2PHTA

Pterocarpus angolensis lectin (p l) in complex with man-7d3
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
240
structure length
240
Chain Sequence
EDSLSFGFPTFPSDQKNLIFQGDAQIKNNAVQLTKTDSNGNPVASTVGRILFSAQVHLWEKSSSRVANFQSQFSFSLKSPLSNGADGIAFFIAPPDTTIPSGSGGGLLGLFAPGTAQNTSANQVIAVEFDTFYAQDSNTWDPNYPHIGIDVNSIRSVKTVKWDRRDGQSLNVLVTFNPSTRNLDVVATYSDGTRYEVSYEVDVRSVLPEWVRVGFSAASGEQYQTHTLESWSFTSTLLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lectin
publication title How a plant lectin recognizes high mannose oligosaccharides
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 53
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2phtA00
1V6JA 4YGDA 3WDUA 4XOGA 3ZSMA 1W6PB 1DQ2A 1GKBA 5EXOA 5GZDA 3RG0A 4FPOB 3U4XA 1AZDA 1UZZA 2JECA 4UW3A 1LHOA 3FUQA 3FLTA 4YM3A 4C1WA 1GV9A 2AUYA 4XHBA 3V65A 1HLCA 4R9DA 1DZQA 3M1HA 4FPEA 4HL0A 3WLUA 1N1VA 1N1YA 1A3KA 1W6NA 2ZGLA 3AP5A 3OYWA 3M3EA 1HQWA 4LBJA 4YZ1A 1YYNA 1S0JA 2GN7A 3KM5A 4XXPA 3MW3A 1J1TA 1MZ6A 1DLLA 3ATGA 3OPZA 4M3CB 3WDWA 3ZSKA 5JMCA 2AH2A 1JUIA 2DVBA 2CNAA 1W6NB 2GNBA 3AYDA 3OYWB 3I8TA 1CPMA 2P3IA 5T55A 3WZ1A 1S0BA 4FPJA 2G4IA 2NN8A 3O5SA 2XB6C 3BOPA 3SH4A 2CWMA 2ES3A 5KXCA 1WBFA 5JDBA 2EXJA 1RITA 2P2KA 3QLQA 4FPHA 1G9BA 2WSVA 2NMNA 1SACA 1WD4A 2HYKA 1FATA 2A6XA 4MYEA 1W0PA 2DUQA 2DWRA 3N7MA 1KDKA 3WCSA 4AGVA 4BMEA 5E89A 2ZHKA 4AVSA 3W58A 2WT1A 1DGLA 1C1LA 2JD4A 3HMYA 2R49A 1GSLA 1LODA 1N1TA 5HCBA 1LGBA 1DQ0A 3FLRA 1LESA 4Z8BA 3QCWA 1LEMA 2ENRA 3WUCA 2CL2A 1SFYA 2GN3A 2DU1A 3A0KA 2PHRA 4RA0A 4YW5A 1G9AA 2DUOA 1O4ZA 1SLCA 2C5DA 2PHTA 3I4IA 3IM0A 3WUDA 3AZYA 1G9FA 1JHNA 1LOEA 1V6NA 4WZFA 3FUOA 2R0FA 3TB0A 5CA6A 1LHVA 1ENSA 1KITA 4YFWA 3VV1A 4R9BA 4YFZA 5FRAA 3USUA 1VIWB 2R1BA 3RQ0A 2D3PA 2ZABA 4R9CA 5T5JA 1LECA 1HQLA 1MACA 4FP2A 4YW2A 2A6WA 3CNAA 3UL2A 1UL9A 3ZSJA 1HKDA 3USUB 3B9CA 3NV1A 4H55A 3ENRA 4UW6A 3VKLA 1N47A 3WDTA 1SLTA 2D6MA 3OJBA 3POYA 3AK0A 1V6IA 2ZGMA 1Z0HA 3AZXA 3D5OA 3INAA 3JUUA 2JE7A 2V5YA 4W65A 5EYYA 4D69A 1MS1A 3OBTA 4Y1XA 3IPVA 1FNYA 1D2SA 1YRZA 1CIWA 1LU2A 1YO8A 1GZWB 1MVEA 1KJRA 2UWBA 4DRVA 2ZAAA 2A7AA 1ONAA 5DZEA 3WG4A 4CRQA 2EALA 4C1XA 3ZVXA 2WT0A 5DZGA 2W08A 3IPVB 1RINA 2OUHA 1URXA 3NV4A 5DUUA 3FBYA 5DUWA 4XBLA 1H9WA 1ZM1A 1LGCA 4YGEA 4Y20B 5CAZA 1WLDA 2NYYA 4LBQB 5GZGA 3ZPYA 3LCPA 3O0VA 5T50A 2GDFA 2D6KA 1OKQA 3V0AA 2DU0A 2A3XA 2FMDA 2UWAA 3ILRA 5L73A 5GLZA 2D44A 2YY1A 5JOZA 1OQ1A 3UK9A 4Q1PA 2XG3A 5GLWA 5IUQA 1S0GA 3TAYA 3SH5A 1QGLA 2R16A 1ULDA 1MS5A 2ARXA 3IN9A 4M3CE 3PVEA 3UJOA 4ISRA 4P9WA 2P34A 3KQRA 2RHPA 1Q8VA 1CQ9A 1SBEA 1W6PA 2PHWA 1WW4A 3DUIA 4KBBA 1F31A 5DUVA 1AVBA 1KDMA 2UURA 5IK8A 2D6OX 4FVVA 2A75A 4XIOA 5F9TA 1DQ4A 1QDOA 2WQZC 1W6QA 4NOTA 2E6VA 1G8WA 1CR7A 2GNTA 4YZ4A 4AVTA 1ULFA 1QMJA 3BIWE 5H9QA 4XTPA 4M01A 5IK4A 4XILA 3ZXKA 1LU1A 3PVNA 3WHTA 2DVAA 3AXDA 3V64A 3BTAA 4FOVA 3WDXA 1GNHA 4FP3A 1W6QB 1QOTA 1CESA 2OW4A 4FQZA 1GANA 5H9SA 3GNEA 2VW0A 5GJ6A 4M3CA 3M3CA 1GZ9A 1GZCA 2DV9A 4YW4A 5GZFA 1JN2P 1S0CA 2E53A 3WG2A 5GLVA 4XTMA 4K1ZA 1YXWA 3AP9A 1N3OA 2AGSA 2SLIA 1IKPA 5DZFA 3POSA 3PVOA 4Q27A 4YGBA 5E8AA 1MS8A 1QOSA 1XQNA 2AYHA 3AZWA 2EXKA 1IOAA 1V6MA 1OFSA 2FHRA 2WSUA 3M2MA 4YG0A 1IS6A 2OUJA 1SBDA 5GLTA 4GKYA 2JJ6A 4UW5A 3ZXFA 3MPPG 4WV8A 1DHKB 2A3YA 1BYHA 3AYAA 4Y1UA 3WVJA 5KXBA 3AFKA 3DGTA 3L2YA 4YG6A 3NV3A 3WHUA 1GICA 2ZACA 4JC1A 3O0XA 4XJAA 4JRAA 2WKKA 1BZWA 2AR6A 4HANA 4M3CF 3B69A 3OBRA 1Q56A 3N3HA 2DTWA 5IK5A 1BKZA 2ZGRA 4ASMB 1LULA 5JOWA 1AX2A 1MS0A 2D3RA 1BXHA 2EF6A 3AP7A 5CNAA 3BODA 4XBQA 3SLIA 4WVVA 2PELA 2ZHNA 2DUPA 1V6LA 2WNEA 2DYCA 1RIRA 4IQPA 1H30A 2CWSA 1JXNA 1QNYA 3R4SA 5GLUA 1FYUA 1SLLA 4BMBA 4PBPA 1SCSA 1GLHA 3AP4A 2D3SA 4Q1RA 1O4YA 2NP0A 5T5PA 2ERFA 5DG1A 1LOFC 2GMPA 1SLIA 1AXZA 1VLNA 4PF5A 3WDVA 4FPYA 2V73A 2TEPA 1V6KA 2GMEA 2D7FA 4FOYA 2JKBA 4DPNA 1EPWA 1UMZA 1F5FA 4TYSA 4BM8A 1JYCA 1AJKA 3AYCA 2ZGOA 1APNA 3ILNA 3OGGA 3WNXA 2NZ9A 4GWNA 4FOWA 2EIGA 2A6VA 3SITA 2YXSA 1GZWA 5LK5A 2VW2A 5GZEA 1LGNA 4CTEA 1G86A 2Z42A 2ZGKA 2C9AA 3R05A 5T52A 1DFQA 1FV3A 1LJ7A 2ZHMA 3RS6A 3LSEA 4Y20A 1I1EA 1UX6A 2D6NA 4LBQA 4AGRA 2WJSA 4XJUA 3RRDA 2DURA 3ZXEA 4I30A 1Q8OA 1W6MB 2PHXA 1SLBA 4YZ5A 1Y7BA 4PBOA 4R9AA 3VUOA 4Y22B 2ZGTA 4XDQA 1S0FA 1G9CA 4GA9A 3AZZA 4U2AA 3IMNA 4XXAA 1KQRA 3N35A 5GALA 2VU9A 4DQAA 1TEIA 4BLJA 1NLSA 3SH3A 2A6YA 4GWMA 4LBMA 2A71A 4AYUA 5JOYA 4YLZA 4GXLA 1AJOA 1QDCA 1Z78A 1N3QA 5DXDA 2DVGA 1UZYA 1QU0A 1WW5A 4AGGA 4BOWA 4YGCA 5JOXA 1WCSA 3N36A 3AXEA 3AX4A 4XIKA 3SISA 1A78A 3WG1A 1JOJA 4F83A 1MR5A 3ZSLA 3NWKA 1H9PA 2A5ZA 5FREA 2ZGQA 2YROA 5T5OA 1DBNA 4FPGA 1LHNA 4Y1YA 1JW6A 4TZDA 1DQ5A 4FPFA 2LALA 2VUAA 2GNMA 2WT2A 2R0HA 1X50A 3AYEA 3JU9A 2B7YA 5GM0A 1WBLA 2D6LX 4Q2FA 4XJ8A 1AX1A 4ITCA 5E88A 3WV6A 4JCKA 5AVAA 2NM1A 4YW1A 2VXRA 2I2SA 2ZZJA 4ZXKA 3AJYA 1S1AA 4NO4A 4ZKTB 1UKGA 2DVFA 2E51A 4UW4A 3T1LA 4DS0A 5IT6A 2D43A 5CBLA 4XJWA 4K21A 1CVNA 4FPCA 2A6ZA 1Q8QA 1AXYA 1AF9A 1CONA 1IS5A 2UU8A 1DIWA 4U36A 1LOAA 1WW6A 1HDKA 2PHUA 1MS4A 4M00A 2D6PA 3O12A 4XZPA 1IKQA 4PQ9A 2E7QA 5GZCA 2ZGSA 1ZA4A 2W52A 1A8DA 1W6OA 1FNZA 4LBNA 4Y24A 3NV2A 4XMAA 