA 3LOUA 1BD6A 2VDHA 4RW8A 3AD7C 2H65B 5KOXA 3WIVA 2HPUA 2W9CB 3OJUA 3V81A 4LJMA 1VBYA 1RAIB 3BN4A 3GIKA 2KVIA 1VI7A 4UQTA 5B09A 5EWEA 2HK2A 2F9JA 1DURA 2OPSA 3BPDA 3ZTRA 3BO3A 2VODA 2B51A 2GMHA 4LUBA 4G1IA 4KPYA 1R6VA 2KT3A 3DOMA 2PI4A 3CD7A 3OTBA 4FP9A 2Z56B 2HFOA 4V19X 3PIPQ 2GGPA 1EQ0A 3LA0A 2R8KA 2NR0A 3TUPA 2B9WA 3O44A 2E7XA 2CQCA 3A8IA 3GJTB 3TVKA 5KFZA 4RW9A 1QY7A 2Y1JA 4DL5A 3CCVS 3QZ8A 1S9FA 2IA6A 2E5GA 4KRWA 4G6VB 1UEUA 4DPTA 4MT1A 4USMA 1OMSA 4C8OA 2VFUA 1KP6A 1UP1A 3TUIC 2X3GA 3OUYA 3NGSA 5CQGA 3CDEA 4OI2A 1KS2A 3W2WA 4EI2A 2FZKB 3BYRA 4N7TA 2WVBA 2DHHA 3KYLA 1VLYA 5L1LA 2G2ZA 2I1RA 2OMLA 1FRIA 4WIQA 3DLHA 2VA3A 1EETB 5LJ5Y 3BEGB 3LPYA 3QIDA 3C6UB 2H4WB 3ILOA 1XBWA 4M5KA 4JI3F 3PO4A 1CPZA 3K8VA 3HSGA 2ASLA 1UVKA 1OQ3A 2L08A 1E6VA 4K8RA 4RNOA 4I7FB 1R8BA 1BQXA 4MIAA 1VHFA 1C0TA 1FRLA 2DGOA 4Q2MA 3NG8A 1M1KT 1HBOA 1R0CB 3J80U 2HLTA 2XLKA 1U1KA 2PA3A 2B8QA 3KFWX 2EVZA 3QRRA 1VISA 1RAAB 1RAFB 2B8PA 4LREA 5D3GB 1Q95G 1KVJA 1U8SA 1DTQA 1U2FA 1HBUA 2WVDA 2LFVA 3BSOA 4A8WA 3QJLA 4K4SA 1NH7A 4Z7YA 2IY5B 1U49A 3M9NB 2V2VA 3M2UB 4MFBB 5ETRA 2MSSA 3QYYA 2IJFA 4LF5J 4LF6F 1X5TA 2PFDA 4UZBA 4OI0A 4IQMA 1K1SA 4QPXA 2EG2A 3KG0A 3SZ2A 1S79A 1I94J 1FE0A 3IN5A 2HHHF 1IJEB 2YWWA 4P7TA 4FYXB 5F8LA 1W2BR 3IRXA 4NE9C 1WNEA 2HZAA 1WOOA 2EFNA 1SC3B 2BJ1A 3KWMA 1U26A 5KFSA 3U1LA 1FWPA 5L8RC 3MUTP 3HZGA 2E5LF 1NO8A 1Y11A 1ULRA 2YNHA 2NZ4A 3LO3A 1NZAA 2XO7A 2VHGA 2OPPB 2Z58B 3H4DA 4NYZA 4JOUA 1PC4A 4QIFA 3C15A 2DNRA 1XMOJ 3ZTPA 4P10A 2GX8A 1F5CA 1WG1A 1OPIA 1EHWA 3U27A 4C0BA 3N01A 1JLQB 3HHLC 2LU1A 7FD1A 2J6SA 1V5VA 1HWIA 2FC9A 4GC6A 3QFHA 1DLOA 2R2TA 2B5JB 2F1FA 1S59A 1GX5A 4PKDB 4LT6A 4U6PA 3EUNA 3GFZA 2XWYA 4IRDA 3MF5A 2F7VA 