2PGTA

Crystal structure of human glutathione s-transferase p1-1[v104] complexed with (9r,10r)-9-(s-glutathionyl)-10-hydroxy-9,10-dihydrophenanthrene
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
210
structure length
210
Chain Sequence
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Structure and function of the xenobiotic substrate-binding site and location of a potential non-substrate-binding site in a class pi glutathione S-transferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 80
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1997-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2pgtA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2pgtA01
2WS2A 5HR1A 4KAEA 3IC4A 2AUVA 4ILFA 2H75A 3W8SA 2A4VA 2RUEA 1OYJA 2HSYA 4KB3A 3E0UA 2REMA 1GTUA 2XBQA 5C00A 5KN0A 3WGDA 2FWFA 5F06A 2N5AA 3L9SA 3DGQA 2B1KA 2YCDA 1O81A 3F3RA 2HRAA 1MEKA 1AW9A 3TJGA 2M80A 5IO0A 1AQXA 2KOKA 3VK9A 4IQ1A 1O8XA 2F8FA 6GSWA 4GQFA 4DSQA 1X5DA 2DJ1A 4JZQA 3M8NA 3GUSA 3HYPA 2H6ZA 3KP8A 2DJ0A 2E2GA 5C04A 2GZYA 4XHMA 1QXHA 3FZ4A 3IK7A 4OD7A 4PNFA 3R2QA 5L71A 2L59A 4ECBA 1R7HA 3DWVA 4ZL8A 3LFLA 1THOA 4BVYA 1VGLA 1Z9HA 1PGTA 3QCPA 3UIWA 5IIZA 5LCZA 2B5XA 2TRXA 1V9WA 1AIUA 3ME8A 2X8CA 1XPVA 4TR3A 5AGYA 4WF4A 4DSRA 5KN2A 2HSMB 1GNWA 4TW5A 2I3YA 2H66A 3HVVA 1HQOA 1V98A 2H0GA 1M2DA 3VWXA 3UJ1A 4E8HA 4KA0A 4HJ2A 2NBSA 1K0CA 4K0GA 2ZNMA 2UZ8A 5ID2A 4HQSA 4NPBA 1FG4A 2H1AA 1EV9A 4LLRA 3SBCA 2PU9C 1O73A 2VL2A 2YWMA 5HQPA 3GIXA 2JSZA 2FA4A 2N5BA 3CSIA 2H74A 2VAFA 4OFMA 4NV5A 3HKRA 1K3OA 3HHVA 4G0IA 3F4RA 3HJOA 2VCQA 3DMLA 8GSSA 3BD2A 3F63A 5EL8A 3LYPA 3F0IA 1DE2A 1OVNA 4G19A 4USSA 2RIIA 5IQYA 2GS3A 3I43A 1GLQA 3D5JA 4MJCA 4PQHA 1IYHA 2JSYA 2BJXA 2H1DA 2HI7A 3F4TA 1EWXA 4ZB6A 4D73A 1F9MA 2K8VA 2C1YA 2L5LA 2VL3A 2VM1A 1XZOA 4NV2A 2I1UA 5G2ZA 2LEGA 1NM3A 3D4MA 5AISA 3ZLPA 4WKWA 5DJLA 1CQHA 1ML6A 2OKAA 1A8LA 4ECIA 2FUG2 1J9BA 3C1SA 1ZL9A 4POBA 2VOCA 1Z7PA 4MCUA 1SK2A 1PMTA 4GTUA 2C3QA 5B6MA 1JFUA 2O85A 4MP4A 3EU3A 5CRGA 11GSA 2OA7A 5ENUA 4G0KA 2C0EA 3TRPA 4H86A 4G2EA 1PKZA 4GCIA 1SKSB 1EP7A 3EU4A 1URMA 1A2MA 1YY7A 4GSSA 5B6NA 2LKUA 1GP1A 4KSMA 5JWQB 1UC7A 3NZNA 2VLTA 4POMA 1ERVA 3G9BA 4KCEA 4IVFA 1G7EA 6GSUA 3FK8A 2L6CA 3CYNA 3EC3A 3KJYA 1GSYA 2ZCTA 18GSA 2LTKA 4POLA 2L57A 3M0FA 2AHEA 4MJEA 5DJMA 3IDVA 1E6BA 1X9SB 4D73B 1GSDA 1T4YA 4OO5A 3U5RE 2MMAA 1VF4A 4V2NA 5KN1A 2LS5A 1XVQA 1I5GA 3WT1A 1ERUA 3DRNA 4EVMA 4L5LA 4ML6A 4WETA 5HR3A 3GSTA 5HR2A 2YP6A 4OO4A 1BG5A 1A8YA 1V57A 4MPFA 4K1FA 5D73A 3M9JA 3AY8A 2H6YA 5D9TA 1HNAA 3ERFA 2CQ9A 2WRTA 4N10A 4EKZA 2H72A 1SYXA 5ELAA 1T00A 1FOVA 3F6FA 1A2LA 1PX6A 3FEUA 4HU9A 3PGTA 1DSBA 2LV3A 3KMOA 4AJ6A 1TI3A 2F9SA 2GQLA 2DJ3A 1QGVA 3E3EA 2GT6A 2PN8A 4Z7XA 1M2BA 2ON5A 1TXXA 3RBTA 1K0MA 2VL2C 1BYEA 3A3TA 4Q5NA 1NHYA 4IJIA 1TJDA 4MA9A 1ZMAA 5E59A 4GQCA 3TOUA 2WB9A 5G1LA 1AXDA 4F9ZA 2H19A 1GSQA 5DALA 5ECPB 3QFBC 2F8AA 1X5EA 1EV4A 1KNGA 2BMXA 3CTFA 2OBKA 2GGTA 4AJ7A 3BBYA 2MMOA 1OC3A 1B48A 1M2AA 2C80A 5GAPD 1QMVA 2WDUA 3CSHA 4NAXA 3NOFA 1ILOA 4WXTA 1GSSA 3TKSE 4RI7A 1RK4A 1K0BA 1SJ6A 4K8MA 4QL7A 1FVJA 2L4CA 4F0CA 1A0RP 2R5GA 4IP1A 4IELA 4J2FA 4OFTA 1GTAA 2EIQA 4ISDA 5KEJA 3HVXA 4KDUA 2YN1A 3ZTLA 3EMXA 4XS1A 2AV4A 3WGEA 1BQ7A 4HJMA 1OC9B 3IPZA 4MH2A 3ERGA 2MMNA 2RM5A 2TRCP 3CRUA 4LMVA 1GTBA 5D9WA 1XWBA 5INYA 4JBBA 2OACA 4BWQA 4OCFA 4HZ4A 6GSSA 5B8BA 1WPIA 2LUSA 1WE0A 5DALB 1G7OA 2DJJA 3GL5A 3ZMKA 5EPFA 3WYWA 2VCTA 2HSHA 2HT9A 2E0QA 5AIXA 1GULA 3Q18A 1GWCA 3UOMA 3A2XA 4TKYA 1U88A 1ERTA 4EDZA 3HVSA 5F07A 1RQMA 5DBQA 2PWJA 1CQGA 3GFKA 3F9UA 4YQUA 2YWOA 3TB2A 1GUHA 3EYTA 4MF6A 1WP0A 2AYTA 3KTLA 1GSFA 3GRXA 4J57E 4MZCA 2PPTA 5GSSA 3FZ5A 4MPGA 2C0FA 2V6OA 3QAGA 4IS0A 2HFDA 2FLSA 6GSYA 2KUCA 4E8EA 3UBLA 5ECLB 4BA7A 4HQZA 4GWRA 3F8UA 2HE3A 3HDCA 7GSSA 2MBSA 2FD3A 1T8EB 2WCIA 4NHWA 2H71A 4TR4A 1XW9A 5CNWA 4IN0A 2JZRA 3GV1A 2JZTA 1WWJA 1UA5A 3P90A 2HRKB 3TRXA 4AGSA 5J9CA 5DQYA 1V2AA 2CZ2A 1XW5A 3FW2A 4MJAA 1XWKA 3C71A 3CTGA 1XOBA 19GSA 5B8AA 1H75A 2EIRA 1Y25A 5ECIB 5D9VA 4EO3A 3EMPA 1O6JA 4MMMA 3M3MA 3EVIA 5ECKB 2WFCA 4IP6A 1WIKA 3UEMA 2IL3A 2P5QA 3C1RA 5G1KA 1A0FA 3P7XA 3GTUA 3GKXA 1OE7A 4TXOB 2C3NA 1ON4A 2HSNB 1BEDA 1EZKA 1RW1A 4TRXA 1TTZA 3GNJA 1XVWA 1B8XA 4QL9A 3VPQA 3KP9A 2FY6A 1PN9A 4PQ1A 5DVBA 5FWGA 3P2AA 4X1UA 2B5YA 4ZIJA 4O32A 2YV9A 4JE1A 4TXVA 3D22A 3KM6A 3IA1A 2DJKA 1GLPA 2B7JA 5J41A 5CRHA 2MYGA 1AAZA 3S9FA 1TU8A 2HZFA 2JACA 3FHKA 5G30A 4G10A 2O89A 2A2SA 2H76A 1PL2A 2C8UA 1WMJA 3RPPA 4Q5FA 3GX8A 1A24A 4TOPA 1XOAA 2IFQB 3TJJA 4HDEA 3IAS2 3N9JA 1MD3A 4YAVA 1N8JA 1LJRA 4FYBA 1T1VA 2I81A 4HUAA 6GSTA 4IJ3A 3HJMA 1TI1A 4HI7A 2GQKA 3VWVA 1K3LA 4I2TA 5COHA 1EOHA 2V32A 4POKA 2DSAA 3G7JA 3V1WA 3TKPA 4KF9A 2IIYA 2QGVA 1TK5B 4K9ZA 4ID0A 3RHBA 4EXJA 1XW6A 3TKSC 3QR6A 4PQIA 1DUGA 4YAPA 4L5OA 2P31A 1VF2A 3H8QA 5HFIA 3D6IA 1SKRB 2LSTA 4ECJA 3GURA 5J9BA 1OAZA 3D4TA 1K0OA 1FHEA 3TGZA 3PH9A 5JCGA 3RHCA 1MDIA 5B7CA 2VM2A 4BVYB 3QPMA 1GNEA 2KP1A 5CRWA 1EGRA 4F03A 4TR1A 1YQ1A 1J08A 2DIYA 4I5QA 2P5RA 2IMKA 2O87A 17GSA 4TR0A 3ERWA 4GF0A 3IK9A 1B4QA 4HU7A 3LSZA 4JU5A 3VPTA 5GSTA 4P3YB 4EE0A 2IPAA 3ZVJA 4GSTA 2ON7A 4PX1A 1S3CA 5A4WA 5IM9A 5ID2B 3P8WA 4ZXGA 2IMEA 2R2JA 1ZGNA 2I4AA 2YZUA 2HQTA 4NHZA 5F8BA 5CO3A 2HRFA 2V41A 4KE3A 2BTOT 3ZITA 3GN3A 3G7YA 1F37A 2VLVA 5GAND 3R3EA 1OKTA 3Q19A 4XIHA 3CSJA 5CAXA 4MLYA 3RDWA 3GMFA 3KZQA 4V2MA 2X64A 3WGXA 4KCAA 3KIJA 4PTSA 3RPNA 4RQXA 2LJKA 2H01A 1F2EA 3LXTA 1YDKA 3OR5A 1AUCA 4MJBA 1I9DA 1YEXA 4I6XA 3IR4A 4V1Ag 4FYUA 3H93A 1H4OA 3Q6OA 2H8LA 4KUNA 5GZZB 2OE0A 1XWAA 3CXGA 6GSVA 1Z5YE 4OWYA 2G2QA 5JWRB 4WR5A 2KLXA 4WBRD 5CRDA 4L0WA 3US3A 3ISOA 2LNTA 2LRTA 2R4VA 5IMAA 2MMZA 2MZCA 4FQUA 2YWNA 5IPHA 4ZILA 12GSA 1EOGA 3KH9A 1OE8A 2K8SA 3LORA 4XRDA 3VI5A 4N30A 2FWGA 4K6XA 3ZZXA 5E4WA 3ZIVA 3VWUA 4F82A 4ZL9A 3H1NA 3D21A 2AB6A 5JCWA 3FR9A 1PD21 4OFNA 1SL2B 2O8VB 10GSA 4DSSA 4RI6A 3DIEA 4MZBA 2GZZA 5F0GA 2KHPA 3ZRDA 1JZRA 2GSTA 2H73A 9GSSA 2DMMA 4IQAA 2V2GA 2GZPA 2VO4A 2ES7A 1TKDB 2E2MA 4KSOA 1AQWA 3UMAA 2D2ZA 1HNCA 3GKNA 1M7TA 3L0HA 1FB0A 1SU9A 3WT2A 1KTEA 3TCOA 2GT5A 4IKHA 5FHIA 1SKWB 2C4JA 3G7IA 2DJ2A 3QFAC 1U87A 3M9KA 3HA9A 4JR6A 4OCEA 1Q4JA 2E7PA 3UARA 1ABAA 2WZ9A 3VURA 3GX0A 3CRTA 1SJIA 4EC0A 3IE3A 1Z7RA 2DIZA 5IMCA 1C72A 5CYYA 2LRNA 2OE1A 5HFKA 1TRWA 5JWOB 3KXOA 4KH7A 1U6TA 3GH9A 3MDKA 2HRNA 1W4VA 3GH6A 5D96A 4DSSB 4HS1A 2CVKA 2VUPA 1Z3EA 1MTCA 5ABRA 2QSIA 1F6MC 2IN3A 3PINA 1TP9A 4ZL7A 1Z6MA 1XBSA 5H5QA 4KDXA 2VD1A 5IO2A 3KTBA 1VRSD 1WOUA 2QC7A 5H5RA 3GSSA 4N11A 1VF3A 2VLUA 4WBJA 2M72A 3HCZA 2X8HA 3IOSA 3W8JA 3UVTA 2B1LA 2IJYA 2C0GA 1HYUA 2R3XA 2A2RA 4ACSA 5ECNB 4MK3A 4EUYA 2JZSA 4NMUA 4QQ7A 1TK0B 1O8WA 3F3QA 1ZOFA 2LQOA 5F05A 4RUVA 3TKSA 4PURA 1UVZA 2GTUA 2NVLA 1S3DA 2DC5A 1PSQA 3HZ4A 1T4ZA 1PKWA 3U6VA 3IC8A 4JEDA 1R5AA 5IPGA 1EGOA 1B9XC 5IMFA 2FWHA 1K0NA 1FAAA 5EVOA 2HZEA 2K9FA 2OE3A 2YJ7A 2YWIA 4HEA2 5J3RA 4HZ2A 2HLSA 1NHOA 2FGXA 2QKEA 1VF1A 4LL1B 4L0UA 3QOUA 1FO5A 4K7NA 1GH2A 1AQVA 4FYCA 5HR0A 3DVWA 4YQVA 4BVXA 3A5WA 3QDNA 4MZWA 2OJLA 4GSNA 4BWSA 1Y6EA 4KDYA 2FWEA 3SWLA 1TK8B 4XRAA 5IOWA 4LMWA 3APSA 1OKDA 3NIVA 1JHBA 2PBJA 3APQA 3APOA 3I6AA 5BMUA 5LD0A 1WJKA 3TJBA 4IBPA 5J5NA 1U3IA 3IRAA 2HSMA 2LQQA 1R4WA 2X8GA 1DE1A 5ECMB 4GRFA 2IMIA 3Q74A 1TRUA 3HJPA 3MSZA 5HFGA 3MAKA 1M99A 3LWAA 1X9MB 4G9HA 2B3SA 3MWHA 4V2LA 1B9YC 1O7UA 3GHAA 1BAYA 2HZEB 4DEJA 4IGJA 1BJXA 1SYRA 3J7Yb 2YNXA 1GSEA 1U3AA 4ZBBA 5IMVA 3IHQA 1TDIA 3BCKA 4PGTA 3ED3A 2R6KA 2WJUA 2PMTA 2OADA 3I69A 1YZXA 2R37A 5KN3A 4WEYA 4BVXB 3CMIA 1JZOA 2PERA 3DVXA 1XCCA 4JR4A 1GUKA 1M9BA 4YQMA 3DD3A 3EINA 3LYKA 3EWLA 5IMDA 3RAZA 2AJQB 2L5OA 3CBUA 1A23A 2CX4A 1WRYA 3KGKA 5H5SA 5LNKe 5ECOB 2N5FA 2EIOA 2PUKC 2K18A 5CREA 2O7KA 4ZBAA 3KMNA 2H30A 4AJ8A 3DKSA 3GTUB 2XBIA 3VI7A 4EDYA 2GSRA 1Q98A 5A4UA 3VWWA 5D9XA 2B7KA 2VD0A 1AC1A 2I9HA 3ZREA 4LL4B 1TW9A 3M1GA 5DCHA 1DBYA 1EEMA 3PR8A 2K6VA 1T3BA 2J23A 1TU7A 4XTSA 3O76A 5D8IA 2LJAA 2ZUPA 1E2YA 1GUMA 1ZYQB 2H1GA 3JCML 2VL9A 1XWGA 4MF7A 2M46A 1QUWA 2CV4A 1W89A 2YJHA 3VLNA 3H4KA 1HNBA 3H79A 4EL1A 2RUFA 1XXUA 4MDCA 5ELGA 3VFIA 3KD0A 3IAM2 3W6GA 5A4VA 4F0BA 5ECQB 4KW6A 3IBHA 22GSA 1NSWA 1X9WB 5DAKA 3TDGA 3KH7A 1SK0A 2CAIA 4ULXA 1PRXA 2H6XA 4V1Ap 4XS4A 5DDLA 1FB6A 5A5KA 1PA3A 1ST9A 1YF1A 3IV4A 4FO5A 1YJ6A 4Q5RA 14GSA 2MBTA 3UL3A 1K0AA 4O92A 1SD9A 4WR4A 1OC8A 1ERWA 1THXA 3EURA 2RLIA 2VIMA 1TRSA 3DXBA 2VCWA 2RM6A 3ZMLA 1GL8A 1LBKA 3IXRA 2YV7A 13GSA 2TIRA 1ZCPA 2GLRA 1SENA 1G6WA 2PGTA 3GA4A 2P0GA 2VCVA 2GQMA 2H1BA 5AN1A 2XPEA 2XPDA 2CT6A 2F51A 3A2WA 2PVQA 1KBNA 2CA8A 2JADA 2IWTA 1YKCA 3ZFLA 4CHSA 3QAVA 4MF5A 5DQSA 1JZDA 4F2IA 2B5EA 1M9AA 4TN8A 2EC4A 4ZBDA 1FVKA 4TR1B 5G31A 2LJRA 1EP8A 1SJZA 1SL0B 2ALBA 3ZYWA 1X0RA 5DAKB 1J0FA 3TJFA 3O6TA 4J56E 1UN2A 3L78A 1TRVA 1PL1A 2IMDA 5AIVA 3TKQA 3A2VA 2L6DA 3E9JB 2C0DA 2FA8A 5D93A 2DLXA 5JCUA 4XS4B 3ZFBA 1G0TA 3DYRA 1EEJA 3FRCA 5ECRB 3HZ8A 1A2JA 1K3YA 3L9UA 2HYXA 3HD5A 2YPMA 2YOIA 1M0UA 1GRXA 1GTIA 3BCIA 3UBKA 1ACVA 3LEFA 1BX9A 4I8BA 1X5CA 2LRCA 3HXSA 2J9HA 3LG6A 1YEPA 3QMXA 3N5OA 3L4NA 3BOAA 2CZ3A 3QAWA 2GDRA 3QD9A 1IYIA 2WGRA 4K7OA 2F3MA 5EY6A 4K7IA 4I97A 4FH8A 3LQ7A 2FHEA 2WULA 4YH2A 3TJKA 5DCGA 1HD2A 3DEXA 4I2UA 2NPBA 5ECHB 2PVOC 3TUEA 3PPUA 1XWCA 1QK8A 2CAQA 1V58A 3TKRA 4ECCA 1OC9A 3TOTA 3J7Yk 3I9V2 4X43A 3LXZA 4OMVA 4GXZA 4RQRA 4ZB8A 3GL3A 4JRRA 2JU5A 4MABA 2XC2A 2Z9SA 2NDOA 3LJRA 1R26A 4PUFC 4PUAA 4O7HA 2CX3A 4MH3A 1PX7A 2FNOA 2H0HA 3GKMA 3ZIJA 3K8NA 1JLVA 2GSQA 1K0DA 1FW1A 1O85A 3BJ5A 1YF0A 3KEBA 1GSUA 1T7PB 4TVEA 2H0IA 2V1MA 2G0FA 5G5EA 1B4PA 2XHFA 2X99A 3FY7A 3UVHA 4AF2A 4WF5A 2C3TA 1V40A 4BPYA 1MD4A 2CVBA 2V6KA 2FCHA 4LA1A 1USBA 4CDOA 1MDKA 3GKKA 1S3AA 5FT3A 2B6MA 2DMLA 3C8EA 1NW2A 2L4QA 3EE2A 4NWYA 4G0LA 3ME7A 3FR6A 4BL7A 3FKFA 2HXKA 4K2DA 2NTOA 3FZAA 3FZ9A 1MDJA 4X0XA 2HRKA 2YZHA 4ZB9A 3F6DA 2VCXA 1SL1B 3TRQA 3ZVJD 6GSXA 2AAWA 4DVCA 3FYGA 3WD6A 3F4SA 1KEBA 4KNDA 1JZWA 3GYKA 2CVDA 4ML1A 2GSSA 1F3AA 4CW9A 5IMZA 4Q5QA 2YANA 2IMFA 1G6YA 2KP2A 4EF0A 1TOFA 4KX4A 20GSA 2HNLA 4O5RA 3O3TA 4TXOA 5J4UA 4IW9A 5G5FA 2LNSA 4NXIA 1LU4A 4PNGA 1R5PA 4PXOA 3C7MA 3LGCA 1N2AA 2OBIA 1F3BA 3L9VA 1SK1A 16GSA 2DBCA 4N0VA 4IHUA 2VCZA 3FR3A 3MNGA 2JL4A 3HY2A 4K0NA 1QFNA 4L8EA 4GLTA 3ZL5A 1XFLA 4KGIA 5CP1A 4FIWA 1QQ2A 3C73A 1Z6NA 1PQNA 5ECSA 2H70A 4BL7B 3UAPA 3KCMA 1ZYEA 1YKAA 4XS6A 3D0ZA 5IOXA 1SD8A 2GVPA 1ZZYA 1XIYA 4XCSA 2IFQA 4N0ZA 1JLWA 4HOJA