2ZGUA 2OVUA 1R1ZA 2CTVA 2AREA 3AZVA 4XE9A 3ZXLA 1CN1A 1IS3A 1QKQA 5IK7A 5JVVA 1KRIA 2EXIA 3ZXJA 3HN1A 1N3PA 1QOOA 3V0BA 3M3QA 1U0AA 1W6OB 2R1DA 1SBFA 5SV8A 4LBLA 1LHUA 3VKFC 3WDYA 5HCAA 2YV8A 1F9KA 1C4RA 1YI7A 3WOGA 4FOQA 3W59A 1G9DA 1Q8SA 2H0BA 1LCLA 4FQ4A 1I3HA 3AJZA 1LOCA 3ZYPA 4L8QA 3VKNA 4BQ1A 1AX0A 1UAIA 1DQ6A 1UN1A 2GALA 3V0BB 3UJQA 1LEDA 2AENA 2VH9A 2ZGNA 1DYKA 4GALA 2ZKNA 1GNZA 4FPKA 3B01A 1JYIA 2DVDA 2KM2A 3N7LA 4YW3A 3A0NA 3IKWA 3LSDA 3PMEA 4ATFA 1KJLA 1CJPA 1VAMA 2LTNA 1NXD1 3N7JA 2DTYA 4XJZA 1C57A 4P9YA 2EAKA 3APBA 1IS4A 3RMYA 5T5LA 1ENRA 1Q8PA 1CPNA 2BQPA 1LOBA 5KXEA 4YG3A 2W68A 3SNMA 1MVQA 2ZGPA 2VW1A 5JLVA 4K1YA 2P3KA 4Y26A 5EWSA 2YMZA 2ZHLA 2A3WA 3N7KA 1MZ5A 1FX5A 1LENA 2JDZA 3MEPA 3O0WA 1FAYA 1FV2A 1W6MA 3FFZA 4WVWA 3GALA 1VALA 1WLCA 2A70A 3R4UA 2ZBJA 5F5QA 3RSJA 1MS9A 3ZYRA 5DG2A 4Y22A 4YM0A 2WLQA 2ZMLA 3VKMA 1WLWA 1ENQA 1BJQA 1JBCA 2ARBA 1N1SA 1ULEA 1VAVA 4Q8KA 3Q9OA 3WCRA 4ATEA 3T1MA 1PZ7A 5KXDA 2JE9A 3FLPA 5HCFA 3H0OA 1WD3A 1DQ1A 4P14A 1PZ8A 4Y1VA 4YZ3A 3OY8A 4XJ9A 4XBNA 1S0EA 1LHWA 1LTEA 1S0DA 2PHFA 1MS3A 1SCRA 4PCRA 4LBOA 1WUVA 5H9RA 4BPZA 3B00A 4FPLA 4P9XA 1DYPA 4LBQD 2GNDA 1YIFA 3RMXA 1WW7A 4K20A 4CZSA 1PZ9A 1QNWA 3C2UA 4Y1ZA 5CB7A 3OY8B 4XYXA 1W0OA 2EXHA 1QF3A 1GYKA 4GKXA 1V00A 1UPSA 3B3QE 4XHXA 4YZ2A 2ZA9A 3AP6A 3D6EA 2SBAA 3HR9A 3WG3A 4AWDA 4BLIA 4YM2A 1V6OA 2W39A 1ULCA 2P3JA 3VKOA 1ULGA 1S0IA 1C1FA 1LOFA 2VY0A 4ISQA 5BYNA 4LBKA 2UWCA 2YZ4A 3ASIA 4OZXA 3A4UA 1G7YA 4XMIA 4Q8LA 3MW4A 3V0AB 2P37A 4DRRA 4Q26A 2Q5TA 1D0HA 2ZMKA 2CY6A 2ZMNA 1B09A 4SLIA 5DUXA 2E7TA 1SLAA 2NMOA 3PJQA 4DFSA 2GMMA 4YM1A 5EYXA 5H9PA 4RL7A 3ILFA 3MW2A 1BQPA 3POWA 1GBGA 1LOGA 2CYFA 1AXKA 3M3OA 5T54A 4AVVA 3D4KA 3T2TA
chains in the Genus database with same CATH superfamily
2HWD3 3FN9A 1RUC1 1W6PB 1TZOA 1DQ2A 3I97A 3KV4A 5EXOA 1HV1A 4I0AA 5GZDA 1AL22 3U4XA 5FMOL 2EIEA 3NVCA 4D6RA 2QUOA 3HQXA 4UW3A 2VQAA 1GOGA 1FMD1 2HEWF 4Q4W1 3FLTA 1LKNA 1S55A 4YVWA 4CCNA 2QZ3A 3QD6A 5FXZA 3HAGA 2YC0A 3HT1A 1RMU2 2XDVA 4LO5B 4R9DA 4OHXA 3I2KA 2J1AA 2ZGLA 3AP5A 4LBJA 5A32B 4CCOA 4YZ1A 1YYNA 5AC91 3R0RA 3I2FA 5KWRA 2RS53 3P3PA 4YRDA 2VNGA 4R8HA 1DLLA 4MGTA 4Y3OA 3ZSKA 5DDJ1 2BVVA 4C8DA 1NYWA 1RMU1 4K8RB 2WZR3 2CNAA 1W6NB 3ACGA 4CDUC 4P00B 2VE1A 2VNVA 3C7FA 3WZ1A 1CAUB 4FPJA 3CJXA 1ZYBA 4MH0E 2DFBA 1PIV1 3H8UA 3O5SA 3DXTA 2VVFA 2JKXA 1ND2A 5KXCA 4LO4B 4EN7B 4YVSB 4C0BA 2Q1FA 2CGOA 2VOWA 2JDMA 4NPMA 2P2KA 1NA1A 4FXGB 4FPHA 3UETA 2Z69A 1W3XA 2DBNA 4NHXA 3O1SA 4QQHA 4IUGA 1WCUA 2BW8A 4LULA 3B94A 1W0PA 2DUQA 1VBE2 1W28A 5E89A 3EBRA 3RWNA 1ZBA2 3HMYA 2CAVA 5JPMB 5JAXA 1GSLA 2WN2A 4Z8BA 3E6CC 1UOBA 4ASLA 2AEZA 1RXGA 2JWPA 2GN3A 3EMRA 3MIGA 4RGGA 4CDXC 3ZYJB 4YW5A 3VL8A 1G9AA 3MFAA 4DXTA 2XKPA 5C9AB 1G6NA 4JHTA 4IE6A 3WY6A 3AZYA 1G9FA 4JHZA 1JHNA 4WZFA 2E9QA 3LWCA 1BBT2 1ZBA1 3VDAA 2BWCA 5ABJA 1LHVA 1KITA 3ST7A 3EO6A 2IXIA 3VV1A 4CU8A 3M4FA 3IWZA 3USUA 1X9PA 1H2NA 2JG8B 5FK8A 1UW8A 3NNJA 4QM8A 4KGQA 3VBSA 3GJAA 1HQLA 4QDRA 4YW2A 4BYYA 1R092 4WBBA 5A70A 1QXJA 1EV12 2IWGB 3IDCB 3POEA 5C4WA 4EN6B 1VBB2 4L99A 3LDKA 4QX0A 2R043 3CF6E 3J4UH 1DP0A 4H55A 3VKLA 2RR12 1N47A 2J22A 4NPLA 1JYVA 2FCUA 2P1BA 3AK0A 1AYN1 1V6IA 2ZGMA 1Z0HA 2F6BA 3AZXA 3GBWA 3MIBA 3WX5A 2V5YA 4ARYA 4QB6A 4DXZA 1OBNA 2VMFA 1UZWA 4NRQA 2Q30A 2PN5A 1EV11 4JGZA 3C7GA 3WOGA 3MHZA 3CU7A 4AQ2A 5C8WA 2WO1A 2WABA 1XXNA 1JZ2A 4XETA 5DZEA 3WG4A 2JXAA 3E5XA 4ONUA 1J3RA 4IE7A 3CHXA 4DXSA 1YQ5A 4CYDA 3U0ZA 1DDLA 4YGEA 1ZM1A 4Y20B 4AHWA 4LBQB 4EQVA 4YSFA 1OOPB 3O0VA 4UFMA 2HWD2 5JSRA 2DU0A 2A3XA 2FMDA 2UWAA 3FC0A 1VBD2 1IPJA 5B4NA 5M0TA 1R083 5AVPA 3MIDA 5A1LA 5GLWA 2QQWA 3PUQA 5IVYA 3ZYIB 4DZGA 3ZFEC 4GH4A 2R16A 1ULDA 1MS5A 5FXVA 5EP9A 3KQRA 4HLTA 2X29A 1VBD1 4KBBA 1WW4A 4OYUA 5DUVA 1AVBA 2UURA 2Z4FA 2D6OX 2PTMA 2R063 1DQ4A 1POV0 1YI9A 2WQZC 3FBMA 4KL1A 2D5FA 1G8WA 4XUPA 4NRMA 5FP3A 5CKNA 2D98A 2RS33 1Y3TA 1QMJA 3CIHA 3Q8CA 1HXS3 3ACLA 4XTPA 4XILA 2WZR2 1D4M3 5DN2A 5FZOB 1OH4A 3RZKA 5LCWL 2XLAA 3ZFFB 1NCRA 5FP9A 2BGPA 1XNAA 3GNEA 5FP4A 2VW0A 3ZSEA 4JGYC 5FOBB 1S0CA 2E53A 3KHBA 5GLVA 4QXBA 1YXWA 4QQOA 4B8EA 5J09A 5FZ1A 4Q27A 3VBOC 1CGPA 3SQOA 4A44A 4XCBA 4GULA 5BNNB 1IOAA 3M7AA 4N43A 4EYUA 1XNDA 4Q0UA 1UY4A 2I45A 1W8HA 1LRHA 1SBDA 1YFYA 2OUJA 5GLTA 5A6QA 3ZXFA 1RJ8A 1H1AA 1NZCA 4WV8A 4QHBA 4CEYB 3VBFB 2Y6HA 5FPBA 3PDQA 5FIXA 1I5ZA 1OLMA 1AYM1 3ON7A 3NJXA 4YG6A 1XNTA 2WQ8A 1OA3A 2FZ1A 3N9OA 5L7OB 3WHUA 3P1IA 1GICA 3RZMA 2OT7A 2ZACA 4QX8A 3S30A 4HANA 2I74A 3NRUA 1TNFA 4M3CF 5B4XA 3OBRA 3ZN6B 4RFRB 5GKAC 4OQ8A 1L7RA 3I54A 4I0WB 1AR83 2BUKA 1MS0A 2D3RA 3C7HA 5JOWA 3F95A 3BODA 4XBQA 2PELA 2HEYF 2XONA 3ZDSA 2W0XA 2YGMA 2DYCA 3DYMA 2R042 1ZRDA 1RIRA 2R073 5FPUA 5EJ1B 3VBUA 1DGWX 1W2TA 2HBTA 4OI2A 3DXUA 4ZS2A 1LAJA 2JE8A 1FYUA 5C8CA 4TXWA 2D3SA 5FZ7A 4A3ZA 1O4YA 4OI0A 1YHFA 3J9SA 3GZAA 5T5PA 1ALYA 4GAZA 1OQEA 1HN1A 3LIHA 4PF5A 2R041 4FPYA 1K5MA 4MX3A 4AFDA 2HWB3 3CJIC 3I3MA 2D7FA 1ACCA 4DPNA 4JQRA 4Q5OA 5FJHA 1F5FA 1QJEA 4TYSA 2QQOA 3I59B 1ZRRA 4CP1A 5FYVA 1O5UA 3WNXA 5JXHA 4XZUG 2WDBA 4FOWA 2EIGA 3AVSA 1O3QA 2XBO1 2ZTNA 1LB2A 1IHMA 3BU7A 