2PGCA

Crystal structure of a a marine metagenome protein (jcvi_pep_1096685590403) from uncultured marine organism at 2.53 a resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
206
structure length
206
Chain Sequence
MSNINYVILTVASVDFSYRETMARLMSSYSKDLIDNAGAKGTRFGSIGTGDHAGSLIFIQFYDDLTGYQKALEIQSKSSVFKEIMDSGKANIYLRNISTSLPTKFEQSYEHPKYIVLTRAEAAMSDKDKFLNCINDTASCFKDNGALTLRFGNLLTGSNVGNYLLGVGYPSMEAIEKTYDELLAHSSYKELMTFAKVNMRNIIKIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein
publication title Crystal structure of uncharacterized protein (JCVI_PEP_1096685590403) from an environmental metagenome (unidentified marine microbe), Sorcerer II Global Ocean Sampling experiment at 2.53 A resolution
rcsb
source organism Uncultured marine organism
molecule tags Unknown function
total genus 53
structure length 206
sequence length 206
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2007-04-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2pgcA01
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2pgcA02
2OKQA 3BN7A 3HDSA 3TOQA 1YG0A 3KKFA 5B0CA 2RILA 4F67A 1FVQA 1P8GA 5B0AA 1WD6A 3HHLC 3WDOA 1AFIA 2OAUA 3LO3A 1MWYA 3BGUA 3QMQA 5B0DA 3K7RA 3E8OA 1Q53A 1TL4A 1FEEA 1QUPA 1N5VA 2OD6A 4YDXA 4HH1A 4A48A 1CPZA 5A6PA 2OFGX 2GFFA 5K9FA 5F0UA 1GXTA 2BJDA 3BM7A 2IFXA 2LDIA 3UDCA 1V3ZA 1JK9B 3TRGA 5KAKA 2XMVA 3IWLA 2RSQA 2VV5A 3TNVA 2KYZA 2LQ9A 2LXFA 2OFHX 3HHLB 1FESA 5B0EA 3CJKB 2GGPA 3HF5A 1OPZA 4A4JA 1P6TA 1OSDA 3VTIA 2QYCA 2FIUA 2K1RB 2BUNA 2EW9A 1IUJA 3KNGA 2ROGA 3BR8A 1MWZA 3FGVA 4Y2KA 2RU9A 2XMKA 2ZDPA 4FNHA 3FMBA 2XMMA 4HI1A 1FVSA 5B08A 1Q4RA 3KG1A 1VQSA 3F44A 4NPOA 2HFNA 2GO8A 2AJ0A 4A46A 2L3MA 3BB5A 3DCAA 2HIQA 2K2PA 2QLWA 1N5SA 5B09A 2BJEA 3MCSA 1AFJA 1Q8LA 1YJVA 2HLTA 1S6OA 4DL0C 2BYCA 4OIXA 1SI9A 2XMWA 2XMJA 1Y3KA 3BDEA 4ZA1A 4Y2MA 1Y3JA 4FNIA 3FRYA 4HL9A 2ASYA 2RMLA 4EFAC 2ROEA 1Y0HA 3LGMA 2KKHA 1YJTA 1KVJA 3DXSX 1FE4A 2W4CA 1FE0A 3BF4A 5T7LA 2KT2A 2XMTA 4DN9A 4YEAA 2GGPB 1K0VA 1W2IA 1X7VA 2IYIA 2AJ1A 2QIFA 4OJ1A 2G9OA 1LQ9A 1Q8BA 3HFKA 3HX9A 1JWWA 2N7YA 1S6UA 1CC7A 3I9ZA 1N5QA 2K7KA 4A47A 4Q2MA 1Y9OA 2ROPA 2GA7A 2QLXA 4DPOA 1TUVA 1KVIA 1SB6A 1YRXA 1APSA 1TL5A 3QGPA 2ACYA 5IXUA 1YJRA 2PD1A 3GZ7A 2AP6A 2HFOA 3HHLD 2GV1A 2IYGA 5A6WA 1X8DA 2OMOA 2AW0A 1YJUA 2VH7A 2W4PA 5F0WA 1OQ3A 1OQ6A 2K7JA 2XMUA 4OJHA 1AW0A 5B0BA 2CRLA 1FD8A 1VQYA 2FTRA 1N5TA 2HQIA 4U9RA 4Y2IA 2FHMA 5B0FA 3MZIA 4HH0A 3T9NA 1GXUA 2JDJA 4HI2A 1R6YA 1RJJA 1U7LA 1TR0A 1SQEA 1URRA 4OJGA 2HLUA 2ZDOA 1KQKA 2W4DA 4ZOSA 4QOTA 4Q2LA 1TZ0A 2GCFA 2BBEA 1CC8A 2KT3A 3HHLA 5B0GA 5T7LB 2N4DA 3CJKA 2Q3PA 4NL5A 1ULRA 3KG0A 2OP5A 1XBWA 1X0PA 2N4CA 4OJ3A 2LQBA 2PGCA 2K1RA 2OD4A 3LGNA 3IWXA 2FB0A
chains in the Genus database with same CATH superfamily
1S0OA 4FYXB 1KHWA 2D69A 4B3MJ 4QYZJ 3Q89A 1UJ6A 2JRSA 3P49B 2DGQA 3HMJG 5C5JA 1NB7A 3DLGB 3CJKB 2GGPA 3PEJA 3IXQA 3CCUS 2JEGA 2XG8A 3ZZUA 3KK1B 1Q7YT 4Y00A 4NLXA 1GMUA 1RT4B 1RT2B 1RTJB 1Y7PA 3ENQA 1EHWA 4CLKA 3N9UC 1RU1A 4Z2XA 1HR0J 3CCWA 3ADAC 4QQBA 2K7KA 2CVEA 2DIVA 3K89A 4PKDB 2HEKA 1CULB 4CLZA 1WC6A 2BANB 1B0VA 2D3O1 1O51A 3CF5Q 2J0WA 1R6VA 1LFWA 4E8UA 1JLGA 4NLTA 3C46A 4N76A 1YG0A 4KQZA 2IM3A 4C8NA 1YTYA 4CT8A 4CH0S 4EI2A 1BWEA 2LCWA 4TXSA 2YNHA 2D3ZA 1YBTA 3MMBA 1GK8A 3NKYA 2UUAJ 2J8AA 3DMJA 4EZ6A 2DNPA 2DHAA 5DG7A 1NSKL 2RDDA 2E9RX 2W9CB 2XWYA 4DX7A 4URGA 2QFJA 2G0JA 2ROGA 2HZVA 1IQTA 9RUBA 4F4KA 1HA1A 2J9DE 1DJ0A 1HARA 3CJ8A 1KKHA 2HSEB 4ED6A 2JLGA 1XMQF 2PT0A 2UXBF 1X5OA 2PFDA 3W64A 2I9SA 4IKAA 2Y1LB 3R8YA 3VVTA 2HVEA 1AZSB 1YGYA 5J2QB 1RT7A 2C22A 2AYEA 1VQ6S 3EJMA 5I42A 3LAKA 4LF6J 1VRQC 4J9PA 1Y5LB 3M8ZA 2DR7A 3EMTA 3CJ2A 4JI8J 2RD5C 2AD9A 1TZ0A 1ZBTA 3KK2B 1IBLJ 1QAXA 3DLEA 5H1SV 2C3MA 5J1EA 1YQHA 2V9WA 3LO3A 1W2BR 2XHCA 1FTCA 4W98A 2E5LF 1Z2LA 1S76D 4F02A 2DEIA 3LP2B 5HBMB 3M8QB 4DR5J 4LF9J 4ALZA 3VTIA 3CDWA 5A0YA 2JVRA 3IN5A 3C2PA 2QTWA 2V2KA 3Q8VA 4OZ2A 3MECB 1GMVA 1WTBA 3D0GE 2F1FA 4IOBA 2KKHA 2WSCC 2A2CA 3G87A 4HTIA 3GR1A 2BJ8A 3MFIA 3AA9A 3HSJA 2RF2B 2LXUA 2N82B 4Q2MA 4OX9F 4C48A 4DQRA 3IG1B 3G8QA 2KHDA 2K7JA 2VG7A 2R7UA 2Y3YA 2FJDB 3L3CA 2AIRB 4W92B 2LQBA 5K14A 4KO0B 4OQJA 5ETKA 1X4GA 3TUPA 5C25B 1PIEA 3JSMB 4DFJA 1G4CA 1F5AA 8ATCB 5DDPC 2F65A 1T0TV 1VBYA 3I32A 2G1DA 3V2UC 4ZPBA 1RBLA 1SBRA 2R7QA 5D4PA 3IRWP 2NR0A 1K8AT 3DLLQ 4H4MA 1K47A 1UW9A 5C24A 4I68A 5AE1A 4HI1A 3P5TL 1SIWB 3FCHA 5EWFA 4LF7F 2AJ2A 1JQGA 2J9DA 4L75A 3D2WA 4Y2MA 1ZH5A 1TUWA 4B3RF 3MMCA 1FE4A 4DN9A 4UY8T 1RTIB 3E01A 3H59A 2LEPA 5IXUA 4OZ3A 2YX1A 1WDTA 5F0WA 4DR7J 1S77D 4K4XA 3V6KA 2KXHA 2POKA 3JAMU 1Q81T 2MGZA 2ZDOA 1NJXA 3Q83A 5F9LA 3J7ZT 2DIUA 3M6XA 2DNLA 2XM3A 3E8OA 5HROB 4XK8C 2B5JB 4YUDA 3H5YA 4ED4A 1P1TA 2XMVA 3GFHA 4PXBA 2OFHX 2M3DA 1VQ5S 1FRLA 1OPZA 4OZJA 1O8BA 5IT9U 4ECQA 3OJSA 1Y10A 4ZITA 4ED3A 1TAUA 2VU5A 4PQAA 5GAEI 2FLPA 3DCAA 1NLKL 1AFJA 4OYXA 4ZCLA 4P2XA 5E3PA 2W7PA 4BC9A 4EZ9A 1HKAA 3MURP 3FRZA 1TFYA 1GFWB 1NK9A 3OFEA 3RW7A 4IRKA 1XIQA 1CC7A 3EVOA 2GJFA 4J9RA 4ECRA 3L09A 3L7PA 3ZXWA 4EEYA 5J2MA 1C2PA 2IYGA 4B9MA 3E51A 4FPIA 4YR3A 5K20B 1T9XA 5D0HA 2HQIA 3QJPA 3D5MA 2J6UA 2C2MB 2UUBJ 4OJGA 4YOEA 