chains in the Genus database with same CATH superfamily
2WS2A 5HR1A 4KAEA 3IC4A 2AUVA 4ILFA 2H75A 3W8SA 2A4VA 2RUEA 1OYJA 2HSYA 4KB3A 3E0UA 2REMA 1GTUA 2XBQA 5C00A 5KN0A 4BIKA 1M3JA 2FWFA 3WGDA 5F06A 2N5AA 3L9SA 3DGQA 2B1KA 2YCDA 1O81A 3F3RA 2HRAA 1MEKA 1AW9A 3TJGA 2M80A 5IO0A 1AQXA 2KOKA 3VK9A 4IQ1A 1O8XA 2F8FA 6GSWA 4GQFA 4DSQA 1X5DA 2DJ1A 4JZQA 3M8NA 3GUSA 3HYPA 2H6ZA 3KP8A 2DJ0A 2E2GA 5C04A 2GZYA 2WVXB 4XHMA 1QXHA 3FZ4A 3IK7A 2EFHA 4OD7A 4PNFA 1BF5A 3R2QA 5L71A 2L59A 4ECBA 1R7HA 3DWVA 4ZL8A 3LFLA 1THOA 4BVYA 1VGLA 1Z9HA 1PGTA 3QCPA 3UIWA 5IIZA 2O36A 5LCZA 2B5XA 2TRXA 1V9WA 1AIUA 3HVNA 3ME8A 5BMUB 2X8CA 1XPVA 4TR3A 2R0GA 5AGYA 4WF4A 4DSRA 5KN2A 2HSMB 1GNWA 4TW5A 2I3YA 2H66A 3HVVA 1HQOA 1V98A 2H0GA 1M2DA 3VWXA 3UJ1A 4E8HA 4KA0A 4HJ2A 2NBSA 1K0CA 4K0GA 2ZNMA 2UZ8A 5ID2A 4HQSA 4NPBA 2A2PA 1FG4A 2H1AA 1EV9A 4LLRA 3SBCA 2PU9C 1O73A 2VL2A 2YWMA 5HQPA 3GIXA 2JSZA 2FA4A 2N5BA 3CSIA 2H74A 2VAFA 4OFMA 4NV5A 3HKRA 1K3OA 3HHVA 4G0IA 3F4RA 3HJOA 2VCQA 3DMLA 8GSSA 3BD2A 3F63A 5EL8A 3LYPA 3F0IA 1DE2A 1OVNA 4N3ZA 4G19A 3FMWA 4USSA 2RIIA 5IQYA 2GS3A 3I43A 1GLQA 3D5JA 4MJCA 4PQHA 1IYHA 2JSYA 2BJXA 2H1DA 2HI7A 3F4TA 1EWXA 4ZB6A 4D73A 1F9MA 2K8VA 2C1YA 2L5LA 2VL3A 2VM1A 1XZOA 4NV2A 2I1UA 5G2ZA 2LEGA 1NM3A 3D4MA 5AISA 3ZLPA 4WKWA 5DJLA 4W66A 1CQHA 1ML6A 2OKAA 1A8LA 4ECIA 2FUG2 1J9BA 3C1SA 1ZL9A 5KOXA 4POBA 2VOCA 1Z7PA 4MCUA 1SK2A 1PMTA 4GTUA 2C3QA 5B6MA 1JFUA 2DKHA 2O85A 4MP4A 3EU3A 5CRGA 11GSA 2OA7A 5ENUA 4G0KA 2C0EA 3TRPA 4H86A 4G2EA 1PKZA 4GCIA 5J4YA 1SKSB 1EP7A 3EU4A 1URMA 1A2MA 1YY7A 1BG1A 4GSSA 5B6NA 2LKUA 1GP1A 3IHGA 4KSMA 5JWQB 1UC7A 3NZNA 4PI2C 2VLTA 4POMA 1ERVA 3G9BA 4KCEA 4IVFA 1G7EA 6GSUA 3FK8A 2L6CA 3CYNA 3EC3A 3KJYA 1GSYA 2ZCTA 18GSA 2EFDA 2LTKA 4POLA 2L57A 3M0FA 2AHEA 4MJEA 5DJMA 3IDVA 1E6BA 1X9SB 4D73B 1GSDA 4K5RA 1T4YA 4OO5A 3U5RE 2MMAA 1VF4A 4V2NA 5KN1A 2LS5A 1XVQA 1I5GA 3WT1A 1ERUA 3DRNA 4EVMA 4L5LA 4ML6A 4WETA 5HR3A 3GSTA 5HR2A 2YP6A 2H1LA 4OO4A 1BG5A 1A8YA 1V57A 4YKGA 4MPFA 4K1FA 5D73A 3M9JA 3CWGA 3AY8A 2H6YA 5D9TA 1HNAA 5A1NA 3ERFA 2CQ9A 2WRTA 3MYDA 4N10A 4EKZA 2H72A 1SYXA 5ELAA 1T00A 1FOVA 3F6FA 1A2LA 1PX6A 3FEUA 4HU9A 3PGTA 1DSBA 2LV3A 3KMOA 1S4BP 4AJ6A 2WW3A 1TI3A 2F9SA 2GQLA 2DJ3A 1QGVA 3E3EA 2GT6A 2PN8A 2OT3A 4Z7XA 1M2BA 2ON5A 2WW1A 1TXXA 3RBTA 1K0MA 2VL2C 1BYEA 3A3TA 4Q5NA 2A4HA 1NHYA 4IJIA 1TJDA 4MA9A 1ZMAA 5E59A 4GQCA 3TOUA 3CQFA 2WB9A 5G1LA 1AXDA 4F9ZA 2H19A 1GSQA 5DALA 5ECPB 3QFBC 2F8AA 1X5EA 1EV4A 1KNGA 2BMXA 3CTFA 2OBKA 2GGTA 4AJ7A 3BBYA 2MMOA 5J4VA 1OC3A 1B48A 1M2AA 2C80A 4K2XA 5GAPD 1QMVA 2WDUA 3CSHA 4NAXA 3NOFA 1ILOA 4WXTA 1GSSA 3TKSE 4RI7A 1RK4A 1K0BA 1SJ6A 4K8MA 4QL7A 1FVJA 2L4CA 4F0CA 1A0RP 2R5GA 4IP1A 4IELA 4J2FA 4OFTA 1GTAA 2EIQA 4ISDA 4O5QA 5KEJA 3HVXA 4KDUA 4AKGA 2YN1A 3ZTLA 3EMXA 4XS1A 2AV4A 3WGEA 1BQ7A 4HJMA 1OC9B 3IPZA 5J40A 3ERGA 4MH2A 2MMNA 2RM5A 2TRCP 3CRUA 4LMVA 1GTBA 5D9WA 1XWBA 5INYA 3LW9A 4JBBA 2OACA 4BWQA 4OCFA 4HZ4A 6GSSA 1ZYNA 5B8BA 1WPIA 2LUSA 1WE0A 5DALB 1G7OA 2DJJA 3GL5A 3ZMKA 5EPFA 3WYWA 2VCTA 2HSHA 2HT9A 2E0QA 5AIXA 1GULA 3Q18A 1GWCA 3UOMA 3A2XA 4TKYA 1U88A 1ERTA 4GDFA 4EDZA 3HVSA 5F07A 1RQMA 5DBQA 2PWJA 1CQGA 3GFKA 3F9UA 4YQUA 2YWOA 3TB2A 1GUHA 3EYTA 4MF6A 1WP0A 2AYTA 3KTLA 1GSFA 3GRXA 4J57E 4MZCA 2PPTA 5GSSA 3FZ5A 4MPGA 2C0FA 2V6OA 3QAGA 4IS0A 2HFDA 2FLSA 6GSYA 2KUCA 4E8EA 2X49A 3UBLA 5ECLB 4BA7A 4HQZA 4GWRA 3F8UA 2HE3A 3HDCA 7GSSA 2MBSA 2FD3A 1T8EB 2WCIA 4NHWA 2H71A 4TR4A 1XW9A 5CNWA 4IN0A 2JZRA 3GV1A 2JZTA 1WWJA 1UA5A 3P90A 2HRKB 4PI0C 3TRXA 4AGSA 5J9CA 5DQYA 1V2AA 2CZ2A 1XW5A 3FW2A 4MJAA 1XWKA 3C71A 3CTGA 1XOBA 19GSA 5B8AA 1H75A 2EIRA 1Y25A 5ECIB 5D9VA 4EO3A 3EMPA 1O6JA 4MMMA 3M3MA 3EVIA 5ECKB 2WFCA 4IP6A 1WIKA 3UEMA 2IL3A 2P5QA 3C1RA 5G1KA 1A0FA 3P7XA 3GTUA 3GKXA 1OE7A 4TXOB 2C3NA 1ON4A 2HSNB 1BEDA 1EZKA 1PFOA 1RW1A 4TRXA 1TTZA 2X4AA 3GNJA 1XVWA 1B8XA 4QL9A 3VPQA 3KP9A 2FY6A 1PN9A 4PQ1A 5DVBA 5FWGA 3P2AA 4X1UA 2B5YA 4ZIJA 4O32A 2YV9A 4JE1A 4TXVA 3D22A 3KM6A 3IA1A 4O5UA 2DJKA 1GLPA 2B7JA 5J41A 5CRHA 2MYGA 1AAZA 3S9FA 1TU8A 2HZFA 2JACA 3FHKA 5G30A 4G10A 2O89A 2A2SA 2H76A 1PL2A 2C8UA 1WMJA 3RPPA 4Q5FA 3GX8A 1A24A 4TOPA 1XOAA 2IFQB 3TJJA 2O5VA 4HDEA 3IAS2 3N9JA 1MD3A 4YAVA 2R0CA 1N8JA 1LJRA 4FYBA 1T1VA 2I81A 4HUAA 6GSTA 4IJ3A 3HJMA 1TI1A 4HI7A 2GQKA 2VKZG 3VWVA 1K3LA 4I2TA 5COHA 1EOHA 2V32A 4POKA 2DSAA 3G7JA 3V1WA 3TKPA 1TXUA 4KF9A 2IIYA 2QGVA 1TK5B 4K9ZA 4ID0A 3RHBA 4EXJA 1XW6A 3TKSC 3QR6A 4PQIA 1DUGA 4YAPA 4L5OA 2P31A 1VF2A 3H8QA 5HFIA 3D6IA 1SKRB 2LSTA 4ECJA 3GURA 5J9BA 1OAZA 3D4TA 1K0OA 1FHEA 3TGZA 3PH9A 4QMKA 5JCGA 3RHCA 1MDIA 5B7CA 2VM2A 4BVYB 3QPMA 1GNEA 2KP1A 5CRWA 1EGRA 4F03A 4TR1A 1YQ1A 1J08A 2DIYA 4I5QA 2P5RA 2IMKA 2O87A 17GSA 4TR0A 4AKIA 3ERWA 1S3RA 4GF0A 3IK9A 1B4QA 4HU7A 3LSZA 4JU5A 3VPTA 5GSTA 4P3YB 4EE0A 2IPAA 3ZVJA 4GSTA 2ON7A 4PX1A 1S3CA 5A4WA 5IM9A 5ID2B 3P8WA 4ZXGA 2IMEA 2R2JA 1ZGNA 2I4AA 2YZUA 2HQTA 4NHZA 5F8BA 5CO3A 2HRFA 2V41A 4KE3A 2BTOT 3ZITA 3GN3A 3G7YA 1F37A 2VLVA 5GAND 3R3EA 1OKTA 3Q19A 4XIHA 3CSJA 5CAXA 4MLYA 3RDWA 3GMFA 3KZQA 4V2MA 2X64A 3WGXA 4KCAA 3KIJA 4PTSA 3RPNA 4RQXA 2LJKA 2H01A 1F2EA 3LXTA 1YDKA 3OR5A 1AUCA 4MJBA 1I9DA 1YEXA 4I6XA 3IR4A 4V1Ag 4FYUA 3H93A 1H4OA 3Q6OA 2H8LA 4KUNA 5GZZB 2OE0A 1XWAA 3CXGA 6GSVA 1Z5YE 4OWYA 2G2QA 5JWRB 4WR5A 2KLXA 4WBRD 5CRDA 4L0WA 3US3A 3ISOA 2LNTA 2LRTA 2R4VA 5IMAA 2MMZA 4E68A 2MZCA 4YKFA 4FQUA 2YWNA 5IPHA 4ZILA 12GSA 1EOGA 3KH9A 1OE8A 2K8SA 3LORA 4XRDA 1YVLA 3VI5A 4N30A 2FWGA 4K6XA 3ZZXA 5E4WA 3ZIVA 3VWUA 4F82A 4ZL9A 3H1NA 3D21A 2WW2A 2AB6A 5JCWA 3FR9A 1PD21 4OFNA 1SL2B 4K5SA 2O8VB 10GSA 4DSSA 4RI6A 3DIEA 4MZBA 2GZZA 5F0GA 2KHPA 4AI6A 3ZRDA 1JZRA 2GSTA 2H73A 9GSSA 2DMMA 4IQAA 2V2GA 2GZPA 2VO4A 2ES7A 1TKDB 3MIXA 2E2MA 4KSOA 1AQWA 3UMAA 1N25A 2D2ZA 1HNCA 2R0PA 3GKNA 1M7TA 3L0HA 1FB0A 1SU9A 3WT2A 1KTEA 3TCOA 2WVZA 2GT5A 4IKHA 4ICYA 5FHIA 1SKWB 2C4JA 3G7IA 2DJ2A 3QFAC 1U87A 3M9KA 3A5IA 3HA9A 4JR6A 4OCEA 1Q4JA 2E7PA 3UARA 1ABAA 2WZ9A 3VURA 3GX0A 5A1NB 4A5PA 3CRTA 1SJIA 4G01A 4EC0A 5A5HA 3IE3A 5A34A 1Z7RA 4PHZC 2DIZA 5IMCA 1C72A 3RFRC 5CYYA 2LRNA 2OE1A 5HFKA 1TRWA 5JWOB 3KXOA 4KH7A 1U6TA 3GH9A 3MDKA 2HRNA 1W4VA 3GH6A 5D96A 4DSSB 4HS1A 2CVKA 1I1IP 2VUPA 1Z3EA 1MTCA 5ABRA 2QSIA 1F6MC 2IN3A 3PINA 1TP9A 4ZL7A 1Z6MA 1XBSA 5H5QA 4KDXA 2VD1A 5IO2A 3KTBA 1VRSD 1WOUA 2QC7A 5H5RA 3GSSA 4N11A 1VF3A 2VLUA 4WBJA 2M72A 3HCZA 2X8HA 3IOSA 3W8JA 3UVTA 2B1LA 2IJYA 2C0GA 1HYUA 2R3XA 2A2RA 4ACSA 5ECNB 4MK3A 4EUYA 2JZSA 4NMUA 4QQ7A 1TK0B 1O8WA 3F3QA 1ZOFA 2LQOA 5F05A 4RUVA 3TKSA 4PURA 1UVZA 2GTUA 2NVLA 1S3DA 2DC5A 1PSQA 5A5HB 3HZ4A 5A34B 1T4ZA 1PKWA 3U6VA 3IC8A 4JEDA 1R5AA 5IPGA 1EGOA 4AKHA 1B9XC 5IMFA 2FWHA 1K0NA 1FAAA 5EVOA 2HZEA 2K9FA 2OE3A 2YJ7A 2YWIA 4HEA2 5J3RA 4HZ2A 2HLSA 1NHOA 2FGXA 2QKEA 2WW0A 1VF1A 4LL1B 1ZYPA 4L0UA 3QOUA 1FO5A 4K7NA 1GH2A 1AQVA 4HSCX 4FYCA 5HR0A 3DVWA 4YQVA 4BVXA 3A5WA 3QDNA 4MZWA 2OJLA 4GSNA 4BWSA 1Y6EA 4KDYA 2FWEA 3SWLA 1TK8B 4XRAA 5IOWA 4LMWA 3APSA 1OKDA 3NIVA 1JHBA 2PBJA 3APQA 3APOA 3I6AA 5BMUA 5LD0A 1WJKA 2QA1A 3RGBC 3TJBA 4IBPA 5J5NA 1U3IA 3IRAA 2HSMA 2LQQA 1R4WA 2X8GA 1DE1A 5ECMB 4GRFA 2IMIA 3Q74A 1TRUA 3HJPA 3MSZA 5HFGA 3MAKA 1M99A 3LWAA 1X9MB 4Z2RA 4G9HA 2B3SA 3MWHA 2WZSA 4V2LA 1B9YC 1O7UA 3GHAA 1BAYA 2HZEB 4DEJA 4IGJA 1BJXA 1SYRA 3J7Yb 2YNXA 1GSEA 3TU3B 4ZBBA 1U3AA 3IHQA 5IMVA 1TDIA 3BCKA 4PGTA 3ED3A 2R6KA 2WJUA 2PMTA 2OADA 3I69A 1YZXA 2R37A 5KN3A 4WEYA 4BVXB 3CMIA 1JZOA 4Z2UA 2PERA 3DVXA 1XCCA 4JR4A 1GUKA 1M9BA 4YQMA 3DD3A 3EINA 3LYKA 3EWLA 5IMDA 3RAZA 2AJQB 2L5OA 3CBUA 1A23A 2CX4A 1WRYA 2WVYA 3KGKA 5H5SA 5LNKe 5ECOB 2N5FA 2EIOA 2PUKC 2K18A 2QA2A 5CREA 2O7KA 4ZBAA 3KMNA 2H30A 4AJ8A 3DKSA 4EIQA 3GTUB 2XBIA 3VI7A 4EDYA 2GSRA 1Q98A 5A4UA 3VWWA 5D9XA 2B7KA 2VD0A 1AC1A 2I9HA 3ZREA 4LL4B 1TW9A 3M1GA 5DCHA 1DBYA 1EEMA 3PR8A 2K6VA 1T3BA 3CHXC 2J23A 1TU7A 4XTSA 3O76A 5D8IA 2LJAA 2ZUPA 1E2YA 4Z2TA 1GUMA 1ZYQB 2H1GA 3JCML 2VL9A 1XWGA 4MF7A 2M46A 1QUWA 2CV4A 1W89A 2YJHA 3VLNA 3H4KA 1HNBA 3H79A 4EL1A 2RUFA 1XXUA 4MDCA 5ELGA 3VFIA 3KD0A 3IAM2 1SVOA 3W6GA 5A4VA 4X4JA 4F0BA 5ECQB 4KW6A 1SVMA 3IBHA 22GSA 1NSWA 1X9WB 5DAKA 3TDGA 3KH7A 1SK0A 2CAIA 4ULXA 1PRXA 2H6XA 4V1Ap 4XS4A 1YEWC 5DDLA 1FB6A 1FOHA 5A5KA 1PA3A 5BRTA 1ST9A 1YF1A 3IV4A 4FO5A 1YJ6A 4Q5RA 14GSA 2MBTA 1M3IA 3UL3A 1K0AA 4O92A 1SD9A 4WR4A 1OC8A 1ERWA 1THXA 3EURA 2RLIA 2VIMA 1TRSA 3DXBA 2VCWA 2RM6A 3ZMLA 1GL8A 1LBKA 3IXRA 4AKXB 2YV7A 13GSA 2TIRA 2UV8G 1ZCPA 2GLRA 1SENA 1G6WA 2PGTA 3GA4A 2P0GA 2VCVA 2GQMA 2H1BA 4CY6A 5AN1A 2XPEA 2XPDA 2CT6A 2F51A 3A2WA 2PVQA 1KBNA 2O3EA 2CA8A 2JADA 2IWTA 1YKCA 3ZFLA 4CHSA 3QAVA 4MF5A 5DQSA 1JZDA 4F2IA 2B5EA 2DKIA 1M9AA 4TN8A 3EPTA 2EC4A 4ZBDA 1FVKA 4TR1B 5G31A 2LJRA 1EP8A 1SJZA 1SL0B 2ALBA 3ZYWA 1X0RA 4EIPA 5DAKB 1J0FA 3TJFA 3O6TA 4J56E 1UN2A 3L78A 1TRVA 1PL1A 2IMDA 5AIVA 3TKQA 3A2VA 2L6DA 3E9JB 2C0DA 2EFEA 2FA8A 