3GZUC 1U5ZA 2RDRA 2HEVF 5LATA 3WQBA 4ARXA 3A21A 3AC0A 4CTEA 3KS7A 1R082 3BUCA 3J8F1 1JOBA 1FV3A 3HD8B 5IW0A 3LSEA 2XJSA 3RS6A 5AFEA 2LW8A 5D8AA 4ZXEA 1JZ6A 4JDOA 4Q4Y3 2DURA 1JU3A 4Y5Z0 1UZVA 4I30A 1BEV1 1W6MB 2HBUA 3POJA 3RVHA 4PIYA 2WAAA 4EZ4A 2A73B 4PBOA 3MGUA 1D7PM 2EIDA 4R9AA 3WW2A 5LY1A 5DPNA 5EV7A 2R062 4B4PA 1W8UA 1GOHA 1UNBA 1XE8A 2P6CA 3CZUA 2JDAA 3M70A 1VMFA 3DECA 4XDQA 2RS32 1G9CA 4U2AA 1AR61 4IGPA 1GOFA 3E1F1 3IBMA 1NLSA 1D4M2 4QMAA 5FDBA 5FO7B 2WYSA 4CPBD 3G6JB 1Y4WA 5BNOC 5K0UB 4BIFA 1OXCA 1QDCA 2R061 1VE0A 1UZYA 1QU0A 3GJBA 4IE5A 2OYZA 3ZR5A 4AGGA 4BOWA 5IAXA 1YUDA 2HKXA 5HPOA 1IG3A 5FZ8A 4IETA 1NKGA 2UY9A 3KT7A 2XMLA 1JOJA 4P9LA 2ET7A 1CAVB 3DPRA 4LLOA 3NNGA 2WLPA 4MGKE 3NWKA 1NT0A 1F4AA 3ZSLA 1JMUB 2BWAA 3VBHC 3FWEA 3O1MA 1DBNA 1RUE1 2HWC3 2KXLA 1GZTA 4FPGA 3SCFA 3HQUA 1RXFA 1WMDA 3EXUA 1YJKA 1JW6A 5ANNA 4DUXA 2GNMA 4XC9A 3C8XA 4HK9A 3JCIA 1Y9GA 2B7YA 1W3VA 2CU5A 3GBGA 1H8VA 3D8CA 1OLME 2NM1A 1E5SA 2VXRA 2ZZJA 3G7DA 4YW1A 3WDYA 4NO4A 1S1AA 1T6BX 3ELNA 3IB3A 1UKGA 4OI4A 4UW4A 3T1LA 4AI8A 4AEDA 4IEXA 4DS0A 5C70A 1RC6A 1ZRCA 2BRTA 2VC9A 2BERA 1AR82 3W9AA 2B46X 2GU9A 1AHSA 4K40A 3JBG3 1Q8QA 1EYBA 4OMDA 4F8AA 5JPNB 2W47A 1CONA 4CUBA 2WC2A 5B2GB 1M4WA 2R072 4BHPA 1WW6A 1HDKA 2JDYA 4OHZA 2D6PA 4XZPA 4FAGA 1FNZA 4V2VA 5FYIA 2ZGUA 2QFEA 2X53S 3ZXLA 2AREA 4OUSA 4O9GA 3BOWA 1QKQA 2XHNA 2R071 4YVWB 3KHCA 5JVVA 1GFF2 4KH9A 3ZXJA 5F8PA 4KG8A 3MLKA 3V0BA 1POV1 3M3QA 1KS5A 3K77A 2ATFA 2QTWB 2YU2A 3GM8A 3S7IA 1SHWB 1YCIA 2B4KA 5A7SA 3VKFC 1YI7A 4IEWA 5CKMA 3ZOIA 2YUEA 1AR93 1G9DA 4Z92B 4H14A 2H0BA 3W5NA 5A6YA 3AJZA 1ASJ3 4HMZA 3ZYPA 4E4SA 5JZGC 5C3PA 1V0AA 1U5IA 3NNLA 2G1MA 2V5DA 2GALA 1C5IA 1LEDA 4LA3A 5CADA 3J7LA 4GALA 1S2BA 4FPKA 3WF4A 4LT5A 3NSTA 3U07A 3B01A 3IZOA 4B7EA 5FWEA 1RVF3 1FI2A 3BU0A 4Y4YA 4ATFA 4DY3A 1VAMA 5I0RA 2LTNA 1X7NA 5A7NA 1ND2B 3IT8A 3JXSA 2IVJA 4META 4N8MA 2EAKA 4Q4Y2 1GP5A 3RMYA 3LPFA 1UIKA 4QPYA 1Q8PA 3UKTA 1NA1B 2PMWB 4LK6A 1LOBA 4FI9A 5KXEA 4YG3A 1MVQA 1BLZA 3IDAA 5LB6A 3THCA 3O1VA 1JZ5A 4XURA 1EUUA 2P3KA 3OOXA 3TBDA 3H1YA 5E6HA 4ES8A 2YMZA 4MZUA 1Z7S3 3AKSA 3DN7A 3HT2A 4NIHA 4Q4Y1 3PLQA 1FX5A 3MEPA 4CCEA 1WLCA 1CAXA 2A70A 2WFPA 4FSJA 3PIJA 4AVCA 3ZN5A 4COVA 3DV8A 2VOKA 4M4PA 2Z79A 2WLQA 4JGYB 3PUIA 3P5BA 5A3PA 4A2UA 1ENQA 1BJQA 1SPPA 2ARBA 2ZEYA 5ABJB 2TUNA 1LR5A 1VAVA 4QGLA 3Q9OA 1PNGA 4N53A 1OI6A 3VBOB 5FWJA 4GWIA 3L9JT 3FLPA 3VBSB 2G19A 2PAMA 3MF9A 3H0OA 3ZX7A 1UXZA 4J1XA 3GHNA 4P14A 1PZ8A 3ZMNA 5C4WB 4QT6A 2HWC2 1LHWA 4N90A 4YVSC 4EWEA 2CAUA 4LBOA 5H9RA 4BPZA 5I0UA 1KD7A 5C7GA 3OUIA 3B00A 4P9XA 2QQJA 1DYPA 3RMXA 1V9U3 4KBZA 3C2UA 4QPIB 3K3NA 4AVBA 2EXHA 1FOD3 2LROA 1QF3A 4JGZB 4B3NA 2P17A 2P5BA 2ZX4A 3CMGA 5FZCA 5FMBA 3H3ZA 4BXFA 4XHXA 1QXPA 2ZA9A 2DCJA 3AP6A 2C4XA 2VM9A 2GP5A 3W20A 3CBNA 1RTVA 3WG3A 4AWDA 4BLIA 4R4XA 5F5CA 1UPIA 2W39A 5C9AC 3UNPA 1BK0A 3JBG2 4IEZA 4LMFA 4XAAA 1ULGA 5J36A 1OUXA 2O1QA 4LBKA 3ZFGA 4ZU4A 4IEQA 4RS5A 2UWCA 4AI3A 2CV6A 2HWE3 2Y0OA 4OZXA 5LY2A 1G7YA 1WWYA 4BK5A 3MW4A 2GC2A 4LE4A 3HEIA 3I2IA 4AHZA 4Q26A 5KBFA 1D0HA 2ZMKA 1H1MA 3VBRC 4CXWA 3JBG1 1PMHX 1R1A3 5DUXA 1SLAA 5CFDA 4MGQA 2VBBA 1OPOA 4CCKA 4CDQA 1PNFA 4YM1A 4DFSA 4RL7A 5FZDA 1XU1A 3A7QA 4TN7A 3CJIB 4GH4B 2G9FA 2CYFA 1PVC1 4ZHNA 3T2TA 4ASKA 1V6JA 1Q5OA 4WM8A 5EQUA 4MXWB 5CZKA 1GKBA 1F4HA 4IGQA 1Q43A 3WT3A 5DAXA 3K4DA 3RJRA 2JECA 5EFUA 1MZEA 1AR92 4XFIA 3WNPA 1XRUA 1ASJ2 3FUQA 3EB7A 2QBXA 4EWAA 5HXMA 4XHBA 4AAPA 1DU3D 1REFA 3MFCA 1RUC3 4CCJA 4AK3A 1DZQA 2R30A 4BQWA 4FPEA 3TWIA 4C90A 4TTGA 4N9IA 1NE6A 3RNSA 1A3KA 2HWF1 3OYWA 3M3EA 5KC6A 1RVF2 1STMA 1NCRB 1S0JA 1AR91 1FMD3 3KM5A 3MW3A 1J1TA 3THPA 3ATGA 4RR3A 3WDWA 3ZXDA 1WMXA 4Q29A 4XABA 3U11A 1CD3G 5FPLA 2AH2A 2H0VA 5LW9A 4AF9A 5LK7B 2GNBA 4RD7A 3AYDA 1ZZBA 4WM7A 5AC93 2ZX0A 2NN8A 3VBRB 4K3UA 2XUEA 1YIPA 4DUWA 2K2SA 3SH4A 2JEMA 1H2KA 1ZZCA 5DDJ3 4ZY9A 2K0GA 1Z7S2 2ZZQA 1WBFA 2D97A 1CJDA 4M0NA 4XFAA 3R6SA 4ZZ8A 5JDBA 3HNYM 2IUWA 1RITA 1LNSA 3VDDB 2VZVA 4EN8B 2FZ2A 1PIV3 1WD4A 3FFQA 5A1FA 2FDHA 2HYKA 1FATA 5CEHA 4MYEA 4A6OA 2DWRA 3N7MA 3WCSA 4AGVA 2Y26A 4BMEA 5A6ZA 3VD4A 1RUNA 3W58A 2WT1A 1DGLA 2JD4A 3I3EA 2R49A 1LODA 5CA6A 1DQ0A 4Q0QA 4XUOA 2ZEWA 3VGIA 5J98B 2DU1A 4XF9A 3A0KA 4RA0A 3OTFA 3VZLA 1L7QA 2DUOA 4KG0A 3LAGA 2Y6GA 4KQ7A 1UU4A 2C5DA 4NAOA 4L9BA 3WUDA 2EVXA 1JODA 3E5QA 3KCXA 1V6NA 4LO6B 1QEXA 1XNCA 3WINE 3BTZA 2XUMA 4AI0A 4YFWA 2ZKLA 2JB4A 3OBZA 4YFZA 1UMHA 2FDJA 4FFHA 4PQQA 4FO9A 3MV01 3VBUB 2BU9A 2D3PA 4D6SA 1MQTA 1SQ4A 1MACA 1V9U2 5DQ0A 3CEWA 3TEZA 2C26A 4JAAA 4GMP0 2Q8CA 2WNVA 3LB9A 1SZBA 1FOD2 4RYDA 4A7YA 1OPMA 1ZBE3 2W91A 1PM4A 3UV9A 5BNNC 4ET7A 1HKDA 4JDNA 4A6SA 1K5MB 4LR4A 4KWLA 4IESA 2QDNA 3LA7A 4CEYC 3VBFC 4XUNA 3JUUA 3R4DB 5A33A 1V9U1 1YNAA 4D69A 3LA2A 3LKJA 2E31A 1MS1A 3OBTA 3NKGA 3LPGA 4LKSA 4Y1XA 2YBSA 3JQXA 3UT0A 1D2SA 2HWE2 2VZUA 1LU2A 1YO8A 3GDBA 1AYN3 3MLLA 2UWBA 3OD4A 5FBJA 1NE4A 2BZDA 2ZAAA 1M06G 1ONAA 1QH6A 3FE5A 2EALA 4C1XA 3ZVXA 1R1A2 4BCUA 2W08A 3IPVB 3AKQA 5DUUA 5DUWA 5LA9A 3FBYA 4KU8A 1PX3A 2OA2A 4XBLA 1H9WA 1RGSA 5J3UA 2HWE1 2R6QA 5GZGA 3ZPYA 2XJPA 