2PHTA

Pterocarpus angolensis lectin (p l) in complex with man-7d3
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
240
structure length
240
Chain Sequence
EDSLSFGFPTFPSDQKNLIFQGDAQIKNNAVQLTKTDSNGNPVASTVGRILFSAQVHLWEKSSSRVANFQSQFSFSLKSPLSNGADGIAFFIAPPDTTIPSGSGGGLLGLFAPGTAQNTSANQVIAVEFDTFYAQDSNTWDPNYPHIGIDVNSIRSVKTVKWDRRDGQSLNVLVTFNPSTRNLDVVATYSDGTRYEVSYEVDVRSVLPEWVRVGFSAASGEQYQTHTLESWSFTSTLLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lectin
publication title How a plant lectin recognizes high mannose oligosaccharides
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 53
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2phtA00
4XBLA 1LU2A 1ULDA 1W0OA 3A0NA 1PZ9A 1LHOA 4FOWA 2D7FA 5JVVA 1ZA4A 2VY0A 2FHRA 1N1YA 2W39A 2ZHNA 1LHWA 1NXD1 3RSJA 1G7YA 1SLBA 1ZM1A 2DVBA 2UWAA 5H9RA 3ZSKA 4Y1VA 3FLRA 2YY1A 3SLIA 1LEMA 2LTNA 1G9DA 1YI7A 2ZGOA 1AZDA 3WHUA 5H9QA 3A0KA 4XIOA 3T2TA 2WSUA 3WDTA 3ZVXA 4P9WA 1GZCA 1QKQA 3KQRA 4DRVA 4JCKA 2BQPA 3AZXA 3AP6A 3NWKA 4NOTA 2DTWA 1PZ7A 3SISA 3ZXFA 1TEIA 1IS3A 1RIRA 4M3CA 4YGEA 4ATFA 2D3PA 1YXWA 3WUCA 1WW4A 4Y26A 5DZFA 1N3PA 1FAYA 1W6QB 1IKQA 2NZ9A 4I30A 3SITA 4JRAA 4M01A 3POSA 2C9AA 3VKMA 1CQ9A 4YW2A 1WW5A 1CIWA 2A3XA 1QMJA 2WKKA 3D4KA 3PMEA 5HCFA 4WVWA 2EXHA 3I4IA 4GWMA 1LGNA 3AK0A 5CB7A 5JOXA 1WW7A 2GNTA 3D5OA 5FREA 1LOAA 4UW3A 2UU8A 1BXHA 1W6PB 3WVJA 1CPNA 3A4UA 3CNAA 4XHBA 1SLAA 4XHXA 5GZEA 3NV1A 5DZGA 3USUA 2ARXA 3GNEA 4XYXA 2HYKA 1ONAA 1OQ1A 1LHVA 1RITA 1SLTA 1SLCA 2PHWA 1DLLA 1LESA 1GBGA 4LBQA 2JKBA 4FPCA 1V6KA 1R1ZA 3R05A 4ZXKA 3AP7A 2VH9A 1SLLA 5CAZA 2DUPA 1YIFA 2XB6C 4IQPA 3OPZA 3WDUA 1DIWA 2VW1A 1GYKA 1W0PA 1Y7BA 4Y24A 5T5PA 1Q8PA 1O4ZA 1GZWA 3PVNA 4Y20B 4H55A 1LEDA 1VAMA 2UWCA 4Y1ZA 4XZPA 3N36A 1V6JA 4XXAA 1G86A 1HLCA 1JW6A 4HANA 2NMOA 1D2SA 4Y1XA 4YZ4A 4M3CE 5T5OA 4FP2A 3WCSA 1S0DA 1MZ6A 3PVEA 