5D93A 2DLXA 5JCUA 4XS4B 3ZFBA 1G0TA 3DYRA 1XG8A 1EEJA 3FRCA 5ECRB 3HZ8A 1A2JA 1K3YA 3L9UA 2HYXA 3HD5A 5KOWA 2YPMA 2YOIA 1M0UA 1GRXA 1GTIA 3BCIA 3UBKA 1ACVA 3LEFA 1BX9A 4I8BA 1X5CA 2LRCA 3HXSA 2J9HA 3LG6A 1YEPA 3QMXA 3N5OA 3L4NA 3BOAA 2CZ3A 3QAWA 2GDRA 3QD9A 1IYIA 2WGRA 4K7OA 2F3MA 5EY6A 4K7IA 4I97A 4FH8A 3LQ7A 2FHEA 2WULA 4YH2A 3TJKA 1SVLA 5DCGA 1HD2A 3DEXA 4I2UA 2NPBA 5ECHB 2PVOC 3TUEA 3PPUA 1XWCA 1QK8A 2CAQA 1V58A 3TKRA 4ECCA 1OC9A 3TOTA 3J7Yk 3I9V2 4X43A 3LXZA 4OMVA 4GXZA 4RQRA 4ZB8A 1PN0A 4ZB7A 3GL3A 4JRRA 2JU5A 4MABA 2XC2A 2Z9SA 2NDOA 3LJRA 1R26A 4PUFC 4PUAA 4O7HA 2CX3A 4MH3A 1PX7A 2FNOA 2H0HA 3GKMA 3ZIJA 3K8NA 1JLVA 2GSQA 1K0DA 1FW1A 1O85A 3BJ5A 1YF0A 3KEBA 1GSUA 2EFCA 1T7PB 4TVEA 2H0IA 2V1MA 1Y1UA 2G0FA 5G5EA 1B4PA 2XHFA 2X99A 3FY7A 3UVHA 4AF2A 4WF5A 4FXYP 2C3TA 1V40A 4BPYA 5J47A 1MD4A 2CVBA 2V6KA 2FCHA 4LA1A 1USBA 4CDOA 1MDKA 3GKKA 1S3AA 5FT3A 2B6MA 2DMLA 3C8EA 1NW2A 2L4QA 3EE2A 4NWYA 4G0LA 3ME7A 3FR6A 4BL7A 3FKFA 2HXKA 4K2DA 2NTOA 3FZAA 3FZ9A 1MDJA 4X0XA 2HRKA 2YZHA 4ZB9A 3F6DA 2VCXA 1SL1B 3TRQA 3ZVJD 6GSXA 2AAWA 4DVCA 3FYGA 3WD6A 3F4SA 1KEBA 4KNDA 1JZWA 3GYKA 2CVDA 4ML1A 2GSSA 1F3AA 4CW9A 5IMZA 4Q5QA 2YANA 2IMFA 1G6YA 2KP2A 4EF0A 1TOFA 4KX4A 20GSA 2HNLA 4O5RA 3O3TA 4TXOA 5J4UA 4IW9A 5G5FA 2HSNA 2LNSA 4NXIA 1LU4A 4PNGA 1R5PA 4PXOA 3C7MA 3LGCA 1N2AA 2OBIA 1F3BA 3L9VA 1SK1A 16GSA 2DBCA 4N0VA 4IHUA 2VCZA 3FR3A 2WVXA 3MNGA 2JL4A 3HY2A 4K0NA 1QFNA 4L8EA 4GLTA 3ZL5A 1XFLA 4KGIA 5CP1A 4FIWA 1QQ2A 3C73A 1Z6NA 1PQNA 5ECSA 2H70A 4BL7B 3UAPA 3KCMA 1ZYEA 1YKAA 4XS6A 3D0ZA 5IOXA 1SD8A 2GVPA 4MNNA 1ZZYA 1XIYA 4XCSA 2IFQA 4N0ZA 4CY8A 1JLWA 3HMJG 4HOJA
chains in the Genus database with same CATH topology
2WS2A 5HR1A 4KAEA 3IC4A 2AUVA 4ILFA 2H75A 3W8SA 2A4VA 2RUEA 1OYJA 2HSYA 4KB3A 3E0UA 2REMA 1GTUA 2XBQA 5C00A 5KN0A 3WGDA 2FWFA 5F06A 2N5AA 3L9SA 3DGQA 2B1KA 2YCDA 1O81A 3F3RA 2HRAA 1MEKA 1AW9A 3TJGA 2M80A 5IO0A 1AQXA 2KOKA 3VK9A 4IQ1A 1O8XA 2F8FA 6GSWA 4GQFA 4DSQA 1X5DA 2DJ1A 4JZQA 3M8NA 3GUSA 3HYPA 2H6ZA 3KP8A 2DJ0A 2E2GA 5C04A 2GZYA 4XHMA 1QXHA 3FZ4A 3IK7A 2EFHA 4OD7A 4PNFA 1BF5A 3R2QA 5L71A 2L59A 4ECBA 1R7HA 3DWVA 4ZL8A 3LFLA 1THOA 4BVYA 1VGLA 1Z9HA 1PGTA 3QCPA 3UIWA 5IIZA 5LCZA 2B5XA 2TRXA 1V9WA 1AIUA 3ME8A 5BMUB 2X8CA 1XPVA 4TR3A 2R0GA 5AGYA 4WF4A 4DSRA 5KN2A 2HSMB 1GNWA 4TW5A 2I3YA 2H66A 3HVVA 1HQOA 1V98A 2H0GA 1M2DA 3VWXA 3UJ1A 4E8HA 4KA0A 4HJ2A 2NBSA 1K0CA 4K0GA 2ZNMA 2UZ8A 5ID2A 4HQSA 4NPBA 2A2PA 1FG4A 2H1AA 1EV9A 4LLRA 3SBCA 2PU9C 1O73A 2VL2A 2YWMA 5HQPA 3GIXA 2JSZA 2FA4A 2N5BA 3CSIA 2H74A 2VAFA 4OFMA 4NV5A 3HKRA 1K3OA 3HHVA 4G0IA 3F4RA 3HJOA 2VCQA 3DMLA 8GSSA 3BD2A 3F63A 5EL8A 3LYPA 3F0IA 1DE2A 1OVNA 4N3ZA 4G19A 3FMWA 4USSA 2RIIA 5IQYA 2GS3A 3I43A 1GLQA 3D5JA 4MJCA 4PQHA 1IYHA 2JSYA 2BJXA 2H1DA 2HI7A 3F4TA 1EWXA 4ZB6A 4D73A 1F9MA 2K8VA 2C1YA 2L5LA 2VL3A 2VM1A 1XZOA 4NV2A 2I1UA 5G2ZA 2LEGA 1NM3A 3D4MA 5AISA 3ZLPA 4WKWA 5DJLA 4W66A 1CQHA 1ML6A 2OKAA 1A8LA 4ECIA 2FUG2 1J9BA 3C1SA 1ZL9A 5KOXA 4POBA 2VOCA 1Z7PA 4MCUA 1SK2A 1PMTA 4GTUA 2C3QA 5B6MA 1JFUA 2DKHA 2O85A 4MP4A 3EU3A 5CRGA 11GSA 2OA7A 5ENUA 4G0KA 2C0EA 3TRPA 4H86A 4G2EA 1PKZA 4GCIA 5J4YA 1SKSB 1EP7A 3EU4A 1URMA 1A2MA 1YY7A 1BG1A 4GSSA 5B6NA 2LKUA 1GP1A 3IHGA 4KSMA 5JWQB 1UC7A 3NZNA 2VLTA 4POMA 1ERVA 3G9BA 4KCEA 4IVFA 1G7EA 6GSUA 3FK8A 2L6CA 3CYNA 3EC3A 3KJYA 1GSYA 2ZCTA 18GSA 2EFDA 2LTKA 4POLA 2L57A 3M0FA 2AHEA 4MJEA 5DJMA 3IDVA 1E6BA 1X9SB 4D73B 1GSDA 4K5RA 1T4YA 4OO5A 3U5RE 2MMAA 1VF4A 4V2NA 5KN1A 2LS5A 1XVQA 1I5GA 3WT1A 1ERUA 3DRNA 4EVMA 4L5LA 4ML6A 4WETA 5HR3A 3GSTA 5HR2A 2YP6A 2H1LA 4OO4A 1BG5A 1A8YA 1V57A 4YKGA 4MPFA 4K1FA 5D73A 3M9JA 3CWGA 3AY8A 2H6YA 5D9TA 1HNAA 5A1NA 3ERFA 2CQ9A 2WRTA 3MYDA 4N10A 4EKZA 2H72A 1SYXA 5ELAA 1T00A 1FOVA 3F6FA 1A2LA 1PX6A 3FEUA 4HU9A 3PGTA 1DSBA 2LV3A 3KMOA 4AJ6A 1TI3A 2F9SA 2GQLA 2DJ3A 1QGVA 3E3EA 2GT6A 2PN8A 2OT3A 4Z7XA 1M2BA 2ON5A 1TXXA 3RBTA 1K0MA 2VL2C 1BYEA 3A3TA 4Q5NA 2A4HA 1NHYA 4IJIA 1TJDA 4MA9A 1ZMAA 5E59A 4GQCA 3TOUA 2WB9A 5G1LA 1AXDA 4F9ZA 2H19A 1GSQA 5DALA 5ECPB 3QFBC 2F8AA 1X5EA 1EV4A 1KNGA 2BMXA 3CTFA 2OBKA 2GGTA 4AJ7A 3BBYA 2MMOA 5J4VA 1OC3A 1B48A 1M2AA 2C80A 4K2XA 5GAPD 1QMVA 2WDUA 3CSHA 4NAXA 3NOFA 1ILOA 4WXTA 1GSSA 3TKSE 4RI7A 1RK4A 1K0BA 1SJ6A 4K8MA 4QL7A 1FVJA 2L4CA 4F0CA 1A0RP 2R5GA 4IP1A 4IELA 4J2FA 4OFTA 1GTAA 2EIQA 4ISDA 4O5QA 5KEJA 3HVXA 4KDUA 4AKGA 2YN1A 3ZTLA 3EMXA 4XS1A 2AV4A 3WGEA 1BQ7A 4HJMA 1OC9B 3IPZA 5J40A 3ERGA 4MH2A 2MMNA 2RM5A 2TRCP 3CRUA 4LMVA 1GTBA 5D9WA 1XWBA 5INYA 3LW9A 4JBBA 2OACA 4BWQA 4OCFA 4HZ4A 6GSSA 1ZYNA 5B8BA 1WPIA 2LUSA 1WE0A 5DALB 1G7OA 2DJJA 3GL5A 3ZMKA 5EPFA 3WYWA 2VCTA 2HSHA 2HT9A 2E0QA 5AIXA 1GULA 3Q18A 1GWCA 3UOMA 3A2XA 4TKYA 1U88A 1ERTA 4GDFA 4EDZA 3HVSA 5F07A 1RQMA 5DBQA 2PWJA 1CQGA 3GFKA 3F9UA 4YQUA 2YWOA 3TB2A 1GUHA 3EYTA 4MF6A 1WP0A 2AYTA 3KTLA 1GSFA 3GRXA 4J57E 4MZCA 2PPTA 5GSSA 3FZ5A 4MPGA 2C0FA 2V6OA 3QAGA 4IS0A 2HFDA 2FLSA 6GSYA 2KUCA 4E8EA 2X49A 3UBLA 5ECLB 4BA7A 4HQZA 4GWRA 3F8UA 2HE3A 3HDCA 7GSSA 2MBSA 2FD3A 1T8EB 2WCIA 4NHWA 2H71A 4TR4A 1XW9A 5CNWA 4IN0A 2JZRA 3GV1A 2JZTA 1WWJA 1UA5A 3P90A 2HRKB 3TRXA 4AGSA 5J9CA 5DQYA 1V2AA 2CZ2A 1XW5A 3FW2A 4MJAA 1XWKA 3C71A 3CTGA 1XOBA 19GSA 5B8AA 1H75A 2EIRA 1Y25A 5ECIB 5D9VA 4EO3A 3EMPA 1O6JA 4MMMA 3M3MA 3EVIA 5ECKB 2WFCA 4IP6A 1WIKA 3UEMA 2IL3A 2P5QA 3C1RA 5G1KA 1A0FA 3P7XA 3GTUA 3GKXA 1OE7A 4TXOB 2C3NA 1ON4A 2HSNB 1BEDA 1EZKA 1RW1A 4TRXA 1TTZA 2X4AA 3GNJA 1XVWA 1B8XA 4QL9A 3VPQA 3KP9A 2FY6A 1PN9A 4PQ1A 5DVBA 5FWGA 3P2AA 4X1UA 2B5YA 4ZIJA 4O32A 2YV9A 4JE1A 4TXVA 3D22A 3KM6A 3IA1A 4O5UA 2DJKA 1GLPA 2B7JA 5J41A 5CRHA 2MYGA 1AAZA 3S9FA 1TU8A 2HZFA 2JACA 3FHKA 5G30A 4G10A 2O89A 2A2SA 2H76A 1PL2A 2C8UA 1WMJA 3RPPA 4Q5FA 3GX8A 1A24A 4TOPA 1XOAA 2IFQB 3TJJA 2O5VA 4HDEA 3IAS2 3N9JA 1MD3A 4YAVA 2R0CA 1N8JA 1LJRA 4FYBA 1T1VA 2I81A 4HUAA 6GSTA 4IJ3A 3HJMA 1TI1A 4HI7A 2GQKA 2VKZG 3VWVA 1K3LA 4I2TA 5COHA 1EOHA 2V32A 4POKA 2DSAA 3G7JA 3V1WA 3TKPA 1TXUA 4KF9A 2IIYA 2QGVA 1TK5B 4K9ZA 4ID0A 3RHBA 4EXJA 1XW6A 3TKSC 3QR6A 4PQIA 1DUGA 4YAPA 4L5OA 2P31A 1VF2A 3H8QA 5HFIA 3D6IA 1SKRB 2LSTA 4ECJA 3GURA 5J9BA 1OAZA 3D4TA 1K0OA 1FHEA 3TGZA 3PH9A 4QMKA 5JCGA 3RHCA 1MDIA 5B7CA 2VM2A 4BVYB 3QPMA 1GNEA 2KP1A 5CRWA 1EGRA 4F03A 4TR1A 1YQ1A 1J08A 2DIYA 4I5QA 2P5RA 2IMKA 2O87A 17GSA 4TR0A 4AKIA 3ERWA 4GF0A 3IK9A 1B4QA 4HU7A 3LSZA 4JU5A 3VPTA 5GSTA 4P3YB 4EE0A 2IPAA 3ZVJA 4GSTA 2ON7A 4PX1A 1S3CA 5A4WA 5IM9A 5ID2B 3P8WA 4ZXGA 2IMEA 2R2JA 1ZGNA 2I4AA 2YZUA 2HQTA 4NHZA 5F8BA 5CO3A 2HRFA 2V41A 4KE3A 2BTOT 3ZITA 3GN3A 3G7YA 1F37A 2VLVA 5GAND 3R3EA 1OKTA 3Q19A 4XIHA 3CSJA 5CAXA 4MLYA 3RDWA 3GMFA 3KZQA 4V2MA 2X64A 3WGXA 4KCAA 3KIJA 4PTSA 3RPNA 4RQXA 2LJKA 2H01A 1F2EA 3LXTA 1YDKA 3OR5A 1AUCA 4MJBA 1I9DA 1YEXA 4I6XA 3IR4A 4V1Ag 4FYUA 3H93A 1H4OA 3Q6OA 2H8LA 4KUNA 5GZZB 2OE0A 1XWAA 3CXGA 6GSVA 1Z5YE 4OWYA 2G2QA 5JWRB 4WR5A 2KLXA 4WBRD 5CRDA 4L0WA 3US3A 3ISOA 2LNTA 2LRTA 2R4VA 5IMAA 2MMZA 4E68A 2MZCA 4YKFA 4FQUA 2YWNA 5IPHA 4ZILA 12GSA 1EOGA 3KH9A 1OE8A 2K8SA 3LORA 4XRDA 1YVLA 3VI5A 4N30A 2FWGA 4K6XA 3ZZXA 5E4WA 3ZIVA 3VWUA 4F82A 4ZL9A 3H1NA 3D21A 2AB6A 5JCWA 3FR9A 1PD21 4OFNA 1SL2B 4K5SA 2O8VB 10GSA 4DSSA 4RI6A 3DIEA 4MZBA 2GZZA 5F0GA 2KHPA 4AI6A 3ZRDA 1JZRA 2GSTA 2H73A 9GSSA 2DMMA 4IQAA 2V2GA 2GZPA 2VO4A 2ES7A 1TKDB 3MIXA 2E2MA 4KSOA 1AQWA 3UMAA 1N25A 2D2ZA 1HNCA 2R0PA 3GKNA 1M7TA 3L0HA 1FB0A 1SU9A 3WT2A 1KTEA 3TCOA 2GT5A 4IKHA 4ICYA 5FHIA 1SKWB 2C4JA 3G7IA 2DJ2A 3QFAC 1U87A 3M9KA 3A5IA 3HA9A 4JR6A 4OCEA 1Q4JA 2E7PA 3UARA 1ABAA 2WZ9A 3VURA 3GX0A 5A1NB 4A5PA 3CRTA 1SJIA 4G01A 4EC0A 5A5HA 3IE3A 5A34A 1Z7RA 2DIZA 5IMCA 1C72A 5CYYA 2LRNA 2OE1A 5HFKA 1TRWA 5JWOB 3KXOA 4KH7A 1U6TA 3GH9A 3MDKA 2HRNA 1W4VA 3GH6A 5D96A 4DSSB 4HS1A 2CVKA 2VUPA 1Z3EA 1MTCA 5ABRA 2QSIA 1F6MC 2IN3A 3PINA 1TP9A 4ZL7A 1Z6MA 1XBSA 5H5QA 4KDXA 2VD1A 5IO2A 3KTBA 1VRSD 1WOUA 2QC7A 5H5RA 3GSSA 4N11A 1VF3A 2VLUA 4WBJA 2M72A 3HCZA 2X8HA 3IOSA 3W8JA 3UVTA 2B1LA 2IJYA 2C0GA 1HYUA 2R3XA 2A2RA 4ACSA 5ECNB 4MK3A 4EUYA 2JZSA 4NMUA 4QQ7A 1TK0B 1O8WA 3F3QA 1ZOFA 2LQOA 5F05A 4RUVA 3TKSA 4PURA 1UVZA 2GTUA 2NVLA 1S3DA 2DC5A 1PSQA 5A5HB 3HZ4A 5A34B 1T4ZA 1PKWA 3U6VA 3IC8A 4JEDA 1R5AA 5IPGA 1EGOA 4AKHA 1B9XC 5IMFA 2FWHA 1K0NA 1FAAA 5EVOA 2HZEA 2K9FA 2OE3A 2YJ7A 2YWIA 4HEA2 5J3RA 4HZ2A 2HLSA 1NHOA 2FGXA 2QKEA 1VF1A 4LL1B 1ZYPA 4L0UA 3QOUA 1FO5A 4K7NA 1GH2A 1AQVA 4FYCA 5HR0A 3DVWA 4YQVA 4BVXA 3A5WA 3QDNA 4MZWA 2OJLA 4GSNA 4BWSA 1Y6EA 4KDYA 2FWEA 3SWLA 1TK8B 4XRAA 5IOWA 4LMWA 3APSA 1OKDA 3NIVA 1JHBA 2PBJA 3APQA 3APOA 3I6AA 5BMUA 5LD0A 1WJKA 2QA1A 3TJBA 4IBPA 5J5NA 1U3IA 3IRAA 2HSMA 2LQQA 1R4WA 2X8GA 1DE1A 5ECMB 4GRFA 2IMIA 3Q74A 1TRUA 3HJPA 3MSZA 5HFGA 3MAKA 1M99A 3LWAA 1X9MB 4Z2RA 4G9HA 2B3SA 3MWHA 4V2LA 1B9YC 1O7UA 3GHAA 1BAYA 2HZEB 4DEJA 4IGJA 1BJXA 1SYRA 3J7Yb 2YNXA 1GSEA 3TU3B 4ZBBA 1U3AA 3IHQA 5IMVA 1TDIA 3BCKA 4PGTA 3ED3A 2R6KA 2WJUA 2PMTA 2OADA 3I69A 1YZXA 2R37A 5KN3A 4WEYA 4BVXB 3CMIA 1JZOA 4Z2UA 2PERA 3DVXA 1XCCA 4JR4A 1GUKA 1M9BA 4YQMA 3DD3A 3EINA 3LYKA 3EWLA 5IMDA 3RAZA 2AJQB 2L5OA 3CBUA 1A23A 2CX4A 1WRYA 3KGKA 5H5SA 5LNKe 5ECOB 2N5FA 2EIOA 2PUKC 2K18A 2QA2A 5CREA 2O7KA 4ZBAA 3KMNA 2H30A 4AJ8A 3DKSA 4EIQA 3GTUB 2XBIA 3VI7A 4EDYA 2GSRA 1Q98A 5A4UA 3VWWA 5D9XA 2B7KA 2VD0A 1AC1A 2I9HA 3ZREA 4LL4B 1TW9A 3M1GA 5DCHA 1DBYA 1EEMA 3PR8A 2K6VA 1T3BA 2J23A 1TU7A 4XTSA 3O76A 5D8IA 2LJAA 2ZUPA 1E2YA 4Z2TA 1GUMA 1ZYQB 2H1GA 3JCML 2VL9A 1XWGA 4MF7A 2M46A 1QUWA 2CV4A 1W89A 2YJHA 3VLNA 3H4KA 1HNBA 3H79A 4EL1A 2RUFA 1XXUA 4MDCA 5ELGA 3VFIA 3KD0A 3IAM2 1SVOA 3W6GA 5A4VA 4X4JA 4F0BA 5ECQB 4KW6A 1SVMA 3IBHA 22GSA 1NSWA 1X9WB 5DAKA 3TDGA 3KH7A 1SK0A 