4LKEA 4QX5A 4URTA 5F6KA 2GDFA 1OKQA 2O8OA 3ILRA 5GLZA 2D44A 2WN3A 4XFFA 1OQ1A 1IZ3A 3UK9A 5I8TA 2ADDA 3L2HA 1UY1A 1VMJA 4LPLA 3USSA 1S0GA 3TAYA 3UJOA 3IN9A 5CKQA 4M3CE 1RUC2 3PVEA 3PHMA 1VMHA 4L97A 2P34A 4D0QA 1Q8VA 1CQ9A 3DUIA 5FYCA 5IWFA 5IK8A 1NLQA 1ZRFA 4I3PA 4XIOA 3RGBA 1W6QA 2WZEA 3BGAA 4NOTA 3TN93 3U1XA 1CR7A 4YZ4A 1ULFA 1UU6A 5JIUA 3BIWE 5H9QA 2KR2A 4GB31 2PAKA 5IK4A 3KD4A 3KMHA 1VBD3 3PVNA 3TEXA 3UESA 4AXOA 5AC92 1J59A 1OMIA 3DPRB 1RUI3 4FP3A 1X8EA 1VB4A 4FQZA 5H9SA 5DDJ2 5I8SA 4AFMA 3KV9A 4IV1C 4UWDA 4EROA 5GJ6A 2BFUL 1GZ9A 1EY2A 5DAWA 2WQ4A 3LD8A 4OHWA 5L19A 2RDNA 3WG2A 5C33A 1DYOA 4TSVA 4XVHA 1JZ7A 1PIV2 1IKPA 5DZFA 4YGBA 5FO9B 1MS8A 1XQNA 4PDWA 2AYHA 2O14A 2WSUA 2FHRA 3Q8AA 4NIAA 2Q1MA 5EIYB 4OLLA 1OQDA 4UW5A 3B7MA 4F7ZA 4KWJA 2WL1A 2BP6A 1BYHA 3QH7A 3AYAA 5K0UC 3WVJA 1HB2A 4S2FA 5FZGA 3L2YA 5KXBA 1GU3A 1OA4A 3ES4A 3SKJE 2F4PA 4BQ2A 3OEBA 1GWLA 3NW4A 3BI3A 2X5IA 5IK5A 2DTWA 2YGLA 4CEWA 4W50A 5I0TA 1AYM3 1AX2A 4DY5A 2QQKA 1O59A 3AP7A 1H8TA 3SLIA 5CG8A 3H7JA 2ZHNA 1ND3A 2DUPA 4PLMA 1ZBE2 4NIIA 2NQYA 2WNEA 1ODNA 5IYYA 1ZZ8A 2P6HA 3NJYA 2XJRA 4JX0A 1BHGA 1H30A 4NMIA 4NWWA 1JXNA 1PO11 5F3EA 3T4VA 1YQ2A 4QQPA 4F3JA 4Q0SA 1W06A 1W2OA 3KVAA 2QDRA 5ACA1 3AP4A 4E27A 5L9RA 3OEAA 3QH6A 3KV5A 3A23A 2GMPA 1ZBE1 4NR1A 5EJ3A 1SLIA 4QPGB 1AXZA 2HJIA 2PAEA 1AYN2 4QKFA 3WW4A 2GMEA 4KNCA 5SV5A 2WYFA 2BOIA 5BPXA 5FZHA 2BBVA 2Y0IA 1XC6A 3WNOA 2ZGOA 2Z5WA 3PJYA 4X6QB 3ILNA 5F3IA 4FTEA 1BCXA 3O1TA 3OGGA 2PLV1 4JKKA 4CUAA 2ILMA 2VZPA 3SITA 2A6VA 3S6PA 2YXSA 1GZWA 4FTBA 1UU5A 4GD4A 2FCVA 5LK5A 2VW2A 1YWKA 2RJLA 3PUAA 4UT5A 3LF7A 2ZGKA 5E1RA 3THTA 4I2OA 4HSJA 1RUJ1 5BV6A 1JS9A 2GC1A 2ZHMA 2BGOA 1NQJA 1I1EA 2PHDA 1UX6A 2XBO3 5F39A 3ZXAC 2V4VA 4YVWC 1Q8OA 1GQHA 1SLBA 4K6BA 1XJAA 1UYYA 1Y7BA 3J8F3 4NROA 1NCQA 2VMDA 4IEPA 3I49A 3OG2A 2IVIB 2WAOA 2ZGTA 3IDEA 3TN92 1S0FA 1FT9A 2W1SA 3DCQA 1SPPB 2WFF3 1JYXA 1MZFA 1BEV3 2VU9A 4DQAA 4DNYA 5CIRA 4E2QA 1W8FA 2ZCWA 3SH3A 5C3OA 4COYA 1EAH1 4AQSA 3J7HA 1DZRA 1RUI2 1K3IA 2EICA 4B1LA 2WINB 3O14A 2WNUA 2WWSA 3RYRA 3NAPA 3TN91 1AR63 4NRPA 3T2QA 4LLFA 1TNRA 4IEVA 1ND2C 5JOXA 4OMCA 4JVAA 4NPRA 4Q4X1 3AX4A 4XIKA 1GR3A 2J1EA 3SISA 3ZKYA 5C71A 1NA1C 4CUCA 2VTFA 4W6WA 1RUI1 2VCAA 1MR5A 3H42B 1W9WA 3HBZA 4IEOA 3SKVA 5F2WA 2JB8A 1CAWA 3MBWA 2ZGQA 4DXRA 2IFRA 2VMEA 1HJGA 2PXJA 1LHNA 1YFUA 3N9NA 2OPKA 4XQWA 5FMCA 4AI9A 5IVEA 3HJRA 2PHLA 5FYYA 3SC7X 3C7OA 3AYEA 2C1FA 1WBLA 3O1PA 2FDIA 2D6LX 4XJ8A 4IV3A 2QKDA 3VZKA 1AUYA 1RUE3 5TSWA 3ZFGB 4BB3A 3AL6A 3I3QA 4P9JA 4RS5B 2I2SA 5ABJC 2V09A 4AG4A 3LQCA 3KWVA 3P3NA 2E51A 1ZREA 5IT6A 3ZMOA 1UYPA 2CHHA 4O65A 3WQ7A 5CBLA 4XJWA 1AYM2 4RQPA 2PQQA 1CVNA 3CZJA 4QHZA 3TNPB 4FPCA 3VBSC 4QPWA 3J26N 2B9UA 3FL7A 4CDQB 4COUA 5C4WC 1ODMA 3ZLIA 2Q4SA 1HB3A 2UU8A 5FUNA 1A6CA 1V70A 2PHUA 4M00A 5DAPA 4WM8B 5FY5A 5F2SA 1IKQA 2XJVA 4PQ9A 4QQLA 4XAEA 1OD5A 1RUG1 4LBNA 4LKDA 4QPIC 4G3YC 2CTVA 3AZVA 3IIIA 2AZ5A 4JGZC 3D0JA 2D93A 3P6BA 4MGYE 1NX9A 4CU9A 2IC1A 1KRIA 1NXMA 2EXIA 3M3IA 1N3PA 1QOOA 4RSUA 2E33A 1GQGA 5I0SA 4NIGA 2QCSB 1U0AA 1W6OB 4OHYA 1GNYA 2YV8A 1F9KA 2X09A 3AB0A 4I0BA 4FOQA 1YFXA 2GP3A 3E5UA 5FZMA 4DB5A 4LUMA 4BH9A 2ZX2A 1LCLA 1LOCA 4RR3B 1Y43B 4BQ1A 1AX0A 3HIFA 1DQ6A 5C5TA 1POV3 4QGMA 4FFIA 2AENA 2IXKA 3U75A 1DYKA 3PUSA 5FPZA 4WM7B 2QQUA 5DAQA 4N9HA 4Z07A 2KM2A 3A22A 4YW3A 2YC4A 3PMEA 3LSDA 5A7WA 4D94A 1CJPA 1W90A 1NXD1 4BK4A 1TVGA 2DTYA 2XBO2 4P9YA 3VBHA 2BNMA 3APBA 4KWKA 3RFRA 2LM3A 4GH4C 3AL5A 1CPNA 4FAHA 3W5MA 4E8CA 3J8F2 3T4HB 2ZGPA 1ULPA 1CZTA 2RV9A 4RGKA 3VHNA 5FYUA 4UBGA 4NN0A 2O8QA 5JXGA 4Y26A 2WFF2 4LA2A 3N7KA 1C8NA 1BEV2 5CFCA 1MZ5A 5EPAA 5FMOS 2WS91 5LBBA 3LDRA 4WVWA 3GALA 3T2OA 5A3UA 3T09A 2J1SA 2OZ6A 3R4UA 5FZ0A 1MS9A 4UYBA 3RSJA 2FDGA 4IV1B 1O3SA 1NCRC 2Q8OA 3GF6A 3VKMA 2ZMLA 1AR62 4HKOA 3Q8BA 2Y38A 1PK6A 1DGRN 2WFF1 4BWOA 2QJVA 1N1SA 3TYJA 3PTYA 4LEJA 3LDBA 5L9VA 4OCTA 3ORJA 1S2KA 2BNOA 4HONA 4QB2A 3JD71 5BUVA 3ES1A 4LITA 5HCFA 1YLLA 4QAWA 1DQ1A 1XOYA 5FPVA 1QH7A 5J96B 5JCTA 4Y1VA 4LO7A 2XQXA 2WRAA 4XJ9A 3LEMA 1S0EA 1LTEA 4CDWA 5FZAA 1MS3A 2F17A 3HQRA 3VDDC 1QJY3 2ZX3A 2QQLA 4LBQD 4B1MA 2GNDA 1YIFA 4K20A 4CZSA 1C8M3 2XVGA 4QXKA 5L9BA 3OY8B 4IGOA 4QQ2A 1RUE2 2XLGA 4XF4A 4FFFA 2XWJB 4HPKA 3B3QE 1UPSA 4YZ2A 1O3TA 1S2EA 2EAAA 1UY2A 5C3SA 2X8KA 2SBAA 2QZ2A 2ZAHA 3KCCA 4LTAA 3IAPA 4XDOA 2X05A 4XQDA 2GH8A 1BVP1 1V6OA 4PIXA 5F5IA 1AR71 2P3JA 3O1RA 2NLRA 3J7NA 1C1FA 1JHJA 1LOFA 5EJZB 2YZ4A 5BNPA 5A7QA 4NWVA 4C0HA 4XMIA 4Q8LA 3VBUC 2P37A 4MSVA 5JSPA 4H3WA 3WP6A 2Q5TA 4MV2A 2CY6A 2F4LA 1W9SA 2ZMNA 5C8CC 4SLIA 4QKNA 4WZCA 4KGGA 2RS11 3AKRA 2DDUA 5EYXA 1O8SA 5H9PA 2VBPA 2W95A 2WA3A 5FZEA 3WNLA 4W8JA 1GBGA 5T54A 3VZNA 4AVVA 2B9VA 3I3BA 1K5MC 1TG7A 2B39A 3SCGA 1R64A 4G4FA 4XOGA 3AMQA 3TOJA 1QJX1 2EIBA 3IAQA 1AZDA 3ITQA 3HN3A 4XEZA 5A32A 3S0MA 4QDQA 1D0GA 1LHOA 1PVC3 5A3LA 2ETEA 1GV9A 2JD9A 4FXKB 4C1WA 5A7PA 3M1HA 3WLUA 1N1VA 1N1YA 2AC1A 2H6CA 1HB4A 1W6NA 4NAMA 1ENXA 3ZO0B 5FO8B 1HQWA 2XLFA 4E9KA 1CAUA 4KMQA 4S2DA 4XXPA 1J1LA 2D40A 2FD8A 3OPZA 3POGA 3ZN4A 5APAA 5JMCA 2CDOA 2DVBA 3RZZA 1J3PA 2HWF3 1OSGA 3I8TA 