2A75A 3Q9OA 3HN1A 4FOYA 4FPKA 3AP9A 4JC1A 2CTVA 4TZDA 2NYYA 1DQ2A 4M00A 2E51A 5E88A 2R0HA 5DG2A 1C1LA 5BYNA 3AJZA 2ZHMA 5CNAA 1UX6A 2ZHLA 3FBYA 4U2AA 5CA6A 4FPLA 4FPEA 1JYIA 3N7MA 2ZGMA 1FV3A 2GALA 5GM0A 1GNHA 1N1TA 1G9FA 2A5ZA 2GNBA 2D6LX 2DUOA 3FFZA 2WT1A 3ZXLA 1AJOA 4UW6A 3AXDA 1KJRA 2ZKNA 1BKZA 2GMEA 1DBNA 2V73A 3O0VA 5GJ6A 5DUWA 1KJLA 2ZACA 4FPGA 2VU9A 1Q8OA 2D6OX 2WLQA 4R9BA 1GKBA 3V0AB 4LBOA 2R49A 5E89A 5DUXA 2RHPA 1WBFA 1Z0HA 3M2MA 1GSLA 1B09A 1SLIA 3L2YA 3V0BB 2JD4A 2NM1A 4YZ1A 1XQNA 2A3YA 2DV9A 3B9CA 3O5SA 4FPJA 5LK5A 2VUAA 4K1YA 5L73A 1Q8SA 4YLZA 4PBPA 4DRRA 1W6MB 3VKFC 5GZFA 4BLJA 4ISQA 1UPSA 2DURA 2AGSA 1S0GA 5HCAA 1YO8A 1VIWB 1LGCA 1C1FA 1A3KA 2ZMNA 1N47A 1W6OB 1GICA 1LOBA 2JE7A 2YV8A 3IPVB 1DQ1A 4Q1RA 3WZ1A 2CYFA 1O4YA 5GLWA 2DVGA 5JDBA 3TAYA 1V6IA 1GANA 3N7KA 3V65A 1LULA 3VKNA 5IK8A 3OBTA 1AVBA 1AXYA 3ZXEA 1V6NA 1H9PA 1IS6A 2ES3A 3W59A 4XE9A 2CY6A 4AVSA 2ZGLA 3SH5A 2LALA 4AGGA 1WUVA 1MS4A 1KDMA 1WLCA 4TYSA 1IS5A 1N1SA 2D6KA 3DGTA 5FRAA 4YW1A 4YZ5A 1AXZA 4BPZA 4HL0A 1W6NB 3AXEA 2W68A 4LBMA 4Q1PA 4PQ9A 2ZGNA 3GALA 1FATA 1G9CA 2ZA9A 2P3IA 1S0CA 1CPMA 1LCLA 2WT2A 2GN3A 4WVVA 3AP4A 1N3QA 3JUUA 4XJUA 5JOZA 3U4XA 4ISRA 1QDCA 4GKXA 4XJ8A 1V00A 1LOGA 3VKLA 4M3CF 4UW4A 2ZGUA 3IN9A 2JDZA 2R1BA 1ULCA 1HQLA 4XBNA 2PELA 1V6OA 4FQ4A 2KM2A 1LECA 2W08A 2TEPA 2DWRA 3QCWA 3ZSLA 3FUQA 3OBRA 4UW5A 5T50A 4ITCA 2Z42A 3H0OA 2D6PA 3TB0A 4K21A 4BMEA 2CWSA 3WG2A 1DQ4A 2AENA 4FPYA 3OYWB 1N1VA 2R16A 1G9BA 1SCRA 2VXRA 2WQZC 3BIWE 2P2KA 5DZEA 1JN2P 3BTAA 4FP3A 3T1LA 2EIGA 3VUOA 1WW6A 4WZFA 1LHNA 2GDFA 2GMPA 1HDKA 3AFKA 4LBNA 2YROA 1A8DA 4KBBA 2UWBA 4AYUA 5IUQA 3ZXJA 3OY8B 2EXIA 4ASMB 1D0HA 2G4IA 3AYDA 3OGGA 2A71A 5T54A 5DG1A 1CONA 5T5LA 1DZQA 3WDYA 1LODA 2D44A 1UZYA 1JXNA 1DYKA 1DQ5A 4XJZA 5IT6A 3WLUA 2DYCA 2PHUA 3MW4A 5JOYA 5GLZA 1JHNA 4YW4A 1QOTA 3ILFA 1SCSA 