3P4UB 3QLHA 2DGWA 3GSIA 3C6UA 1RT6A 4JYAJ 1FHTA 3DNCA 3CJKA 9ATCB 4TQSA 2AW0A 2ZH4A 3M30B 1NK0A 1FTRA 2E66A 2Z0GA 3M8PB 2EBEA 4WP9A 3B82A 1V6HA 1LEOA 1NNDA 4UTGA 3QLHB 4CNZA 3J81j 5FIIA 2MSTA 5KFKA 4XPEA 1YIJS 1QTNB 4LF9J 2KB2A 2IM3A 2ZE2A 4M5LA 5D78A 4Q43A 2J7UA 3BSNA 1Q5VA 2CPXA 5DRKA 1B64A 4WWSA 3H5YA 3BO4A 1HNWJ 1RU1A 2CZVC 2G9OA 4UOHA 4RW7A 4PRFA 3PR4A 2VG7B 2AU0A 1F9HA 4QU7A 2AEMA 1NCLA 2WB1D 2WB4A 4YUDA 1Y10A 2LEAA 1YSJA 3PEJA 4ZPDA 3DM2B 2M3DA 1CJVA 4NYOA 2H54B 2HFVA 2CJKA 3IWXA 1QM9A 2EFPA 2HAIA 4DV5F 2C1EB 2R8JA 2YQ1A 3POTA 4A8FA 5KOWA 2KHDA 3Q0AA 1I51B 2J7WA 2ZHOA 1S4FA 2JC0A 1HWKA 1R7IA 2V8VA 2ZH2A 4J9RA 3UCZP 2HVZA 3PX4A 2YWHA 1HNZF 3H0PA 5B0EA 5DQHA 4DFPA 2V6AA 2ROGA 1NJZA 4CLUA 1Z2LA 4RW4B 4ED7A 2VZ9A 2XB2D 4P73A 2RMLA 4AL5A 2VFSA 1X0PA 3FQKA 4I2PA 3MWBA 1AUSL 2HURA 3HVTB 2VBZA 2ZD1B 4CT9A 4JI3J 1RISA 3IGNA 2VB6A 4K2XA 4UY85 3UO0A 1X5PA 1RT2B 4TN2A 2B5JA 2O67A 2RDIA 4P71A 2EG1A 2HZCA 4EZ9A 2P2CB 4K5SA 1WC6A 2L41A 3PKYA 5KG2A 4LQ9A 3TANA 4P75A 1WG5A 5A0YA 3Q24A 5HP1B 3LUYA 4FYWB 2FGOA 5J2MB 1RTDA 3DGPB 5KTQA 2QYCA 3T6BA 4YHHF 3FJ2A 2JSXA 3B8HA 5L9XA 4L3NA 5C42B 1CVJA 3GQCA 3MEDB 4ZP9A 4UOGA 1EP4A 2CQBA 1RKIA 3T1YJ 1FI4A 2ATLA 4KKOB 2OTJS 1VRUB 1GEHA 2HS4A 1NKCA 4FXDA 4DV0F 2XYHB 3PXGa 4FF2A 4CLTA 5CHCB 1KHVA 4I4BA 4NXNF 1O51A 2V8GA 5HQLA 2ZZNA 5KG6A 2NSCA 1FFGB 1B4SA 3EWGA 2DGUA 4J9PA 3AXMA 1RWOB 3SSRA 1T7PA 3LGMA 3K8WA 4WE1A 2CJXB 2HWTA 2KI2A 2L48A 2KU7A 4DV5J 1AZSA 1S1XA 2AEJA 2MZSA 2BQRA 4GKJF 2RE1A 2IYGA 2W2MP 3GU0A 3JYTA 4YFUA 1HNXF 1YJ9S 2BABA 4R5PA 2A6MA 1PYSB 2J0WA 1UVLA 1MROA 2IRYA 5ETQA 1PJ7A 4ZVRB 1WDDA 4A8OA 2KG0A 3HXMA 2CPYA 4ZVTB 2R7WA 1VBKA 4ED1A 2ILYA 2HW3A 5DQIA 2LQBA 1VBXA 1Q7LB 