2P3IA 1TME1 1S0BA 3VD9A 2G4IA 1ZNPA 4PDWB 2XJQA 3W21A 4JV4A 2ES3A 4P02B 4HVOA 2UYAA 4MO3M 1H2LA 3SEEA 2VTXA 3AMMA 2KA3A 3QLQA 5A3TA 1G9BA 1E5HA 2WSVA 1HW5A 5LWBA 1SACA 4AOCA 4Y5SA 3VL9A 4JKMA 3AVRA 2A6XA 1KDKA 2WO3A 1PM7A 3GHMA 1DCSA 2ZHKA 4FCAA 4AQ6A 4AVSA 3MICA 4JTNA 2Y6JA 5HCBA 1LGBA 2Q8DA 1O6UA 1LEMA 2ENRA 4UFHA 2CL2A 2RE9A 2X5IB 2PHRA 4A45A 4CEWB 1VR3A 2FBEA 1D2QA 1O4ZA 2JG8A 3LA3A 2J42A 3VLBB 2VMCA 2E26A 3DPRC 3I4IA 3IM0A 1H8TB 3ME2A 3NJVA 4N7IA 1IQDC 1ULOA 1LOEA 1ND3B 1F35A 4JTOA 2R0FA 5F1RA 3TB0A 4Z2AA 1ENSA 1X36A 2BDRA 4PI0A 5CYYA 5FUPA 1QJY2 2R1BA 2VMGA 2BPA2 4LHNA 3JZVA 5HI0A 2ZABA 4D6QA 5T5JA 1C8M2 4FP2A 1PHMA 2A6WA 3CNAA 4QDSA 4QGNA 5L7OA 1W8WA 3UL2A 5K4LA 2R7EB 1UL9A 5F3GA 4BU2A 4H7LA 3USUB 1W39A 3B9CA 4AEDC 4GWJA 4UW6A 2Y6KA 1QJY1 1SLTA 1UD1A 3OJBA 3WDTA 1UYXA 3POYA 3I2OA 1WCKA 3INAA 4W65A 3D3AA 1C8M1 2JE7A 5IVCA 5FK7A 2BNNA 3S7EA 2WR9A 1HB1A 4BQ3A 5IVFA 5FZ9A 2MHFA 1B35A 1FNYA 4D7YA 1UY3A 2Y34A 3ZYFA 1JZ3A 1CIWA 4QWNA 4AR2A 4CPBA 3MPBA 1GZWB 1MVEA 1KJRA 1OVSA 1OOPA 2R32A 4QKBA 3PIGA 4QD2A 5FTTC 1YQ6A 4CRQA 2WUHA 3ALQA 3NV4A 4CSWA 2JX9A 2OUHA 1URXA 1GWKA 5J48A 5JR2A 3VDBA 1WLDA 1K5JA 1ZZ9A 3NQHA 2JG9A 3I2JA 5HXVA 5FPXA 3LCPA 5T50A 1O5LA 2VVEA 1JH5A 2D6KA 1XB9A 1XE0A 3GBFA 1O8PA 3HNBM 4Q0PA 5J1XA 1W2AX 1OD3A 5K9YA 1NCQB 3ACHA 4DINB 4Q1PA 2RDSA 2VUDA 1UXXX 2UYBA 1Q3EA 2XG3A 1RUD1 4IERA 4XDPA 3O1OA 3LOBA 1PVC2 4QPGC 5IUQA 4M4RA 2Z2SB 3SH5A 1JOPA 3TRSB 4NHYA 4P9WA 5JI9A 1SBEA 4MGZE 1VJ2A 2PHWA 1OLQA 2YPJA 1KDMA 4G9SB 2CSGA 4NUBA 4FVVA 2WNUB 1W9TA 5F9TA 1QDOA 3AM2A 3ZFFA 3KGLA 2E6VA 4J1WA 1C5HA 4LQRA 2BTVC 4HOOA 4AVTA 4BJ0A 2RDQA 4Q4V1 4E8DA 3WW1A 4CU6A 5FLHA 5G05L 3ZXKA 2HWF2 4HN0A 3BTAA 3OPTA 1H4GA 4FFGA 3K4ZA 2DCTA 4JDMA 2GAUA 3K51A 1GANA 2JENA 4P08A 4UFLA 1CAWB 1CZSA 4M3CA 3M3CA 4MLOA 1GZCA 1TMF3 1OLRA 4GB33 3M8LA 4YW4A 5GZFA 4RHV1 4XTMA 1TQ5A 4I02A 3AP9A 5LA2A 1N3OA 5FZ6A 3ZYGA 1W99A 1YQCA 3POSA 3PVOA 1QJU1 1QOSA 3CO2A 2XOMA 4IV3B 4OULA 3AZWA 5FQ0A 2EXKA 2YHJA 1IS6A 2V72A 1REDA 4A7ZA 3LEGA 1K12A 2VZOA 2JJ6A 3C3VA 3U10A 3BALA 5C6CA 4N53C 1QWRA 1DHKB 2W87A 3ZN6A 1O4TA 2MEV1 4AFAA 4RQPB 4XFGA 4Y1UA 2UY8A 1P8JA 4HVRA 3AFKA 3DGTA 3J7MA 4N43B 1REEA 1FPN1 3F2ZA 3I2HA 4XPVA 1US3A 2VR4A 3DKQA 4MGSA 3O0XA 4R4ZA 2VCCA 1BZWA 2AR6A 2WKKA 3TNQA 3B69A 4MUVA 4ES9A 5CVRA 1YFWA 3UGGA 5LASA 5CNAA 3WR0A 1BXHA 5FY1A 4EN0A 2XHKA 1PMJX 4IEYA 4CA9A 1IGOA 5K7PA 1V6LA 1PO21 1SDWA 2ORZA 3U78A 4QX2A 4IQPA 2YBKA 4HK8A 4SBVA 5FP7A 5GLUA 4DMIA 3X29B 4S2GA 1SCSA 1GLHA 1ZVFA 5FY0A 3KSCA 1HRI2 2ZEXA 1SDDB 2BEOA 4NVPA 2XXZA 5FBZA 2NP0A 3ZFGC 4RS5C 1OKOA 1VLNA 3FX3A 4UXAA 1PO13 3VZMA 3WNNA 2V73A 2TEPA 3CLPA 5ACA3 1V6KA 5C8CB 2DF7A 3C7EA 4LIVA 4RGAA 4FOYA 2JKBA 1JTZX 4OZOA 1UMZA 5CU1A 3N4MA 2XKOA 2IXCA 2XGXA 4BM8A 3OCPA 1HRI1 4HKWA 5FZ4A 4XW3A 5A7WB 3AYCA 4HT1T 2XR4A 4Z1VA 5CFDC 5CG9A 4CDQC 2Q1ZB 4GWNA 5J37A 1PGL1 2QQMA 3RDIA 2VECA 5LA0A 3K46A 5ANQA 1QIQA 3ZPOA 1NQDA 2WO7A 4WM8C 3RJ2X 3DL3A 5GZEA 1E57A 1LGNA 4KI5M 5FLJA 1JYTA 1G86A 2C9AA 4HZFA 3R05A 5CISA 2PLV3 1ZRIA 1LJ7A 4PJYA 3AMNA 1D4VB 3B5LB 4E4ZA 3AFGA 2D6NA 1O91A 3LZZA 4AGRA 2WJSA 5KHGA 4I3GA 3RRDA 2RJKA 5CFCB 4ZONA 1H2MA 1NAEA 4LXLA 4LNVA 4CDUA 1UF2C 3ZDVA 5F3CA 4YZ5A 4RFT0 1VBC1 1RUJ3 2XVLA 1BMV1 1F2NA 1PVXA 1UX7A 4XFBA 5D8AB 3SCHA 5FZ3A 1A8MA 1WGPA 4RR3C 4XXAA 1KQRA 1CZVA 1O7FA 3NJZA 5GALA 1UQXA 4QHOA 2ZX1A 2TBVA 4LO8A 2A6YA 3JB8A 3LEKA 3VHPA 4LBMA 3H1MA 4AYUA 3BVCA 3S57A 1W8ZA 4COWA 3BTXA 3KT4A 4WM7C 1VBA3 3S5QA 2QQNA 5A80A 4GXLA 1CAVA 1AJOA 1Z78A 4OUMA 1N3QA 4E2SA 5DXDA 5IFTA 4CXYA 1F8VA 1WW5A 4CP9A 1TMF2 4GB32 3N36A 1RUH1 4CDWB 5FR3A 3NKTA 3AMPA 3AXEA 4CDXA 1EAH3 1DF0A 4K8FA 4HXCA 4Z2WA 2DFCA 4LJHA 2JDUA 3GCWA 2DCYA 3IIAA 3MIFA 2P4EA 1L7LA 4CCCA 5FREA 3O1UA 1GQPA 4Q4X3 4A4AA 1TMF1 4IL7A 3OUHA 1J83A 3WNMA 3CQOA 3SEPA 4GMP3 3RI8A 4TZDA 3FJSA 1HJFA 2FDFA 2VUAA 1XYNA 3H3LA 2WT2A 1X50A 3JU9A 5GM0A 5C3RA 1HRV3 2XL9A 2WO2A 4GZ9A 5IATA 3ZYHA 1BK1A 5E88A 3RPQA 3N9PA 4JCKA 1OURA 3WV6A 2QVSB 3N9MA 4ZXKA 2DVFA 5FMDA 2B8MA 2YB7A 1VRH2 1AL0G 1MQTC 4K21A 5FXXA 2YBPA 4MGIE 1W9YA 1UO9A 1ZZ6A 2A6ZA 4GQ7A 4UBHA 2WNVC 1IPSA 1AF9A 1HN0A 2JDHA 4UOJA 3E6BA 1E5IA 4AEDB 4BIOA 3H8RA 2VZ3A 1U12A 1DIWA 4U36A 2W2IA 2XQRA 4BQ4A 1MS4A 4MG2A 1OH3A 3O12A 1VRH1 1XYOA 5JMOA 2E7QA 2ZGSA 1ZA4A 2W52A 3POBA 2BJSA 3KVBA 4Y24A 4XMAA 4WVMA 1AL21 2OVUA 1UOJA 1YQ8A 1DGWA 1PO12 1JYIA 1GMMA 5IK7A 3EYPA 2RVAA 5ACA2 4BA6A 3I2GA 4AW7A 1E5RA 5IVJA 2W46A 1OA2A 1RUG3 2R1DA 4BDVB 1LHUA 3OBAA 4XUTA 3TEWA 2W92A 5FYSA 1C4RA 2ZXQA 3K4AA 1Q8SA 1RL3A 4DOUA 3ZFEA 2VZQA 2OS2A 4L8QA 1NUKA 3S5AA 1UAIA 1UN1A 4CCLA 3V0BB 4FBFA 3HPNA 2ZGNA 4BQXA 2ZKNA 1GNZA 2GC0A 2CDPA 2YG0A 1VB2A 1QJFA 3SMHA 2PLV2 3A0NA 1WMEA 3N7JA 4XJZA 1C57A 3KLSA 4MOAA 5I8YA 4LIUA 5LA1A 1IS4A 2WWJA 5T5LA 1ENRA 5FJKA 3ZM8A 4TLFA 2BQPA 3VDCA 3SXWA 4QM9A 4A7KA 4JZRA 4UI9L 3SNMA 3QBQA 1XBFA 3ZIXA 1WA4A 1RUJ2 4K9SA 2KD7A 4AAXA 4XF3A 2VULA 1RHI2 1RUF3 3LGRA 5FYHA 4UFKA 3KF5A 1VBE1 1EPZA 4JGYA 2H6BA 1LENA 1ZZ7A 3O0WA 1OF4A 3FFZA 2BYVE 2E63A 1VALA 3WQ1A 4BZ4A 3B93A 2ZBJA 4L11A 1T2XA 1GP6A 3RYKA 3VBOA 1VBA2 3BTYA 