2CAIA 4ULXA 1PRXA 2H6XA 4V1Ap 4XS4A 5DDLA 1FB6A 1FOHA 5A5KA 1PA3A 5BRTA 1ST9A 1YF1A 3IV4A 4FO5A 1YJ6A 4Q5RA 14GSA 2MBTA 3UL3A 1K0AA 4O92A 1SD9A 4WR4A 1OC8A 1ERWA 1THXA 3EURA 2RLIA 2VIMA 1TRSA 3DXBA 2VCWA 2RM6A 3ZMLA 1GL8A 1LBKA 3IXRA 4AKXB 2YV7A 13GSA 2TIRA 2UV8G 1ZCPA 2GLRA 1SENA 1G6WA 2PGTA 3GA4A 2P0GA 2VCVA 2GQMA 2H1BA 4CY6A 5AN1A 2XPEA 2XPDA 2CT6A 2F51A 3A2WA 2PVQA 1KBNA 2CA8A 2JADA 2IWTA 1YKCA 3ZFLA 4CHSA 3QAVA 4MF5A 5DQSA 1JZDA 4F2IA 2B5EA 2DKIA 1M9AA 4TN8A 3EPTA 2EC4A 4ZBDA 1FVKA 4TR1B 5G31A 2LJRA 1EP8A 1SJZA 1SL0B 2ALBA 3ZYWA 1X0RA 4EIPA 5DAKB 1J0FA 3TJFA 3O6TA 4J56E 1UN2A 3L78A 1TRVA 1PL1A 2IMDA 5AIVA 3TKQA 3A2VA 2L6DA 3E9JB 2C0DA 2EFEA 2FA8A 5D93A 2DLXA 5JCUA 4XS4B 3ZFBA 1G0TA 3DYRA 1EEJA 3FRCA 5ECRB 3HZ8A 1A2JA 1K3YA 3L9UA 2HYXA 3HD5A 5KOWA 2YPMA 2YOIA 1M0UA 1GRXA 1GTIA 3BCIA 3UBKA 1ACVA 3LEFA 1BX9A 4I8BA 1X5CA 2LRCA 3HXSA 2J9HA 3LG6A 1YEPA 3QMXA 3N5OA 3L4NA 3BOAA 2CZ3A 3QAWA 2GDRA 3QD9A 1IYIA 2WGRA 4K7OA 2F3MA 5EY6A 4K7IA 4I97A 4FH8A 3LQ7A 2FHEA 2WULA 4YH2A 3TJKA 1SVLA 5DCGA 1HD2A 3DEXA 4I2UA 2NPBA 5ECHB 2PVOC 3TUEA 3PPUA 1XWCA 1QK8A 2CAQA 1V58A 3TKRA 4ECCA 1OC9A 3TOTA 3J7Yk 3I9V2 4X43A 3LXZA 4OMVA 4GXZA 4RQRA 4ZB8A 1PN0A 4ZB7A 3GL3A 4JRRA 2JU5A 4MABA 2XC2A 2Z9SA 2NDOA 3LJRA 1R26A 4PUFC 4PUAA 4O7HA 2CX3A 4MH3A 1PX7A 2FNOA 2H0HA 3GKMA 3ZIJA 3K8NA 1JLVA 2GSQA 1K0DA 1FW1A 1O85A 3BJ5A 1YF0A 3KEBA 1GSUA 2EFCA 1T7PB 4TVEA 2H0IA 2V1MA 1Y1UA 2G0FA 5G5EA 1B4PA 2XHFA 2X99A 3FY7A 3UVHA 4AF2A 4WF5A 2C3TA 1V40A 4BPYA 5J47A 1MD4A 2CVBA 2V6KA 2FCHA 4LA1A 1USBA 4CDOA 1MDKA 3GKKA 1S3AA 5FT3A 2B6MA 2DMLA 3C8EA 1NW2A 2L4QA 3EE2A 4NWYA 4G0LA 3ME7A 3FR6A 4BL7A 3FKFA 2HXKA 4K2DA 2NTOA 3FZAA 3FZ9A 1MDJA 4X0XA 2HRKA 2YZHA 4ZB9A 3F6DA 2VCXA 1SL1B 3TRQA 3ZVJD 6GSXA 2AAWA 4DVCA 3FYGA 3WD6A 3F4SA 1KEBA 4KNDA 1JZWA 3GYKA 2CVDA 4ML1A 2GSSA 1F3AA 4CW9A 5IMZA 4Q5QA 2YANA 2IMFA 1G6YA 2KP2A 4EF0A 1TOFA 4KX4A 20GSA 2HNLA 4O5RA 3O3TA 4TXOA 5J4UA 4IW9A 5G5FA 2HSNA 2LNSA 4NXIA 1LU4A 4PNGA 1R5PA 4PXOA 3C7MA 3LGCA 1N2AA 2OBIA 1F3BA 3L9VA 1SK1A 16GSA 2DBCA 4N0VA 4IHUA 2VCZA 3FR3A 3MNGA 2JL4A 3HY2A 4K0NA 1QFNA 4L8EA 4GLTA 3ZL5A 1XFLA 4KGIA 5CP1A 4FIWA 1QQ2A 3C73A 1Z6NA 1PQNA 5ECSA 2H70A 4BL7B 3UAPA 3KCMA 1ZYEA 1YKAA 4XS6A 3D0ZA 5IOXA 1SD8A 2GVPA 4MNNA 1ZZYA 1XIYA 4XCSA 2IFQA 4N0ZA 4CY8A 1JLWA 3HMJG 4HOJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WS2 A;  5HR1 A;  4KAE A;  3IC4 A;  2AUV A;  4ILF A;  2H75 A;  3W8S A;  2A4V A;  2RUE A;  1OYJ A;  2HSY A;  4KB3 A;  3E0U A;  2REM A;  1GTU A;  2XBQ A;  5C00 A;  5KN0 A;  3WGD A;  2FWF A;  5F06 A;  2N5A A;  3L9S A;  3DGQ A;  2B1K A;  2YCD A;  1O81 A;  3F3R A;  2HRA A;  1MEK A;  1AW9 A;  3TJG A;  2M80 A;  5IO0 A;  1AQX A;  2KOK A;  3VK9 A;  4IQ1 A;  1O8X A;  2F8F A;  6GSW A;  4GQF A;  4DSQ A;  1X5D A;  2DJ1 A;  4JZQ A;  3M8N A;  3GUS A;  3HYP A;  2H6Z A;  3KP8 A;  2DJ0 A;  2E2G A;  5C04 A;  2GZY A;  4XHM A;  1QXH A;  3FZ4 A;  3IK7 A;  4OD7 A;  4PNF A;  3R2Q A;  5L71 A;  2L59 A;  4ECB A;  1R7H A;  3DWV A;  4ZL8 A;  3LFL A;  1THO A;  4BVY A;  1VGL A;  1Z9H A;  1PGT A;  3QCP A;  3UIW A;  5IIZ A;  5LCZ A;  2B5X A;  2TRX A;  1V9W A;  1AIU A;  3ME8 A;  2X8C A;  1XPV A;  4TR3 A;  5AGY A;  4WF4 A;  4DSR A;  5KN2 A;  2HSM B;  1GNW A;  4TW5 A;  2I3Y A;  2H66 A;  3HVV A;  1HQO A;  1V98 A;  2H0G A;  1M2D A;  3VWX A;  3UJ1 A;  4E8H A;  4KA0 A;  4HJ2 A;  2NBS A;  1K0C A;  4K0G A;  2ZNM A;  2UZ8 A;  5ID2 A;  4HQS A;  4NPB A;  1FG4 A;  2H1A A;  1EV9 A;  4LLR A;  3SBC A;  2PU9 C;  1O73 A;  2VL2 A;  2YWM A;  5HQP A;  3GIX A;  2JSZ A;  2FA4 A;  2N5B A;  3CSI A;  2H74 A;  2VAF A;  4OFM A;  4NV5 A;  3HKR A;  1K3O A;  3HHV A;  4G0I A;  3F4R A;  3HJO A;  2VCQ A;  3DML A;  8GSS A;  3BD2 A;  3F63 A;  5EL8 A;  3LYP A;  3F0I A;  1DE2 A;  1OVN A;  4G19 A;  4USS A;  2RII A;  5IQY A;  2GS3 A;  3I43 A;  1GLQ A;  3D5J A;  4MJC A;  4PQH A;  1IYH A;  2JSY A;  2BJX A;  2H1D A;  2HI7 A;  3F4T A;  1EWX A;  4ZB6 A;  4D73 A;  1F9M A;  2K8V A;  2C1Y A;  2L5L A;  2VL3 A;  2VM1 A;  1XZO A;  4NV2 A;  2I1U A;  5G2Z A;  2LEG A;  1NM3 A;  3D4M A;  5AIS A;  3ZLP A;  4WKW A;  5DJL A;  1CQH A;  1ML6 A;  2OKA A;  1A8L A;  4ECI A;  2FUG 2;  1J9B A;  3C1S A;  1ZL9 A;  4POB A;  2VOC A;  1Z7P A;  4MCU A;  1SK2 A;  1PMT A;  4GTU A;  2C3Q A;  5B6M A;  1JFU A;  2O85 A;  4MP4 A;  3EU3 A;  5CRG A;  11GS A;  2OA7 A;  5ENU A;  4G0K A;  2C0E A;  3TRP A;  4H86 A;  4G2E A;  1PKZ A;  4GCI A;  1SKS B;  1EP7 A;  3EU4 A;  1URM A;  1A2M A;  1YY7 A;  4GSS A;  5B6N A;  2LKU A;  1GP1 A;  4KSM A;  5JWQ B;  1UC7 A;  3NZN A;  2VLT A;  4POM A;  1ERV A;  3G9B A;  4KCE A;  4IVF A;  1G7E A;  6GSU A;  3FK8 A;  2L6C A;  3CYN A;  3EC3 A;  3KJY A;  1GSY A;  2ZCT A;  18GS A;  2LTK A;  4POL A;  2L57 A;  3M0F A;  2AHE A;  4MJE A;  5DJM A;  3IDV A;  1E6B A;  1X9S B;  4D73 B;  1GSD A;  1T4Y A;  4OO5 A;  3U5R E;  2MMA A;  1VF4 A;  4V2N A;  5KN1 A;  2LS5 A;  1XVQ A;  1I5G A;  3WT1 A;  1ERU A;  3DRN A;  4EVM A;  4L5L A;  4ML6 A;  4WET A;  5HR3 A;  3GST A;  5HR2 A;  2YP6 A;  4OO4 A;  1BG5 A;  1A8Y A;  1V57 A;  4MPF A;  4K1F A;  5D73 A;  3M9J A;  3AY8 A;  2H6Y A;  5D9T A;  1HNA A;  3ERF A;  2CQ9 A;  2WRT A;  4N10 A;  4EKZ A;  2H72 A;  1SYX A;  5ELA A;  1T00 A;  1FOV A;  3F6F A;  1A2L A;  1PX6 A;  3FEU A;  4HU9 A;  3PGT A;  1DSB A;  2LV3 A;  3KMO A;  4AJ6 A;  1TI3 A;  2F9S A;  2GQL A;  2DJ3 A;  1QGV A;  3E3E A;  2GT6 A;  2PN8 A;  4Z7X A;  1M2B A;  2ON5 A;  1TXX A;  3RBT A;  1K0M A;  2VL2 C;  1BYE A;  3A3T A;  4Q5N A;  1NHY A;  4IJI A;  1TJD A;  4MA9 A;  1ZMA A;  5E59 A;  4GQC A;  3TOU A;  2WB9 A;  5G1L A;  1AXD A;  4F9Z A;  2H19 A;  1GSQ A;  5DAL A;  5ECP B;  3QFB C;  2F8A A;  1X5E A;  1EV4 A;  1KNG A;  2BMX A;  3CTF A;  2OBK A;  2GGT A;  4AJ7 A;  3BBY A;  2MMO A;  1OC3 A;  1B48 A;  1M2A A;  2C80 A;  5GAP D;  1QMV A;  2WDU A;  3CSH A;  4NAX A;  3NOF A;  1ILO A;  4WXT A;  1GSS A;  3TKS E;  4RI7 A;  1RK4 A;  1K0B A;  1SJ6 A;  4K8M A;  4QL7 A;  1FVJ A;  2L4C A;  4F0C A;  1A0R P;  2R5G A;  4IP1 A;  4IEL A;  4J2F A;  4OFT A;  1GTA A;  2EIQ A;  4ISD A;  5KEJ A;  3HVX A;  4KDU A;  2YN1 A;  3ZTL A;  3EMX A;  4XS1 A;  2AV4 A;  3WGE A;  1BQ7 A;  4HJM A;  1OC9 B;  3IPZ A;  4MH2 A;  3ERG A;  2MMN A;  2RM5 A;  2TRC P;  3CRU A;  4LMV A;  1GTB A;  5D9W A;  1XWB A;  5INY A;  4JBB A;  2OAC A;  4BWQ A;  4OCF A;  4HZ4 A;  6GSS A;  5B8B A;  1WPI A;  2LUS A;  1WE0 A;  5DAL B;  1G7O A;  2DJJ A;  3GL5 A;  3ZMK A;  5EPF A;  3WYW A;  2VCT A;  2HSH A;  2HT9 A;  2E0Q A;  5AIX A;  1GUL A;  3Q18 A;  1GWC A;  3UOM A;  3A2X A;  4TKY A;  1U88 A;  1ERT A;  4EDZ A;  3HVS A;  5F07 A;  1RQM A;  5DBQ A;  2PWJ A;  1CQG A;  3GFK A;  3F9U A;  4YQU A;  2YWO A;  3TB2 A;  1GUH A;  3EYT A;  4MF6 A;  1WP0 A;  2AYT A;  3KTL A;  1GSF A;  3GRX A;  4J57 E;  4MZC A;  2PPT A;  5GSS A;  3FZ5 A;  4MPG A;  2C0F A;  2V6O A;  3QAG A;  4IS0 A;  2HFD A;  2FLS A;  6GSY A;  2KUC A;  4E8E A;  3UBL A;  5ECL B;  4BA7 A;  4HQZ A;  4GWR A;  3F8U A;  2HE3 A;  3HDC A;  7GSS A;  2MBS A;  2FD3 A;  1T8E B;  2WCI A;  4NHW A;  2H71 A;  4TR4 A;  1XW9 A;  5CNW A;  4IN0 A;  2JZR A;  3GV1 A;  2JZT A;  1WWJ A;  1UA5 A;  3P90 A;  2HRK B;  3TRX A;  4AGS A;  5J9C A;  5DQY A;  1V2A A;  2CZ2 A;  1XW5 A;  3FW2 A;  4MJA A;  1XWK A;  3C71 A;  3CTG A;  1XOB A;  19GS A;  5B8A A;  1H75 A;  2EIR A;  1Y25 A;  5ECI B;  5D9V A;  4EO3 A;  3EMP A;  1O6J A;  4MMM A;  3M3M A;  3EVI A;  5ECK B;  2WFC A;  4IP6 A;  1WIK A;  3UEM A;  2IL3 A;  2P5Q A;  3C1R A;  5G1K A;  1A0F A;  3P7X A;  3GTU A;  3GKX A;  1OE7 A;  4TXO B;  2C3N A;  1ON4 A;  2HSN B;  1BED A;  1EZK A;  1RW1 A;  4TRX A;  1TTZ A;  3GNJ A;  1XVW A;  1B8X A;  4QL9 A;  3VPQ A;  3KP9 A;  2FY6 A;  1PN9 A;  4PQ1 A;  5DVB A;  5FWG A;  3P2A A;  4X1U A;  2B5Y A;  4ZIJ A;  4O32 A;  2YV9 A;  4JE1 A;  4TXV A;  3D22 A;  3KM6 A;  3IA1 A;  2DJK A;  1GLP A;  2B7J A;  5J41 A;  5CRH A;  2MYG A;  1AAZ A;  3S9F A;  1TU8 A;  2HZF A;  2JAC A;  3FHK A;  5G30 A;  4G10 A;  2O89 A;  2A2S A;  2H76 A;  1PL2 A;  2C8U A;  1WMJ A;  3RPP A;  4Q5F A;  3GX8 A;  1A24 A;  4TOP A;  1XOA A;  2IFQ B;  3TJJ A;  4HDE A;  3IAS 2;  3N9J A;  1MD3 A;  4YAV A;  1N8J A;  1LJR A;  4FYB A;  1T1V A;  2I81 A;  4HUA A;  6GST A;  4IJ3 A;  3HJM A;  1TI1 A;  4HI7 A;  2GQK A;  3VWV A;  1K3L A;  4I2T A;  5COH A;  1EOH A;  2V32 A;  4POK A;  2DSA A;  3G7J A;  3V1W A;  3TKP A;  4KF9 A;  2IIY A;  2QGV A;  1TK5 B;  4K9Z A;  4ID0 A;  3RHB A;  4EXJ A;  1XW6 A;  3TKS C;  3QR6 A;  4PQI A;  1DUG A;  4YAP A;  4L5O A;  2P31 A;  1VF2 A;  3H8Q A;  5HFI A;  3D6I A;  1SKR B;  2LST A;  4ECJ A;  3GUR A;  5J9B A;  1OAZ A;  3D4T A;  1K0O A;  1FHE A;  3TGZ A;  3PH9 A;  5JCG A;  3RHC A;  1MDI A;  5B7C A;  2VM2 A;  4BVY B;  3QPM A;  1GNE A;  2KP1 A;  5CRW A;  1EGR A;  4F03 A;  4TR1 A;  1YQ1 A;  1J08 A;  2DIY A;  4I5Q A;  2P5R A;  2IMK A;  2O87 A;  17GS A;  4TR0 A;  3ERW A;  4GF0 A;  3IK9 A;  1B4Q A;  4HU7 A;  3LSZ A;  4JU5 A;  3VPT A;  5GST A;  4P3Y B;  4EE0 A;  2IPA A;  3ZVJ A;  4GST A;  2ON7 A;  4PX1 A;  1S3C A;  5A4W A;  5IM9 A;  5ID2 B;  3P8W A;  4ZXG A;  2IME A;  2R2J A;  1ZGN A;  2I4A A;  2YZU A;  2HQT A;  4NHZ A;  5F8B A;  5CO3 A;  2HRF A;  2V41 A;  4KE3 A;  2BTO T;  3ZIT A;  3GN3 A;  3G7Y A;  1F37 A;  2VLV A;  5GAN D;  3R3E A;  1OKT A;  3Q19 A;  4XIH A;  3CSJ A;  5CAX A;  4MLY A;  3RDW A;  3GMF A;  3KZQ A;  4V2M A;  2X64 A;  3WGX A;  4KCA A;  3KIJ A;  4PTS A;  3RPN A;  4RQX A;  2LJK A;  2H01 A;  1F2E A;  3LXT A;  1YDK A;  3OR5 A;  1AUC A;  4MJB A;  1I9D A;  1YEX A;  4I6X A;  3IR4 A;  4V1A g;  4FYU A;  3H93 A;  1H4O A;  3Q6O