1YYNA 3AYAA 4LBLA 3VKOA 3B3QE 4P14A 3D6EA 2R0FA 2AUYA 3BOPA 2E6VA 4L8QA 2ZMLA 1X50A 4U36A 4XBQA 5KXCA 1QOSA 3V0BA 1IOAA 1ENQA 1V6LA 2R1DA 2CWMA 2EXKA 1DGLA 1S0JA 2D3SA 2D6NA 5GZDA 1W6MA 4M3CB 4YG3A 2DVAA 1LENA 4Y22B 3RMYA 4Q26A 2P3KA 3POYA 1LOFC 2Q5TA 3WOGA 4XOGA 4LBKA 3WCRA 2ZGQA 3IPVA 1PZ8A 1ULFA 4YW5A 3SH3A 1YRZA 3SNMA 1OFSA 4FPOB 5JMCA 3M3EA 1S0EA 4PCRA 1MZ5A 1LGBA 3HR9A 2EALA 2ZGRA 4C1WA 4YG0A 2EXJA 2EAKA 1LOFA 1FNZA 1S0IA 4LBJA 2E7TA 2PHFA 3VV1A 3FUOA 1WBLA 3BODA 1UAIA 1ENRA 5T55A 3AZYA 4YZ2A 2A6WA 4YM0A 2JJ6A 1FNYA 1LOEA 1MS8A 1I1EA 3WDWA 3ZYRA 2EF6A 2JECA 2VW0A 2WJSA 1S0FA 5IK4A 2A6ZA 1DQ0A 4CZSA 2UURA 1Q56A 4BM8A 1LOCA 1MVQA 1HKDA 1MR5A 3WUDA 4DQAA 5DXDA 4LBQD 3ZSMA 1ENSA 3NV3A 5H9PA 1W6QA 2OUJA 2AR6A 5EWSA 1CJPA 1V6MA 4YGDA 3RQ0A 4PF5A 1LJ7A 2OUHA 3WG1A 3POWA 4XMAA 3N3HA 4AVTA 3ZPYA 5T52A 1MS3A 3ILRA 3NV2A 3PVOA 3B00A 4XDQA 4AGVA 2P34A 1FV2A 1DQ6A 3R4SA 1VALA 4Q27A 4XXPA 4XJAA 2NN8A 1W6PA 3DUIA 3OYWA 4YG6A 3WG4A 4YM3A 2D6MA 1S0BA 3MPPG 1F31A 2GMMA 2A7AA 2P37A 4GALA 4Y1UA 2E53A 4FPHA 3N35A 2OW4A 3N7LA 4AVVA 3IM0A 1FYUA 2YZ4A 4XJ9A 1BQPA 2ZMKA 4YFZA 4FPFA 4FVVA 1JBCA 1DHKB 3T1MA 1OKQA 2GNMA 3OY8A 1URXA 1AJKA 3FLTA 1KQRA 4ZKTB 2WNEA 3M3OA 2NMNA 5CBLA 5JOWA 1H9WA 4AWDA 5E8AA 3RG0A 4Y20A 3WG3A 5F5QA 4XTPA 3RRDA 5GZCA 4FOVA 2ARBA 2DU0A 2OVUA 1F9KA 2ZGSA 4Y1YA 3B69A 4YGCA 3ILNA 4Q8LA 3KM5A 3ZXKA 2AYHA 3AZZA 1VLNA 1SBDA 4CRQA 1KRIA 1AX2A 3UK9A 1MS5A 1GLHA 2I2SA 2ZHKA 4R9AA 3WDVA 1DFQA 1JYCA 3PJQA 3ENRA 4ATEA 3AP5A 4W65A 4RA0A 1C57A 2C5DA 4Y22A 5JLVA 4XMIA 1QOOA 1AXKA 2ENRA 1UMZA 1WD3A 1QU0A 1BZWA 1QNWA 1UN1A 3O12A 3AYCA 5EYYA 1AX1A 2CNAA 2SBAA 3MEPA 3M3QA 5EYXA 1C4RA 2VW2A 1EPWA 1I3HA 2DVFA 2ZABA 3LSDA 3WHTA 1CESA 4MYEA 3R4UA 3OJBA 4PBOA 4WV8A 3M3CA 1CR7A 4YZ3A 1IS4A 2YMZA 1SFYA 4YM2A 2PHXA 1WLDA 3APBA 1WLWA 2GN7A 4FOQA 1Q8VA 1WD4A 4GKYA 2A3WA 4BQ1A 