2CQ4A 3G71S 1E6VB 3UNGC 1F2HA 1NPRA 2WOMA 5B0GA 1IXKA 1ZZNA 3OTOF 2VL1A 3H8YA 1J5OB 2F40A 3CC7S 1FRKA 1W25A 3I9V9 1HA1A 4BLGA 4USKA 2J0QD 4DG1A 1V5IB 4NASA 2DO4A 2V5HG 1S48A 4OQJA 2AJFE 2MJUA 4MKVA 3TJ8A 4USTA 2IHR1 5B0DA 5L1IA 1JJ4A 3QIPA 4GKKF 3OTDA 3J7YU 3ENWA 2BV3A 3MEEA 3PNIA 2AMCB 2OPQB 2M7SA 3HHLA 5HAOA 1SJFA 4B9TA 1GK8A 3DXBA 4IRCA 2N7YA 3AQOA 4ZLLA 5E3RA 2YWEA 5A0YB 2GIRA 1YBTA 3HLUA 1LWCB 4YR2A 5KG5A 3JSMA 4WKRA 3O1LA 2W2OP 4N47A 3Q83A 3QWPA 2XY6A 4ELUA 3R5JB 3H20A 4LBIA 4OJHA 1LWFB 1RTHA 2DY1A 5D0RA 4ZS6A 4B02A 5G0RB 3CJQA 4P9SA 1X5OA 4B08A 4OZ5A 1VQSA 2V4JB 4BHQA 4O0IA 2ZH6A 5E3QA 2ERRA 1S6PA 2GC8A 2VV5A 3GP9A 5E0OA 3M9OB 1HD0A 1RTZA 2M5YA 4YOEA 1QAJA 1BQNB 1VQ8S 3UD5A 3CMQA 4YB5A 4JI4F 3IG1B 1WACA 2BM1A 2KDOA 3LWMA 3KLIA 2AZ3A 1IWAA 3MEKA 4CO1A 4TYAA 5DDQC 4X4PA 1VGYA 2VBXA 5CYMA 2HRUA 1IKYA 4D3GA 1HARA 1MWYA 4EBDA 3VAGA 4DL4A 3AA8A 4C7QA 5B08A 2LA4A 3BGOP 3C16A 3R7NB 2FYXA 4DFKA 2YNGA 1HNXJ 2K1RB 3BREA 4NZ6A 5HQ8A 4AQYF 1N34J 4QYZK 2HHXA 4Q44A 2ZITA 2VPXB 1SV5B 2LEBA 4NLUA 3EZOA 3B78A 2IVFB 1L3KA 2A1BA 2ZVSA 3PYEA 1HKAA 3LALA 5L9NA 3MR7A 1NSKL 4GO5X 3D6TB 3FFIA 5KFLA 1RE1B 3G8QA 4DSJA 2G0JA 3BH6B 4LF8J 3BGRA 3KLHB 2VKZG 1IM4A 2V4QA 1FNXH 3MFIA 5GAHU 3JQJA 5KFWA 4DFMA 4LFBJ 5A8KA 2NXNA 3HULA 4DV3F 1D09B 4F0MA 3DDIA 3VAIA 2DHGA 3T6JA 4JV5J 2DT9A 1WC1A 3HKWA 5A8RA 2W4CA 2CPHA 4OYAA 4B9NA 3CJKB 1VBZA 3OUYB 1F0XA 2H5IB 4NA1A 3F73A 4N76A 3DYAB 2N82B 2J6TA 3EGZA 1BGXT 2CJYB 2Y8WA 3W9HA 2F4FA 2V68A 1FTCA 1TV6A 3N5BA 1IBLF 4A8KA 4XAKA 1LFPA 1XMBA 1YJUA 2J5AA 2DB1A 3GTYX 4RU9A 3J7A1 3CSKA 1DFDA 1N54B 1TKDA 1H3DA 2CG4A 4OL8A 1R31A 3MMAA 1KVKA 4QIVA 3TARA 2XI3A 1DY3A 4NLDA 4K0KJ 4G3IA 5CAAA 2VFVA 3FKBA 5M2PA 