4ZVTB 3NNAA 3DLKB 1ZOTA 2V4QA 1S49A 3T19A 2IVFB 1X0PA 5IZHA 2CPIA 2XLIA 3SDEB 3T1YF 2F5GA 3BGUA 4UF4A 4NYPA 1ZA1B 1NKCA 3R5AA 1XTZA 4NI2A 3OFFA 3TWZA 1HNWJ 5MLCV 4LF5F 2CNNB 2NYHA 2DXDA 4B3SF 2KXNB 2O66A 2ZBIA 2O67A 2PO4A 4XDDA 2OTLS 4BBYA 4C6AA 1ZPWX 2AV5A 1WF0A 1BXNA 3FMBA 1TV6A 2A6MA 5IT0A 1U1KA 4NWBA 1Q78A 2OJ3A 2NZ4A 4IO9Q 2W9AA 4AQYJ 3GE9A 1SI9A 4ZS6A 5SUHA 3MWBA 1S0VA 5T7LA 3FSXA 3DM2A 5CQGA 3BO3A 3OVBA 3FFIA 3H90A 4C0BA 4WTYA 5KOXA 5J2PB 2E7WA 3DLJA 1DARA 3M6UA 1KLMA 3C6TB 5A6WA 4OHWA 1M5KC 4CWBA 2QX0A 2HK3A 1NKBA 4CRJA 2VIHA 3G4SS 2N4DA 1VQMS 1S5ZA 5F9NA 1B0TA 3TANA 2VKZG 3HULA 3EGVA 4USJC 3TQ1A 1S72S 1FJGF 2ZOMA 4QR0A 1RCXB 1L5UA 2OD6A 1V5IB 1RADB 2JX2A 2KRBA 3R6LB 3BSAA 1R8HA 4L76A 3PCOB 2V2QA 2WW8A 4FNHA 4EK2A 4ECVA 4LSNB 2DH8A 5D3GB 4USTA 3EZUA 1RTDB 2GNKA 2QO3A 3SV3A 4FP9A 2BXJA 4NOHA 6FD1A 1S12A 4DQPA 4ED8A 3NGUA 1U1NA 2CDRB 2M9KA 4I2PA 1S6PA 4HDGA 1V9OA 2GQCA 4NLUA 2GVZB 1NBEB 4DU7A 3HD2A 4XPCA 3M6WA 3W3SA 1SPBP 3LPYA 3FSIA 3JB9k 1B7FA 1VHFA 4J9KA 2VBZA 1RWOB 3GV8B 2IY5B 1PCAA 3DI6A 1LW0A 2CJQA 4B08A 1TP7A 1S1UA 4DR1J 3HPOA 2GJ2A 2JL9A 4K7QA 3JYTB 1WC0A 1XMOJ 3BGFA 1RTHA 4F3MA 3Q2TC 3UR0A 5KFIA 4WP9A 2CPZA 3MD1A 2UXCF 3BDPA 2GAGC 2RQCA 1Q4RA 3FUYA 2ALZA 3CCLS 5HJXA 2QA4G 2BJEA 3AB4B 4PUOA 4ZVUB 1KOOA 2E5GA 4FYWB 1VGYA 6FDRA 5KFXA 3C66A 1KNZA 2MYFA 1EARA 1YRXA 4GKJF 3CGIA 2L08A 3GIIA 2DISA 5E3QA 4GRSA 2Z8QA 4HT7A 4LRDA 4B9SA 3NG8A 3DFEA 1WTFA 1FO1A 2UUWA 1HMVA 3J80U 4LFAJ 3DDNA 3PV8A 4LF4F 4RUBA 3QATA 4DDFA 5E5NA 2J5AA 4L74A 3SI8A 1FRKA 2CG8A 4CYUA 4BWJA 1PILA 5HLFB 4LF1A 3UCUP 2FVQA 3MM6A 1S4FA 3PW2A 2LQ8A 1VLOA 2W7OA 2VOPA 4QU7A 4CT9A 1S6OA 1KVKA 5CHCB 3LOUA 2ZVIA 2FJBB 5F8MA 2RHSB 4JV5J 2HVHA 2J0XA 1D3WA 1FFSB 4ILRA 1K1QA 5IV4A 2JFKA 2VC1A 4ZN3A 4LF2A 3DYAA 4DCJB 3EZOA 3H2VE 5DLFA 3US5A 2KZMA 2VG6B 2W7AA 1T94A 5B0GA 3CJ3A 2OI2A 2J7KA 3D1QA 5KT2A 1XBWA 3PR5B 3FVYA 2RQMA 4DX5A 1WOOA 4FXDA 2IRUA 4OX7A 1VQPS 1N6QB 4NYOA 4CO0A 3BYRA 3MEEB 1VQ9S 1DRZA 3TI0A 1UVMA 2DGSA 3KJQB 1U1PA 5K8PA 2V5HG 3IFEA 4DOZA 4DFPA 1U45A 5E41A 1TVRB 5F8LA 1CQMA 1UVIA 4NE9C 3KJVB 2CQ3A 4JI2J 5EWGA 4ILLA 2PEBA 3WC2A 1T9TA 1U6FA 3BR9A 3EGZA 5BYRA 2YNFB 2G9OA 2F3JA 1SL2A 4WFZA 2OPPA 4C8OA 1FDBA 4C8ZA 2AMCB 2ZJPQ 2ZC3A 3ILOA 1IBCB 4F50A 3L9ZA 4M5MA 4J9QA 4CH1A 2DH7A 1EP4A 1SL1A 4WFNQ 2V4RA 1HBMA 1BE4A 2F9JA 2LYVA 1XWLA 2I1RA 3A8EA 3PX6A 4O0IA 3A12A 3TARA 1CVJA 5KFMA 1QUPA 2BA9A 3HFZB 2VFVA 5FDLB 3A1YG 1QE1A 2UUAF 4C2MA 4X84A 5GAEU 3AQPA 3OL6A 2VF3A 1FWPA 1FERA 2MKYA 3QJLA 2UU9J 1WJ9A 4WK1A 1KOHA 2XB2D 1RYSA 4C7QA 3I0SA 3MM8B 1P9YA 2FGOA 2W8LA 1F2GA 1JLQA 1JWWA 2FZCB 3M05A 3JTPA 2ZBCA 1S9GA 1N34J 4U96A 5KG5A 4DN0A 4LF6F 3UDLA 4USIA 1YI2S 2MQQA 1R8CA 4HR2A 4ZLLA 4HHUA 4Y6IA 2RS8A 1VR6A 4JI8F 4TY8A 1N5YA 4DSJA 4AXIA 1I94J 1M90T 1IBLF 1WHWA 2NYIA 3MCMA 4DR2J 4ID8A 3PM9A 1NDCA 2DR9A 3NBPB 1HHQA 4USVA 3OXLA 2MKJA 1RAEB 4C3MA 4NCGB 4YY3F 1GMWD 1ITPA 3QLHB 3VAJA 5A8KB 1T9WA 2A0FB 2HAFA 3B6BA 2QYCA 4DR5F 4LF9F 2IM1A 5KFWA 2ILYA 4LRBA 4WKRA 4BCAA 1NEEA 1NB2A 3FRYA 3KDOA 3MI7X 2HNDA 1PC4A 2C1EB 3CJSA 4IFVB 1D0EA 2KFYA 2WVDA 2KG0A 3KHRA 4FBTA 4CIOA 3MM9B 2FLLA 4JI1J 2C42A 2DGUA 2QGFB 5DQIA 2HWIA 4X4PA 1GNKA 2A2DA 4CCHA 5KFPA 1SQEA 2V9KA 4V1Ak 5JUMA 5LMNJ 3MD3A 3KTQA 1R27B 4N8NA 3DU5A 4CO1A 3LP0B 2XGPA 2DR6A 1OWXA 5M2RA 2E1PA 3T41A 1JJ2R 3LF0A 1UZDA 4L72B 4K4ZA 1FEEA 3QO9B 4HH1A 2XSJB 3D0IE 1UW4A 1H74A 4PG5A 5U47A 3HHLB 1AYEA 3VR1A 4NMLA 3DKDA 1IWGA 4IQXA 1C0UA 2EG1A 1NSPA 1EAYC 2HNYA 2CNLB 5FJ4A 5G4DA 2C3PA 2X3DA 2AX1A 4MIWA 4RUAA 1N88A 2C3YA 1FJEB 3RYLA 3ULHA 2A3JA 3TQEA 4C3LA 1VRUB 2P5VA 3C16B 5GADI 3DC2A 3WC0A 2MMYA 5KFBA 4F3OA 1NJYA 3H42A 3LP1A 1YJ7A 4QU6A 3PX4A 3M32B 3D0HE 4OJHA 5EN1A 3GG0A 2OPSA 3O44A 1CBKA 1DHMA 1PYTA 2CG4A 4ZK7M 3L95X 3GONA 2LVWA 1AT1B 1S1TB 3W9IA 5IOLA 4M95A 3EVMA 2JLEA 1VS3A 1VRTA 4OYIA 4RNHA 1VBXA 1UA1A 2UXDJ 4PPZA 7FDRA 1U0SA 5G0RB 2KL8A 4ITSA 3ZZRA 4C0OC 1PC5A 4WIQA 1BUXA 3HSDA 3OQ2A 5CD4A 2WAQD 5A8WA 1KD1T 3TNVA 2ZBPA 2MXYA 3SQGB 2MZ1A 1LWCA 1RAGB 3BBFA 3EXCX 1IM6A 1KLNA 2L48A 1I1GA 2GVDA 3DOMA 3IWNC 1WDDA 1RB0A 1N36J 3KK3A 3T3FA 2R8JA 2K2PA 1OYEA 5HAOA 2ZOFA 3K2YA 3MAAB 3FBFA 2CUYA 2KT2A 2QV6A 4ICLA 3B82A 4ER8A 3DOKB 4PWUA 4UUWA 2FC9A 2HHQA 4NASA 2W2PP 2DCUB 1VI7A 3KOAA 1VQKS 1RA6A 1UZHA 1AUSL 3CEDA 4K4SA 4K2JA 2R2SA 3VAIA 1WG1A 4V19X 2ZUAA 1LNQA 4RW6A 1WC5A 3EICA 1C0TB 4KT0C 1TL3B 1SUQA 1PAEX 1G7CB 3QRQA 3CSKA 4DR6F 4YN3B 4YFUA 3PYEA 3G6VA 4DF8A 5EX0A 5KG6A 4USKA 2YX4A 4QIFA 1T03B 4DSKA 5DETA 3D28A 2BE2B 4WYWA 3SMZA 2MHNA 4ZVOB 3U1LA 3JAMY 1FK9B 2DNYA 2RH3A 4GVBA 3FSYA 1UWBA 1ZPVA 1VQ4S 1MU2A 1JLFA 3KNGA 4CLFA 3HSZA 1SJQA 2RS2A 2EVZA 3QFWA 2B4VA 5I3UB 3W9JA 3VHQA 1RHUB 3BN4A 2HBQB 1UFLA 4KY3A 1T3NA 3FCWA 4NCAA 3FZBA 5D8HB 2BRLA 3H4BA 4AT1B 5IT9Y 1UAWA 5J1PA 5L46A 3GIKA 5DZ6A 1ZA2B 4BC7A 1RWNB 4M5NA 2VG5A 3UD5A 1YVFA 5DQHA 4B3OB 4PYAA 2PIIA 1N54B 2XLKA 3MEKA 2QSWA 3BGRA 1HQ2A 4ZPVR 4BWMA 5JVGQ 4N56A 2ADBA 1XNQJ 3KKFA 3HHLC 2OUGA 1U8SA 3UNGC 3CDBA 4KV8B 5HP1A 1HNVA 1RAOA 3DRPA 4ZPWR 2DD8S 2KYZA 2V67A 1JKHA 1ZAWA 1C1CB 2GX8A 3NAHA 2K06A 3OR1B 1VJWA 4H4KC 1QAIA 5GAGU 4I64A 1EX8A 1YZ6A 5JVHQ 