A;  2H8L A;  4KUN A;  5GZZ B;  2OE0 A;  1XWA A;  3CXG A;  6GSV A;  1Z5Y E;  4OWY A;  2G2Q A;  5JWR B;  4WR5 A;  2KLX A;  4WBR D;  5CRD A;  4L0W A;  3US3 A;  3ISO A;  2LNT A;  2LRT A;  2R4V A;  5IMA A;  2MMZ A;  2MZC A;  4FQU A;  2YWN A;  5IPH A;  4ZIL A;  12GS A;  1EOG A;  3KH9 A;  1OE8 A;  2K8S A;  3LOR A;  4XRD A;  3VI5 A;  4N30 A;  2FWG A;  4K6X A;  3ZZX A;  5E4W A;  3ZIV A;  3VWU A;  4F82 A;  4ZL9 A;  3H1N A;  3D21 A;  2AB6 A;  5JCW A;  3FR9 A;  1PD2 1;  4OFN A;  1SL2 B;  2O8V B;  10GS A;  4DSS A;  4RI6 A;  3DIE A;  4MZB A;  2GZZ A;  5F0G A;  2KHP A;  3ZRD A;  1JZR A;  2GST A;  2H73 A;  9GSS A;  2DMM A;  4IQA A;  2V2G A;  2GZP A;  2VO4 A;  2ES7 A;  1TKD B;  2E2M A;  4KSO A;  1AQW A;  3UMA A;  2D2Z A;  1HNC A;  3GKN A;  1M7T A;  3L0H A;  1FB0 A;  1SU9 A;  3WT2 A;  1KTE A;  3TCO A;  2GT5 A;  4IKH A;  5FHI A;  1SKW B;  2C4J A;  3G7I A;  2DJ2 A;  3QFA C;  1U87 A;  3M9K A;  3HA9 A;  4JR6 A;  4OCE A;  1Q4J A;  2E7P A;  3UAR A;  1ABA A;  2WZ9 A;  3VUR A;  3GX0 A;  3CRT A;  1SJI A;  4EC0 A;  3IE3 A;  1Z7R A;  2DIZ A;  5IMC A;  1C72 A;  5CYY A;  2LRN A;  2OE1 A;  5HFK A;  1TRW A;  5JWO B;  3KXO A;  4KH7 A;  1U6T A;  3GH9 A;  3MDK A;  2HRN A;  1W4V A;  3GH6 A;  5D96 A;  4DSS B;  4HS1 A;  2CVK A;  2VUP A;  1Z3E A;  1MTC A;  5ABR A;  2QSI A;  1F6M C;  2IN3 A;  3PIN A;  1TP9 A;  4ZL7 A;  1Z6M A;  1XBS A;  5H5Q A;  4KDX A;  2VD1 A;  5IO2 A;  3KTB A;  1VRS D;  1WOU A;  2QC7 A;  5H5R A;  3GSS A;  4N11 A;  1VF3 A;  2VLU A;  4WBJ A;  2M72 A;  3HCZ A;  2X8H A;  3IOS A;  3W8J A;  3UVT A;  2B1L A;  2IJY A;  2C0G A;  1HYU A;  2R3X A;  2A2R A;  4ACS A;  5ECN B;  4MK3 A;  4EUY A;  2JZS A;  4NMU A;  4QQ7 A;  1TK0 B;  1O8W A;  3F3Q A;  1ZOF A;  2LQO A;  5F05 A;  4RUV A;  3TKS A;  4PUR A;  1UVZ A;  2GTU A;  2NVL A;  1S3D A;  2DC5 A;  1PSQ A;  3HZ4 A;  1T4Z A;  1PKW A;  3U6V A;  3IC8 A;  4JED A;  1R5A A;  5IPG A;  1EGO A;  1B9X C;  5IMF A;  2FWH A;  1K0N A;  1FAA A;  5EVO A;  2HZE A;  2K9F A;  2OE3 A;  2YJ7 A;  2YWI A;  4HEA 2;  5J3R A;  4HZ2 A;  2HLS A;  1NHO A;  2FGX A;  2QKE A;  1VF1 A;  4LL1 B;  4L0U A;  3QOU A;  1FO5 A;  4K7N A;  1GH2 A;  1AQV A;  4FYC A;  5HR0 A;  3DVW A;  4YQV A;  4BVX A;  3A5W A;  3QDN A;  4MZW A;  2OJL A;  4GSN A;  4BWS A;  1Y6E A;  4KDY A;  2FWE A;  3SWL A;  1TK8 B;  4XRA A;  5IOW A;  4LMW A;  3APS A;  1OKD A;  3NIV A;  1JHB A;  2PBJ A;  3APQ A;  3APO A;  3I6A A;  5BMU A;  5LD0 A;  1WJK A;  3TJB A;  4IBP A;  5J5N A;  1U3I A;  3IRA A;  2HSM A;  2LQQ A;  1R4W A;  2X8G A;  1DE1 A;  5ECM B;  4GRF A;  2IMI A;  3Q74 A;  1TRU A;  3HJP A;  3MSZ A;  5HFG A;  3MAK A;  1M99 A;  3LWA A;  1X9M B;  4G9H A;  2B3S A;  3MWH A;  4V2L A;  1B9Y C;  1O7U A;  3GHA A;  1BAY A;  2HZE B;  4DEJ A;  4IGJ A;  1BJX A;  1SYR A;  3J7Y b;  2YNX A;  1GSE A;  1U3A A;  4ZBB A;  5IMV A;  3IHQ A;  1TDI A;  3BCK A;  4PGT A;  3ED3 A;  2R6K A;  2WJU A;  2PMT A;  2OAD A;  3I69 A;  1YZX A;  2R37 A;  5KN3 A;  4WEY A;  4BVX B;  3CMI A;  1JZO A;  2PER A;  3DVX A;  1XCC A;  4JR4 A;  1GUK A;  1M9B A;  4YQM A;  3DD3 A;  3EIN A;  3LYK A;  3EWL A;  5IMD A;  3RAZ A;  2AJQ B;  2L5O A;  3CBU A;  1A23 A;  2CX4 A;  1WRY A;  3KGK A;  5H5S A;  5LNK e;  5ECO B;  2N5F A;  2EIO A;  2PUK C;  2K18 A;  5CRE A;  2O7K A;  4ZBA A;  3KMN A;  2H30 A;  4AJ8 A;  3DKS A;  3GTU B;  2XBI A;  3VI7 A;  4EDY A;  2GSR A;  1Q98 A;  5A4U A;  3VWW A;  5D9X A;  2B7K A;  2VD0 A;  1AC1 A;  2I9H A;  3ZRE A;  4LL4 B;  1TW9 A;  3M1G A;  5DCH A;  1DBY A;  1EEM A;  3PR8 A;  2K6V A;  1T3B A;  2J23 A;  1TU7 A;  4XTS A;  3O76 A;  5D8I A;  2LJA A;  2ZUP A;  1E2Y A;  1GUM A;  1ZYQ B;  2H1G A;  3JCM L;  2VL9 A;  1XWG A;  4MF7 A;  2M46 A;  1QUW A;  2CV4 A;  1W89 A;  2YJH A;  3VLN A;  3H4K A;  1HNB A;  3H79 A;  4EL1 A;  2RUF A;  1XXU A;  4MDC A;  5ELG A;  3VFI A;  3KD0 A;  3IAM 2;  3W6G A;  5A4V A;  4F0B A;  5ECQ B;  4KW6 A;  3IBH A;  22GS A;  1NSW A;  1X9W B;  5DAK A;  3TDG A;  3KH7 A;  1SK0 A;  2CAI A;  4ULX A;  1PRX A;  2H6X A;  4V1A p;  4XS4 A;  5DDL A;  1FB6 A;  5A5K A;  1PA3 A;  1ST9 A;  1YF1 A;  3IV4 A;  4FO5 A;  1YJ6 A;  4Q5R A;  14GS A;  2MBT A;  3UL3 A;  1K0A A;  4O92 A;  1SD9 A;  4WR4 A;  1OC8 A;  1ERW A;  1THX A;  3EUR A;  2RLI A;  2VIM A;  1TRS A;  3DXB A;  2VCW A;  2RM6 A;  3ZML A;  1GL8 A;  1LBK A;  3IXR A;  2YV7 A;  13GS A;  2TIR A;  1ZCP A;  2GLR A;  1SEN A;  1G6W A;  2PGT A;  3GA4 A;  2P0G A;  2VCV A;  2GQM A;  2H1B A;  5AN1 A;  2XPE A;  2XPD A;  2CT6 A;  2F51 A;  3A2W A;  2PVQ A;  1KBN A;  2CA8 A;  2JAD A;  2IWT A;  1YKC A;  3ZFL A;  4CHS A;  3QAV A;  4MF5 A;  5DQS A;  1JZD A;  4F2I A;  2B5E A;  1M9A A;  4TN8 A;  2EC4 A;  4ZBD A;  1FVK A;  4TR1 B;  5G31 A;  2LJR A;  1EP8 A;  1SJZ A;  1SL0 B;  2ALB A;  3ZYW A;  1X0R A;  5DAK B;  1J0F A;  3TJF A;  3O6T A;  4J56 E;  1UN2 A;  3L78 A;  1TRV A;  1PL1 A;  2IMD A;  5AIV A;  3TKQ A;  3A2V A;  2L6D A;  3E9J B;  2C0D A;  2FA8 A;  5D93 A;  2DLX A;  5JCU A;  4XS4 B;  3ZFB A;  1G0T A;  3DYR A;  1EEJ A;  3FRC A;  5ECR B;  3HZ8 A;  1A2J A;  1K3Y A;  3L9U A;  2HYX A;  3HD5 A;  2YPM A;  2YOI A;  1M0U A;  1GRX A;  1GTI A;  3BCI A;  3UBK A;  1ACV A;  3LEF A;  1BX9 A;  4I8B A;  1X5C A;  2LRC A;  3HXS A;  2J9H A;  3LG6 A;  1YEP A;  3QMX A;  3N5O A;  3L4N A;  3BOA A;  2CZ3 A;  3QAW A;  2GDR A;  3QD9 A;  1IYI A;  2WGR A;  4K7O A;  2F3M A;  5EY6 A;  4K7I A;  4I97 A;  4FH8 A;  3LQ7 A;  2FHE A;  2WUL A;  4YH2 A;  3TJK A;  5DCG A;  1HD2 A;  3DEX A;  4I2U A;  2NPB A;  5ECH B;  2PVO C;  3TUE A;  3PPU A;  1XWC A;  1QK8 A;  2CAQ A;  1V58 A;  3TKR A;  4ECC A;  1OC9 A;  3TOT A;  3J7Y k;  3I9V 2;  4X43 A;  3LXZ A;  4OMV A;  4GXZ A;  4RQR A;  4ZB8 A;  3GL3 A;  4JRR A;  2JU5 A;  4MAB A;  2XC2 A;  2Z9S A;  2NDO A;  3LJR A;  1R26 A;  4PUF C;  4PUA A;  4O7H A;  2CX3 A;  4MH3 A;  1PX7 A;  2FNO A;  2H0H A;  3GKM A;  3ZIJ A;  3K8N A;  1JLV A;  2GSQ A;  1K0D A;  1FW1 A;  1O85 A;  3BJ5 A;  1YF0 A;  3KEB A;  1GSU A;  1T7P B;  4TVE A;  2H0I A;  2V1M A;  2G0F A;  5G5E A;  1B4P A;  2XHF A;  2X99 A;  3FY7 A;  3UVH A;  4AF2 A;  4WF5 A;  2C3T A;  1V40 A;  4BPY A;  1MD4 A;  2CVB A;  2V6K A;  2FCH A;  4LA1 A;  1USB A;  4CDO A;  1MDK A;  3GKK A;  1S3A A;  5FT3 A;  2B6M A;  2DML A;  3C8E A;  1NW2 A;  2L4Q A;  3EE2 A;  4NWY A;  4G0L A;  3ME7 A;  3FR6 A;  4BL7 A;  3FKF A;  2HXK A;  4K2D A;  2NTO A;  3FZA A;  3FZ9 A;  1MDJ A;  4X0X A;  2HRK A;  2YZH A;  4ZB9 A;  3F6D A;  2VCX A;  1SL1 B;  3TRQ A;  3ZVJ D;  6GSX A;  2AAW A;  4DVC A;  3FYG A;  3WD6 A;  3F4S A;  1KEB A;  4KND A;  1JZW A;  3GYK A;  2CVD A;  4ML1 A;  2GSS A;  1F3A A;  4CW9 A;  5IMZ A;  4Q5Q A;  2YAN A;  2IMF A;  1G6Y A;  2KP2 A;  4EF0 A;  1TOF A;  4KX4 A;  20GS A;  2HNL A;  4O5R A;  3O3T A;  4TXO A;  5J4U A;  4IW9 A;  5G5F A;  2LNS A;  4NXI A;  1LU4 A;  4PNG A;  1R5P A;  4PXO A;  3C7M A;  3LGC A;  1N2A A;  2OBI A;  1F3B A;  3L9V A;  1SK1 A;  16GS A;  2DBC A;  4N0V A;  4IHU A;  2VCZ A;  3FR3 A;  3MNG A;  2JL4 A;  3HY2 A;  4K0N A;  1QFN A;  4L8E A;  4GLT A;  3ZL5 A;  1XFL A;  4KGI A;  5CP1 A;  4FIW A;  1QQ2 A;  3C73 A;  1Z6N A;  1PQN A;  5ECS A;  2H70 A;  4BL7 B;  3UAP A;  3KCM A;  1ZYE A;  1YKA A;  4XS6 A;  3D0Z A;  5IOX A;  1SD8 A;  2GVP A;  1ZZY A;  1XIY A;  4XCS A;  2IFQ A;  4N0Z A;  1JLW A;  4HOJ A; 
#chains in the Genus database with same CATH topology
 2WS2 A;  5HR1 A;  4KAE A;  3IC4 A;  2AUV A;  4ILF A;  2H75 A;  3W8S A;  2A4V A;  2RUE A;  1OYJ A;  2HSY A;  4KB3 A;  3E0U A;  2REM A;  1GTU A;  2XBQ A;  5C00 A;  5KN0 A;  4BIK A;  1M3J A;  2FWF A;  3WGD A;  5F06 A;  2N5A A;  3L9S A;  3DGQ A;  2B1K A;  2YCD A;  1O81 A;  3F3R A;  2HRA A;  1MEK A;  1AW9 A;  3TJG A;  2M80 A;  5IO0 A;  1AQX A;  2KOK A;  3VK9 A;  4IQ1 A;  1O8X A;  2F8F A;  6GSW A;  4GQF A;  4DSQ A;  1X5D A;  2DJ1 A;  4JZQ A;  3M8N A;  3GUS A;  3HYP A;  2H6Z A;  3KP8 A;  2DJ0 A;  2E2G A;  5C04 A;  2GZY A;  2WVX B;  4XHM A;  1QXH A;  3FZ4 A;  3IK7 A;  2EFH A;  4OD7 A;  4PNF A;  1BF5 A;  3R2Q A;  5L71 A;  2L59 A;  4ECB A;  1R7H A;  3DWV A;  4ZL8 A;  3LFL A;  1THO A;  4BVY A;  1VGL A;  1Z9H A;  1PGT A;  3QCP A;  3UIW A;  5IIZ A;  2O36 A;  5LCZ A;  2B5X A;  2TRX A;  1V9W A;  1AIU A;  3HVN A;  3ME8 A;  5BMU B;  2X8C A;  1XPV A;  4TR3 A;  2R0G A;  5AGY A;  4WF4 A;  4DSR A;  5KN2 A;  2HSM B;  1GNW A;  4TW5 A;  2I3Y A;  2H66 A;  3HVV A;  1HQO A;  1V98 A;  2H0G A;  1M2D A;  3VWX A;  3UJ1 A;  4E8H A;  4KA0 A;  4HJ2 A;  2NBS A;  1K0C A;  4K0G A;  2ZNM A;  2UZ8 A;  5ID2 A;  4HQS A;  4NPB A;  2A2P A;  1FG4 A;  2H1A A;  1EV9 A;  4LLR A;  3SBC A;  2PU9 C;  1O73 A;  2VL2 A;  2YWM A;  5HQP A;  3GIX A;  2JSZ A;  2FA4 A;  2N5B A;  3CSI A;  2H74 A;  2VAF A;  4OFM A;  4NV5 A;  3HKR A;  1K3O A;  3HHV A;  4G0I A;  3F4R A;  3HJO A;  2VCQ A;  3DML A;  8GSS A;  3BD2 A;  3F63 A;  5EL8 A;  3LYP A;  3F0I A;  1DE2 A;  1OVN A;  4N3Z A;  4G19 A;  3FMW A;  4USS A;  2RII A;  5IQY A;  2GS3 A;  3I43 A;  1GLQ A;  3D5J A;  4MJC A;  4PQH A;  1IYH A;  2JSY A;  2BJX A;  2H1D A;  2HI7 A;  3F4T A;  1EWX A;  4ZB6 A;  4D73 A;  1F9M A;  2K8V A;  2C1Y A;  2L5L A;  2VL3 A;  2VM1 A;  1XZO A;  4NV2 A;  2I1U A;  5G2Z A;  2LEG A;  1NM3 A;  3D4M A;  5AIS A;  3ZLP A;  4WKW A;  5DJL A;  4W66 A;  1CQH A;  1ML6 A;  2OKA A;  1A8L A;  4ECI A;  2FUG 2;  1J9B A;  3C1S A;  1ZL9 A;  5KOX A;  4POB A;  2VOC A;  1Z7P A;  4MCU A;  1SK2 A;  1PMT A;  4GTU A;  2C3Q A;  5B6M A;  1JFU A;  2DKH A;  2O85 A;  4MP4 A;  3EU3 A;  5CRG A;  11GS A;  2OA7 A;  5ENU A;  4G0K A;  2C0E A;  3TRP A;  4H86 A;  4G2E A;  1PKZ A;  4GCI A;  5J4Y A;  1SKS B;  1EP7 A;  3EU4 A;  1URM A;  1A2M