2ZFHA 1KOOA 1R3NA 2P5VA 3CJ3A 1RWXB 4KYZA 4FPIA 5BYSA 3P3DA 3OLBA 3MM5B 4J90A 5KG0A 3VZIA 1LWEA 1VQYA 4E2FB 1TL7B 4QIEA 4EGLA 4DJBA 5GADI 3D0IE 1SKUB 2CQPA 4ER8A 5DG7A 5CYMB 2XCPA 2KKHA 4JB8B 4ZDNA 2YBVA 3W9IA 2R7RA 4J9SA 1SXLA 4PR6A 4ZLJA 3P96A 2NYHA 1HMVB 4NPOA 4AYBD 1HQ2A 2ZUGA 4K7QA 2C22A 5KFUA 3A3NB 3I5CA 3JXOA 1Y0HA 3FSXA 4CLFA 4FKYA 5KFNA 5DGAA 2UU9J 4DFJA 2A18A 2X3DA 4USUA 4ELVA 4ZK7M 4Y65A 4IYQA 2V8PA 5LL6d 3DGPA 2RRNA 2RUSA 4RW9B 4ZVEA 2FDNA 2BR0A 1X4EA 2CPDA 3CO9A 1XERA 3CCMS 4DPUA 3G6VA 3PY8A 1Q53A 2VDIA 2XMUA 5F3TA 4HT7A 1ZTWA 2CNOB 1RT7A 5RUBA 1TAUA 5KT6A 2HVEA 4HI1A 3R7SB 1B99A 1BY9A 3OW2R 1FK9A 4IQXA 1S1TA 3D2WA 3UR3C 1IKWA 2CQIA 5H9EJ 2AHOB 2W9BA 5EUHA 3C14A 3UDVA 1OWXA 1BC6A 3H5XA 1IKXA 1PBUA 3VV2B 1VQKS 2CQ1A 1N5YA 3DDNA 1UWBB 3K7RA 4ALZA 4OI4A 1WEXA 1WKKA 2F63A 4DX7A 2Q1LA 3JSRA 2CIMA 4DV2J 3C14B 1YJTA 5LMNJ 2BKNA 1SH2A 1QUVA 5LXRA 3QSYB 1HI0P 3NNAA 3ZNUA 2KT5A 3ZO7A 4QWDA 5KT3A 1F6TA 2UV8G 3QRQA 5DM7Q 3AOAA 1VQ7S 2UUBF 2FC8A 4KE5A 3VGSA 4J9LA 1BUXA 5K14A 3VQSA 4EYHB 2AGPA 1FXRA 2Z2ZA 2FHKA 3DDKA 3MR2A 2RDJA 2FLNA 3QSIA 2GO8A 2VPZB 3PDNA 3DRSB 4JP8A 3MM7A 2YNGB 3GMGA 3M32A 3TEHB 2XC9A 3BJYA 2XY7A 5HMYA 2BM0A 2ZBCA 3LP1A 4ZA1A 3MM6A 4WXOA 2VIHA 5H9FJ 2B4PA 4U8YA 3BSAA 3NAIA 2X51A 2ZH9A 1H98A 1KKHA 4P2MA 1XNRJ 4DPWA 4EO8A 5DLFA 1DTTB 2KM8C 1S1UB 2ZOFA 4H4MA 4KHPF 4M94A 3D66A 4ZPTR 3QMQA 3VVUA 1S9EB 4C8LA 1IJFB 1K1QA 4F02A 2BW2A 4MK8A 3JSBA 3DCAA 1N5YB 1CC8A 2LEPA 1TL5A 1M1HA 2MQLA 2PIIA 2HHPA 5A8KB 3EMTA 2LECA 1T9TA 3THTA
chains in the Genus database with same CATH topology