3V0AA 5GLUA 1AX0A 1MS0A 4YGBA 3UJQA 1J1TA 4GA9A 4YFWA 3AJYA 2A6YA 2D43A 1FX5A 2DUQA 3MW3A 4Q8KA 3V64A 3AZVA 1QNYA 2DTYA 1MACA 2ZZJA 3LCPA 4C1XA 5DUUA 1KDKA 5H9SA 1LTEA 5GZGA 3M1HA 3IMNA 1A78A 2A6VA 3I8TA 3HMYA 1G9AA 1MS9A 3SH4A 2WSVA 1MVEA 1ULEA 1VAVA 2V5YA 1SBFA 1UZZA 2PHRA 3UJOA 2GNDA 3QLQA 4CTEA 1HQWA 1JOJA 1W6OA 2B7YA 1SACA 4XTMA 3W58A 1KITA 5SV8A 4XIKA 3WNXA 3ATGA 4GXLA 4K20A 4AGRA 4F83A 4BLIA 4DPNA 1CN1A 4XJWA 2W52A 2SLIA 4BMBA 4DFSA 4NO4A 1U0AA 1GV9A 1DYPA 4YW3A 4D69A 1N3OA 2ZGTA 5KXBA 1QGLA 2ZGKA 1BJQA 1F5FA 4SLIA 1JUIA 4DS0A 3B01A 4GWNA 1G8WA 4FQZA 2CL2A 2PHTA 5GLTA 5T5JA 1W6NA 2JE9A 5KXEA 1MS1A 2P3JA 3AZWA 3USUB 3ZYPA 3AYEA 4OZXA 2ZAAA 3UL2A 3ZSJA 2H0BA 4LBQB 1WCSA 3IKWA 4R9CA 3LSEA 4Z8BA 3O0WA 1H30A 3AX4A 1GZ9A 2E7QA 3INAA 3RMXA 1LU1A 2A70A 1GNZA 3RS6A 2A6XA 1SBEA 5EXOA 4YM1A 2AH2A 5IK5A 3WV6A 1ULGA 1UKGA 4P9YA 1GZWB 5F9TA 2DU1A 2ERFA 3MW2A 1IKPA 3NV4A 5GLVA 1S1AA 1APNA 2XG3A 5IK7A 2DVDA 1UL9A 5HCBA 2NP0A 3JU9A 4Q2FA 3ASIA 4XILA 2D3RA 1Q8QA 3FLPA 4R9DA 5DUVA 5GALA 4BOWA 2AREA 2WT0A 5KXDA 1Z78A 1AF9A 3N7JA 4K1ZA 1NLSA 3C2UA 3WDXA 4P9XA 1RINA 2YXSA 2ZGPA 2ZBJA 1CVNA 1LHUA 2FMDA 3O0XA 1QDOA 4RL7A 5AVAA 1QF3A 1BYHA
chains in the Genus database with same CATH superfamily
1RUH1 3VDAA 1ULDA 2XHNA 2JD9A 2PHLA 3A0NA 4Z82A 4D6SA 2VECA 2ZCWA 4LQRA 4IE5A 3BTXA 1LHOA 1NA1A 3OBZA 1ZA4A 2FHRA 1AR62 4EN0A 2W39A 2ZHNA 5L19A 1RMU1 2JG8A 2UY8A 2X5IC 4X6RB 4AEJA 1XSQA 1SLBA 2V4VA 3ZSKA 4BB3A 1W8UA 4XQWA 1DZTA 4Y5SA 2BPA2 2J1SA 2WFF3 4IV1A 1EUUA 3NAPC 4MADA 1YI7A 2JG9C 4HG6B 4QPYA 2XWJB 1RVF1 4LHKA 1WA4A 4NHMA 1UOJA 3ZVXA 3AVRA 4DRVA 4D7YA 5HPOA 2BQPA 3AZXA 3NWKA 3SISA 4NOTA 2VZ3A 4AQSA 4CDWC 1TEIA 4L11A 1NYWA 4CSWA 4A3ZA 1AL0G 4NRPA 3OTFA 4ATFA 5FMOS 1YXWA 2WZR3 2YDEA 2E7AA 1QJX2 4Q0VA 2WZ8A 3TOJA 1S4CA 1IKQA 3CLPA 5LEKA 4NHXA 3SITA 2B9VA 3VKMA 4FFHA 4PHZA 