A;  1YY7 A;  1BG1 A;  4GSS A;  5B6N A;  2LKU A;  1GP1 A;  3IHG A;  4KSM A;  5JWQ B;  1UC7 A;  3NZN A;  4PI2 C;  2VLT A;  4POM A;  1ERV A;  3G9B A;  4KCE A;  4IVF A;  1G7E A;  6GSU A;  3FK8 A;  2L6C A;  3CYN A;  3EC3 A;  3KJY A;  1GSY A;  2ZCT A;  18GS A;  2EFD A;  2LTK A;  4POL A;  2L57 A;  3M0F A;  2AHE A;  4MJE A;  5DJM A;  3IDV A;  1E6B A;  1X9S B;  4D73 B;  1GSD A;  4K5R A;  1T4Y A;  4OO5 A;  3U5R E;  2MMA A;  1VF4 A;  4V2N A;  5KN1 A;  2LS5 A;  1XVQ A;  1I5G A;  3WT1 A;  1ERU A;  3DRN A;  4EVM A;  4L5L A;  4ML6 A;  4WET A;  5HR3 A;  3GST A;  5HR2 A;  2YP6 A;  2H1L A;  4OO4 A;  1BG5 A;  1A8Y A;  1V57 A;  4YKG A;  4MPF A;  4K1F A;  5D73 A;  3M9J A;  3CWG A;  3AY8 A;  2H6Y A;  5D9T A;  1HNA A;  5A1N A;  3ERF A;  2CQ9 A;  2WRT A;  3MYD A;  4N10 A;  4EKZ A;  2H72 A;  1SYX A;  5ELA A;  1T00 A;  1FOV A;  3F6F A;  1A2L A;  1PX6 A;  3FEU A;  4HU9 A;  3PGT A;  1DSB A;  2LV3 A;  3KMO A;  1S4B P;  4AJ6 A;  2WW3 A;  1TI3 A;  2F9S A;  2GQL A;  2DJ3 A;  1QGV A;  3E3E A;  2GT6 A;  2PN8 A;  2OT3 A;  4Z7X A;  1M2B A;  2ON5 A;  2WW1 A;  1TXX A;  3RBT A;  1K0M A;  2VL2 C;  1BYE A;  3A3T A;  4Q5N A;  2A4H A;  1NHY A;  4IJI A;  1TJD A;  4MA9 A;  1ZMA A;  5E59 A;  4GQC A;  3TOU A;  3CQF A;  2WB9 A;  5G1L A;  1AXD A;  4F9Z A;  2H19 A;  1GSQ A;  5DAL A;  5ECP B;  3QFB C;  2F8A A;  1X5E A;  1EV4 A;  1KNG A;  2BMX A;  3CTF A;  2OBK A;  2GGT A;  4AJ7 A;  3BBY A;  2MMO A;  5J4V A;  1OC3 A;  1B48 A;  1M2A A;  2C80 A;  4K2X A;  5GAP D;  1QMV A;  2WDU A;  3CSH A;  4NAX A;  3NOF A;  1ILO A;  4WXT A;  1GSS A;  3TKS E;  4RI7 A;  1RK4 A;  1K0B A;  1SJ6 A;  4K8M A;  4QL7 A;  1FVJ A;  2L4C A;  4F0C A;  1A0R P;  2R5G A;  4IP1 A;  4IEL A;  4J2F A;  4OFT A;  1GTA A;  2EIQ A;  4ISD A;  4O5Q A;  5KEJ A;  3HVX A;  4KDU A;  4AKG A;  2YN1 A;  3ZTL A;  3EMX A;  4XS1 A;  2AV4 A;  3WGE A;  1BQ7 A;  4HJM A;  1OC9 B;  3IPZ A;  5J40 A;  3ERG A;  4MH2 A;  2MMN A;  2RM5 A;  2TRC P;  3CRU A;  4LMV A;  1GTB A;  5D9W A;  1XWB A;  5INY A;  3LW9 A;  4JBB A;  2OAC A;  4BWQ A;  4OCF A;  4HZ4 A;  6GSS A;  1ZYN A;  5B8B A;  1WPI A;  2LUS A;  1WE0 A;  5DAL B;  1G7O A;  2DJJ A;  3GL5 A;  3ZMK A;  5EPF A;  3WYW A;  2VCT A;  2HSH A;  2HT9 A;  2E0Q A;  5AIX A;  1GUL A;  3Q18 A;  1GWC A;  3UOM A;  3A2X A;  4TKY A;  1U88 A;  1ERT A;  4GDF A;  4EDZ A;  3HVS A;  5F07 A;  1RQM A;  5DBQ A;  2PWJ A;  1CQG A;  3GFK A;  3F9U A;  4YQU A;  2YWO A;  3TB2 A;  1GUH A;  3EYT A;  4MF6 A;  1WP0 A;  2AYT A;  3KTL A;  1GSF A;  3GRX A;  4J57 E;  4MZC A;  2PPT A;  5GSS A;  3FZ5 A;  4MPG A;  2C0F A;  2V6O A;  3QAG A;  4IS0 A;  2HFD A;  2FLS A;  6GSY A;  2KUC A;  4E8E A;  2X49 A;  3UBL A;  5ECL B;  4BA7 A;  4HQZ A;  4GWR A;  3F8U A;  2HE3 A;  3HDC A;  7GSS A;  2MBS A;  2FD3 A;  1T8E B;  2WCI A;  4NHW A;  2H71 A;  4TR4 A;  1XW9 A;  5CNW A;  4IN0 A;  2JZR A;  3GV1 A;  2JZT A;  1WWJ A;  1UA5 A;  3P90 A;  2HRK B;  4PI0 C;  3TRX A;  4AGS A;  5J9C A;  5DQY A;  1V2A A;  2CZ2 A;  1XW5 A;  3FW2 A;  4MJA A;  1XWK A;  3C71 A;  3CTG A;  1XOB A;  19GS A;  5B8A A;  1H75 A;  2EIR A;  1Y25 A;  5ECI B;  5D9V A;  4EO3 A;  3EMP A;  1O6J A;  4MMM A;  3M3M A;  3EVI A;  5ECK B;  2WFC A;  4IP6 A;  1WIK A;  3UEM A;  2IL3 A;  2P5Q A;  3C1R A;  5G1K A;  1A0F A;  3P7X A;  3GTU A;  3GKX A;  1OE7 A;  4TXO B;  2C3N A;  1ON4 A;  2HSN B;  1BED A;  1EZK A;  1PFO A;  1RW1 A;  4TRX A;  1TTZ A;  2X4A A;  3GNJ A;  1XVW A;  1B8X A;  4QL9 A;  3VPQ A;  3KP9 A;  2FY6 A;  1PN9 A;  4PQ1 A;  5DVB A;  5FWG A;  3P2A A;  4X1U A;  2B5Y A;  4ZIJ A;  4O32 A;  2YV9 A;  4JE1 A;  4TXV A;  3D22 A;  3KM6 A;  3IA1 A;  4O5U A;  2DJK A;  1GLP A;  2B7J A;  5J41 A;  5CRH A;  2MYG A;  1AAZ A;  3S9F A;  1TU8 A;  2HZF A;  2JAC A;  3FHK A;  5G30 A;  4G10 A;  2O89 A;  2A2S A;  2H76 A;  1PL2 A;  2C8U A;  1WMJ A;  3RPP A;  4Q5F A;  3GX8 A;  1A24 A;  4TOP A;  1XOA A;  2IFQ B;  3TJJ A;  2O5V A;  4HDE A;  3IAS 2;  3N9J A;  1MD3 A;  4YAV A;  2R0C A;  1N8J A;  1LJR A;  4FYB A;  1T1V A;  2I81 A;  4HUA A;  6GST A;  4IJ3 A;  3HJM A;  1TI1 A;  4HI7 A;  2GQK A;  2VKZ G;  3VWV A;  1K3L A;  4I2T A;  5COH A;  1EOH A;  2V32 A;  4POK A;  2DSA A;  3G7J A;  3V1W A;  3TKP A;  1TXU A;  4KF9 A;  2IIY A;  2QGV A;  1TK5 B;  4K9Z A;  4ID0 A;  3RHB A;  4EXJ A;  1XW6 A;  3TKS C;  3QR6 A;  4PQI A;  1DUG A;  4YAP A;  4L5O A;  2P31 A;  1VF2 A;  3H8Q A;  5HFI A;  3D6I A;  1SKR B;  2LST A;  4ECJ A;  3GUR A;  5J9B A;  1OAZ A;  3D4T A;  1K0O A;  1FHE A;  3TGZ A;  3PH9 A;  4QMK A;  5JCG A;  3RHC A;  1MDI A;  5B7C A;  2VM2 A;  4BVY B;  3QPM A;  1GNE A;  2KP1 A;  5CRW A;  1EGR A;  4F03 A;  4TR1 A;  1YQ1 A;  1J08 A;  2DIY A;  4I5Q A;  2P5R A;  2IMK A;  2O87 A;  17GS A;  4TR0 A;  4AKI A;  3ERW A;  1S3R A;  4GF0 A;  3IK9 A;  1B4Q A;  4HU7 A;  3LSZ A;  4JU5 A;  3VPT A;  5GST A;  4P3Y B;  4EE0 A;  2IPA A;  3ZVJ A;  4GST A;  2ON7 A;  4PX1 A;  1S3C A;  5A4W A;  5IM9 A;  5ID2 B;  3P8W A;  4ZXG A;  2IME A;  2R2J A;  1ZGN A;  2I4A A;  2YZU A;  2HQT A;  4NHZ A;  5F8B A;  5CO3 A;  2HRF A;  2V41 A;  4KE3 A;  2BTO T;  3ZIT A;  3GN3 A;  3G7Y A;  1F37 A;  2VLV A;  5GAN D;  3R3E A;  1OKT A;  3Q19 A;  4XIH A;  3CSJ A;  5CAX A;  4MLY A;  3RDW A;  3GMF A;  3KZQ A;  4V2M A;  2X64 A;  3WGX A;  4KCA A;  3KIJ A;  4PTS A;  3RPN A;  4RQX A;  2LJK A;  2H01 A;  1F2E A;  3LXT A;  1YDK A;  3OR5 A;  1AUC A;  4MJB A;  1I9D A;  1YEX A;  4I6X A;  3IR4 A;  4V1A g;  4FYU A;  3H93 A;  1H4O A;  3Q6O A;  2H8L A;  4KUN A;  5GZZ B;  2OE0 A;  1XWA A;  3CXG A;  6GSV A;  1Z5Y E;  4OWY A;  2G2Q A;  5JWR B;  4WR5 A;  2KLX A;  4WBR D;  5CRD A;  4L0W A;  3US3 A;  3ISO A;  2LNT A;  2LRT A;  2R4V A;  5IMA A;  2MMZ A;  4E68 A;  2MZC A;  4YKF A;  4FQU A;  2YWN A;  5IPH A;  4ZIL A;  12GS A;  1EOG A;  3KH9 A;  1OE8 A;  2K8S A;  3LOR A;  4XRD A;  1YVL A;  3VI5 A;  4N30 A;  2FWG A;  4K6X A;  3ZZX A;  5E4W A;  3ZIV A;  3VWU A;  4F82 A;  4ZL9 A;  3H1N A;  3D21 A;  2WW2 A;  2AB6 A;  5JCW A;  3FR9 A;  1PD2 1;  4OFN A;  1SL2 B;  4K5S A;  2O8V B;  10GS A;  4DSS A;  4RI6 A;  3DIE A;  4MZB A;  2GZZ A;  5F0G A;  2KHP A;  4AI6 A;  3ZRD A;  1JZR A;  2GST A;  2H73 A;  9GSS A;  2DMM A;  4IQA A;  2V2G A;  2GZP A;  2VO4 A;  2ES7 A;  1TKD B;  3MIX A;  2E2M A;  4KSO A;  1AQW A;  3UMA A;  1N25 A;  2D2Z A;  1HNC A;  2R0P A;  3GKN A;  1M7T A;  3L0H A;  1FB0 A;  1SU9 A;  3WT2 A;  1KTE A;  3TCO A;  2WVZ A;  2GT5 A;  4IKH A;  4ICY A;  5FHI A;  1SKW B;  2C4J A;  3G7I A;  2DJ2 A;  3QFA C;  1U87 A;  3M9K A;  3A5I A;  3HA9 A;  4JR6 A;  4OCE A;  1Q4J A;  2E7P A;  3UAR A;  1ABA A;  2WZ9 A;  3VUR A;  3GX0 A;  5A1N B;  4A5P A;  3CRT A;  1SJI A;  4G01 A;  4EC0 A;  5A5H A;  3IE3 A;  5A34 A;  1Z7R A;  4PHZ C;  2DIZ A;  5IMC A;  1C72 A;  3RFR C;  5CYY A;  2LRN A;  2OE1 A;  5HFK A;  1TRW A;  5JWO B;  3KXO A;  4KH7 A;  1U6T A;  3GH9 A;  3MDK A;  2HRN A;  1W4V A;  3GH6 A;  5D96 A;  4DSS B;  4HS1 A;  2CVK A;  1I1I P;  2VUP A;  1Z3E A;  1MTC A;  5ABR A;  2QSI A;  1F6M C;  2IN3 A;  3PIN A;  1TP9 A;  4ZL7 A;  1Z6M A;  1XBS A;  5H5Q A;  4KDX A;  2VD1 A;  5IO2 A;  3KTB A;  1VRS D;  1WOU A;  2QC7 A;  5H5R A;  3GSS A;  4N11 A;  1VF3 A;  2VLU A;  4WBJ A;  2M72 A;  3HCZ A;  2X8H A;  3IOS A;  3W8J A;  3UVT A;  2B1L A;  2IJY A;  2C0G A;  1HYU A;  2R3X A;  2A2R A;  4ACS A;  5ECN B;  4MK3 A;  4EUY A;  2JZS A;  4NMU A;  4QQ7 A;  1TK0 B;  1O8W A;  3F3Q A;  1ZOF A;  2LQO A;  5F05 A;  4RUV A;  3TKS A;  4PUR A;  1UVZ A;  2GTU A;  2NVL A;  1S3D A;  2DC5 A;  1PSQ A;  5A5H B;  3HZ4 A;  5A34 B;  1T4Z A;  1PKW A;  3U6V A;  3IC8 A;  4JED A;  1R5A A;  5IPG A;  1EGO A;  4AKH A;  1B9X C;  5IMF A;  2FWH A;  1K0N A;  1FAA A;  5EVO A;  2HZE A;  2K9F A;  2OE3 A;  2YJ7 A;  2YWI A;  4HEA 2;  5J3R A;  4HZ2 A;  2HLS A;  1NHO A;  2FGX A;  2QKE A;  2WW0 A;  1VF1 A;  4LL1 B;  1ZYP A;  4L0U A;  3QOU A;  1FO5 A;  4K7N A;  1GH2 A;  1AQV A;  4HSC X;  4FYC A;  5HR0 A;  3DVW A;  4YQV A;  4BVX A;  3A5W A;  3QDN A;  4MZW A;  2OJL A;  4GSN A;  4BWS A;  1Y6E A;  4KDY A;  2FWE A;  3SWL A;  1TK8 B;  4XRA A;  5IOW A;  4LMW A;  3APS A;  1OKD A;  3NIV A;  1JHB A;  2PBJ A;  3APQ A;  3APO A;  3I6A A;  5BMU A;  5LD0 A;  1WJK A;  2QA1 A;  3RGB C;  3TJB A;  4IBP A;  5J5N A;  1U3I A;  3IRA A;  2HSM A;  2LQQ A;  1R4W A;  2X8G A;  1DE1 A;  5ECM B;  4GRF A;  2IMI A;  3Q74 A;  1TRU A;  3HJP A;  3MSZ A;  5HFG A;  3MAK A;  1M99 A;  3LWA A;  1X9M B;  4Z2R A;  4G9H A;  2B3S A;  3MWH A;  2WZS A;  4V2L A;  1B9Y C;  1O7U A;  3GHA A;  1BAY A;  2HZE B;  4DEJ A;  4IGJ A;  1BJX A;  1SYR A;  3J7Y b;  2YNX A;  1GSE A;  3TU3 B;  4ZBB A;  1U3A A;  3IHQ A;  5IMV A;  1TDI A;  3BCK A;  4PGT A;  3ED3 A;  2R6K A;  2WJU A;  2PMT A;  2OAD A;  3I69 A;  1YZX A;  2R37 A;  5KN3 A;  4WEY A;  4BVX B;  3CMI A;  1JZO A;  4Z2U A;  2PER A;  3DVX A;  1XCC A;  4JR4 A;  1GUK A;  1M9B A;  4YQM A;  3DD3 A;  3EIN A;  3LYK A;  3EWL A;  5IMD A;  3RAZ A;  2AJQ B;  2L5O A;  3CBU A;  1A23 A;  2CX4 A;  1WRY A;  2WVY A;  3KGK A;  5H5S A;  5LNK e;  5ECO B;  2N5F A;  2EIO A;  2PUK C;  2K18 A;  2QA2 A;  5CRE A;  2O7K A;  4ZBA A;  3KMN A;  2H30 A;  4AJ8 A;  3DKS A;  4EIQ A;  3GTU B;  2XBI A;  3VI7 A;  4EDY A;  2GSR A;  1Q98 A;  5A4U A;  3VWW A;  5D9X A;  2B7K A;  2VD0 A;  1AC1 A;  2I9H A;  3ZRE A;  4LL4 B;  1TW9 A;  3M1G A;  5DCH A;  1DBY A;  1EEM A;  3PR8 A;  2K6V A;  1T3B A;  3CHX C;  2J23 A;  1TU7 A;  4XTS A;  3O76 A;  5D8I A;  2LJA A;  2ZUP A;  1E2Y A;  4Z2T A;  1GUM A;  1ZYQ B;  2H1G A;  3JCM L;  2VL9 A;  1XWG A;  4MF7 A;  2M46 A;  1QUW A;  2CV4 A;  1W89 A;  2YJH A;  3VLN A;  3H4K A;  1HNB A;  3H79 A;  4EL1 A;  2RUF A;  1XXU