1TK8A 4ZMMA 2U1AA 2YX1A 3CXCR 3M6XA 3RAQA 3I0RA 4YB7A 4DL7A 3NS5A 1KFDA 3OFEA 2Y0SD 2MZQA 3ZZYA 2KZZA 4DR6F 4U7UK 2H5EA 7FDRA 1Y7PA 3RAMA 1U6ZA 5F41A 5B0AA 5AXMA 5C25A 1J5EF 3BDPA 3CTRA 4DQRA 1XMQF 2C3MA 1W2IA 3FSYA 4NXMF 2YNFB 4IG0A 2VD3A 1RT3B 4QYZJ 3LANA 4EO6A 5DJBA 2FPHX 4NLXA 5F8IA 4ZPCA 3PHEA 2BQ3A 4F4WA 1SBRA 3F41A 4BWMA 2OSRA 2XSJB 3O3LA 1BQNA 3NNCA 2PT0A 4N8OA 1SJRA 5KT5A 1FKPA 3I9ZA 3MI7X 5H1SV 3CCLS 1D9FA 4W90B 4MJKA 2EK1A 2QV6A 1XMOF 2KH9A 1KQGB 3VZHA 1DARA 1RTJB 1KRPA 1XR7A 3CIZA 2XNQA 2UUWA 2PGCA 2HHTA 1RT1B 1QE1A 3QO9B 2HHSA 4OFZA 1HQUA 2LDIA 2HMIB 2KYZA 1S0VA 1E6YB 2MYFA 4OJ3A 1WWHA 3ZZZA 1FD8A 3VAHA 4CTAB 1DRZA 2HQ3A 1ZM9A 4HKQA 4ES1A 1JKHB 2MGZA 2YNHB 1R8AA 3CD0A 3Q8PB 5HL7Q 2BQUA 1RYRA 1QTMA 1G1XA 1P27B 5T7LB 1Q81T 1FXLA 3IWNC 2HFZA 3I4PA 1VRUA 1C1CA 5LSRA 4DS5A 1N0VC 3W2WB 5CCLA 3ZFVA 3GG0A 3LH2S 5KAKA 1M5KC 3N4WA 1VQ6S 1I6JA 1S72S 2DIVA 2NXUA 4C98A 2PFFB 2CQ0A 4Q7AA 4ZOSA 3KLGB 4K50A 1NB7A 2UXCF 1Q4RA 3T9NA 2E29A 1CSJA 3IR7B 1H2UX 5IT0A 1XC9A 1HQUB 3DU5A 1FO1A 4MYTA 3M9MB 3KLGA 2W8LA 4OI6A 3O6QA 1BQMB 4FPRA 4QIGA 3N0VA 3SXLA 4Y2AA 3N79A 5F9NA 3KMQA 1S77D 4I56A 4DN9A 2ADCA 2FJEB 3TAMB 5JJBA 3M8SA 1AUDA 4IO1A 3QGHA 2V9WA 2K7JA 3CCTA 4X65F 4F4YA 1FKAF 4DR7F 3FMWA 1PILA 2XI2A 2E5HA 4O4RA 1SUQB 4ZCIA 1GTEA 2E1RA 2K3KA 4RWXA 3MFHA 1Z4UA 3PFOA 2OTLS 4UY8T 5F8NA 3GILA 1KOHA 3CC2S 4PXDA 2UVVA 5EWFA 2M0GB 1VRTA 4OIXA 5KG1A 3MR3A 3KK2B 4KGMA 4NMLA 4QOTA 4BWJA 3I82A 4ETXA 3SYZA 5IQQA 3IR5B 5LSLA 4NCGA 4Y34A 4ETZA 3V2UC 1NAQA 4M63A 4NLOA 1KC8T 4AE5A 1N6QA 4DR1F 2FHJD 3DLEB 1NKBA 5B0FA 5KFAA 1FDBA 5BJRA 2VG5A 1UETA 1UVJA 1HNIB 3R1LA 2YY3A 2B6AA 3D1OA 4KKOA 4NWBA 4OX7A 5D4LA 3M8QA 1LOUA 1IKXB 2KRBA 3C46A 4X4QA 1T03A 4IOCQ 1Y5LB 2W8KA 4OHYA 3DC2A 4V19J 1H7XA 2F9DA 1N5TA 4Q5VA 3C8YA 2XMWA 3IC1A 1UEVA 3IO1A 3BM7A 3R5AA 5J2MA 3TUZC 