4KFBA 3RBEA 3CDUA 1S6QA 1BQNB 1IBKJ 4EUVA 3HHEA 2FY1A 2YWKA 4JI4F 2CQBA 4YDDB 2YVSA 3NS7B 1F2HA 1F6TA 1HIYA 4R0EA 1SC6A 1SVDA 4M5LA 4WZQA 4ZKAA 1S10A 3IWXA 2G13A 4USWA 4JI5F 5KT6A 1AA1B 5HQMA 2EKYA 3F41A 3QIPA 3VV2B 4LIRA 2HRTA 2DNZA 1UPPA 3RG6A 1X5PA 3VF0B 1N33J 3RAQA 2VPYB 3KNAA 2ZHBA 3EPIA 2ZE2B 3TR5A 2H5IB 1ELOA 2HWHA 4ZCIA 3W2WA 1FCAA 1EETB 4YR0A 1NHUA 4OIXA 1AB8A 3BDEA 4Q7AA 2OPRB 2Q6BA 2J76E 4HHHA 2HHWA 1JX4A 5EGYA 2YNIB 1RTZA 4RJVA 4U9RA 2ZH5A 5F8HA 1N4LA 3H5UA 5ETMA 1WNEA 2J6SA 2VJVA 4C0HA 2YQ0A 4BLGA 1WC4A 2DRBA 4PWWA 4DV6J 3POTB 4LFAF 4IH7A 1TK0A 4QYRA 2CYYA 3DGVA 4N77A 3SIPB 3EXYA 3T5JA 4AXJA 1R0BG 2P9GA 3BM7A 5A8RB 4X4VA 1QUVA 2V50A 2PE8A 1OY6A 1QVFR 2R2RA 2VQEF 1XQIA 3CJQA 4NA1A 2HLTA 1T95A 5GVQA 3W66A 2IJRA 2YKMA 2LEAA 2VDHA 2Z4PA 2GGPB 1NK5A 1FFWB 1YDLA 3N6LA 3UWTA 3Q24A 3CDAA 3PKYA 4U95A 4ZVPB 3MPYA 2MDAA 4DL7A 3GSIA 5GMKa 1HYSA 4C4WA 2XNRA 3OTOF 1TR0A 3CCRS 4RBTA 2OEKA 1KHVA 4NLWA 2W24A 2YTCA 3KG0A 5LM7E 3D6HB 2AEFA 2WSEC 4F25A 4DZDA 2RDJA 1C4CA 2HBRB 3EX7B 3KFWX 1KBRA 3MPWA 4GKKF 4XDCA 2MQOA 3LH2S 1FXRA 2HPUA 4F2RA 2C2OB 3R1HA 1RACB 4HKQA 5HQ8A 1JLGB 1XC9A 4DZ6A 3LW5C 3PNIA 2ZH2A 3A13A 3KG1A 3QIDA 1NCLA 2KM8B 1PJ5A 1YRUA 2E7VA 2YNHB 3MMBB 5CA5A 1GX6A 3DMJB 2PEHA 4R5PA 3MTKA 4JI2F 2E5HA 1X4CA 3UVJA 5DG9A 3LALA 3Q8PB 2MKHA 4ILMA 5HANA 1QSYA 2F4FA 2BDPA 3HHLD 1FNXH 2H1YA 2OMOA 1WKJA 3PW4A 3T9NA 1D9AA 1U24A 4MKVA 1HNXF 2HHSA 4NXNJ 5DO2A 1HWUA 1RT7B 4U8VA 1SXLA 1LWFA 3ICLA 5I42B 4WBFA 1RAIB 2V94A 4EU0A 3C3LA 2RIJA 4NEYA 4ZVEA 1CQNA 1S9EA 3DLEB 4ZVRB 5I3QA 2E9TA 5J1EB 2VQFF 3NCPA 1U49A 2O3DA 3IBCB 2BQRA 2DGOA 2FLNA 4OYBA 1U1OA 2RHQB 2H51B 5K5MA 1X9SA 1HWLA 2MKKA 4AE5A 5A0YB 2EXUA 5C2CA 2ASDA 1EZZB 1Z4UA 1IR2A 1BY9A 3E3XA 2B6AA 1VJQA 3VAKA 1QSLA 1HWJA 2V2ZA 5DQGA 3ZTPA 4DX8H 6AT1B 4ID5A 3QFHA 2I5JA 3QRRA 1FKAF 1AXQA 4K4UA 2IHR1 1MMLA 4K4YA 2BABA 1I94F 1FVQA 3G8SA 3RJMB 2KH9A 3CC2S 2CZ4A 1KR4A 1HI8A 5IM0A 3J7AN 2VG7B 1KSPA 5KG0A 2WB1D 3T1HJ 3KMQA 4ZPCA 2D7SA 3IWLA 2LQ9A 4MYUA 4R8UA 4K4VA 1SQGA 1L3TA 2YKNA 2VB6A 1RHJB 5AE2A 5K14B 3HHDA 1E6YA 2LP4A 5D78A 2FJWA 1C1BB 3SSRA 3GFYA 2F7VA 1NK4A 2VBXA 4CO5A 4TU7A 2FPHX 1T7PA 4DWIA 4KC5A 1XMBA 2CPXA 2BE7D 4H4MB 2IYIA 2MKIA 5C24B 4RU2A 3AD9C 3KYLA 1T3OA 4F0KA 4DV7J 4MK8A 3SYZA 1NJZA 4M1KA 1R31A 3M8YA 2LQJA 4LMZA 1CEZA 1RJJA 2WOMA 2IDEA 3MMCB 3TYTA 2EG2A 1SJ3P 3EYZA 5LMNF 2HVIA 5KT5A 3C14A 3FJ2A 3E01B 3SCLE 4NLVA 4PRFA 2HS0A 2RQKA 2V8VA 2VC0A 4OYAA 1ZM2A 1F60B 2YNGB 1H2TZ 3D3BJ 3M8SA 4Y65A 2GAHC 1JLAA 2LDIA 3UN3A 2KM8C 2MGZB 2QG9B 2IA0A 4IH5A 1IKVA 4PXCA 4ED7A 1IUJA 2W9BA 3CUNA 1B7YB 1PG5B 1W26A 1JNZB 1FD2A 3TZXA 3GLJA 3MR3A 2FVRA 4KHMA 4AFFA 2H3EB 2JHEA 3RGIA 3RW6A 2LU1A 1IVZA 4CTAA 3TVKA 1UWAA 3BSNA 4MH8A 2X3GA 3A4TA 8RUCA 1UKUA 1JJCB 5KOWA 1DTQA 4NLGA 5KG4A 2RB7A 1PAUB 4LR7A 2BVZA 3NWRA 4ZVFA 1KTQA 1RT6A 4C9DA 5DDOC 2DR8A 2IMOA 3NGSA 1RQ0A 2QMXA 2CFXA 4ZMMA 3CULA 1R8BA 1RWMB 4IFYA 4F67A 1UA0A 4USMA 2OH2A 5AXKA 1KDNA 5C42A 2MQMA 5J2MB 4KSEB 4UY85 5GMDA 5KG7A 1RISA 1U26A 2AJ4A 3CMES 2RSQA 3C15A 1NZAA 5L1JA 1J27A 3LUYA 3GQCA 1MWQA 3PTWA 1ZETA 2B8QA 1X4HA 2DO4A 2JH3A 3BBCA 4EBEA 3MOJB 4Y28C 4JV2A 2VKRA 1Y3KA 3KG4A 2D41A 3J7Z5 1HL6A 3IR6B 2QE5A 2G0CA 2GIRA 3WIVA 4OYOA 1TV6B 1IWAA 3QGPA 4F4YA 5GAHI 1Q1KA 5L1IA 4DV0F 1CS4A 4N5SA 1S4EA 5IC4B 2HK2A 2HZCA 1Q0NA 1UVLA 3V4IA 5T7LB 3DM2B 4NZ0A 4JV0A 1N48A 3FFIB 4ES2A 2J8SA 1QAYA 2XZTB 4NYZA 3DRRA 3RZAA 4RKUC 5LSRA 5B0AA 4DL4A 1Q5VA 1KLMB 1KONA 4KGMA 4A8SA 1V3RA 1WHXA 2EFGA 1FKPA 2IDLA 3EGWB 1IBMF 3N01A 5T41A 2WVCA 1RT5A 5HJYA 4NZ7A 5ETRA 3CO0P 3P4UB 3V81A 3T5HA 3DOLA 5AJ3J 2M88A 3EDRB 4MMOA 1U02A 1TQLA 3BEGB 4JP8A 4KHPJ 5KG2A 4MKBA 3H4DA 1BQMA 4ZJQA 2KO1A 2HHTA 4WK3A 3VVUA 4FS1A 1ICEB 2GHWA 1J5OA 1KRPA 1SKRA 4KRWA 5A76A 3NGTA 1BGXT 3KXDA 3GR0A 4QZVB 1K9MT 2HHXA 2ZH6A 2I8EA 1QSSA 4I2PB 3DN9A 1S6PB 4WU3A 1M0SA 3BN7A 1XNRJ 1XNQF 1OPIA 3CCTA 2OAUA 2QN6B 3P6YC 1TL7A 2O5DA 3K17A 1NZ8A 3DRYA 2E44A 2BJDA 2IBOA 3U1MA 3QGHA 2Q79A 3I5BA 4EBCA 1FHTA 1HHSA 1RZMA 1FESA 1TK5A 4Z7CA 1P6TA 3BYPA 1FNMA 3K8VA 1ZAVA 3DI6B 1S1VA 1LW0B 4KB7A 2EFVA 2HIQA 3NAIA 3TVYA 2OMLA 1RLDA 2VA2A 1S1UB 4H54A 2M5YA 1UTAA 3ET6A 2R8KA 1C4AA 2BW7A 3OLAA 3DXSX 4NLQA 1IBKF 3NRBA 1RTHB 3NXZA 1U6ZA 2QMWA 2HQDA 3M1VA 4USHA 3BBBA 2G2YA 2D1CA 2AW0A 2FY8A 4O23A 2D9OA 1DQAA 3IO1A 1UVJA 3MF5A 1SJRA 3CWJA 5KT4A 2OP5A 5HMYA 5F8IA 4JI3J 1REVA 2QL9B 3ELHA 3W62A 3TJ9A 2MSTA 1VMBA 2Y0BB 1VISA 4WE1A 1NXIA 2RQ4A 3V6DB 2WSFC 2IM0A 2HKEA 4NX9A 5F41A 1N32J 1HD1A 4F4ZA 2FJXA 2NLWA 5ITHA 2R2UA 1TMJA 2P9EA 2CQ2A 2DHHA 1N33F 1QTMA 3CCMS 1XN9A 3DRXA 4DV5J 1HMVB 2UUCF 1D09B 1H2VZ 3GPAA 1YLXA 4ZP6A 1U48A 4CYUB 1RDRA 3FNNA 4I0WA 2PMHA 3M30A 3FQLA 2P9CA 3ZZ0A 1HQEA 1FE0A 3MM6B 4X65J 3D1HA 3M9MB 5F8NA 2DCLA 1DQ8A 5AXLA 1JNRB 4KR0B 4EGLA 2FJVA 4P75A 3Q2SC 1HQUA 4OHYA 1YK9A 4J9SA 1T05A 5D15A 4KGVB 4A8FA 3FDSA 4DPYA 2DTJA 2NSBA 3VGSA 3WIUA 1TUGB 2CZ9A 1SKSA 2XGQA 2V0NA 4S0MA 4HEA9 3U27A 1AFIA 3DYAB 4DV6F 1UVKA 2OGUA 5T14A 3I87A 1KQGB 3T9ZA 4ELTA 2AJQA 2R7TA 2ERRA 4I2QA 4LSLB 2GC8A 1N0VC 4Q8EA 3CD5A 2DBBA 4TLRA 3FBEA 2YQ3A 5B09A 4ZLPA 4WF9Q 4QWBA 5KFDA 3IGVA 2Q43A 4DG1A 2DNQA 