A;  4MDC A;  5ELG A;  3VFI A;  3KD0 A;  3IAM 2;  1SVO A;  3W6G A;  5A4V A;  4X4J A;  4F0B A;  5ECQ B;  4KW6 A;  1SVM A;  3IBH A;  22GS A;  1NSW A;  1X9W B;  5DAK A;  3TDG A;  3KH7 A;  1SK0 A;  2CAI A;  4ULX A;  1PRX A;  2H6X A;  4V1A p;  4XS4 A;  1YEW C;  5DDL A;  1FB6 A;  1FOH A;  5A5K A;  1PA3 A;  5BRT A;  1ST9 A;  1YF1 A;  3IV4 A;  4FO5 A;  1YJ6 A;  4Q5R A;  14GS A;  2MBT A;  1M3I A;  3UL3 A;  1K0A A;  4O92 A;  1SD9 A;  4WR4 A;  1OC8 A;  1ERW A;  1THX A;  3EUR A;  2RLI A;  2VIM A;  1TRS A;  3DXB A;  2VCW A;  2RM6 A;  3ZML A;  1GL8 A;  1LBK A;  3IXR A;  4AKX B;  2YV7 A;  13GS A;  2TIR A;  2UV8 G;  1ZCP A;  2GLR A;  1SEN A;  1G6W A;  2PGT A;  3GA4 A;  2P0G A;  2VCV A;  2GQM A;  2H1B A;  4CY6 A;  5AN1 A;  2XPE A;  2XPD A;  2CT6 A;  2F51 A;  3A2W A;  2PVQ A;  1KBN A;  2O3E A;  2CA8 A;  2JAD A;  2IWT A;  1YKC A;  3ZFL A;  4CHS A;  3QAV A;  4MF5 A;  5DQS A;  1JZD A;  4F2I A;  2B5E A;  2DKI A;  1M9A A;  4TN8 A;  3EPT A;  2EC4 A;  4ZBD A;  1FVK A;  4TR1 B;  5G31 A;  2LJR A;  1EP8 A;  1SJZ A;  1SL0 B;  2ALB A;  3ZYW A;  1X0R A;  4EIP A;  5DAK B;  1J0F A;  3TJF A;  3O6T A;  4J56 E;  1UN2 A;  3L78 A;  1TRV A;  1PL1 A;  2IMD A;  5AIV A;  3TKQ A;  3A2V A;  2L6D A;  3E9J B;  2C0D A;  2EFE A;  2FA8 A;  5D93 A;  2DLX A;  5JCU A;  4XS4 B;  3ZFB A;  1G0T A;  3DYR A;  1XG8 A;  1EEJ A;  3FRC A;  5ECR B;  3HZ8 A;  1A2J A;  1K3Y A;  3L9U A;  2HYX A;  3HD5 A;  5KOW A;  2YPM A;  2YOI A;  1M0U A;  1GRX A;  1GTI A;  3BCI A;  3UBK A;  1ACV A;  3LEF A;  1BX9 A;  4I8B A;  1X5C A;  2LRC A;  3HXS A;  2J9H A;  3LG6 A;  1YEP A;  3QMX A;  3N5O A;  3L4N A;  3BOA A;  2CZ3 A;  3QAW A;  2GDR A;  3QD9 A;  1IYI A;  2WGR A;  4K7O A;  2F3M A;  5EY6 A;  4K7I A;  4I97 A;  4FH8 A;  3LQ7 A;  2FHE A;  2WUL A;  4YH2 A;  3TJK A;  1SVL A;  5DCG A;  1HD2 A;  3DEX A;  4I2U A;  2NPB A;  5ECH B;  2PVO C;  3TUE A;  3PPU A;  1XWC A;  1QK8 A;  2CAQ A;  1V58 A;  3TKR A;  4ECC A;  1OC9 A;  3TOT A;  3J7Y k;  3I9V 2;  4X43 A;  3LXZ A;  4OMV A;  4GXZ A;  4RQR A;  4ZB8 A;  1PN0 A;  4ZB7 A;  3GL3 A;  4JRR A;  2JU5 A;  4MAB A;  2XC2 A;  2Z9S A;  2NDO A;  3LJR A;  1R26 A;  4PUF C;  4PUA A;  4O7H A;  2CX3 A;  4MH3 A;  1PX7 A;  2FNO A;  2H0H A;  3GKM A;  3ZIJ A;  3K8N A;  1JLV A;  2GSQ A;  1K0D A;  1FW1 A;  1O85 A;  3BJ5 A;  1YF0 A;  3KEB A;  1GSU A;  2EFC A;  1T7P B;  4TVE A;  2H0I A;  2V1M A;  1Y1U A;  2G0F A;  5G5E A;  1B4P A;  2XHF A;  2X99 A;  3FY7 A;  3UVH A;  4AF2 A;  4WF5 A;  4FXY P;  2C3T A;  1V40 A;  4BPY A;  5J47 A;  1MD4 A;  2CVB A;  2V6K A;  2FCH A;  4LA1 A;  1USB A;  4CDO A;  1MDK A;  3GKK A;  1S3A A;  5FT3 A;  2B6M A;  2DML A;  3C8E A;  1NW2 A;  2L4Q A;  3EE2 A;  4NWY A;  4G0L A;  3ME7 A;  3FR6 A;  4BL7 A;  3FKF A;  2HXK A;  4K2D A;  2NTO A;  3FZA A;  3FZ9 A;  1MDJ A;  4X0X A;  2HRK A;  2YZH A;  4ZB9 A;  3F6D A;  2VCX A;  1SL1 B;  3TRQ A;  3ZVJ D;  6GSX A;  2AAW A;  4DVC A;  3FYG A;  3WD6 A;  3F4S A;  1KEB A;  4KND A;  1JZW A;  3GYK A;  2CVD A;  4ML1 A;  2GSS A;  1F3A A;  4CW9 A;  5IMZ A;  4Q5Q A;  2YAN A;  2IMF A;  1G6Y A;  2KP2 A;  4EF0 A;  1TOF A;  4KX4 A;  20GS A;  2HNL A;  4O5R A;  3O3T A;  4TXO A;  5J4U A;  4IW9 A;  5G5F A;  2HSN A;  2LNS A;  4NXI A;  1LU4 A;  4PNG A;  1R5P A;  4PXO A;  3C7M A;  3LGC A;  1N2A A;  2OBI A;  1F3B A;  3L9V A;  1SK1 A;  16GS A;  2DBC A;  4N0V A;  4IHU A;  2VCZ A;  3FR3 A;  2WVX A;  3MNG A;  2JL4 A;  3HY2 A;  4K0N A;  1QFN A;  4L8E A;  4GLT A;  3ZL5 A;  1XFL A;  4KGI A;  5CP1 A;  4FIW A;  1QQ2 A;  3C73 A;  1Z6N A;  1PQN A;  5ECS A;  2H70 A;  4BL7 B;  3UAP A;  3KCM A;  1ZYE A;  1YKA A;  4XS6 A;  3D0Z A;  5IOX A;  1SD8 A;  2GVP A;  4MNN A;  1ZZY A;  1XIY A;  4XCS A;  2IFQ A;  4N0Z A;  4CY8 A;  1JLW A;  3HMJ G;  4HOJ A; 
#chains in the Genus database with same CATH homology
 2WS2 A;  5HR1 A;  4KAE A;  3IC4 A;  2AUV A;  4ILF A;  2H75 A;  3W8S A;  2A4V A;  2RUE A;  1OYJ A;  2HSY A;  4KB3 A;  3E0U A;  2REM A;  1GTU A;  2XBQ A;  5C00 A;  5KN0 A;  3WGD A;  2FWF A;  5F06 A;  2N5A A;  3L9S A;  3DGQ A;  2B1K A;  2YCD A;  1O81 A;  3F3R A;  2HRA A;  1MEK A;  1AW9 A;  3TJG A;  2M80 A;  5IO0 A;  1AQX A;  2KOK A;  3VK9 A;  4IQ1 A;  1O8X A;  2F8F A;  6GSW A;  4GQF A;  4DSQ A;  1X5D A;  2DJ1 A;  4JZQ A;  3M8N A;  3GUS A;  3HYP A;  2H6Z A;  3KP8 A;  2DJ0 A;  2E2G A;  5C04 A;  2GZY A;  4XHM A;  1QXH A;  3FZ4 A;  3IK7 A;  2EFH A;  4OD7 A;  4PNF A;  1BF5 A;  3R2Q A;  5L71 A;  2L59 A;  4ECB A;  1R7H A;  3DWV A;  4ZL8 A;  3LFL A;  1THO A;  4BVY A;  1VGL A;  1Z9H A;  1PGT A;  3QCP A;  3UIW A;  5IIZ A;  5LCZ A;  2B5X A;  2TRX A;  1V9W A;  1AIU A;  3ME8 A;  5BMU B;  2X8C A;  1XPV A;  4TR3 A;  2R0G A;  5AGY A;  4WF4 A;  4DSR A;  5KN2 A;  2HSM B;  1GNW A;  4TW5 A;  2I3Y A;  2H66 A;  3HVV A;  1HQO A;  1V98 A;  2H0G A;  1M2D A;  3VWX A;  3UJ1 A;  4E8H A;  4KA0 A;  4HJ2 A;  2NBS A;  1K0C A;  4K0G A;  2ZNM A;  2UZ8 A;  5ID2 A;  4HQS A;  4NPB A;  2A2P A;  1FG4 A;  2H1A A;  1EV9 A;  4LLR A;  3SBC A;  2PU9 C;  1O73 A;  2VL2 A;  2YWM A;  5HQP A;  3GIX A;  2JSZ A;  2FA4 A;  2N5B A;  3CSI A;  2H74 A;  2VAF A;  4OFM A;  4NV5 A;  3HKR A;  1K3O A;  3HHV A;  4G0I A;  3F4R A;  3HJO A;  2VCQ A;  3DML A;  8GSS A;  3BD2 A;  3F63 A;  5EL8 A;  3LYP A;  3F0I A;  1DE2 A;  1OVN A;  4N3Z A;  4G19 A;  3FMW A;  4USS A;  2RII A;  5IQY A;  2GS3 A;  3I43 A;  1GLQ A;  3D5J A;  4MJC A;  4PQH A;  1IYH A;  2JSY A;  2BJX A;  2H1D A;  2HI7 A;  3F4T A;  1EWX A;  4ZB6 A;  4D73 A;  1F9M A;  2K8V A;  2C1Y A;  2L5L A;  2VL3 A;  2VM1 A;  1XZO A;  4NV2 A;  2I1U A;  5G2Z A;  2LEG A;  1NM3 A;  3D4M A;  5AIS A;  3ZLP A;  4WKW A;  5DJL A;  4W66 A;  1CQH A;  1ML6 A;  2OKA A;  1A8L A;  4ECI A;  2FUG 2;  1J9B A;  3C1S A;  1ZL9 A;  5KOX A;  4POB A;  2VOC A;  1Z7P A;  4MCU A;  1SK2 A;  1PMT A;  4GTU A;  2C3Q A;  5B6M A;  1JFU A;  2DKH A;  2O85 A;  4MP4 A;  3EU3 A;  5CRG A;  11GS A;  2OA7 A;  5ENU A;  4G0K A;  2C0E A;  3TRP A;  4H86 A;  4G2E A;  1PKZ A;  4GCI A;  5J4Y A;  1SKS B;  1EP7 A;  3EU4 A;  1URM A;  1A2M A;  1YY7 A;  1BG1 A;  4GSS A;  5B6N A;  2LKU A;  1GP1 A;  3IHG A;  4KSM A;  5JWQ B;  1UC7 A;  3NZN A;  2VLT A;  4POM A;  1ERV A;  3G9B A;  4KCE A;  4IVF A;  1G7E A;  6GSU A;  3FK8 A;  2L6C A;  3CYN A;  3EC3 A;  3KJY A;  1GSY A;  2ZCT A;  18GS A;  2EFD A;  2LTK A;  4POL A;  2L57 A;  3M0F A;  2AHE A;  4MJE A;  5DJM A;  3IDV A;  1E6B A;  1X9S B;  4D73 B;  1GSD A;  4K5R A;  1T4Y A;  4OO5 A;  3U5R E;  2MMA A;  1VF4 A;  4V2N A;  5KN1 A;  2LS5 A;  1XVQ A;  1I5G A;  3WT1 A;  1ERU A;  3DRN A;  4EVM A;  4L5L A;  4ML6 A;  4WET A;  5HR3 A;  3GST A;  5HR2 A;  2YP6 A;  2H1L A;  4OO4 A;  1BG5 A;  1A8Y A;  1V57 A;  4YKG A;  4MPF A;  4K1F A;  5D73 A;  3M9J A;  3CWG A;  3AY8 A;  2H6Y A;  5D9T A;  1HNA A;  5A1N A;  3ERF A;  2CQ9 A;  2WRT A;  3MYD A;  4N10 A;  4EKZ A;  2H72 A;  1SYX A;  5ELA A;  1T00 A;  1FOV A;  3F6F A;  1A2L A;  1PX6 A;  3FEU A;  4HU9 A;  3PGT A;  1DSB A;  2LV3 A;  3KMO A;  4AJ6 A;  1TI3 A;  2F9S A;  2GQL A;  2DJ3 A;  1QGV A;  3E3E A;  2GT6 A;  2PN8 A;  2OT3 A;  4Z7X A;  1M2B A;  2ON5 A;  1TXX A;  3RBT A;  1K0M A;  2VL2 C;  1BYE A;  3A3T A;  4Q5N A;  2A4H A;  1NHY A;  4IJI A;  1TJD A;  4MA9 A;  1ZMA A;  5E59 A;  4GQC A;  3TOU A;  2WB9 A;  5G1L A;  1AXD A;  4F9Z A;  2H19 A;  1GSQ A;  5DAL A;  5ECP B;  3QFB C;  2F8A A;  1X5E A;  1EV4 A;  1KNG A;  2BMX A;  3CTF A;  2OBK A;  2GGT A;  4AJ7 A;  3BBY A;  2MMO A;  5J4V A;  1OC3 A;  1B48 A;  1M2A A;  2C80 A;  4K2X A;  5GAP D;  1QMV A;  2WDU A;  3CSH A;  4NAX A;  3NOF A;  1ILO A;  4WXT A;  1GSS A;  3TKS E;  4RI7 A;  1RK4 A;  1K0B A;  1SJ6 A;  4K8M A;  4QL7 A;  1FVJ A;  2L4C A;  4F0C A;  1A0R P;  2R5G A;  4IP1 A;  4IEL A;  4J2F A;  4OFT A;  1GTA A;  2EIQ A;  4ISD A;  4O5Q A;  5KEJ A;  3HVX A;  4KDU A;  4AKG A;  2YN1 A;  3ZTL A;  3EMX A;  4XS1 A;  2AV4 A;  3WGE A;  1BQ7 A;  4HJM A;  1OC9 B;  3IPZ A;  5J40 A;  3ERG A;  4MH2 A;  2MMN A;  2RM5 A;  2TRC P;  3CRU A;  4LMV A;  1GTB A;  5D9W A;  1XWB A;  5INY A;  3LW9 A;  4JBB A;  2OAC A;  4BWQ A;  4OCF A;  4HZ4 A;  6GSS A;  1ZYN A;  5B8B A;  1WPI A;  2LUS A;  1WE0 A;  5DAL B;  1G7O A;  2DJJ A;  3GL5 A;  3ZMK A;  5EPF A;  3WYW A;  2VCT A;  2HSH A;  2HT9 A;  2E0Q A;  5AIX A;  1GUL A;  3Q18 A;  1GWC A;  3UOM A;  3A2X A;  4TKY A;  1U88 A;  1ERT A;  4GDF A;  4EDZ A;  3HVS A;  5F07 A;  1RQM A;  5DBQ A;  2PWJ A;  1CQG A;  3GFK A;  3F9U A;  4YQU A;  2YWO A;  3TB2 A;  1GUH A;  3EYT A;  4MF6 A;  1WP0 A;  2AYT A;  3KTL A;  1GSF A;  3GRX A;  4J57 E;  4MZC A;  2PPT A;  5GSS A;  3FZ5 A;  4MPG A;  2C0F A;  2V6O A;  3QAG A;  4IS0 A;  2HFD A;  2FLS A;  6GSY A;  2KUC A;  4E8E A;  2X49 A;  3UBL A;  5ECL B;  4BA7 A;  4HQZ A;  4GWR A;  3F8U A;  2HE3 A;  3HDC A;  7GSS A;  2MBS A;  2FD3 A;  1T8E B;  2WCI A;  4NHW A;  2H71 A;  4TR4 A;  1XW9 A;  5CNW A;  4IN0 A;  2JZR A;  3GV1 A;  2JZT A;  1WWJ A;  1UA5 A;  3P90 A;  2HRK B;  3TRX A;  4AGS A;  5J9C A;  5DQY A;  1V2A A;  2CZ2 A;  1XW5 A;  3FW2 A;  4MJA A;  1XWK A;  3C71 A;  3CTG A;  1XOB A;  19GS A;  5B8A A;  1H75 A;  2EIR A;  1Y25 A;  5ECI B;  5D9V A;  4EO3 A;  3EMP A;  1O6J A;  4MMM A;  3M3M A;  3EVI A;  5ECK B;  2WFC A;  4IP6 A;  1WIK A;  3UEM A;  2IL3 A;  2P5Q A;  3C1R A;  5G1K A;  1A0F A;  3P7X A;  3GTU A;  3GKX A;  1OE7 A;  4TXO B;  2C3N A;  1ON4 A;  2HSN B;  1BED A;  1EZK A;  1RW1 A;  4TRX A;  1TTZ A;  2X4A A;  3GNJ A;  1XVW A;  1B8X A;  4QL9 A;  3VPQ A;  3KP9 A;  2FY6 A;  1PN9 A;  4PQ1 A;  5DVB A;  5FWG A;  3P2A A;  4X1U A;  2B5Y A;  4ZIJ A;  4O32 A;  2YV9 A;  4JE1 A;  4TXV A;  3D22 A;  3KM6 A;  3IA1 A;  4O5U A;  2DJK