1SB6A 3DMJB 3E8OA 2JEFA 1MU2A 1B0PA 4O3RA 2B7CB 2QMWA 4HTJA 1R43A 5KFVA 1SKRA 3SSQA 1GXTA 3CJ4A 4OZNA 1UA1A 2CQGA 4KO0B 3Q8QB 2CQHA 4Y2MA 1REVA 1F5AA 2B4UA 2ZKTA 3G96A 2OLWA 4Q0BB 3C66A 2P6SA 4I1TA 1TP7A 1DJ0A 2XGPA 4J5OA 3RB3A 2DHSA 4IDKB 3V6DA 3K58A 4OI1A 3TUJC 4A48A 1RQ0A 3M1VA 5HMXA 5HMZA 4DSKA 4MIBA 3IA0A 2YKMB 4HTIA 1HNIA 1J2VA 3JTNA 2CPFA 2HS3A 2YKQA 2OJ3A 5THWA 4Z2XA 5FD1A 3I55S 2I0XA 1A7GE 2HQIA 1M90T 1FVQA 4KHRA 2VBWA 5J1NA 4F67A 4FF4A 4IG0B 4C8MA 2MKKA 3C2PA 4W92B 1IKVB 4H4OB 4NCGB 3SCJE 4CTAA 5GAEI 3MR5A 4Y2CA 4JI1F 1DTQB 3OHAA 1QVGR 2LKZA 1Y3JA 2O66A 1UMJA 3SFGA 4LVOP 3GG1A 2OAUA 3MDFA 3ZZRA 1LXNA 5K8PA 4KJIA 3K5NA 4P2SA 5JVGQ 4F4XA 3DLKB 3H2VE 2AJ4A 5KT7A 2PSZA 4KGKA 2ZE2B 2C3UA 5D4PA 2FGCA 4I7FA 3ZZPA 4QWAA 4FS1A 3QIPB 1ZETA 3L09A 1K0VA 3BQ0A 2HHUA 1GQEA 1NKEA 1HNWF 3M05A 1WF2A 2JLEA 4NLRA 1APSA 4A8SA 1OQ6A 4ED6A 3CC4S 3M1VB 2IVYA 2W7OA 3TAMA 4IO9Q 2LXUA 2MXYA 2QSWA 2DPJA 2JLGA 4RLEA 2PMZD 3HM9A 4HL9A 1UA0A 5KFFA 1NK9A 2RU3A 2UZAA 4FZVA 2UUTA 2QO3A 2E1MC 5M2RA 2KM8B 1LW0A 1FNMA 2LQ5A 3KLEB 5EWGA 5E7OB 3FSIA 1WF0A 3CPWR 1X0FA 4X66F 1N5QA 2FLPA 1S1VA 3X3UA 1QE1B 1SH0A 4TLQA 5E33A 1RT5A 3X1LB 2DISA 5C24B 1PSDA 1HBOB 2V8DA 3ISZA 5HO4A 3AHPA 1SL0A 5IFMA 3RB0A 1AW0A 2E5IA 1IKYB 2CPEA 4X84A 3I56S 3CCSS 3TI0A 2BANB 2YKOA 1ROFA 3KHRA 4RUCA 2JC1A 5AXNA 1RYSA 1O0PA 4NLQA 2ZJQQ 1NU4A 3CJ2A 4ID5B 4OX6A 1X8DA 1BQMA 4NYPA 1B7FA 4FNIA 1S1TB 4JI0F 3R1HA 1VC6A 2F3JA 5HI7A 3OVBA 1YQHA 1G3OA 1Y9OA 2FHOB 1RP5A 5FLXY 4FF1A 2IYIA 3AQPA 2QLWA 4KHMA 3KLEA 2DH8A 3TA2A 3T19A 3LP2A 2RF2A 4QQBA 5GAGU 4RUAA 1S0OA 3SFUA 5JUMA 1HI8A 1CG2A 2MZRA 4KFBA 3T1HF 1QSLA 4NL5A 2CQDA 4ILRA 1RTIB 1IQZA 4EYIB 2Q6BA 1YRTA 4NLPA 3MXHP 2XHWA 