4CU9A 3POIA 1O4TA 4P9GA 2WKKA 4CEYA 4YVWB 4GWMA 3R0RA 1CAXB 2BOJA 5CB7A 4COWA 5JZGB 4JKLA 3KF3A 5FO7B 4C91A 5JXIA 4QGNA 2Y8KA 3KCXA 3N9MA 3MLLA 3A4UA 3WNKA 4AFBA 5LK7B 3HIFA 3S5AA 4A44A 3I3MA 4CCNA 2WUHA 4XHBA 1FMD1 3B7MA 1SLAA 4XHXA 2ZEZA 3MIHA 3JZVA 3OUIA 2I07B 2BUKA 4AL9A 5A6YA 4NHYA 4CUBA 2HYKA 1ONAA 3VHPA 4ET7A 1SLCA 3TEWA 5K0UB 1VR3A 5FZKA 1F5JA 1GBGA 1V6KA 3OEAA 1VRH3 2Y60A 2CDOA 4YYOA 5FYBA 2F4PA 1DGWA 2XB6C 1D4M3 1DIWA 2JG9B 4OLLA 1Y7BA 2BGOA 3DV8A 3NNJA 3SKVA 5C6CA 3NRUA 2IFRA 1O4ZA 5FZMA 1SDDB 1O91A 4Y20B 5BNQA 1VAMA 2HWE3 2UWCA 1RXGA 5JI9A 5KC5A 3O1VA 2OQ6A 1BHGA 2XLAA 5JIUA 3U10A 1C28A 4XXAA 1Q3EA 3LDKA 3W21A 3WCSA 4CDWB 1D2SA 2RMU2 2XBO2 2Z4FA 2F6BA 2ZOEB 4LKDA 4CCLA 5F5AA 4DXZA 3DF0A 3PVEA 2XJVA 4RQPA 4TWTA 4XAEA 3URFA 4NWWA 1DU3D 4AK3A 2ID4A 4E2SA 1H4HA 1OOPB 5FZOA 2JENA 3MHZA 2NYYA 4M00A 5A1AA 3LPFA 2R0HA 4P9LA 5DG2A 1C1LA 2ADEA 5BYNA 1UX6A 4LIUA 2YFUA 3ECQA 3UT0A 2RJLA 1CZTA 3RDIA 5FPLA 1W8FA 5FZ1A 1G9FA 2A5ZA 1XXNA 2DUOA 4NMIA 3GHMA 1ZBA2 3QACA 4ZXEA 5BNPC 3DXTA 1EV11 1SFPA 2W5FA 4QM8A 5EQUA 4CDXC 3O1RA 4UFHA 2QNKA 3SXWA 5KR7A 3SC7X 1HRI3 1QJX3 2V73A 4P08A 5FZAA 4E8DA 1A34A 3MBWA 5LATA 2ZACA 2VZPA 4FPGA 5DABA 2D6OX 4TSVA 4O9EA 1GKBA 3ZFFA 2R49A 5KWRA 4GMP1 4I02A 2BVVA 3M2MA 3SQOA 3TNPB 1B09A 3CO2A 1REEA 1XQNA 4DUWA 2A3YA 1NCRB 4UOJA 1JUHA 4BDVB 5A7WB 4QX0A 1ALYA 1ND3C 3EO6A 5L73A 3VBOA 4AOCA 4CP2A 1DDLA 1X82A 5FY0A 1OA2A 1XU1A 2WS91 2Q8EA 1UPSA 2DURA 2VAUA 4OMDA 1S0GA 1TMF2 1YO8A 3O7OA 5ERLA 1VIWB 2H6CA 1XE8A 4ORFA 1C1FA 2JE7A 1LOBA 3WZ1A 4AI2A 4Q1RA 2OZ6A 4CU6A 4JV4A 2DVGA 3VBSC 1GANA 3N7KA 2Q0AA 2AEYA 5IK8A 4C0HA 3Q8BA 1W9FA 4RS5A 1PGL1 3VBHC 3W59A 3E5QA 5LA9A 2ZGLA 1YFUA 3MUY1 3ROUA 2E63A 4TYSA 1J58A 3DGTA 4YW1A 1RUC1 2YBKA 3LA3A 1Z7S2 5FOJB 3O1SA 4CCOA 2RMU3 4PQ9A 4D7TA 3LIHA 5JR2A 4CCEA 3J26N 4LO5B 1AR73 4LMFA 1H2MA 2VMEA 1H8VA 