3CKHA 3KZ4C 4Y22A 2WZ8A 1RHI1 1XNKA 4ORFA 1K42A 1MEC2 3MDPA 4KWUA 1JBCA 2WS93 2VUJA 1O3RA 1BBT1 1ZA7A 5FYMA 5BY5A 4EWDA 1CAXB 1EAH2 1SFPA 1YJLA 5E16A 3WNKA 4ATEA 1CIYA 3T1MA 3H1WA 5KXDA 1CX1A 2J1UA 4QB1A 4B4RA 1VBA1 3MIEA 1JYNA 1UIJA 1WMFA 4LOSA 4PDWC 2VUCA 1NY72 2FMYA 1MEC1 2VL4A 3VD5A 4NHMA 3WW3A 1R091 4Q4X2 4QPIA 2J1VA 3RWKX 4UF0A 2PHFA 3MUZ1 1SCRA 2Y60A 2WA4A 4N53B 3OGVA 1VBB1 4PCRA 3T2PA 3ACIA 1NLRA 1HX6A 3JD73 3H3UA 4DIQA 5FKBA 2RR11 2RMU3 5I91A 1WW7A 4AI2A 1HRV2 2J1RA 4RN5A 4AEMA 1PZ9A 1QNWA 1L3JA 2BOJA 4Y1ZA 3WXPA 1GP4A 4XYXA 5FUIA 1NY71 5FXWA 1B35B 4GKXA 4AQTA 4LOTA 3OF1A 4GMP1 2VMHA 3HR9A 3FZ3A 4NE9A 2X5IC 4R52A 4W4ZA 4BXSV 4CXXA 4YM2A 1W04A 3OGSA 4CEWC 3UYJA 1HRV1 1ULCA 1VP6A 1W8OA 1H8TC 1S0IA 5HV0A 4OFGA 2VY0A 5FZFA 2VOXA 3JB4C 1ND3C 4I09A 5BYNA 4P5YA 5HBAA 3H8XA 2JG9B 1XYPA 3CJIA 1F15A 3LFIA 2GC3A 3K48A 1AR73 2HWD1 2B5HA 3V56A 5FYZA 4MXWA 2NMOA 3OGJA 2GMMA 5A3OA 4IE4A 2RS52 1EP0A 1TE1B 3POWA 1LOGA 3BCWA 3M3OA 1AXKA 3POFA 2VZTA 3D4KA 4LHSA 2B42B 2NPIA 4YGDA 3WDUA 3ZSMA 3FHAA 1RUG2 3RG0A 2RG4A 2RS13 4BISA 4FPOB 5CFDB 1KFXL 5KHIA 3T30A 1UZZA 3NNMA 1NG0A 2QQIA 2RS51 2AACA 3HWJA 4YM3A 3B02A 3PTRB 2AUYA 3B9IA 3V65A 3BYWA 1HLCA 5G04L 1QJX3 3WP5A 4HL0A 3ZYBA 2WZR1 3AKTA 1WA6X 5I93A 5KHJA 2GN7A 3VBRA 4PI2A 1UWWA 1MZ6A 3T0AA 3OD0A 4M3CB 2GH2A 5IHRA 2ORXA 2IZWA 1WLTA 1JUIA 1W03A 1OVPA 1BVVA 3OYWB 5T55A 3VDDA 1CPMA 1QJZA 1IG0A 5BNOA 3RYPA 3VZOA 3E6DA 1NCQC 3LIGA 4LUKA 2XB6C 5FQ0B 3ACFA 3URFA 1RUF2 2YYOA 3BOPA 2CWMA 4YPJA 1RUOA 2OXBA 1H0BA 5JXJA 2C24A 4H7MA 2EXJA 4E4DX 5FP8A 5FY8A 5JR7B 2VBDA 1TME3 3BIEA 1X8MA 2ARAA 2BV4A 3OSDA 1W2UA 2NMNA 1HIXA 3GCXA 5JSOA 5JI7A 2XVKA 5HV4A 5FOJB 3WQ0A 1RUF1 2WNUC 3KB5A 2HYXA 2W5FA 3NAPC 1C1LA 2WS92 2ZEZA 5FPAA 1N1TA 3FLRA 1LESA 2LUWA 3QCWA 4QU2A 1H6YA 3WUCA 3OUJA 1SFYA 4KU7A 4UFIA 1WCDJ 1SLCA 3RZLA 4IEUA 2PHTA 4JQTA 2TNFA 5HCHA 2XPJA 1WKYA 3FUOA 4DUVA 2ARCA 4GJYA 3MIHA 4R9BA 5FRAA 1VIWB 3NNFA 5I0DA 3JD72 3RQ0A 3K75B 1JU4A 2RMU2 5D2AA 2BFUS 4R9CA 1LECA 1XSRA 4L2NA 4IV3C 1I5PA 5IFPA 4AHXA 4ZZ5A 1W8NA 2VMIA 3ZSJA 1JYWA 4LE3A 3RZHA 3NV1A 4CCMA 3ENRA 1MQTB 2YFZA 3WF3A 4UFJA 2D6MA 4AEJA 2RMU1 1SMVA 3D5OA 2VVDA 4S2HA 3BPZA 4RQPC 2WNVB 5EYYA 1QY4A 2VD7A 2IXHA 1HQNA 2C6SA 2W1QA 4N43C 3RZGA 2ZOEB 3IPVA 4QXHA 1YRZA 2VTXJ 1PMIA 4DRVA 5A33B 1XE7A 2A7AA 2VQ0A 1AR72 4PT6A 5A3WA 3WF0A 2WT0A 1QQP3 5DZGA 4A3XA 1RINA 2JIJA 2YC2A 1R081 2DCKA 1LGCA 2IFWA 1UOFA 5CAZA 2NYYA 5JZGA 4IDZA 1MPXA 3IDBB 4HN1A 2VQUA 2RM23 2GZWA 4XFHA 3V0AA 1COV3 5K8SA 1HXS2 4OUEA 1SG3A 5L73A 4CDUB 2YY1A 5JOZA 1C3HA 2K9ZA 2RS12 2W1UA 4P9IA 4I01A 4EZHA 5LEJA 2LS6A 2V4AA 1X33A 3Q8EA 5DABA 1ST8A 3D0SA 2DCZA 2JDPA 3FHIB 1QGLA 2RS31 4XFCA 2ARXA 1QJX2 3PU8A 1HXS1 4ISRA 5FKCA 5FZLA 5A3NA 3T08A 2RHPA 1W6PA 2L9LA 1D4M1 1F31A 1UZ0A 2QNKA 2CGPA 1RUD3 2A75A 3WD5A 1C28A 1HV0A 4GIQA 4IW3A 2GNTA 3FMGA 2XJTA 1PGW2 3WEZA 4CP9B 5BXXA 4NIDA 4L92A 4E2GA 1OFNA 4M01A 4CDXB 1LU1A 3WHTA 2DVAA 3AXDA 3UKNA 3V64A 4FOVA 3WDXA 1GNHA 3OGRA 5F5AA 3HBKA 4HFSA 4X6RB 3UGHA 1W6QB 1J84A 1CESA 1QOTA 2OW4A 3TEYA 2J7MA 3ECQA 4Q4V3 4BQ5A 3I7DA 2EA7A 4EE2A 1PGW1 2DV9A 1JN2P 3BKZA 5CFCC 3ZIWA 4K1ZA 1TME2 2VGDA 3KV6A 4GJZA 4P5HA 4UAPA 2AGSA 4W6YA 4BE3A 4CE8A 2SLIA 5KR7A 4COZA 4O61A 3WF1A 3NO8A 3BN6A 5E8AA 2VZSA 4C91A 5LEKA 5F37A 2VJXA 2G9ZA 5D1IA 5D8AC 1V6MA 3ROUA 1OFSA 3M2MA 4YG0A 4YVSA 1PK6C 4RHV3 3DKWA 2W9XA 1U5YA 4GKYA 1NZIA 3MPPG 4INDA 5LRRA 4PHZA 2A3YA 1QJU3 4AVAA 1IPKA 1XPWA 1AR81 4QXCA 1YC61 3GZTB 2BBAA 3NV3A 4DEVA 4X8NA 2PYTA 4JC1A 2BGCA 4CDWC 4XJAA 4JRAA 5FY9A 5FZKA 2YPDA 3HOBA 2MEV3 4QX3A 1Q56A 3N3HA 3POIA 1BKZA 2ZGRA 4CP0A 2HWB2 1LULA 4ASMB 5C9AA 5IJRA 2EF6A 2HLEA 1FPN3 1KGYA 2ZJCA 4WVVA 3BB6A 2E7AA 1PX4A 2VQTA 4WVMB 4AL9A 5BNQA 1J3QA 4QPGA 4MHUA 2CWSA 2K46A 4Y33A 1QNYA 4IE0A 4QKDA 5A7OA 3R4SA 1SLLA 4BMBA 4BQYA 2HWB1 4PBPA 3VD7A 4LK7A 4PF1A 3MV11 4Q1RA 3H9AA 3UKVA 1Y9QA 1XNBA 1LOFC 1PO23 2ERFA 3H7YA 5DG1A 5LBEA 4LHLA 4XACA 3WDVA 2C9KA 2FCTA 3ZFEB 2FDKA 5BNPC 2VZRA 3HNMA 3PNAA 1KXGA 2Y33A 3DF0A 2VCMA 4OI1A 4O7XA 1EPWA 4AE2A 5DAVA 1JYCA 1QQP2 2VAUA 1AJKA 1OT5A 2CGNA 2YFUA 1VAKA 3I2DA 3MYXA 3O7OA 5IVBA 3RZJA 5FFOC 1APNA 4L0PA 5IAVA 2NZ9A 2OPWA 5KHKA 3ZKUA 2RM22 2HH9A 1COV2 2YDEA 3H8OA 4JRLA 1CWPA 2Q0AA 4CUGA 1X9TA 3VHRA 1HRI3 1UCXA 3EJKA 4D3WA 1QQP1 3LEIA 2Z42A 5T52A 2RJ2A 1DFQA 2VG9A 1XU2A 3KF3A 4YW6A 2VNOA 4AZZA 2WWUA 4Y20A 4LBQA 3FHQA 4XJUA 1ZX5A 3KT1A 2RM21 2MNGA 3ZXEA 1COV1 5A1AA 2PHXA 4FTSA 3GYDA 2Y6LA 1F5JA 3WSOA 3VUOA 4TWTA 4Y22B 1RUD2 2OQ7A 3DEMA 4NHKA 1US2A 3PUHA 4D7TA 5T3NA 1Y9MA 3HVDA 4GA9A 3AZZA 4HKLA 3IMNA 3N35A 1TEIA 4BLJA 4H2AA 3SHRA 1A34A 1VPHA 3ETPA 1I9RA 1VBC3 4E4HA 4GWMA 2A71A 1GWMA 1QHDA 4YW7A 5JOYA 4YLZA 4Q4V2 2DVGA 1KS4A 2ID4A 1I6XA 1KFUL 2MPFA 4XUQA 4YGCA 3VHOA 1WCSA 4AFCA 1KEXA 4UF0B 3WP3A 2XJUA 2ZS6B 3E97A 4FT8A 2QQPA 2HWC1 3WP4A 2I07B 4WVZA 2N7GA 1XSQA 1A78A 2D5HA 3WG1A 4DEQA 5FZOA 3JQWA 4F83A 2G9GA 2Q8EA 2OQ6A 3IMMA 3NAPB 4Y5TA 1H9PA 2A5ZA 2VNRA 4TLGA 4QX7A 1RUH3 2YROA 5T5OA 4RHV2 4OQ9A 4CP2A 3K2OA 3QACA 3T3YA 1W05A 5J7MA 4Y1YA 1DQ5A 1W0NA 3PMSA 4FPFA 2LALA 5ERLA 