3I9V9 4IQMA 2CQGA 3W65A 1Y9OA 1NK6A 3GYNA 4PEOA 5HMZA 1I6JA 3PHTA 1X5SA 2CPEA 1XERA 3LQVA 4IG3A 3PYFA 4LBPA 4DUYJ 2YPYA 2FHJA 5HVFA 2CPFA 4R25A 2D9PA 1RXOB 2UUTA 2RUSA 3IRXA 3RUBL 1RI7A 1JLBA 1FTRA 4OHXA 4Q8FA 3R7NB 4O3NA 1G2EA 3OSPA 4N8OA 5ETSA 2Z2MA 3ZNJ1 2G4BA 1EP4B 2ILZA 5DGBA 4G65A 3CCZA 4FF2A 1HBMB 1YJNS 2Z2LA 2J9EA 4F4AA 1MG7A 4LRCA 3C8YA 1JXEA 4TLQA 4IR1A 3NOGA 1QVGR 2QLFB 4WU2A 2Z56B 3LAMA 5EHHA 2XI3A 4A8KA 4MJKA 1QE1B 4Y34A 3ZO7A 4QR1A 2R7SA 4QCLA 3K5OA 2F8EX 5C2GA 3BSCA 5E3AA 3W2VA 1WI6A 3VZHA 2JEFA 4ZLNA 3P3DA 4DUZJ 3J7YI 3PJWA 4JI0J 3JQMA 4O3PA 4OZ5A 5CCLA 4G1PA 1FJ7A 4RW4A 2QL7B 1OQ6A 3W5ZA 4UTGA 2AGPA 3CNQP 1ZAXA 3I0SB 2NPIA 2YH0A 4D3GA 2FJAB 2GQ2A 3LTOA 4OMFG 3W1YC 1JLQB 1RT1A 2NUHA 2LMIA 1RAJA 5L9NA 1S9GB 2APOA 1EB0A 3KLFA 4X64J 3W5XA 4CM0A 2F9DA 1H0HB 1Q53A 1G3OA 1XJWB 4A48A 4WFBQ 4NZ6A 3KUEA 3D6MB 4IG0A 2AQ4A 4TY8B 3BO2A 1N5YB 4OZLA 1MWZA 4ECUA 1FDAA 3TP2A 1QY7A 3HJVA 2O1PA 2R7OA 3GG1A 4IOAQ 3M6VA 4GMKA 4ES1A 4P6QA 2E29A 2ZHAA 2OTJS 1Z2ZA 5CCMA 1CJKA 2ASYA 3NNHA 2ADCA 1F3FA 2I6WA 2OPQA 4M5KA 4KGXB 2GZOA 1KVIA 4IOCQ 2QA4S 2DNRA 3QZ8A 3VAGA 1Q16B 2VBWA 1ZM4A 2YY3A 4Q0BA 2FHOB 2AP6A 3D6TB 2M7SA 3WBZA 1DTTA 1A0OB 4XAKA 1UEUA 3PIPQ 3PRBA 4HI2A 4ANEA 2HG4A 3GYXB 2DVIA 2ZD1A 4ZOSA 5DDRC 2GCFA 2HNDB 4K4TA 3VAFA 3GWCA 1SC3B 4OJ3A 2IBKA 4RNMA 5CABA 2CAJA 3MUTP 3CE8A 1RHKB 3TO8A 2A18A 2DH9A 1OSCA 3TA0A 1T9VA 2R8IA 3WX4A 3T1HF 1K0TA 1RKJA 3JQJA 1OSDA 2BQUA 1LWXA 1SC4B 2AWZA 4MT1A 1U0HA 4DCPB 3FZ2A 3W8PA 2QEXS 1D8ZA 2VPXB 1N5SA 2LLZA 1WEYA 1YJVA 4DL0C 4RW8A 3AJ1A 1Y3JA 3M9NB 3W60A 5RUBA 3BF4A 2IMWP 1K0VA 4Y3CA 3GJQB 2OEMA 1WELA 1Q8IA 4NCBA 4DXLA 1C0UB 3HO1A 2XYPB 4DV7F 4ED5A 2HNYB 2H5EA 5IWAJ 1XR7A 3TAQA 3KHLA 1ZYQA 3PXGa 1K73T 2J7UA 3PY8A 1BWVA 1RT3B 2V8GA 1BD6A 2NREA 4MIAA 1BHNA 5EUHA 4MK7A 1D1UA 2JVOA 2HS3A 1L3UA 3LP1B 1WSVA 5E3CA 5CYMA 3W63A 5JMNA 3B78A 2EC0A 3CXCR 2OPSB 2HBZB 3O5TB 3HT0A 4NEZA 2X51A 2XBPA 5B0EA 4Q44A 1VRTB 3QBCA 4YB5A 3QSYB 1F0XA 4GO5X 1SL0A 4TYAA 3T1AA 1M1GA 2GQQA 2PC6A 2LQ5A 1TK8A 2DXFA 3THTA 1U2FA 1M1KT 5A8WB 3SZ2A 1RBAA 3U1NA 3F56A 4URQU 2N3OA 2ACMA 3UQSA 1LWCB 3UPFA 1UL3A 4QIGA 2GVDB 3DOMB 1HI1A 2FDNA 1MN9A 2MTLA 4AD6A 3I0RA 3UFCX 5ETOA 4WTOB 3TZZA 1SKWA 3KK3B 4ETXA 2CNKB 3KDNA 3W5YA 1OQ3A 1WHVA 5HL7Q 2MLXA 1WG5A 4CO2A 2J7WA 1F3VA 1KQKA 2XZDB 2IA6A 2W2QP 4WP3A 1CC8A 4ICLB 2A1BA 2EPIA 1I3OB 1DURA 4ELUA 3FBCA 2YQ1A 1S7HA 3ENWA 3OUYA 3WX8A 3HZEA 2CKWA 4RW6B 3TUIC 4UQGA 4XPEA 1SUQB 1NDLA 4OI6A 1KN6A 1VC5A 1HFEL 2OIHA 1VQOS 1R3NA 3H7HB 9ATCB 3CMQA 2AZ3A 4MFBA 4J7CA 4GVBB 2W4CA 1KTVA 2DITA 2C28A 2BX6A 1MU2B 4P52A 2MJUA 1JLFB 4KIAA 4O3QA 3HX9A 1NO8A 1N5QA 2CQCA 2DR5A 1TL5A 4LSZB 4ELVA 3HVWA 1N8RT 4B9NA 3JSBA 4ZP8A 2RKIB 4OI2A 1LEOA 2AT1B 1I51B 3T5KA 2XMAA 3R3TA 1BQXA 1NH8A 4I56A 3PW5A 3Q22A 3OL8A 3AQOA 2RILA 1SV5A 4OZ0A 4JB8B 3J81j 1OS5A 2Q1LA 1S0MA 3OW2R 2ZNYA 3HCXA 2VG5B 5DM7Q 1QTNB 3RBZA 1IN0A 3EM1A 4URSA 1YJ9S 4ECWA 2B3TB 1OIAA 2XNQA 5D0GA 2C2ZB 4QIVA 3KHHA 3BGRB 3M2VA 1NNDA 3QZ7A 3MHYA 2AYGA 1FVSA 2WRMA 3FMWA 3BO4A 5HP1B 5AJ3F 1HNVB 3ZNUA 3DRPB 2R42A 3X3UA 4RLEA 4YEAA 1VRUA 5KFGA 1JKHB 1JJ4A 2ROPA 2R3VA 2CQIA 1R0AA 1TKXA 3ZZZA 4ENOA 4KFBB 1S6QB 4O44A 3QT6A 1JXVA 3MR7A 2MQ8A 2BJ7A 3O1LA 3PX0A 2HQCA 1KC8T 3M8RA 2F40A 1QAJA 2WTFA 3T1YJ 3R97A 4KHRA 2HAIA 2DT9A 2HGMA 1LV5A 5LOQA 4LF5J 4HTJA 3QIPB 3L7OA 3AOCA 2WONA 2JEIA 4E2FB 3J7YU 3ITHA 4I7FA 4GC6A 4X66J 4L3NA 3O6QA 4E0DA 4F0MA 2NXCA 3MMAA 4F8RA 2QIFA 3THVA 4ZHRA 1S6UA 4EMDA 4GVLA 2A10A 2LDYA 5ETPA 2E1AA 3W2WB 2DNOA 2MLZA 1TL3A 3Q8YA 1JB0C 1R43A 1SJ4P 4UZCA 4FN5A 2IRYA 2FYXA 1HWKA 3MUMP 4XIUA 4QIWD 5B0CA 1P8GA 4JI3F 4PYDA 1B0PA 1HPZA 2MPUA 1CSJA 3GV7B 1GH8A 4DV3J 1DY3A 2NXJA 4OYPA 1IKXA 3N4WA 1FJGJ 4DR4F 1NAQA 2X1FA 4G1QA 1TU0B 4DV5F 2CJXB 3GJRB 4DLGA 5ETVA 3MCOA 3TEGA 4DX6A 5J2NA 2IAJA 4PR6A 1RWKB 4JI7J 3ZZOA 2BM1A 4X65F 3K57A 2Z57B 1NPPA 3R5JB 1PO6A 3HVAA 3MR6A 1TKZA 1Y5IB 3D54A 4RO0A 5LSOA 1NM2A 2VODA 2GMLA 4ETZA 5D0EA 1V3SA 1ZM9A 3KUHA 2VZ9A 2L41A 2XI2A 3HP6A 1HW9A 3AH6A 1S79A 5KFVA 4DPUA 2OO4A 5IT4A 1LOUA 4EYIB 3QYYA 4B9UA 1HYSB 2DGWA 3PFEA 2ZEJA 4P2SA 4JI6J 2RJZA 4P73A 3A8IA 4ANCA 2EI5A 1XR5A 1LW2A 5F8JA 5F8GA 4P7VA 3RRGA 2KVIA 3OLBA 1ZM3A 4A46A 1HNIA 1PYSB 1U1QA 2FVSA 2NPFA 2HFUA 2ROEA 2I38A 3I56S 2DNHA 2AKWB 2UXCJ 3MM5A 1CLFA 4TQRA 1UFWA 1H98A 3MDFA 5AXMA 4PG7A 3V5RA 2XS2A 2DHGA 4Y2CA 3ISZA 2HBYB 1NDPA 1X4BA 2W4PA 4B3MF 4R5PB 1TTHB 4X4TA 4WYLA 4DV4J 3QT7A 4QIEA 5LXRA 5H9FK 3UVJB 5IFMA 3DDIA 2VUGA 3EE3A 2AEMA 3ETOA 2G1HA 4KKOA 5DG8A 1DAXA 2FQQB 4PPDA 4UOHA 2G2OA 3OFGA 5A6PA 2O01C 3R7SB 4MIBA 3CCES 1IM4A 2RRNA 2XS7A 1M5HA 3HVTA 3RR7A 5H9EK 1FKOA 1RWPB 1HR0F 5IS2A 3AOBA 1GQEA 2H54B 1UJ4A 5BYSA 4X4OA 3RRKA 5B08A 1H7WA 3L4BC 4RBVA 3PHEA 1LWFB 2C2KB 3G82A 3B4MA 4FDFA 2GS8A 4ATNA 3UDVA 2VONA 1S9EB 3KLHA 3MAHA 5CH7B 2DY9A 4DUZF 3HJFA 1LXJA 1VOMA 4J9LA 3OHAA 3DGPA 1LK7A 1SJFA 5HN0A 2IJFA 2HIYA 5BR8J 2KB2A 4YB1P 2QLBB 2KI2A 4DFKA 5DZ7A 3GTYX 4WKYA 5LSLA 3OR2A 5KT7A 4C11A 2AYBA 4LF8J 1FNOA 2B6AB 2KHCA 1M5PC 3PO4A 3A8JA 1FRJA 2WW4A 4X64F 4ID5B 4HHJA 2I5JB 4O3SA 2LECA 5A8RA 3SEOA 3IP0A 1V3ZA 1LXNA 3TRGA 2N3LA 2UP1A 2ATCB 4RW9A 