1VBB1 3KCYA 4Z2AA 2B45X 4G4FA 1N3QA 3K77A 4XJUA 2X05A 3U4XA 2NQYA 3TNQA 1B35A 3GGLA 4M3CF 2OXBA 2BYVE 2ZEYA 1HQLA 2PELA 1P8JA 1HRV1 4MOAA 1HIXA 1FI2A 3KZ4C 2KM2A 4WM8A 1H1MA 2KD7A 2MNGA 3E6DA 2TEPA 3K4ZA 2DWRA 4FT8A 3QCWA 1QXJA 5EV7A 1UU4A 4CCMA 2VTFA 4AI1A 3FUQA 4JRLA 2WNVA 3AM2A 2W87A 1SDWA 2ZX2A 2F4LA 1PO23 4RR3B 1COV2 5JPMB 2CWSA 3WG2A 4HK9A 1L7LA 1N1VA 2VXRA 2J1EA 2WQZC 3POEA 5FLIA 2P2KA 4J1WA 5C3SA 1IHMA 4DXSA 5FZ6A 3LEIA 1ND2C 5FUIA 3VBRC 3VUOA 3T1LA 3TEYA 5CU1A 5LRSA 1QJZA 4K40A 3HQUA 4DOUA 4WZFA 4XURA 2VBBA 4A3XA 1V0AA 2GMPA 4LBNA 3OCPA 3LEGA 4KBBA 3CDZB 4RGGA 3JD72 5IVEA 3H1WA 1JU4A 3PUAA 3WSOA 4QB2A 1D0HA 2DCYA 5G04L 4PDWC 5T5LA 1PVXA 1UIJA 3C3VA 1UXXX 3WDYA 4HVQA 4EN6B 4QXHA 1JXNA 1O3TA 5FQ0B 4MGQA 2WZEA 4TLFA 2ET1A 2WFF1 2DYCA 5GLZA 3N9PA 1STMA 3ZFGC 3W5MA 5FZ8A 4P14A 3D6EA 3MIDA 4CDUB 2AUYA 2E6VA 5FOBB 1X50A 5ACA2 1UQXA 1XNTA 3R4DB 1DGWX 1ENQA 2JDYA 1J3QA 2VC9A 3I2KA 2QJVA 3JQWA 3MLJA 3UNPA 1OF4A 2D3SA 2D6NA 5GZDA 3VL8A 5I8YA 1W6MA 3T2QA 3FHQA 1VB2A 2V5DA 3CHXA 4YG3A 4EE2A 4NRQA 5C4WC 3MGUA 4Y22B 3IAPA 4QQPA 3THCA 4WM7B 2WZR1 4Q26A 5FYCA 3VGIA 2Q5TA 3H9AA 1NE6A 1KS5A 5CG9A 5JUVA 1RUE2 4UAPA 2VULA 3DCQA 4BISA 2IVIB 3M3EA 2WO1A 5BXXA 4LOSA 4LT5A 2XDVA 1RHI2 4H7LA 4XCBA 3WP5A 3OPWA 3B94A 1GWLA 4P00B 4OHVA 1PM4A 2GC0A 2BBVA 1FNZA 3POGA 4BXSV 2GC1A 1S0IA 2WR9A 4E2GA 3KVAA 1TNFA 5L9RA 3VV1A 3P3PA 3VBFA 5JWPA 1M06G 4YZ2A 1MPXA 4AQTA 1LOEA 3ZYRA 4ASKA 5CVRA 2WJSA 4XF9A 5AFEA 2BGPA 2QTWB 1W99A 4UYBA 4CZSA 4HK8A 4KU7A 1COV3 4NN0A 1MVQA 3HN3A 3MIGA 1VRH1 3ACGA 4QPIC 1UNBA 3TWIA 4BE3A 3D0JA 4IEVA 5APAA 1ZRCA 5FJKA 1ENSA 5H9PA 1XNDA 5I91A 3VDDC 1D4M1 5EWSA 1CJPA 1V6MA 1W9WA 4YGDA 3S5QA 1MQTA 1LJ7A 3WG1A 1ZZ6A 2BDRA 2VUDA 3O1OA 5JIAA 3ZPYA 2HWE1 2WL1A 1MS3A 1QEXA 3OGJA 3B00A 3GBGA 2VZ1A 1E57A 4YVSA 2CSGA 4V2VA 4KMQA 4Q27A 4LJHA 3H3LA 4XXPA 5F3GA 3HT1A 