2DNZA 3GFYA 4ECRA 2HNZA 5HBMB 3MD3A 4CO5A 1LQ9A 1M5SA 3DRPA 3FZ2A 5CZVA 3N5FA 3POTB 2ZOGA 1TKZA 2IRXA 4DHVA 1D1UA 3ZC4A 4ECQA 3LP0A 5KFPA 2K3IA 2KZMA 4PG5A 2J9DA 4WYWA 3S8SA 4CCHA 4LVNP 5FDLA 4PG8A 2GGPB 4PG4A 2HYIB 1FJ7A 2MPUA 3MUVP 3BQ1A 2DNOA 1KFSA 1C1BB 2O01C 3OL6A 4RBTA 5KFXA 3T1YF 2NYIA 2RS8A 2FHJA 1U1QA 3LF0A 2SXLA 5F0UA 5IWAF 5L39A 2R2UA 1DHMA 2POKA 1GX6A 4HH1A 4JI2F 3KLIB 4DF4A 4LSLA 4JUZA 3MCSA 3NNHA 2HWIA 1FRHA 1S6UA 1KVIA 2D9OA 2XEXA 1JLFA 3AJ2A 5DG9A 2JVOA 2C3PA 1B0TA 3I0SA 4CO4A 1DTTA 4DQPA 2YKNB 5CYQB 4YB6A 1SQEA 2BJEA 5F8HA 4HHJA 3PW2A 3IAM9 1LV5A 4M1KA 3HJFA 2DGVA 2QT7A 1KD1T 3QGGA 3MMAB 5FDLB 2N4DA 4YB1P 1Q7YT 3N6LA 2FVSA 2DRAA 1JJHA 2MKHA 4WFZA 2KXNB 3ENQA 2BBEA 4K59A 3T5LA 4HEA9 3LAMA 4DR3F 2VBYA 2MQQA 4NLVA 3HK2A 1FA0A 4RW4A 3RBDA 3ZZUA 1S1WA 1TFWA 3HKZD 1N34F 5EHHA 4OHXA 4WYLA 3FDSA 4FF3A 4RW6A 1JXEA 3NP5A 5HLFB 2B7BB 2KJWA 3GB0A 4ECYA 1IKWB 3RW7A 3WDOA 2VPYB 4O23A 3OSNA 1P8GA 1QAJA 1KLMB 4R0EA 3MAHA 4NRUA 2RQCA 3H25A 4LF8F 2D1CA 3K5OA 1RT5B 3BR9A 4RZRA 3UWTA 2FIUA 2V9KA 2CQ2A 2PDAA 4HH0A 2RNEA 4OZ0A 1XWLA 2CRLA 3N28A 4MK9A 4XIUA 1GXUA 1FVSA 5GAGI 1YRXA 2RSQA 1X4HA 2GJ2A 3ICLA 5KFJA 1C0TB 5EX0A 3PR5B 3OLAA 2ZNYA 4FVCA 4DV6F 4IH5A 2JOQA 3OJSA 1WHVA 4IH7A 1F60B 1N88A 4B9MA 2COLA 4C8ZA 1JLFB 2CJAA 2PI5A 2DNLA 3ISND 3VAFA 4I64A 3V4IA 3GFHA 2J9CA 1VC5A 3IFEA 1N0UA 3GR0A 1TR0A 1JLAB 2XMTA 3UD3P 2OPRB 3OFGA 3VALA 2IRUA 1B0VA 2WOMB 3D0HE 3DOKB 3CMES 2YVSA 3HMJG 2V4JA 2IJNA 4KIAA 4P6QA 2E9TA 4C9DA 2MKCA 3KJVB 4M5DA 1T3NA 2LLZA 1TL1A 3B4DA 2VA2A 1CLFA 3DMJA 2AJ0A 2RD5C 4URSA 4JV1A 4X4UA 3AB4B 1UJ6A 1WI8A 1NJXA 3I0RB 3U1NA 2MQNA 3Q22A 1SUQA 1FKPB 3A1YG 3JB9k 5DQGA 5HLFA 2CDQA 1M5PC 1YRUA 2ZKUA 4KV8B 2M2BA 