A;  1GLP A;  2B7J A;  5J41 A;  5CRH A;  2MYG A;  1AAZ A;  3S9F A;  1TU8 A;  2HZF A;  2JAC A;  3FHK A;  5G30 A;  4G10 A;  2O89 A;  2A2S A;  2H76 A;  1PL2 A;  2C8U A;  1WMJ A;  3RPP A;  4Q5F A;  3GX8 A;  1A24 A;  4TOP A;  1XOA A;  2IFQ B;  3TJJ A;  2O5V A;  4HDE A;  3IAS 2;  3N9J A;  1MD3 A;  4YAV A;  2R0C A;  1N8J A;  1LJR A;  4FYB A;  1T1V A;  2I81 A;  4HUA A;  6GST A;  4IJ3 A;  3HJM A;  1TI1 A;  4HI7 A;  2GQK A;  2VKZ G;  3VWV A;  1K3L A;  4I2T A;  5COH A;  1EOH A;  2V32 A;  4POK A;  2DSA A;  3G7J A;  3V1W A;  3TKP A;  1TXU A;  4KF9 A;  2IIY A;  2QGV A;  1TK5 B;  4K9Z A;  4ID0 A;  3RHB A;  4EXJ A;  1XW6 A;  3TKS C;  3QR6 A;  4PQI A;  1DUG A;  4YAP A;  4L5O A;  2P31 A;  1VF2 A;  3H8Q A;  5HFI A;  3D6I A;  1SKR B;  2LST A;  4ECJ A;  3GUR A;  5J9B A;  1OAZ A;  3D4T A;  1K0O A;  1FHE A;  3TGZ A;  3PH9 A;  4QMK A;  5JCG A;  3RHC A;  1MDI A;  5B7C A;  2VM2 A;  4BVY B;  3QPM A;  1GNE A;  2KP1 A;  5CRW A;  1EGR A;  4F03 A;  4TR1 A;  1YQ1 A;  1J08 A;  2DIY A;  4I5Q A;  2P5R A;  2IMK A;  2O87 A;  17GS A;  4TR0 A;  4AKI A;  3ERW A;  4GF0 A;  3IK9 A;  1B4Q A;  4HU7 A;  3LSZ A;  4JU5 A;  3VPT A;  5GST A;  4P3Y B;  4EE0 A;  2IPA A;  3ZVJ A;  4GST A;  2ON7 A;  4PX1 A;  1S3C A;  5A4W A;  5IM9 A;  5ID2 B;  3P8W A;  4ZXG A;  2IME A;  2R2J A;  1ZGN A;  2I4A A;  2YZU A;  2HQT A;  4NHZ A;  5F8B A;  5CO3 A;  2HRF A;  2V41 A;  4KE3 A;  2BTO T;  3ZIT A;  3GN3 A;  3G7Y A;  1F37 A;  2VLV A;  5GAN D;  3R3E A;  1OKT A;  3Q19 A;  4XIH A;  3CSJ A;  5CAX A;  4MLY A;  3RDW A;  3GMF A;  3KZQ A;  4V2M A;  2X64 A;  3WGX A;  4KCA A;  3KIJ A;  4PTS A;  3RPN A;  4RQX A;  2LJK A;  2H01 A;  1F2E A;  3LXT A;  1YDK A;  3OR5 A;  1AUC A;  4MJB A;  1I9D A;  1YEX A;  4I6X A;  3IR4 A;  4V1A g;  4FYU A;  3H93 A;  1H4O A;  3Q6O A;  2H8L A;  4KUN A;  5GZZ B;  2OE0 A;  1XWA A;  3CXG A;  6GSV A;  1Z5Y E;  4OWY A;  2G2Q A;  5JWR B;  4WR5 A;  2KLX A;  4WBR D;  5CRD A;  4L0W A;  3US3 A;  3ISO A;  2LNT A;  2LRT A;  2R4V A;  5IMA A;  2MMZ A;  4E68 A;  2MZC A;  4YKF A;  4FQU A;  2YWN A;  5IPH A;  4ZIL A;  12GS A;  1EOG A;  3KH9 A;  1OE8 A;  2K8S A;  3LOR A;  4XRD A;  1YVL A;  3VI5 A;  4N30 A;  2FWG A;  4K6X A;  3ZZX A;  5E4W A;  3ZIV A;  3VWU A;  4F82 A;  4ZL9 A;  3H1N A;  3D21 A;  2AB6 A;  5JCW A;  3FR9 A;  1PD2 1;  4OFN A;  1SL2 B;  4K5S A;  2O8V B;  10GS A;  4DSS A;  4RI6 A;  3DIE A;  4MZB A;  2GZZ A;  5F0G A;  2KHP A;  4AI6 A;  3ZRD A;  1JZR A;  2GST A;  2H73 A;  9GSS A;  2DMM A;  4IQA A;  2V2G A;  2GZP A;  2VO4 A;  2ES7 A;  1TKD B;  3MIX A;  2E2M A;  4KSO A;  1AQW A;  3UMA A;  1N25 A;  2D2Z A;  1HNC A;  2R0P A;  3GKN A;  1M7T A;  3L0H A;  1FB0 A;  1SU9 A;  3WT2 A;  1KTE A;  3TCO A;  2GT5 A;  4IKH A;  4ICY A;  5FHI A;  1SKW B;  2C4J A;  3G7I A;  2DJ2 A;  3QFA C;  1U87 A;  3M9K A;  3A5I A;  3HA9 A;  4JR6 A;  4OCE A;  1Q4J A;  2E7P A;  3UAR A;  1ABA A;  2WZ9 A;  3VUR A;  3GX0 A;  5A1N B;  4A5P A;  3CRT A;  1SJI A;  4G01 A;  4EC0 A;  5A5H A;  3IE3 A;  5A34 A;  1Z7R A;  2DIZ A;  5IMC A;  1C72 A;  5CYY A;  2LRN A;  2OE1 A;  5HFK A;  1TRW A;  5JWO B;  3KXO A;  4KH7 A;  1U6T A;  3GH9 A;  3MDK A;  2HRN A;  1W4V A;  3GH6 A;  5D96 A;  4DSS B;  4HS1 A;  2CVK A;  2VUP A;  1Z3E A;  1MTC A;  5ABR A;  2QSI A;  1F6M C;  2IN3 A;  3PIN A;  1TP9 A;  4ZL7 A;  1Z6M A;  1XBS A;  5H5Q A;  4KDX A;  2VD1 A;  5IO2 A;  3KTB A;  1VRS D;  1WOU A;  2QC7 A;  5H5R A;  3GSS A;  4N11 A;  1VF3 A;  2VLU A;  4WBJ A;  2M72 A;  3HCZ A;  2X8H A;  3IOS A;  3W8J A;  3UVT A;  2B1L A;  2IJY A;  2C0G A;  1HYU A;  2R3X A;  2A2R A;  4ACS A;  5ECN B;  4MK3 A;  4EUY A;  2JZS A;  4NMU A;  4QQ7 A;  1TK0 B;  1O8W A;  3F3Q A;  1ZOF A;  2LQO A;  5F05 A;  4RUV A;  3TKS A;  4PUR A;  1UVZ A;  2GTU A;  2NVL A;  1S3D A;  2DC5 A;  1PSQ A;  5A5H B;  3HZ4 A;  5A34 B;  1T4Z A;  1PKW A;  3U6V A;  3IC8 A;  4JED A;  1R5A A;  5IPG A;  1EGO A;  4AKH A;  1B9X C;  5IMF A;  2FWH A;  1K0N A;  1FAA A;  5EVO A;  2HZE A;  2K9F A;  2OE3 A;  2YJ7 A;  2YWI A;  4HEA 2;  5J3R A;  4HZ2 A;  2HLS A;  1NHO A;  2FGX A;  2QKE A;  1VF1 A;  4LL1 B;  1ZYP A;  4L0U A;  3QOU A;  1FO5 A;  4K7N A;  1GH2 A;  1AQV A;  4FYC A;  5HR0 A;  3DVW A;  4YQV A;  4BVX A;  3A5W A;  3QDN A;  4MZW A;  2OJL A;  4GSN A;  4BWS A;  1Y6E A;  4KDY A;  2FWE A;  3SWL A;  1TK8 B;  4XRA A;  5IOW A;  4LMW A;  3APS A;  1OKD A;  3NIV A;  1JHB A;  2PBJ A;  3APQ A;  3APO A;  3I6A A;  5BMU A;  5LD0 A;  1WJK A;  2QA1 A;  3TJB A;  4IBP A;  5J5N A;  1U3I A;  3IRA A;  2HSM A;  2LQQ A;  1R4W A;  2X8G A;  1DE1 A;  5ECM B;  4GRF A;  2IMI A;  3Q74 A;  1TRU A;  3HJP A;  3MSZ A;  5HFG A;  3MAK A;  1M99 A;  3LWA A;  1X9M B;  4Z2R A;  4G9H A;  2B3S A;  3MWH A;  4V2L A;  1B9Y C;  1O7U A;  3GHA A;  1BAY A;  2HZE B;  4DEJ A;  4IGJ A;  1BJX A;  1SYR A;  3J7Y b;  2YNX A;  1GSE A;  3TU3 B;  4ZBB A;  1U3A A;  3IHQ A;  5IMV A;  1TDI A;  3BCK A;  4PGT A;  3ED3 A;  2R6K A;  2WJU A;  2PMT A;  2OAD A;  3I69 A;  1YZX A;  2R37 A;  5KN3 A;  4WEY A;  4BVX B;  3CMI A;  1JZO A;  4Z2U A;  2PER A;  3DVX A;  1XCC A;  4JR4 A;  1GUK A;  1M9B A;  4YQM A;  3DD3 A;  3EIN A;  3LYK A;  3EWL A;  5IMD A;  3RAZ A;  2AJQ B;  2L5O A;  3CBU A;  1A23 A;  2CX4 A;  1WRY A;  3KGK A;  5H5S A;  5LNK e;  5ECO B;  2N5F A;  2EIO A;  2PUK C;  2K18 A;  2QA2 A;  5CRE A;  2O7K A;  4ZBA A;  3KMN A;  2H30 A;  4AJ8 A;  3DKS A;  4EIQ A;  3GTU B;  2XBI A;  3VI7 A;  4EDY A;  2GSR A;  1Q98 A;  5A4U A;  3VWW A;  5D9X A;  2B7K A;  2VD0 A;  1AC1 A;  2I9H A;  3ZRE A;  4LL4 B;  1TW9 A;  3M1G A;  5DCH A;  1DBY A;  1EEM A;  3PR8 A;  2K6V A;  1T3B A;  2J23 A;  1TU7 A;  4XTS A;  3O76 A;  5D8I A;  2LJA A;  2ZUP A;  1E2Y A;  4Z2T A;  1GUM A;  1ZYQ B;  2H1G A;  3JCM L;  2VL9 A;  1XWG A;  4MF7 A;  2M46 A;  1QUW A;  2CV4 A;  1W89 A;  2YJH A;  3VLN A;  3H4K A;  1HNB A;  3H79 A;  4EL1 A;  2RUF A;  1XXU A;  4MDC A;  5ELG A;  3VFI A;  3KD0 A;  3IAM 2;  1SVO A;  3W6G A;  5A4V A;  4X4J A;  4F0B A;  5ECQ B;  4KW6 A;  1SVM A;  3IBH A;  22GS A;  1NSW A;  1X9W B;  5DAK A;  3TDG A;  3KH7 A;  1SK0 A;  2CAI A;  4ULX A;  1PRX A;  2H6X A;  4V1A p;  4XS4 A;  5DDL A;  1FB6 A;  1FOH A;  5A5K A;  1PA3 A;  5BRT A;  1ST9 A;  1YF1 A;  3IV4 A;  4FO5 A;  1YJ6 A;  4Q5R A;  14GS A;  2MBT A;  3UL3 A;  1K0A A;  4O92 A;  1SD9 A;  4WR4 A;  1OC8 A;  1ERW A;  1THX A;  3EUR A;  2RLI A;  2VIM A;  1TRS A;  3DXB A;  2VCW A;  2RM6 A;  3ZML A;  1GL8 A;  1LBK A;  3IXR A;  4AKX B;  2YV7 A;  13GS A;  2TIR A;  2UV8 G;  1ZCP A;  2GLR A;  1SEN A;  1G6W A;  2PGT A;  3GA4 A;  2P0G A;  2VCV A;  2GQM A;  2H1B A;  4CY6 A;  5AN1 A;  2XPE A;  2XPD A;  2CT6 A;  2F51 A;  3A2W A;  2PVQ A;  1KBN A;  2CA8 A;  2JAD A;  2IWT A;  1YKC A;  3ZFL A;  4CHS A;  3QAV A;  4MF5 A;  5DQS A;  1JZD A;  4F2I A;  2B5E A;  2DKI A;  1M9A A;  4TN8 A;  3EPT A;  2EC4 A;  4ZBD A;  1FVK A;  4TR1 B;  5G31 A;  2LJR A;  1EP8 A;  1SJZ A;  1SL0 B;  2ALB A;  3ZYW A;  1X0R A;  4EIP A;  5DAK B;  1J0F A;  3TJF A;  3O6T A;  4J56 E;  1UN2 A;  3L78 A;  1TRV A;  1PL1 A;  2IMD A;  5AIV A;  3TKQ A;  3A2V A;  2L6D A;  3E9J B;  2C0D A;  2EFE A;  2FA8 A;  5D93 A;  2DLX A;  5JCU A;  4XS4 B;  3ZFB A;  1G0T A;  3DYR A;  1EEJ A;  3FRC A;  5ECR B;  3HZ8 A;  1A2J A;  1K3Y A;  3L9U A;  2HYX A;  3HD5 A;  5KOW A;  2YPM A;  2YOI A;  1M0U A;  1GRX A;  1GTI A;  3BCI A;  3UBK A;  1ACV A;  3LEF A;  1BX9 A;  4I8B A;  1X5C A;  2LRC A;  3HXS A;  2J9H A;  3LG6 A;  1YEP A;  3QMX A;  3N5O A;  3L4N A;  3BOA A;  2CZ3 A;  3QAW A;  2GDR A;  3QD9 A;  1IYI A;  2WGR A;  4K7O A;  2F3M A;  5EY6 A;  4K7I A;  4I97 A;  4FH8 A;  3LQ7 A;  2FHE A;  2WUL A;  4YH2 A;  3TJK A;  1SVL A;  5DCG A;  1HD2 A;  3DEX A;  4I2U A;  2NPB A;  5ECH B;  2PVO C;  3TUE A;  3PPU A;  1XWC A;  1QK8 A;  2CAQ A;  1V58 A;  3TKR A;  4ECC A;  1OC9 A;  3TOT A;  3J7Y k;  3I9V 2;  4X43 A;  3LXZ A;  4OMV A;  4GXZ A;  4RQR A;  4ZB8 A;  1PN0 A;  4ZB7 A;  3GL3 A;  4JRR A;  2JU5 A;  4MAB A;  2XC2 A;  2Z9S A;  2NDO A;  3LJR A;  1R26 A;  4PUF C;  4PUA A;  4O7H A;  2CX3 A;  4MH3 A;  1PX7 A;  2FNO A;  2H0H A;  3GKM A;  3ZIJ A;  3K8N A;  1JLV A;  2GSQ A;  1K0D A;  1FW1 A;  1O85 A;  3BJ5 A;  1YF0 A;  3KEB A;  1GSU A;  2EFC A;  1T7P B;  4TVE A;  2H0I A;  2V1M A;  1Y1U A;  2G0F A;  5G5E A;  1B4P A;  2XHF A;  2X99 A;  3FY7 A;  3UVH A;  4AF2 A;  4WF5 A;  2C3T A;  1V40 A;  4BPY A;  5J47 A;  1MD4 A;  2CVB A;  2V6K A;  2FCH A;  4LA1 A;  1USB A;  4CDO A;  1MDK A;  3GKK A;  1S3A A;  5FT3 A;  2B6M A;  2DML A;  3C8E A;  1NW2 A;  2L4Q A;  3EE2 A;  4NWY A;  4G0L A;  3ME7 A;  3FR6 A;  4BL7 A;  3FKF A;  2HXK A;  4K2D A;  2NTO A;  3FZA A;  3FZ9 A;  1MDJ A;  4X0X A;  2HRK A;  2YZH A;  4ZB9 A;  3F6D A;  2VCX A;  1SL1 B;  3TRQ A;  3ZVJ D;  6GSX A;  2AAW A;  4DVC A;  3FYG A;  3WD6 A;  3F4S A;  1KEB A;  4KND A;  1JZW A;  3GYK A;  2CVD A;  4ML1 A;  2GSS A;  1F3A A;  4CW9 A;  5IMZ A;  4Q5Q A;  2YAN A;  2IMF A;  1G6Y A;  2KP2 A;  4EF0 A;  1TOF A;  4KX4 A;  20GS A;  2HNL A;  4O5R A;  3O3T A;  4TXO A;  5J4U A;  4IW9 A;  5G5F A;  2HSN A;  2LNS A;  4NXI A;  1LU4 A;  4PNG A;  1R5P A;  4PXO A;  3C7M A;  3LGC A;  1N2A A;  2OBI A;  1F3B A;  3L9V A;  1SK1 A;  16GS A;  2DBC A;  4N0V A;  4IHU A;  2VCZ A;  3FR3 A;  3MNG A;  2JL4 A;  3HY2 A;  4K0N A;  1QFN A;  4L8E A;  4GLT A;  3ZL5 A;  1XFL A;  4KGI A;  5CP1 A;  4FIW A;  1QQ2 A;  3C73 A;  1Z6N A;  1PQN A;  5ECS A;  2H70 A;  4BL7 B;  3UAP A;  3KCM A;  1ZYE A;  1YKA A;  4XS6 A;  3D0Z A;  5IOX A;  1SD8 A;  2GVP A;  4MNN A;  1ZZY A;  1XIY A;  4XCS A;  2IFQ A;  4N0Z A;  4CY8 A;  1JLW A;  3HMJ G;  4HOJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...