1JMTA 3MGJA 1UPMB 1KQSR 4OI1A 4CLYA 5IM0B 1S57A 4ED2A 2BMBA 1VHIA 2E5IA 4L3KA 2HNZA 3D68A 4R8UB 2AGOA 4FKYA 2YKNB 3OTCA 2B9EA 4B9VA 5SZTA 2DGXA 1E6YB 2XO7A 3AAWB 1A7GE 4JV1A 2HWTA 1X8DA 5CXTA 3WHIA 3M2UA 5AT1B 4F4WA 1OO0B 3UNYA 5JXSA 2UVRA 4OFZA 1AROP 1E6VA 4QJVA 1H3DA 3SV4A 4GC7A 3K5PA 3HDSA 1MSWD 4ZDNA 5KFUA 1VYAA 2BR0A 2MY8A 1DLOA 2IJNA 2PSZA 2VDIA 2VASA 1IKYA 3OJUA 2YKAA 1WKLA 3M9OB 3H25A 3ISNC 1M5OC 2ZWPA 1NJWA 2WOMB 2BKPA 2JC0A 3NGKA 4OHZA 3P45B 3OBIA 3C14B 2AYMA 3I55S 4F7VA 4G1IA 4CI0B 1FX2A 4CM2A 3BB5A 2F4VJ 1JLAB 1LK5A 1B70B 3R27A 1O6XA 1VDHA 4K59A 4RNFA 1IKVB 4ED0A 4EWTA 4OJ1A 3D4JA 2W9BB 3H40A 3NGDA 3PEHA 4WP8A 5KFRA 4WWSA 2GHPA 3M2RA 2UV8A 5IWAF 1MROA 1FRHA 3ENVA 1U7LA 4CTAB 3R2DJ 2ASLA 4NLRA 3FEXB 4ES3A 2ZZNA 4ECYA 1G1XA 1DTQB 1NPRA 4DV2J 2V4JA 3BKUA 3DHXA 2CQ4A 3UDCA 2BE9B 5I3PA 3AXMA 1UCNA 2HYIB 1RT6B 2VV5A 1NDKA 4IRDA 3ILIA 5CYJA 1HBOB 3JS9A 2ZBRA 2XSFA 4Y2KA 1KQFB 4IFYB 1XK8A 1LKZA 4M5JA 4Z37A 4ZVHA 1YHQS 3N6MA 4PG8A 2CDQA 3UO0A 5C42B 4P72A 4E98A 4V19J 2P2CB 2W2NP 2HVZA 4YY3J 2BYCA 3QRPA 3BQ1A 4LVNP 3EPGA 1NKEA 3LANA 5KFAA 3HFVA 3MMJA 1B64A 4DR7F 5J1NA 3C15B 1X0FA 1WUUA 2N7YA 3VAHA 3D66A 2XHWA 4DPOA 3V6HA 1B4SA 2G2ZA 5DM6Q 2UVVA 2V68A 2CADA 5HQLA 3IA0A 2ZNZA 3HZGA 3N28A 1R8AA 3KLEA 1F5BA 4DHVA 3CCVS 3BH6B 1O5JA 1G6BA 1J5EJ 4WPAA 5KFJA 1LFPA 1X60A 4FXVA 2ZH3A 2OD4A 3W8GA 1FRIA 1S7IA 1UJ5A 4JUZA 4TYBA 3CMAS 1WACA 1M5SA 4M5IA 3R5BA 1UVNA 3RR8A 3I31A 1CS4B 2BJ1A 4A8WA 4OI0A 4YDXA 3G71S 3SQOP 3V4IB 1S1WA 3D1OA 3M8PA 4J9MA 3HF5A 2RRBA 1RE1B 1C1BA 4DR3J 3DRRB 2BM0A 4DUTA 3D6FB 1HBNA 2HFZA 2ZM6J 2AU0A 3F44A 1WORA 4RNNA 4O3RA 1FKPB 3NP5A 3IC1A 3VQTA 4RZRA 4UZBA 2FC8A 3TAMA 1X7VA 3R5GA 1RT5B 2UUBF 2QLXA 3R5CA 3EGNA 5EDWA 3V81B 2NCKL 3DOLB 3QWPA 2VFRA 1RKIA 1VQYA 2KT5A 5B0FA 4EYHB 3RBDA 5KG1A 2AX0A 3OL9A 2J0SD 2MKSA 1BQMB 2EEYA 3IAS9 4QWDA 1HNWF 1SQFA 4EO8A 2K1RA 1W7WA 4TU9A 4N41A 1J5OB 4CLPA 2JSXA 5FLXU 4RUCA 2YNGA 4HT5A 4ECXA 3N0VA 2YH1A 2RE1A 5F0UA 4M5DA 3TJAA 4PG4A 3CW2C 3UN5A 4AQYF 1T9YA 3BKFA 3NCQA 4CO4A 1UP1A 4MKYA 1UETA 4OI4A 3SSQA 1VLYA 4DPTA 2QSFA 1VQLS 2ZH8A 4NPOA 1TL7B 1GX5A 1CJTA 4JYAJ 4KYZA 4OX8A 3Q8SB 3DHWC 2R7XA 3Q8QB 3UCZP 2ZBQA 1NK7A 2FVPA 2CVIA 1IQZA 3ZTQA 2BV3A 2GA7A 1S1VB 2HGLA 4QW8A 4DI6A 1RYRA 2QYGA 2Y8YA 3CD7A 3NCRA 3G9CA 5IQ6A 4ZJLA 4P2FA 4M5GA 4I6WA 2NXEA 4ZCKA 5IV3A 2AHOB 3N6NA 1SC1B 2FHMA 3MZIA 3AJDA 3D67A 3ET6B 3ISND 5L1KA 2HZAA 2JNJA 1S99A 4LREA 4DPWA 2M8HA 5BYQA 3TOQA 3M1VB 2VD3A 4PWDA 2WCXA 4F26A 5HSPA 3T6BA 3QJJA 1YWXA 3SFUA 2IM2A 4I69A 1EQ0A 2GFFA 5K9FA 1U6BA 2HURA 3EDQB 1Q95G 3I82A 4DR6J 1RWVB 4DQIA 3SXLA 1RA7A 2X1BA 3DRSA 4P71A 4RW7A 1ZS6A 2B4UA 2EW9A 1REVB 4LJMA 3MEGA 2UZAA 1VBKA 4WE1B 4KJIA 1TKTA 5M2UA 1U2CA 2NUUG 2VPWB 4FF1A 1RHRB 2ZH9A 2XMWA 1JXLA 2PA8D 3LWMA 2C2DA 2U1AA 4X66F 2HGNA 2HHUA 5ETTA 1F5CA 5M2PA 1P27B 3HFKA 2BACA 3Q0AA 1NU4A 4MKAA 4ERDA 2AZ1A 4UQTA 3H5XA 1YJRA 3GZ7A 2PI4A 4RUHA 1HBUA 2GV1A 3GIRA 3CCSS 2VH7A 2XMUA 3CJTA 4M63A 2EBEA 3TX8A 5L38A 4KBIA 1URRA 5E3RA 1YIJS 3M30B 3NGRA 1HQEB 1IR0A 2JC1A 4DR1F 3H98A 1XMOF 4C8YA 3MFHA 1HQUB 1EKSA 1RWWB 4DV3F 1T05B 4DL3A 2BW2A 4U67Q 3AJ2A 2CWKA 2BUNA 3OTEA 1VK8A 2XS5A 2DGVA 4HVZA 2IC3A 3NMAA 5CZXA 5LL6d 4J9NA 2DB1A 1KWMA 4CP5A 2XMJA 1TL1A 2KU7A 1J2VA 3RB3A 3MR2A 2F63A 3RBXA 2VFSA 4DCOB 2DK2A 4JI7F 2VA3A 4HDHA 1F9EB 4I2QB 1F1BB 3H8YA 3TEHB 1MNEA 3E2EA 5H9FJ 3PJXA 1S9FA 2RT3A 2YBVA 5HMXA 1IKWA 4U6PA 4JI4J 3KJFB 4DG1B 4AL7A 4LFCJ 4PAAA 1ULRA 1B99A 2V8DA 1WSRA 1EQMA 3UD3P 5DDQC 3ETMA 1RSCA 3OFHA 1ROFA 4PQUA 5H9EJ 2FZGB 4IG3B 3PYGA 4QW9A 1Y5NB 4IR9A 2YKOA 4QWEA 4JI5J 4JI6F 2CNOB 2J0QD 3IRXB 5D6GA 4I4BA 4JV5F 3S8SA 1JLCA 4LFBJ 3IR5B 1JLBB 4Q5VA 2CZVC 1T9UA 2L9WA 4DJBA 1CJVA 3T5LA 3R1LA 1IJEB 4P9SA 2ZJQQ 4NLPA 2DNNA 3U7JA 4OYMA 2DYAA 1KVJA 5L9XA 3RAXA 2WZ1A 2ZKTA 4FBUA 1CJUA 2C2RA 2H5JB 4W4MA 3I5AA 1TUVA 5CYQA 1BLUA 2JLFA 1R0CB 3M8WA 4A8MP 5DS7A 2HMIA 2JWNA 4ZJOA 4ZPTR 1WI8A 2XZWA 4K0KJ 3V6JA 3B8HA 4DBQA 4Q2LA 4HYKA 3F0NA 4ZPDA 4DV4F 3W2VB 2HQ3A 2CPJA 1VFJA 1JLEA 5KFCA 3GB0A 3V6DA 4P7TA 4H4OA 2CQ1A 3IGNA 1NK8A 1PGZA 5KG3A 4O4GA 4RW4B 3IR7B 4OZ1A 2ZH1A 2XYHB 4HACA 5CAAA 5K8MA 4JOUA 2Z2ZA 5GADU 5EX3A 4C8KA 2GW8A 3D3CJ 2FIUA 4CNZA 3G6YA 1RT1B 4CLTA 2CWXA 3C6UA 3IS9A 2GO8A 2GIFA 2RDIA 3KLFB 2KN4A 2R4FA 4QR2A 3CC4S 3HD1A 3KLGA 2CQHA 4HL9A 2H4WB 4IG0B 5IQQA 3GJTB 4LBHA 2QL5B 4DSIA 1Q8BA 2OLWA 3GFXA 1QLNA 1S1XA 2VQEJ 2PI5A 4KPYA 1XR6A 3MEDA 1D8YA 2MZJA 2L9DA 2VPZB 1RAHB 2FTRA 2IIHA 2JDJA 2C3UA 1K44A 1WHYA 2YWEA 3K59A 1CJKB 3GFZA 5BR8F 2OPQB 3KLIA 2CJBA 4F0HA 3T6JA 5KTQA 1HHTP 5D4OA 2EFOA 4B17A 3OTOJ 4Q0BB 4LF8F 1TFWA 2FUG9 2P6TA 5E0OA 1DTTB 3LA0A 2GO9A 3PRVA 2UU9F 1YBAA 1EIYB 2FLOA 1H7XA 2ZD1B 2H4YB 4KPCA 1LWEA 4LSLA 4TY9A 3PVXA 4ZP7A 2XY7A 4GKKJ 3UR3C 2B9WA 1U2RA 3P5BP 3NS5A 2A6OA 2ZVSA 2LXIA 5E33A 4IDKA 3IBFB 3G8TA 3CJ5A 3MM7A 1H6KX 1DQ9A 4UOCA 4ZN1A 4Y2AA 1N34F 4RBUA 2Z30B 2Y1RI 3SCKE 5KFEA 2BJ3A 3QQCD 4OYWA 1FDDA 2YKPA 3ZTOA 1LQ9A 4B9TA 1U0HB 3CJ4A 4YB7A 4FPRA 5FD1A 3BPSP 1Y11A 1B3TA 3PFOA 1L3SA 4LVOP 2DNMA 3O3LA 4DR2F 4RW8B 2VICA 5GAGI 2GJIA 3D7SB 3GILA 1RP5A 3DLGA 3VCDA 3CJKA 2WBRA 1P9QC 4OI3A 3PW7A 1FWLA 