1QJU2 2R0HA 2JG8C 3ZXGA 4Q2FA 4XF1A 2Y8KA 1AX1A 4ITCA 5BNNA 3MO4A 5AVAA 3KCYA 3UGFA 5C3QA 3AJYA 5JXIA 1T6GC 1U5XA 4ZKTB 3QOPA 3Q8FA 5LZ6A 1WCQA 2MEV2 1JZ8A 1H4HA 2D43A 2ET1A 4CEYA 3VBFA 4ZPIA 4EN9B 1DLCA 1YEWA 3CDZB 4N7UA 1FPN2 1DZTA 5EZWA 1AXYA 1RYYA 5L7OC 4MHRA 4AFBA 4HVQA 1SEFA 3NL1A 1IS5A 2VZ1A 4LKFA 1LOAA 4B7KA 4B4QA 3OPWA 2JDNA 1VRBA 1JUHA 4Q0VA 4JKLA 5GZCA 2LRPA 1A8DA 3ETQA 1W6OA 3AKPA 5IVVA 3NV2A 1PO22 1R1ZA 4XE9A 3PL0A 1RB8G 3ABZA 1CN1A 1H1IA 1B35C 3KQ4B 3MF6A 2DBIA 2QE3A 1IS3A 2XH6A 1DG6A 4Q4W3 2WZPP 1ASJ1 1VRH3 2Y6FA 3HN1A 4YARA 1OOPC 2VPVA 4PIZA 3I3DA 4IXLA 4PLOA 5L36A 5FZIA 2ADEA 1POQA 1SBFA 5SV8A 4LBLA 1AL23 5F7UA 3LOIA 5HCAA 1QXRA 2VOVA 3W59A 4NJ4A 1RVF1 2IXLA 1OF3A 4FQ4A 1I3HA 1FXZA 1W9FA 4K7JA 1UKRA 3VKNA 2JG9C 2PA7A 4LORA 4P9GA 1X82A 2OIIA 3U14A 1NOVA 3VZJA 1JZ4A 1RMU3 2OZJA 2VCBA 3UJQA 4HG6B 1PGSA 1UOGA 2VH9A 3LFMA 3LE0A 2W3JA 3T0BA 5F6LB 3I59A 5BNOB 2DVDA 2VXJA 3N7LA 1IQAA 3ZR6A 3IKWA 3MLJA 3N9LA 2W94A 4OHVA 1KJLA 5FY4A 4AEKA 3T0DA 1PGL2 5C5UA 2IXJA 3N9QA 2FQPA 2GSYA 3GGLA 4V2WA 1Z7S1 4NHLA 1WZXA 2YU1A 3MZHA 1UYZA 2AEYA 2W68A 4CCDA 5LRSA 2VW1A 3D82A 5JLVA 5JUVA 3OB8A 4YWAA 5LBCA 5A6XA 4K1YA 4HBNA 3VD3A 4URAA 4IV1A 3VBHB 1H6XA 5FCCA 5EWSA 3ZFFC 2ZHLA 5KC5A 2A3WA 4YYOA 2JDKA 4LHKA 4V1PA 3MI8A 2JDZA 4CVUA 1FAYA 1FV2A 1W6MA 5DMYA 5FAXA 1VBC2 4QX1A 1EUTA 2J1TA 1BMV2 5F5QA 3GXUA 3ZYRA 5EHDA 5DG2A 2JICA 4D8MA 4XF0A 1VBE3 4YM0A 1WLWA 3THDA 3U4SA 1ZBA3 3RI9A 3KGZA 2VO5A 3H50A 5A3MA 4MXVA 1ULEA 5JIAA 5FYBA 4Q8KA 3WCRA 2O0OA 4J6GA 5KHHA 5F32A 3WF2A 1PZ7A 2QQVA 2JE9A 1RHI3 5K0UA 1J58A 1JI6A 1WD3A 3EQEA 3DYOA 4MVTA 2PFWA 1PK6B 1OUSA 2XL7A 4YZ3A 1RUH2 3OY8A 5D21A 1BBT3 3BPSA 4XBNA 4D7SA 4DO0A 1CX4A 1SFNA 1FOD1 1S0DA 5ISLA 3DYPA 1DGRA 2WIIB 4J25A 1RJ7A 1WUVA 3VB9A 4A42A 2C0ZA 4OVEA 4EJRA 4Y4RA 2P3YA 4FPLA 3CL1A 1S4CA 2X10A 4W6XA 2BVBA 1MEC3 5CB7A 1R093 2XWBB 4Z82A 1W0OA 3U37A 3EHKA 1EV13 2E32A 3NMBA 1GYKA 1VBB3 1V00A 2PQSA 4MADA 3D6EA 4YNIA 1OHFA 2RR13 1W2NA 2W1WA 5JWPA 3GZEA 2WNOA 5LBFA 5AFBA 3K3OA 3PU3A 4B29A 1K45A 2WBKA 5FYTA 4M0HA 4XCAA 4AHYA 3VKOA 4ZS3A 4ISQA 5FY7A 4HPKB 4A41A 1R1A1 1W8TA 1GUIA 2VOTA 4ZU7A 2OKXA 3PURA 4CU7A 2A1XA 3ASIA 2B45X 5JZGB 3A4UA 1OC1A 2ZPXA 3AMHA 1UY0A 5FZBA 3V0AB 4DRRA 3VN4A 5FV3A 1B09A 4QU1A 4EV0A 2OX0A 4PLNA 2E7TA 3PJQA 2Y64A 3PVBB 2JIGA 4HSLA 4ZU5A 5BNPB 4HETA 1FMD2 3ILFA 4Q4W2 3MW2A 1BQPA 3MUY1 4X8PA 4AI1A 4O9EA 4XQ4A 5FLIA 1UMIA
chains in the Genus database with same CATH topology
2HWD3 1RUC1 1W6PB 1DQ2A 5EXOA 5GZDA 1HV1A 4I0AA 3U4XA 1AL22 5FMOL 3NVCA 2QUOA 3HQXA 4UW3A 2VQAA 1FMD1 2HEWF 4Q4W1 3FLTA 1LKNA 1S55A 4YVWA 2QZ3A 3QD6A 3HAGA 2YC0A 3HT1A 1RMU2 4LO5B 4R9DA 4OHXA 2ZGLA 3AP5A 4LBJA 4YZ1A 5A32B 1YYNA 5AC91 3R0RA 5KWRA 2RS53 3P3PA 4YRDA 2VNGA 4R8HA 1DLLA 3ZSKA 5DDJ1 2BVVA 1NYWA 1RMU1 2WZR3 2CNAA 1W6NB 4CDUC 3WZ1A 1CAUB 4FPJA 3CJXA 1ZYBA 4MH0E 2DFBA 1PIV1 3H8UA 3O5SA 2VVFA 5KXCA 1ND2A 4LO4B 4EN7B 4YVSB 4C0BA 2CGOA 2VOWA 2P2KA 1NA1A 4FXGB 4FPHA 2Z69A 4QQHA 2BW8A 4LULA 3B94A 1W0PA 2DUQA 1VBE2 5E89A 3EBRA 3RWNA 1ZBA2 3HMYA 2CAVA 5JPMB 5JAXA 1GSLA 3E6CC 4Z8BA 4ASLA 2GN3A 4RGGA 3MIGA 4CDXC 3ZYJB 4YW5A 3VL8A 1G9AA 3MFAA 2XKPA 5C9AB 1G6NA 3WY6A 3AZYA 1G9FA 1JHNA 4WZFA 2E9QA 3LWCA 1BBT2 1ZBA1 2BWCA 5ABJA 1LHVA 1KITA 3ST7A 3EO6A 2IXIA 3VV1A 3M4FA 3IWZA 3USUA 1H2NA 2JG8B 1UW8A 4QM8A 4KGQA 3VBSA 1HQLA 4YW2A 4BYYA 1R092 4WBBA 1QXJA 1EV12 2IWGB 3IDCB 5C4WA 4EN6B 1VBB2 4L99A 2R043 3CF6E 3J4UH 4H55A 3VKLA 2RR12 1N47A 3AK0A 1AYN1 1V6IA 2ZGMA 1Z0HA 2F6BA 3AZXA 3GBWA 3MIBA 3WX5A 2V5YA 4DXZA 2Q30A 2PN5A 1EV11 4JGZA 3CU7A 4AQ2A 5C8WA 1XXNA 4XETA 5DZEA 3WG4A 2JXAA 3E5XA 4ONUA 1J3RA 4CYDA 3U0ZA 1DDLA 4YGEA 1ZM1A 4Y20B 4AHWA 4LBQB 4YSFA 1OOPB 3O0VA 2HWD2 5JSRA 2DU0A 2A3XA 2FMDA 2UWAA 3FC0A 1VBD2 1IPJA 1R083 5AVPA 3MIDA 5GLWA 3ZYIB 4DZGA 3ZFEC 4GH4A 2R16A 1ULDA 1MS5A 3KQRA 4HLTA 2X29A 1VBD1 4KBBA 1WW4A 5DUVA 1AVBA 2UURA 2D6OX 2PTMA 2R063 1DQ4A 1POV0 1YI9A 2WQZC 3FBMA 4KL1A 2D5FA 1G8WA 2D98A 2RS33 1Y3TA 1QMJA 1HXS3 3ACLA 4XTPA 4XILA 2WZR2 1D4M3 2XLAA 3ZFFB 1NCRA 3GNEA 2VW0A 3ZSEA 4JGYC 5FOBB 1S0CA 2E53A 5GLVA 1YXWA 4QQOA 4B8EA 5J09A 4Q27A 3VBOC 1CGPA 4GULA 5BNNB 1IOAA 3M7AA 4N43A 1XNDA 4Q0UA 2I45A 1LRHA 1SBDA 1YFYA 2OUJA 5GLTA 3ZXFA 1RJ8A 1H1AA 1NZCA 4WV8A 4QHBA 4CEYB 3VBFB 1I5ZA 1AYM1 4YG6A 1OA3A 2FZ1A 3WHUA 1GICA 2ZACA 3S30A 4HANA 2I74A 4M3CF 1TNFA 3ZN6B 3OBRA 5GKAC 3I54A 4I0WB 1AR83 2BUKA 1MS0A 2D3RA 5JOWA 3BODA 4XBQA 2PELA 2HEYF 3ZDSA 2W0XA 2YGMA 2DYCA 1ZRDA 2R042 1RIRA 2R073 3VBUA 1DGWX 4OI2A 1FYUA 5C8CA 2D3SA 1O4YA 4OI0A 1YHFA 3J9SA 3GZAA 5T5PA 1ALYA 1OQEA 4PF5A 2R041 4FPYA 1K5MA 4MX3A 4AFDA 2HWB3 3CJIC 2D7FA 4DPNA 4JQRA 4CP1A 1F5FA 4TYSA 3I59B 1ZRRA 1O5UA 3WNXA 4FOWA 2EIGA 1O3QA 2XBO1 2ZTNA 1LB2A 1IHMA 3BU7A 3GZUC 1U5ZA 2HEVF 4CTEA 3KS7A 1R082 3J8F1 1FV3A 3HD8B 3RS6A 3LSEA 2XJSA 5AFEA 5D8AA 4JDOA 4Q4Y3 2DURA 4Y5Z0 4I30A 1BEV1 1W6MB 4PIYA 2A73B 4PBOA 3MGUA 4R9AA 3WW2A 5EV7A 2R062 4B4PA 1XE8A 3M70A 4XDQA 3VBRC 2RS32 1G9CA 4U2AA 1AR61 3IBMA 1NLSA 1D4M2 4QMAA 5FDBA 5FO7B 3G6JB 5BNOC 5K0UB 4BIFA 1QDCA 2R061 1UZYA 1QU0A 2OYZA 4AGGA 