3S7IA 3WG4A 3LAGA 1RUI3 2YU1A 4XZUG 1D0GA 1TME3 4Q0PA 4RQPB 5BNNC 4GALA 4NUBA 3N35A 4RD7A 2DCKA 4KNCA 3N7LA 5J3UA 1RUH2 1WGPA 2VQAA 4Y5Z0 1FYUA 2YZ4A 4QPGC 1CWPA 4XW3A 3P3NA 5J7MA 2IWGB 4HVOA 4P02B 4OI2A 5LBBA 5ACA3 1JZ4A 2WNUC 3FLTA 2TNFA 3UESA 4P9JA 4ZU7A 2NMNA 4L0PA 3NJXA 2OKXA 4ZS3A 4B4QA 4LK6A 3CKHA 4XTPA 1RVF2 3LGRA 5GZCA 1HRI1 1QJX1 2VMDA 4MX3A 1D4VB 3U11A 5AVPA 4Z92B 2ZGSA 1E5IA 1OC1A 3HAGA 1W90A 4AG4A 3DYMA 3ZFFB 2DBNA 3JB4C 5F8PA 2BP6A 1D7PM 2YGMA 3IAQA 3KM5A 3WF1A 2AYHA 5A1LA 4CUAA 1GWKA 4XFBA 3PTYA 3VHRA 1KRIA 2R7EB 5FV3A 3UK9A 1MS5A 2I2SA 3KV9A 5CFCC 1F8VA 1W2TA 1Y43B 3PJQA 4HZFA 4KL1A 2OPKA 2WC2A 2YGLA 4XF3A 2XL7A 4RA0A 4QKNA 1C57A 2VPVA 3SEPA 5JLVA 4M4RA 1JZ6A 1QU0A 5CISA 2VTXA 3AYCA 5EYYA 3VD5A 2CNAA 5IVCA 4N9HA 3MEPA 2PMWB 1C5HA 1HB1A 2IFWA 3NQHA 1XNKA 5D8AB 4COYA 4D6RA 3M70A 3KVBA 4DMIA 2DVFA 3LSDA 5C3QA 5CZKA 4WV8A 2P4EA 3G7DA 1HB2A 4RFRB 4FFIA 3M3CA 5EZWA 4JGYA 5LRRA 5BNNB 2FDFA 3ES4A 4IW3A 4MV2A 5JXGA 4TTGA 1W2AX 2PHXA 4PIZA 3BKZA 1OURA 3ZN4A 5ANNA 2FBEA 1AUYA 4RS5B 1SPPB 4PT6A 3CJXA 1PMHX 4IDZA 3SKJE 4GKYA 3NW4A 1DLCA 2XVKA 4BK5A 3LA7A 4V2WA 2FCUA 4Q4V2 3ES1A 5BNOC 3O1PA 1J1TA 3AL6A 5LBFA 2WWUA 3WINE 4NVPA 4YFWA 3WNOA 3ZN6A 4MG2A 4JQTA 4GH4A 4DXRA 4H7MA 3O1UA 1MACA 2RMU1 2X10A 3LCPA 1F2NA 4C1XA 1AR71 1VJ2A 5E16A 5H9SA 1OD3A 1A78A 2RJKA 1W2NA 5I0TA 1G9AA 1MS9A 4UT5A 1B35B 4QD2A 4CTEA 4IEQA 2B7YA 1SACA 4RGAA 3ZYFA 1KITA 1OLQA 3RJ2X 3WNXA 4GXLA 4AI9A 4BIFA 1CN1A 3BGAA 4EYUA 1BCXA 2W52A 5A7OA 4BMBA 4MLOA 1W06A 2WAOA 4NO4A 1XNBA 3RJRA 1N3OA 1H1AA 2XUMA 1NCQB 1PO21 2JE8A 2QCSB 2Q30A 5C7GA 4GAZA 1F5FA 5L7OA 1SG3A 4DXTA 3GCXA 2G9FA 2JDKA 4HT1T 5GLTA 4S2GA 2XJQA 2CL2A 2PHTA 4K6BA 4I3PA 2OYZA 1W04A 1W39A 2JE9A 2P3JA 3LEMA 4MHUA 5E6HA 3RGBA 5KXEA 2PAEA 5C5TA 5EJZB 1SMVA 3Q8AA 3WNMA 4CDQC 3ZSJA 3UL2A 2AEZA 4A4AA 4J25A 1UIKA 1EV12 3LSEA 