3LGNA 3GYGA 3KK1A 2MY7A 1RT4A 1RT2A 1RTJA 3VZIA 2Y1IA 1ZTTA 1HNXJ 1OMSA 3SCIE 3PW0A 2K3IA 2IFXA 1JK9B 1HNZJ 1PBUA 1W25A 3CJ0A 4Z7YA 2DXEA 1WEZA 2KJVA 2P8IA 2GMHA 1CULA 1RWUA 4ZCMA 2BANA 1NSQA 5CYMB 1RUSA 4LBIA 1BMQB 2F4VF 3H2UB 4JI1F 3OVAA 1D9FA 3BKTA 3B4DA 4RPFA 2VQFJ 1FF2A 1WKKA 4NXMJ 1Q86T 3N5FA 5JJBA 3D9BA 1WEXA 2VHGA 1APSA 5LT5A 3J81U 1YJUA 4WFYA 2ZUGA 1NK0A 1UEVA 3TA1A 1R7IA 4L73A 1IXKA 1URNA 2J9CA 1Q5YA 2LKZA 4IH6A 2UVUA 2W4DA 2W9CA 4A8YA 3ZTSA 4ECTA 4UOGA 2MZQA 3TVZA 1SJ1A 2KVQE 5AXNA 2CJAA 3I0RB 2MQPA 3WDOA 1N52B 2RRAA 4DV2F 3AD7C 1BC6A 2EK1A 1R8PA 1U1LA 3TW0A 3BJYA 4U8YA 5DGAA 4CLSA 4ECSA 2MEWA 2ZDPA 5KFKA 1AZSA 5J2QA 3NNCA 5AE3A 4UOFA 3RU0A 2FVCA 2Z58B 2QLWA 5LMUJ 3OUYB 2BJ9A 1X4FA 3ZTRA 4NLOA 4YMEA 1Y0HA 3ZFVA 3GSDA 5LXYA 3KK2A 1OY9A 2QA1A 5CZVA 5E7OB 2CQ0A 2EWHA 3A3OB 4DSFA 2UXDF 3I4PA 2DJWA 1FXLA 4MFBB 1GXUA 1R6YA 4EO6A 4I1TA 3MTJA 4UT4A 1NHKL 5KFSA 3HKZD 2GMJA 3LP2A 5HBMA 3M8QA 2R8GA 1J5EF 4DV1J 1UFKA 1EJ7L 2HHPA 1KP6A 1FJCA 5HMWA 1R89A 2C2NA 2V6AA 3MECA 2W2OP 2MQLA 2D3OR 1N36F 2KDOA 3I4HX 4NI2B 1GEHA 1TELA 4I67A 3FGVA 4W90B 2RF2A 3BPDA 4DR3F 3IG1A 2HRYA 4JBCA 1SV5B 2MHEA 2ZM6F 2CQDA 1YITS 5F3ZA 1HLWA 1MMNA 1AUDA 5D77A 3QNWB 2WHOA 2YXLA 1V5VA 1MN7A 1U1RA 2AJFE 2ZKUA 4IO1A 2MZSA 2CQPA 4KO0A 3M2VB 2Y9HA 4A47A 4C98A 5C25A 4M94A 2GHVC 3JSMA 2DO0A 1X4EA 1FDNA 1H38A 5D4LA 4FF3A 4G6VB 2FHKA 2JOQA 1RT3A 3GJSB 4BHQA 2D74B 4QOTA 2H65B 2COLA 2YWFA 2ZJRQ 3Q8RB 4O4RA 1WD6A 3ONQA 2WK4A 2B8PA 2IVYA 1R0AB 5B0DA 1TKXB 1RHMB 2V8HA 3UD4P 4F4XA 1VQ8S 4O44B 4GO7X 3VGUA 1Q7LB 3BREA 3RTVA 1RTIA 1VBZA 3MAQA 2XMKA 4U7CA 4K8RA 1FT8A 3W9HA 2M8DB 2P6SA 1VCTA 4OL8A 2U2FA 4DPXA 3VQSA 4KTQA 4FNIA 4JYAF 4OLPA 2XMTA 1VC6A 3K5LA 3L7UA 3F73A 3RRHA 5ETNA 3QGGA 4NLSA 1X9WA 2FHJD 2LA4A 1YSJA 3JXOA 5HROA 2NS1B 2WONB 5LJ3Y 1N5TA 2B5JA 4HH0A 4ZVQB 3M7VA 3ITHB 4I7FB 2B51A 5A2QU 2HHHJ 8AT1B 1DFDA 3HHKA 3MMAB 1L3KA 1Y00A 4ZHRB 1F9FA 4DV0J 4J37A 2BQ3A 4FVMA 2L9NA 1SCJB 4X4RA 4TU8A 1OY8A 1OJ4A 4ZLJA 2ZWOA 1KFDA 3MPVA 2VOOA 1DZ5A 4PXDA 1HD0A 2R9LA 3ENAA 4PCQA 4X62J 2B7BB 4A4JA 4DU8A 2W1BA 4PG6A 3ZZTA 1RBOB 2XWXA 5FLXY 1HPZB 5KT3A 3UE2A 4F04B 1GMWA 1IBMJ 1SH2A 3W7BA 3BV8A 3PACA 1IKXB 3CCQS 3DLKA 4B3TJ 4PUOB 4PABA 4BS2A 1ZZNA 2FZKB 3Q23A 1S59A 2EK6A 4WXOA 5L1LA 4F36A 2BOPA 5F3TA 2CJKA 4G1QB 3SDEA 3SFGA 4NRUA 4TQSA 2Q66A 2ALYB 2RKIA 2HS4A 1TAQA 2KJWA 3G2XA 5J2NB 1NJIT 4WJBA 2IAJB 4AYBD 1NHVA 2KT3A 2KYXA 2XLJA 3RB0A 3HI9A 4YB6A 2XYGB 1RU2A 2YWGA 4AL6A 3QWUA 1QDUB 2GIQA 1TKZB 2D3UA 3KJNB 4C8MA 3VAMA 1REGX 3OHBA 2OFGX 5DJBA 4MK9A 4LT6A 4FVCA 3IBWA 2LXFA 3FKBA 1X4AA 3MPDA 2E66A 3PDNA 3R2CJ 1F9HA 5J2PA 5K8NA 2MZRA 4EBDA 2N7CA 2RU9A 2V2VA 2B9YA 2RAQA 3C6TA 1FRXA 2EKNA 2ATLA 1PYOB 1YBUA 1YJTA 4LQ9A 2Z0GA 2VFUA 4B9LA 1IJFB 3MR5A 3V4MA 3I9ZA 2I0XA 1LW2B 1SB6A 3FK4A 5DRKA 2RU3A 4RR5A 1FI4A 1U8WA 1HNIB 2KFNA 1X31C 2X7IA 4I6YA 4DS4A 2RUGA 3OTBA 3MM5B 3TX0A 4YHHJ 4FYYB 4YP3A 4LFCF 4YR2A 2K8GA 4LSNA 5D3GA 3JSRA 2NXNA 2VBYA 1RTDA 1WC3A 1VK3A 4WFAQ 1GXTA 2C3OA 5ADZA 2QFIA 4M5HA 4Y0FA 1CG2A 4WXWA 4J9OA 2KXFA 3SCJE 2GVZA 4LFBF 3ILJA 4KKOB 3R7BB 3I5CA 2IPOB 2R7WA 3DU6A 3KUGA 3HVRA 3CIMA 1M1HA 2Q6CA 2BOAA 5FIIA 3LWLA 2UUCJ 2ASJA 3S1TA 4P10A 3HVTB 3AA8A 4CNYA 3O2IA 1FKOB 2WBMA 5CD4H 4Q45A 1FEHA 3IM9A 3AD8C 5I4MA 3PJ9A 5MAOA 2OPPB 2EBGA 3UW1A 1GAOA 2EFPA 3DXBA 1QJHA 4FXWA 3G82B 2OELA 2OSRA 1VIOA 4LUBA 3JTNA 3JYTA 4K0KF 3THPA 2W25A 3GCWP 2JEJA 2OHDA 4OLOA 1X9MA 5HK4A 1V6HA 3R5DA 3KLHB 2MQNA 2LEBA 4NA3A 4PZVA 4NMXA 2YWWA 4KGKA 3JQKA 2HQFA 1DBDA 1IR1A 3AY0A 1I5OB 3FQKA 3DGPB 3ZC4A 5KFLA 3FEZA 3CCJS 2ZZTA 4FKXA 4K50A 4ZIWA 3OR2B 3AT1B 3RB4A 3CIZA 4DEZA 4C11B 3EWGA 4NRTA 4X4QA 3K5MA 2DGTA 3G6XA 3HSGA 3CB4A 2W2MP 3K0JA 4NLDA 1H72C 4RU9A 4RW9B 2HQGA 4NXNF 2ACYA 2CPYA 1QM9A 2B0GA 1MMDA 1PJ6A 3UCGA 4TN2A 2HLUA 5HLFA 5HI7A 2HNZB 2F8MA 1A9NB 1GT8A 2BBEA 1WF2A 3EZ5A 4NL5A 1RABB 1VC0A 4DSEA 1RHQB 3NEKA 3I6PA 3ZZYA 3FBBA 2DPIA 1MWYA 2XCPA 1RGVA 2BRKA 5KFQA 3M2UB 2KRRA 3MOZA 4LQ3A 1U47A 4ZVGA 3WZ0A 2QMUB 1E6VB 1H73A 1FRMA 4USUA 5GAHU 5BJRA 1DLOB 4X4SA 2ZITA 1IKYB 2WVFA 1Q82T 2ZOGA 3H0PA 2PFFB 5HVGA 2VG6A 2RVJA 3Q86A 4IRCA 3M4XA 3MCNA 4CH7A 3J80Y 2ABYA 3KLVA 1WF1A 4WZMA 3EUNA 1Z1ZA 3BZQA 1WOSA 4QPTA 4X2BA 4RWWA 3O8WA 3FC9A 3DLBA 1N6QA 4CLWA 3RB6A 1ZZFA 3MEEA 3NOCA 4R0JA 3FCVA 2BKOA 2WVEA 2PGCA 5HO4A 1HW8A 4FZVA 1MLAA 3CPWR 1TVRA 2VL1A 2V69A 3M2RB 5C7PA 3VALA 3KJVA 1MROB 1K1SA 4QYZK 3NWGA 4Q43A 1HNZF 4KE5A 4DQSA 2C2EA 3CTRA 2YNFA 4DL2A 3GIMA 1KS2A 3QGIA 1T8EA 2V4JB 3NL0A 1WC1A 2I2YA 3MCSA 5KFYA 1XMQJ 2Y8WA 2UXBJ 2RMLA 1YX2A 3EVWA 4OHVA 1NSAA 4P74A 3H20A 1H2UX 2W8KA 4NXMF 4DL6A 3KWMA 3MPUB 2RNEA 2AF6A 5HVHA 4X4UA 3IM8A 3R9LA 5ETQA 5FDLA 2BZ2A 1KFSA 3SSSA 2XCAA 5THWA 4DFMA 3A8KA 2MKCA 3OXFA 3B54A 3IAM9 2QRRA 2E5LJ 4C8LA 3KLEB 1PBAA 1U25A 3MM8A 3AHPA 4K5RA 3AXKA 2XO6A 4RX6A 1D9DA 2Y0SD 1TMMA 2FD2A 1VQSA 2M70A 1HWIA 1NH7A 1EKRA 2B4PA 4WIIA 1Q8LA 1NPKA 5LMUF 1UEKA 2YPZA 4A8XA 2CJ9A 3A3NB 3LPEA 2KFZA 3OV7A 1S1WB 1SIZA 3M8PB 4WFXA 1YRTA 3G6ES 4OX9J 3SBMA 3UN2A 4AUKA 1HBNB 2QT7A 2B56A 3HT3A 2H9ZA 3ZZPA 3CO9A 3NBPA 3J7A1 1Q8KA 3OVSA 3BSOA 1AW0A 1FWKA 2CRLA 5EWEA 2K3KA 2MSSA 