4BOWA 1YUDA 2HKXA 4IETA 2UY9A 3KT7A 1JOJA 4P9LA 2ET7A 1CAVB 3DPRA 4LLOA 2WLPA 4MGKE 3NWKA 3ZSLA 3VBHC 2BWAA 3FWEA 1DBNA 1RUE1 2HWC3 2KXLA 4FPGA 3SCFA 1WMDA 3EXUA 1YJKA 1JW6A 2GNMA 4HK9A 3JCIA 2B7YA 3GBGA 1H8VA 3D8CA 2NM1A 4YW1A 2VXRA 2ZZJA 3G7DA 4NO4A 1S1AA 4AI8A 3ELNA 4OI4A 1UKGA 4AEDA 4UW4A 3T1LA 4DS0A 4IEXA 1RC6A 1ZRCA 1AR82 3W9AA 2B46X 2GU9A 1AHSA 4K40A 3JBG3 1Q8QA 1EYBA 5JPNB 4F8AA 1CONA 2WC2A 5B2GB 1M4WA 2R072 4BHPA 1WW6A 1HDKA 4OHZA 2D6PA 4XZPA 4FAGA 1FNZA 2ZGUA 2QFEA 2X53S 3ZXLA 2AREA 4OUSA 4O9GA 3BOWA 1QKQA 4YVWB 2R071 5JVVA 1GFF2 4KH9A 3ZXJA 4KG8A 3MLKA 3V0BA 1POV1 3M3QA 1KS5A 2ATFA 3S7IA 3WDYA 3VKFC 1YCIA 4AQTA 1YI7A 4IEWA 1G9DA 4Z92B 2YUEA 1AR93 4H14A 2H0BA 3AJZA 1ASJ3 4HMZA 3ZYPA 4E4SA 5JZGC 1U5IA 2GALA 1C5IA 1LEDA 4LA3A 5CADA 4GALA 1S2BA 4FPKA 4LT5A 3NSTA 3U07A 3B01A 4B7EA 1RVF3 1FI2A 4Y4YA 4ATFA 4DY3A 1VAMA 5I0RA 2LTNA 1X7NA 1ND2B 3IT8A 4META 2EAKA 4Q4Y2 3RMYA 1UIKA 4QPYA 1Q8PA 3UKTA 1NA1B 1LOBA 5KXEA 4YG3A 1MVQA 2P3KA 3TBDA 3H1YA 4ES8A 2YMZA 4MZUA 1Z7S3 3AKSA 3DN7A 3HT2A 4Q4Y1 3PLQA 1FX5A 3MEPA 1WLCA 1CAXA 2A70A 2WFPA 4FSJA 4AVCA 3ZN5A 4COVA 3DV8A 2VOKA 2Z79A 2WLQA 4JGYB 4A2UA 1ENQA 1BJQA 2ARBA 5ABJB 2TUNA 1LR5A 1VAVA 4QGLA 3Q9OA 1PNGA 4N53A 1OI6A 3VBOB 3L9JT 3FLPA 3VBSB 2PAMA 3MF9A 3ZX7A 3H0OA 4J1XA 3GHNA 4P14A 1PZ8A 3ZMNA 5C4WB 4QT6A 1LHWA 2HWC2 4N90A 4YVSC 4EWEA 2CAUA 4LBOA 5H9RA 4BPZA 5I0UA 1KD7A 3B00A 4P9XA 1DYPA 3RMXA 1V9U3 3C2UA 4QPIB 4AVBA 2EXHA 1FOD3 4JGZB 1QF3A 4B3NA 2P17A 2ZX4A 3H3ZA 4XHXA 1QXPA 2ZA9A 2DCJA 3AP6A 1RTVA 3WG3A 4AWDA 4BLIA 4R4XA 1UPIA 2W39A 5C9AC 3JBG2 4IEZA 5J36A 1ULGA 3ZFGA 2O1QA 4LBKA 4AI3A 4ZU4A 4IEQA 4RS5A 2UWCA 2CV6A 2HWE3 2Y0OA 4OZXA 1G7YA 3MW4A 2GC2A 4LE4A 4AHZA 4Q26A 5KBFA 1D0HA 2ZMKA 1H1MA 3JBG1 1R1A3 5DUXA 1SLAA 5CFDA 4DFSA 1OPOA 4CDQA 1PNFA 4YM1A 4RL7A 1XU1A 3CJIB 4GH4B 2G9FA 2CYFA 1PVC1 3T2TA 1V6JA 1Q5OA 4WM8A 4MXWB 1GKBA 1Q43A 3WT3A 3RJRA 2JECA 5EFUA 1MZEA 1AR92 4XFIA 1XRUA 1ASJ2 3FUQA 4EWAA 4XHBA 1DU3D 1REFA 3MFCA 1RUC3 4AK3A 1DZQA 2R30A 4FPEA 3TWIA 4C90A 4N9IA 1NE6A 3RNSA 1A3KA 2HWF1 3OYWA 3M3EA 5KC6A 1RVF2 1NCRB 1S0JA 1AR91 1FMD3 3KM5A 3MW3A 1J1TA 3THPA 3ATGA 4RR3A 3WDWA 3ZXDA 4Q29A 3U11A 1CD3G 2AH2A 2H0VA 4AF9A 5LK7B 2GNBA 4RD7A 3AYDA 1ZZBA 4WM7A 5AC93 2ZX0A 2NN8A 3VBRB 4K3UA 1YIPA 2K2SA 3SH4A 2JEMA 1H2KA 1ZZCA 5DDJ3 2K0GA 1Z7S2 2ZZQA 1WBFA 2D97A 1CJDA 4M0NA 4XFAA 3R6SA 5JDBA 1RITA 3VDDB 4EN8B 2FZ2A 1PIV3 1WD4A 3FFQA 2HYKA 1FATA 4MYEA 2DWRA 3N7MA 3WCSA 4AGVA 2Y26A 4BMEA 1RUNA 3W58A 2WT1A 1DGLA 2JD4A 2R49A 1LODA 5CA6A 1DQ0A 4Q0QA 3VGIA 5J98B 2DU1A 4XF9A 3A0KA 4RA0A 3OTFA 3VZLA 2DUOA 4KG0A 3LAGA 4KQ7A 1UU4A 2C5DA 4L9BA 3WUDA 2EVXA 3E5QA 3KCXA 1V6NA 4LO6B 1XNCA 3WINE 2XUMA 4AI0A 4YFWA 2ZKLA 4YFZA 4FO9A 3VBUB 2D3PA 1MQTA 1SQ4A 1MACA 1V9U2 3CEWA 4JAAA 4GMP0 2WNVA 3LB9A 4A7YA 1FOD2 5BNNC 1OPMA 1ZBE3 3UV9A 1HKDA 4JDNA 1K5MB 4LR4A 4KWLA 4IESA 2QDNA 3LA7A 4CEYC 3VBFC 3JUUA 3R4DB 5A33A 1V9U1 1YNAA 4D69A 3LA2A 3LKJA 1MS1A 3OBTA 3NKGA 4Y1XA 3JQXA 1D2SA 2HWE2 1LU2A 1YO8A 1AYN3 3MLLA 2UWBA 3OD4A 1M06G 1NE4A 2ZAAA 1ONAA 1QH6A 3FE5A 2EALA 4C1XA 3ZVXA 1R1A2 4BCUA 2W08A 3IPVB 3AKQA 5DUUA 5DUWA 3FBYA 4KU8A 2OA2A 4XBLA 1H9WA 1RGSA 5J3UA 2HWE1 2R6QA 5GZGA 3ZPYA 2XJPA 4QX5A 4URTA 5F6KA 2GDFA 1OKQA 2O8OA 3ILRA 5GLZA 2D44A 4XFFA 1OQ1A 1IZ3A 3UK9A 5I8TA 3L2HA 3USSA 1S0GA 3TAYA 3UJOA 3IN9A 4M3CE 1RUC2 3PVEA 3PHMA 4L97A 2P34A 1Q8VA 1CQ9A 3DUIA 5IK8A 1ZRFA 4I3PA 4XIOA 1W6QA 4NOTA 3TN93 1CR7A 4YZ4A 1ULFA 1UU6A 5JIUA 3BIWE 5H9QA 4GB31 2PAKA 5IK4A 3KD4A 3KMHA 1VBD3 3PVNA 4AXOA 5AC92 1J59A 1OMIA 3DPRB 1RUI3 4FP3A 1X8EA 1VB4A 4FQZA 5H9SA 5DDJ2 5I8SA 4AFMA 4IV1C 4EROA 5GJ6A 2BFUL 1GZ9A 1EY2A 2WQ4A 4OHWA 5L19A 3WG2A 5C33A 4TSVA 1PIV2 1IKPA 5DZFA 4YGBA 5FO9B 1MS8A 1XQNA 4PDWA 2AYHA 2WSUA 2FHRA 2Q1MA 4OLLA 1OQDA 4UW5A 3B7MA 4F7ZA 4KWJA 2WL1A 1BYHA 3QH7A 3AYAA 5K0UC 3WVJA 5KXBA 4S2FA 3L2YA 1OA4A 3ES4A 2F4PA 3NW4A 2X5IA 5IK5A 2DTWA 2YGLA 4CEWA 5I0TA 1AYM3 1AX2A 4DY5A 3AP7A 1H8TA 3SLIA 5CG8A 3H7JA 2ZHNA 1ND3A 2DUPA 4PLMA 1ZBE2 2NQYA 2WNEA 1ZZ8A 2XJRA 1H30A 4NWWA 1JXNA 1PO11 4QQPA 4F3JA 4Q0SA 5ACA1 2QDRA 3AP4A 4E27A 3QH6A 2GMPA 1ZBE1 4NR1A 5EJ3A 1SLIA 4QPGB 1AXZA 2HJIA 2PAEA 1AYN2 3WW4A 2GMEA 4KNCA 5SV5A 5BPXA 2BBVA 2Y0IA 2ZGOA 2Z5WA 3PJYA 4X6QB 3ILNA 4FTEA 1BCXA 3OGGA 2PLV1 2ILMA 3SITA 2A6VA 3S6PA 2YXSA 1GZWA 4FTBA 1UU5A 5LK5A 2VW2A 1YWKA 2RJLA 3THTA 2ZGKA 5E1RA 4I2OA 4HSJA 1RUJ1 5BV6A 2GC1A 2ZHMA 1NQJA 1I1EA 2PHDA 1UX6A 2XBO3 3ZXAC 4YVWC 1Q8OA 1GQHA 1SLBA 4K6BA 1Y7BA 3J8F3 1NCQA 4IEPA 2ZGTA 3IDEA 3TN92 1S0FA 1FT9A 2WFF3 1MZFA 1BEV3 2VU9A 4DQAA 4DNYA 5CIRA 4E2QA 2ZCWA 3SH3A 4COYA 1EAH1 4AQSA 1DZRA 1RUI2 2WINB 3O14A 2WNUA 2WWSA 3RYRA 3NAPA 3TN91 1AR63 4LLFA 1TNRA 4IEVA 1ND2C 5JOXA 4JVAA 4NPRA 4Q4X1 3AX4A 4XIKA 1GR3A 3SISA 1NA1C 4W6WA 1RUI1 1MR5A 3HBZA 4IEOA 1CAWA 2ZGQA 2IFRA 1LHNA 1YFUA 4XQWA 2OPKA 2PHLA 3AYEA 2C1FA 1WBLA 2D6LX 4XJ8A 4IV3A 2QKDA 3VZKA 1AUYA 1RUE3 5TSWA 3ZFGB 4P9JA 4RS5B 2I2SA 5ABJC 2V09A 4AG4A 3P3NA 2E51A 1ZREA 5IT6A 3ZMOA 3WQ7A 5CBLA 4XJWA 1AYM2 4RQPA 2PQQA 1CVNA 3TNPB 3VBSC 4FPCA 3J26N 2B9UA 4CDQB 4COUA 5C4WC 2Q4SA