4DG1B 5JVHQ 4EBCA 2F8HA 5IT9Y 2CFXA 2ROPA 5LSOA 4TU8A 3TYTA 2XS7A 4LMZA 2ACYA 2I38A 2XG8A 3V6DB 2ZH5A 1M5OC 3CDAA 1GNKA 5C42A 3V6KA 2HNDB 5I3UA 2RJZA 2VFRA 1N56A 2HRYA 1TVRB 3Q8SB 3FFIB 4TY8A 2WW8A 1N4LA 3DOLB 1U7LA 4MH8A 1JLGA 2ZH8A 1HYSB 3MM7B 3T3FA 3PKMA 1FKOA 3PJXA 1TKTA 3UDCA 3JSMB 3KNGA 1UFLA 3TP2A 3LWLA 2FJBB 3OXFA 1IR0A 2GHWA 1S76D 3TW0A 1JK9B 4DV2F 4JI7F 2YX4A 4QWBA 4CO2A 1KEKA 3M6UA 3PW5A 2FVQA 2RH3A 3BF4A 2OPRA 1XR5A 3PW0A 1YJRA 4NZ7A 4IG3B 2X1BA 2B4OA 4DUYF 1NK7A 3T9ZA 2XCAA 3HPOA 4NA3A 3HHKA 2L9NA 2I2YA 4A8YA 3UW1A 2XZWA 3RRKA 5T14A 4XPCA 1SKWA 4DX8H 4R8UB 1S6QB 2EI5A 2R7UA 4OI3A 3M6WA 3DLEA 1JKHA 2VKRA 4USJC 2CPJA 5D4NA 5AE2A 2DK2A 2M4MA 2VH7A 5KFEA 3DN9A 4PQUB 1DLOB 2PA8D 1X9SA 3CCES 2ZDOA 2DHXA 2W9AA 3M2RA 4IUFA 3KK2A 4K4YA 2HMIA 4ECUA 2JL9A 1TQLA 1O5JA 1RT2A 3I0SB 3K0JA 2D74B 4PXCA 3GIMA 2L9WA 3D54A 4YDXA 5EDWA 4RW6B 4QIWD 2R9LA 3HHNB 3D1QA 3ENVA 5T7LA 3VTIA 3V4IB 1FRMA 1H7WA 4RX6A 2NUUG 2IMWP 2MY8A 1NK8A 2DR5A 1D9AA 1RT3A 2DGXA 4WFNQ 1ZOTA 4UUXA 5LT5A 5F8GA 3JYTB 1WTBA 3HHLD 1JXLA 3KKFA 3DRSA 1RA7A 2BACA 2EK6A 5IT4A 4OZJA 4OZ1A 1U1PA 2F8MA 3CVKA 4KB7A 3WC0A 2GCFA 4M5DB 4DV7F 2LQJA 3VAJA 4QPTA 1VQOS 2XNRA 2UVUA 2IM2A 4OHVA 3D28A 4ICLB 2RQMA 4A47A 1YITS 3GE9A 1MSWD 4CO0A 1QAXA 3QJPA 2FUG9 2R8GA 2R7VA 1D3WA 2CVIA 4PUOB 3IG1A 3NRBA 5GADU 1FCAA 1NH8A 3UDLA 2IVMA 2DCUB 4Q8FA 4YY3F 4I6WA 2NSBA 1JNRB 1XN9A 2GHPA 3I6PA 2D41A 1P1TA 1D9DA 4TLRA 3CF5Q 1FNOA 2XBPA 1L3TA 2HVIA 1XNQF 3IXQA 1RK8A 1UAWA 3D5MA 2KJVA 4R0JA 1VC0A 1NJWA 2KG1A 4I69A 4ZVGA 1D8YA 1SV5A 4DEZA 3CCZA 4F8RA 2ZZMA 4WE1B 3EGNA 4IR9A 4GC7A 2WCXA 1NK4A 2ZJPQ 1Z2ZA 2HHQA 3CCUS 5KFCA 4RU2A 5CZXA 2EWHA 4O3OA 4DR4F 1NHVA 4C0OC 3RRGA 1G6BA 3O8WA