4QBUA 1YJWS 4NCGA 2HVDA 3BQ0A 3UI3A 2Q3PA 3QLHA 4RL1A 3TAMB 5A8KA 4HLBA 1SKUB 3TA2A 1RAAB 3VGTA 4DV1F 2AGQA 2G0IA 1ACMB 2B43A 3J81Y 1RCOB 3VGVA 1CPZA 4CLUA 3NLCA 4IFVA 1N56A 2PDAA 4KGZB 2K1RB 1ZTWA 1UWBB 3K8WA 4KH0B 2XMMA 3QPIA 1NMEB 2W01A 4LF7J 2ZH7A 3MM9A 4DSLA 2PA3A 4FYDA 1P1LA 1O0PA 3PRDA 1T02A 3PZPA 2E1MC 4ECZA 1JJHA 1GXLA 4B3RJ 4M5DB 4N7TA 4ZPAA 2DY1A 2B9XA 2ZC4A 3LP0A 1MW7A 1KEKA 2XULA 3GMGA 3QAEA 2PD1A 3GV5B 3H5SA 2KTQA 3QO9A 4NA2A 2J6TA 2XSJA 1CJTB 4UUXA 2CJYB 1OYDA 2UVWA 2EC2A 1S0NA 4QWCA 3HHLA 4KH1B 5KFFA 2DRDA 4MAKA 3CD6S 3GU0A 3W61A 5DLGA 1T11A 4M8LA 2JJ4D 3Q8UA 5HATA 3JSYA 4DMZA 1GTEA 3CDEA 2NZCA 1WG4A 3WQPA 4ANDA 2CPDA 3OSNA 3HK2A 1TKDA 2XTJP 3X1LB 1WOPA 2IRXA 1X4DA 4RNOA 1HBOA 3H2LA 2DNKA 4H4KA 4U7UD 4KHPF 3IMQJ 3C16A 3CT9A 4J90A 2LFVA 2HFNA 4PWDB 2L3MA 2E1RA 4ZVSB 3M32A 2HRUA 1VIXA 3K58A 4D3HA 2ZHOA 3TZYA 4LRAA 3HLUA 3TAPA 1S1TA 2Z2YB 3OT9A 2KG1A 3TJ8A 4TKTA 2ZZMA 2DEJA 3DRSB 4RW7B 2YX7A 2VJUA 4U7UK 2FGCA 3VWSA 3MEGB 3OTDA 2MLYA 2H48B 2YKQA 2R7VA 4I6AA 1TKTB 5G0RA 5E2QA 1JIHA 2NXUA 1XNRF 4F3QA 5D4NA 1GTHA 3BH7B 4TVAB 2XQCA 1VQNS 3P96A 3TZWA 2KZZA 2HHHF 3SQGA 3DLHA 4C3KA 4N47A 4CO3A 2FB0A 3FEYB 2HHVA 7AT1B 5L39A 4G3IA 5ETLA 2MJNA 5KFZA 4NLYA 2BEFA 2PMZD 1HBUB 2V34A 2QJ3A 2XY6A 1RK8A 4MTPA 4B3SJ 3MAAA 4J9UE 2M0GB 4X62F 4OV6A 1U4BA 3DOKA 4J5OA 3I96A 2QA2A 1NUEA 4CQ1A 3N5BA 2CXEA 2AJ0A 4BDPA 3G86A 3BGOP 2E9ZA 1RWXB 2Y1JA 3RAMA 2CPHA 4LRFA 2HW3A 1C0TA 1S48A 1Y4ZB 4WCEQ 4OX6A 4B3TF 4XO0A 5KFTA 1W2IA 2AJ1A 4CDIA 3PKMA 2LA6A 3K5NA 2M2BA 2IC3B 3OXGA 4DF4A 3NS6A 1T03A 4ZP9A 5KFHA 3C19A 4Y2IA 4OYZA 3UDEA 4IUFA 2UV8G 2BE2A 3AOAA 4L6V3 2XY5A 1FK9A 2DKOB 1TL1B 2E1CA 2FJEB 4RWXA 2WVBA 1FX4A 2DHSA 3OPKA 1N32F 3CVKA 3KMSA 3G96A 1FFGB 4A8QA 3S7RA 1L3VA 5I3UA 1TL4A 3GP9A 2ZH4A 3QT8A 5A2QY 1IKWB 2DHXA 7FD1A 4OZNA 2MB0B 2QLJB 3MUVP 5L8RC 3P8BB 3HHNB 4K5SA 3DDKA 4KAIA 2F8HA 4CLLA 4PQUB 4FYVB 4TNOA 1N0UA 3BQ2A 5B7WA 4K2XA 4O3OA 4P2MA 4J9VA 2IVMA 4ZA1A 4B3OA 2V8PA 2DRAA 2V63A 1WWHA 5BXIA 2YKMB 3AB2B 2QC3A 3U02A 1JLCB 4FS2A 2CIMA 2OEJA 4QPXA 4QWAA 2CA9A 2M52A 3A3PB 3AODA 3JTOA 4KV8A 1CJVB 5B0BA 3MXHP 4K4WA 4LR9A 3S01A 2JFDA 3CJRA 3PIOQ 2JZ5A 4O0NA 2NQPA 2DNGA 2N4CA 4YS2A 4YHHF 2QZ8A 2OKQA 1CJUB 1C1CA 1U09A 5CYQB 3OR1A 3GCXP 5GMEA 3OD2A 3QMQA 1X5TA 2PN6A 2HFSA 1N5VA 1S97A 2HMIB 5IC6B 2B4OA 3S6EA 1BQNA 5D0RA 4PXEA 3PYDA 5LJ5Y 4DQQA 1JLEB 3GIJA 3BR8A 1FA0A 3DNCA 1U1MA 4H4OB 3CC7S 1SH0A 1NRKA 2HFVA 4O4GB 1HI0P 4ED1A 4CZCA 3KHGA 4HACB 2BKNA 4DS5A 3BS9A 4EFAC 3LGMA 4DR4J 3QT5A 3TUJC 4DUYF 5KFOA 3C6UB 4GKJJ 4B02A 4XTTA 3BGLA 2R2TA 3IS9B 1PSDA 2DPJA 2HFOA 4IYQA 4C97A 1FD8A 2YWHA 1M5VC 3QAUA 1SH3A 3KLGB 1PJ7A 1RLCL 4UW2A 4F2SA 1XEZA 2X1AA 4LF4J 1S1XB 2PMWA 3CD0A 4DL5A 3N79A 4A8OA 3AFGA 4ZIVA 2ZE2A 3MEDB 1A6LA 1Q79A 2E7XA 4J91A 3K7RA 3QSIA 2E5JA 1EETA 1QD1A 1YKWA 5KFNA 4AL5A 5KAKA 3HXMA 3KLIB 4X4NA 2OPRA 3HM9A 4YQWA 3PG9A 1YZ7A 4MYTA 2OSQA 4OV1A 2SXLA 2YNIA 2B7CB 2AEJA 4FF4A 3ILLA 4JI0F 2XC9A 4DLEA 2MZTA 2EFNA 3HKWA 1FXDA 2VFTA 4LR8A 1LWEB 3PO5A 2NSCA 3NMRA 2EFQA 3LGHA 3POTA 4LIWA 1UMJA 2XEXA 2M4MA 4IDKB 1RAFB 3MM7B 5K8OA 2LU2A 1VQ7S 3NY0A 3R6GB 2R8HA 2X1GA 3PR4A 2ZFHA 1PKUA 2WB4A 3OL7A 3TUZC 2R7RA
chains in the Genus database with same CATH topology
2G13A 4JI5F 3AQOA 1S0OA 5KT6A 1KHWA 2MZQA 2RILA 3TVZA 1SJ1A 5AXNA 4QYZJ 2CJAA 3I0RB 2EKYA 1SV5A 3F41A 3WDOA 2MQPA 4OZ0A 1OS5A 2Q1LA 1N52B 3QIPA 2RRAA 1S0MA 1UJ6A 4DV2F 3OW2R 2JRSA 2ZNYA 2VG5B 5DM7Q 3P49B 4LIRA 2DGQA 1BC6A 2EK1A 3HMJG 5C5JA 1R8PA 1IN0A 4URSA 1U1LA 3TW0A 1YJ9S 2DNZA 1NB7A 4ECWA 2B3TB 1OIAA 3DLGB 2XNQA 3CJKB 1X5PA 2GGPA 3VF0B 3BJYA 3PEJA 3IXQA 3RAQA 3CCUS 2VPYB 3KNAA 4QIVA 2JEGA 2XG8A 5DGAA 3KHHA 3BGRB 3ZZUA 3KK1B 3M2VA 2ZHBA 4ECSA 1Q7YT 2ZDPA 1NNDA 5KFKA 3QZ7A 3MHYA 4Y00A 2AYGA 1FVSA 5J2QA 2WRMA 4NLXA 3EPIA 5AE3A 3NNCA 1RT4B 2ZE2B 1RT2B 3FMWA 3TR5A 3RU0A 2FVCA 1ELOA 2HWHA 4ZCIA 3W2WA 1RTJB 1Y7PA 3ENQA 3BO4A 2QLWA 1FCAA 1EETB 3N9UC 3OUYB 5HP1B 5AJ3F 4YR0A 1NHUA 1X4FA 1HNVB 4OIXA 4NLOA 3DRPB 4Z2XA 3BDEA 4YMEA 3X3UA 1Y0HA 4RLEA 4Q7AA 3ZFVA 3GSDA 4YEAA 1VRUA 3CCWA 5KFGA 2OPRB 1JKHB 5LXYA 2Q6BA 3KK2A 2J76E 2QA1A 1JJ4A 5CZVA 4QQBA 5E7OB 2HHWA 2CQ0A 2EWHA 2K7KA 1JX4A 2ROPA 2CVEA 2DIVA 4PKDB 5EGYA 4DSFA 2CQIA 2YNIB 1R0AA 2BANB 1TKXA 1B0VA 3ZZZA 2UXDF 4U9RA 4KFBB 3I4PA 2ZH5A 5F8HA 2DJWA 1FXLA 4MFBB 1O51A 1GXUA 1N4LA 1R6YA 4EO6A 4I1TA 3H5UA 1S6QB 3MTJA 4O44A 1WNEA 2J6SA 5KFSA 3CF5Q 2J0WA 3HKZD 2GMJA 3LP2A 5HBMA 3M8QA 2R8GA 4C0HA 1LFWA 1J5EF 4E8UA 1JLGA 4NLTA 3C46A 2HHPA 4N76A 1YG0A 2DRBA 4KQZA 2IM3A 3POTB 4C8NA 4LFAF 1FJCA 5HMWA 4IH7A 1R89A 4CT8A 1YTYA 1TK0A 4CH0S 4QYRA 2CYYA 3O1LA 1BWEA 2LCWA 3PX0A 4TXSA 2YNHA 4N77A 2D3ZA 3MECA 3EXYA 3T5JA 3MMBA 1KC8T 2MQLA 4AXJA 3M8RA 2D3OR 3NKYA 2J8AA 3DMJA 1N36F 2P9GA 3BM7A 4EZ6A 2KDOA 3I4HX 2DNPA 2F40A 2DHAA 5A8RB 5DG7A 1QAJA 2WTFA 2E9RX 2W9CB 2XWYA 4X4VA 1QUVA 4I67A 4URGA 2QFJA 2ROGA 3FGVA 4W90B 2RF2A 4KHRA 2PE8A 1IQTA 2HAIA 4F4KA 1HA1A 4DR3F 2DT9A 1QVFR 2HGMA 3IG1A 2HRYA 4JBCA 1SV5B 1LV5A 2MHEA 2ZM6F 2CQDA 4HTJA 3QIPB 2R2RA 3L7OA 1YITS 2VQEF 5F3ZA 2J9DE 1DJ0A 1HARA 4NA1A 2HLTA 2WONA 1T95A 1MMNA 2JEIA 3J7YU 4ED6A 5GVQA 3ITHA 2JLGA 4I7FA 1XMQF 1AUDA 5D77A 4GC6A 2WHOA 2YKMA 2LEAA 2PT0A 4L3NA 2UXBF 1X5OA 3O6QA 4E0DA 1U1RA 2AJFE 2Z4PA 2GGPB 2ZKUA 3MMAA 4IO1A 1NK5A 3UWTA 3N6LA 2QIFA 3THVA 2MZSA 4ZHRA 4F8RA 2CQPA 4KO0A 2I9SA 3M2VB 3Q24A 1S6UA 3CDAA 4A47A 4C98A 4IKAA 5C25A 3PKYA 4M94A 2GHVC 3JSMA 2DO0A 2A10A 1YGYA 5J2QB 1RT7A 1X4EA 2LDYA 3MPYA 1FDNA 2MDAA 1H38A 2E1AA 4DL7A 2C22A 5D4LA 2AYEA 1VQ6S 3KMQA 3W2WB 5GMKa 5I42A 3LAKA 2DNOA 4J9PA 1HYSA 1Y5LB 4FF3A 1TL3A 4G6VB 1JB0C 2FHKA 2DR7A 4C4WA 2JOQA 1R43A 3OTOF 2XNRA 3CJ2A 1RT3A 1TR0A 3CCRS 1SJ4P 4BHQA 2RD5C 2AD9A 4FN5A 4RBTA 2D74B 4QOTA 1TZ0A 1KHVA 4NLWA 2IRYA 1ZBTA 2W24A 2YTCA 3KK2B 3KG0A 1QAXA 3DLEA 2COLA 2WSEC 1HWKA 5H1SV 2YWFA 3MUMP 4XIUA 4QIWD 4F25A 2C3MA 5B0CA 1P8GA 5J1EA 2RDJA 2ZJRQ 3Q8RB 4JI3F 1C4CA 4O4RA 1WD6A 3ONQA 1YQHA 1B0PA 1HPZA 2WK4A 3EX7B 2IVYA 3KFWX 2MPUA 3LO3A 1R0AB 2V9WA 1W2BR 1CSJA 5B0DA 1TKXB 3GV7B 1GH8A 3MPWA 4GKKF 4XDCA 1FTCA 2V8HA 3UD4P 2E5LF 2MQOA 3LH2S 1FXRA 2HPUA 1Z2LA 4F4XA 1IKXA 1VQ8S 3N4WA 1S76D 4F02A 4O44B 4GO7X 4F2RA 3R1HA 1Q7LB 3LP2B 3BREA 3M8QB 5HBMB 3RTVA 4HKQA 5HQ8A 1RTIA 4ALZA 1VBZA 3VTIA 3CDWA 5A0YA 3MAQA 1JLGB 2JVRA 2XS7A 3IN5A 3C2PA 2XMKA 4DR4F 1XC9A 1NAQA 2V2KA 3LW5C 2X1FA 4G1QA 4DV5F 3PNIA 4U7CA 2ZH2A 3KG1A 1FT8A 3QIDA 2M8DB 2KM8B 2P6SA 4DLGA 1YRUA 2YNHB 3MECB 1WTBA 3MMBB 3D0GE 4OL8A 5CA5A 2U2FA 1GX6A 3VQSA 2F1FA 2PEHA 3DMJB 4R5PA 4KTQA 3MTKA 5J2NA 4JI2F 4FNIA 4IOBA 4JYAF 2KKHA 4OLPA 2IAJA 4PR6A 2WSCC 2XMTA 2A2CA 1VC6A 3K5LA 2E5HA 1X4CA 3ZZOA 2BM1A 4HTIA 3GR1A 3F73A 5DG9A 3RRHA 3LALA 3QGGA 4X65F 3Q8PB 3MFIA 4NLSA 3AA9A 3K57A 2MKHA 4ILMA 2RF2B 1QSYA 2LXUA 2N82B 4Q2MA 4OX9F 4DQRA 1X9WA 1PO6A 2FHJD 3IG1B 3HVAA 3MR6A 3G8QA 2BDPA 1TKZA 1Y5IB 3HHLD 1FNXH 3D54A 2LA4A 1YSJA 2OMOA 5LSOA 5HROA 2NS1B 2KHDA 2K7JA 3PW4A 2VODA 2GMLA 2VG7A 2WONB 1N5TA 4ETZA 5LJ3Y 1V3SA 1ZM9A 2B5JA 4HH0A 3T9NA 3ITHB 4I7FB 2B51A 1D9AA 1U24A 2VZ9A 2R7UA 1DFDA 1HNXF 2L41A 2HHSA 3HHKA 3MMAB 2FJDB 5DO2A 3L3CA 1L3KA 2XI2A 1Y00A 4ZHRB 4W92B 1F9FA 2LQBA 5K14A 4KO0B 3HP6A 4OQJA 1X4GA 4J37A 1HW9A 1HWUA 3AH6A 2BQ3A 1S79A 5C25B 5KFVA 3JSMB 4DFJA 1F5AA 5DDPC 4FVMA 1RT7B 2L9NA 2OO4A 5IT4A 1LOUA 4EYIB 1SXLA 4X4RA 4TU8A 1VBYA 3I32A 1LWFA 3ICLA 2G1DA 3QYYA 5I42B 3V2UC 4B9UA 1HYSB 2DGWA 4ZPBA 1KFDA 3MPVA 1SBRA 3PFEA 2VOOA 2V94A 1DZ5A 4EU0A 2R7QA 4PXDA 1HD0A 3C3LA 2R9LA 4P2SA 2RJZA 5D4PA 3IRWP 4PCQA 2NR0A 1K8AT 2RIJA 2B7BB 3DLLQ 4H4MA 4A4JA 4ZVEA 1CQNA 1S9EA 3DLEB 5C24A 2EI5A 1XR5A 4I68A 4PG6A 3ZZTA 5I3QA 2E9TA 5J1EB 1LW2A 5F8JA 5F8GA 4P7VA 2VQFF 3NCPA 2KVIA 3RRGA 2XWXA 4HI1A 5AE1A 3OLBA 3P5TL 5FLXY 1HPZB 5KT3A 1U49A 1SIWB 3UE2A 2O3DA 1ZM3A 3FCHA 5EWFA 4LF7F 4A46A 2BQRA 2J9DA 2DGOA 2FLNA 1SH2A 1HNIA 3W7BA 1U1QA 2FVSA 1U1OA 2NPFA 3D2WA 3PACA 1IKXB 4Y2MA 1ZH5A 3CCQS 4B3RF 2ROEA 2I38A 3DLKA 5M2UA 3I56S 3MMCA 4PUOB 4BS2A 1ZZNA 5K5MA 1FE4A 1X9SA 2DNHA 1HWLA 4DN9A 3Q23A 2MKKA 3MM5A 1CLFA 2EK6A 4AE5A 4UY8T 1RTIB 4TQRA 4WXOA 1UFWA 5A0YB 3E01A 5L1LA 3H59A 2BOPA 2LEPA 2ASDA 1Z4UA 1H98A 3MDFA 5F3TA 5AXMA 4G1QB 4PG7A 2CJKA 3V5RA 2XS2A 1BY9A 3SDEA 3E3XA 3SFGA 2DHGA 4NRUA 2B6AA 4Y2CA 5IXUA 3VAKA 4TQSA 1QSLA 3ISZA 2Q66A 1HWJA 2RKIA 5DQGA 2YX1A 1X4BA 2HS4A 2W4PA 5F0WA 4DX8H 1TAQA 4B3MF 1S77D 4ID5A 4K4XA 2KJWA 3V6KA 2I5JA 2KXHA 2POKA 4R5PB 1Q81T 1FKAF 5J2NB 1AXQA 2MGZA 4K4UA 2ZDOA 1NJIT 4WJBA 2IAJB 4X4TA 4AYBD 4WYLA 1NHVA 1NJXA 2KT3A 2IHR1 2KYXA 4QIEA 5LXRA 2XLJA 3RB0A 5F9LA 5IFMA 1MMLA 2VUGA 4K4YA 2BABA 3HI9A 3J7ZT 1I94F 1FVQA 2DIUA 3M6XA 3G8SA 4YB6A 2KH9A 3ETOA 3CC2S 2YWGA 2CZ4A 4AL6A 3QWUA 4KKOA 1KR4A 1HI8A 2DNLA 2GIQA 1TKZB 2D3UA 4C8MA 5IM0A 5DG8A 3VAMA 1DAXA 3E8OA 5HROB 4XK8C 2VG7B 1KSPA 4PPDA 3OHBA 3OFGA 2B5JB 4YUDA 5A6PA 5KG0A 2OFGX 2WB1D 3H5YA 2O01C 5DJBA 4MIBA 3CCES 1IM4A 4LT6A 4MK9A 4ZPCA 1P1TA 2XMVA 4FVCA 2D7SA 2RRNA 3GFHA 3IBWA 3IWLA 2LQ9A 2LXFA 2M3DA 2OFHX 4MYUA 4PXBA 1M5HA 3HVTA 1X4AA 4R8UA 2E66A 4K4VA 1FRLA 3PDNA 3RR7A 1OPZA 1FKOA 4OZJA 2YKNA 2VB6A 1L3TA 1O8BA 5AE2A 5K14B 1HR0F 3HHDA 5J2PA 1E6YA 4ECQA 5K8NA 2MZRA 3OJSA 5IS2A 4EBDA 2N7CA 2RU9A 1GQEA 1UJ4A 5D78A 2B9YA 2FJWA 5BYSA 4ED3A 4X4OA 3RRKA 5B08A 1TAUA 1C1BB 4PQAA 1H7WA 4RBVA 3SSRA 5GAEI 3C6TA 2FLPA 3PHEA 3DCAA 1LWFB 3GFYA 1FRXA 2F7VA 1NK4A 1AFJA 2VBXA 4ZCLA 2ATLA 5E3PA 4CO5A 4TU7A 2W7PA 4BC9A 4EZ9A 3B4MA 2FPHX 1T7PA 3MURP 4DWIA 1YJTA 4KC5A 3FRZA 1XMBA 1TFYA 4LQ9A 1NK9A 2CPXA 2VFUA 2Z0GA 4H4MB 4ATNA 2IYIA 4B9LA 1IJFB 3MR5A 2VONA 1S9EB 3OFEA 3RW7A 2MKIA 3V4MA 5C24B 3KLHA 4IRKA 4RU2A 3I9ZA 1CC7A 3MAHA 5CH7B 3KYLA 2I0XA 1LW2B 1T3OA 3L09A 4J9RA 4DUZF 4ECRA 1SB6A 3L7PA 3HJFA 4EEYA 4MK8A 3SYZA 5J2MA 5DRKA 1C2PA 2RU3A 1NJZA 2IYGA 4B9MA 3E51A 1LXJA 4M1KA 1R31A 1VOMA 4YR3A 4J9LA 3OHAA 2HQIA 3DGPA 3QJPA 1HNIB 1LK7A 2KFNA 3D5MA 1SJFA 2LQJA 2J6UA 4LMZA 5HN0A 1CEZA 1RJJA 4I6YA 4DS4A 2IJFA 4OJGA 4YOEA 2KB2A 3NNAA 2RUGA 2WOMA 3DLKB 3MMCB 1ZOTA 3OTBA 4YB1P 1S49A 3T19A 2EG2A 3TYTA 2V4QA 2IVFB 1SJ3P 3EYZA 2KI2A 3MM5B 5LMNF 2HVIA 5KT5A 4DFKA 4WKYA 1X0PA 3FJ2A 5LSLA 3OR2A 3E01B 3SCLE 4YP3A 4LFCF 5IZHA 4YR2A 5KT7A 4NLVA 4C11A 2K8GA 2CPIA 2AYBA 4PRFA 2XLIA 2HS0A 2RQKA 4LSNA 3SDEB 3T1YF 1FNOA 2B6AB 5D3GA 3JSRA 2V8VA 2KHCA 1M5PC 3PO4A 3BGUA 2VC0A 2VBYA