2FCTA 4JGZA 2BGCA 2XVGA 4K9SA 5EFUA 1F4AA 2E7QA 2PN5A 3INAA 5FCCA 1QH6A 2A70A 3F95A 2KR2A 1US2A 2I45A 4P9IA 2A6XA 1SBEA 2MEV3 3CJIA 4LHLA 4HSLA 5EXOA 2AH2A 4HONA 5HBAA 5IK5A 5LY1A 1ULGA 4P9YA 3NNMA 1GZWB 4IXLA 3VZMA 5JPNB 2DU1A 3NV4A 3IWZA 4NHLA 3KT1A 3FE5A 3IDEA 5IK7A 2VUJA 3O1TA 4E9KA 3JU9A 2OQ7A 1VP6A 2W47A 3FLPA 4BOWA 1K5MC 1VE0A 2WT0A 3LFIA 2OA2A 3N7JA 3G6JB 3MFCA 3C2UA 2AZ5A 3WDXA 2XKOA 2YXSA 5B2GB 5FZBA 3GDBA 1JZ3A 4BU2A 5FMOL 2XHKA 3U14A 4Q4V3 2EA7A 3HNMA 4TLGA 4MGIE 4HBNA 3P6BA 1QQP3 4FOWA 2W3JA 3UETA 5CEHA 1C8M3 3RSJA 2CGOA 4O61A 1PGL2 2DVBA 2VNOA 2XJSA 1C3HA 5H9RA 3RZKA 1WMEA 2XMLA 4PLNA 3SLIA 1OLMA 1G9DA 1AZDA 3WHUA 2JB4A 1R093 1F4HA 1HW5A 4MVTA 1POQA 2X5IA 2WSUA 5FMBA 3WDTA 3ZKUA 4P9WA 5C9AC 1QKQA 2HEVF 3KQRA 5FLJA 4JCKA 3MUZ1 3POJA 3ZXFA 3AP6A 2DTWA 1PZ7A 1UY0A 1YQCA 3MV11 4XF1A 2ZKLA 4S2DA 1COV1 4YGEA 1NZIA 3I54A 4LUKA 2QQWA 3K3NA 1HRV2 3WUCA 3L2HA 5DZFA 2XQXA 1R083 2VVDA 4N43C 4JTNA 1X9TA 5FBJA 2E26A 2YHJA 4JRAA 4M01A 3MICA 3PU8A 5ABJC 5FY5A 5IVYA 1ZVFA 4AFAA 4CCJA 2VG9A 4NJ4A 3V56A 1OF3A 2EXHA 1W2UA 3I4IA 3VBUA 3D5OA 5C71A 4YVSB 5FREA 3VD9A 1CJDA 5FZ7A 1RUI1 2OIIA 5FWJA 4YPJA 4DZGA 5IVFA 1JU3A 1TME1 4D8MA 1YLLA 1W9TA 2LS6A 3USUA 3NV1A 1O3RA 2E9QA 4XYXA 4Y5TA 2VQ0A 1HN1A 2JDNA 5FY8A 1RITA 5F1RA 1LHVA 1SLTA 4BQYA 3PMSA 4HKWA 5A70A 1DLLA 1LESA 4LULA 3LWCA 3ZIXA 5LY2A 3MV01 4ZXKA 4KWKA 3AP7A 4COVA 3SMHA 1SLLA 3QOPA 4NWVA 4QPWA 3LZZA 5FBZA 5ACA1 3AKRA 3BU0A 4PI2A 2B9UA 3TN93 4IQPA 1HJGA 3OPZA 4GJYA 5LB6A 1C5IA 1E5HA 1GYKA 2VW1A 2ARAA 3N9OA 2J7MA 3QBQA 2WFF2 5A33A 1Q8PA 1W0NA 3OD0A 3PVNA 4JDMA 4Q4Y3 3HD8B 4Y1ZA 1EPZA 2CAUA 3RZJA 5HI0A 3OGRA 1V6JA 3KHCA 1G86A 1JW6A 4Y1XA 2XPJA 4N53C 4OHYA 4FP2A 3E6CC 2XLFA 4FXKB 1S0DA 3FN9A 4NROA 1MZ6A 4MZUA 3VZNA 2A75A 3Q9OA 4LE4A 3GM8A 4FOYA 4I09A 4AFCA 4JC1A 3JCIA 1AYM2 4NHKA 4JQRA 2ZTNA 3T0BA 1DYOA 3PUIA 5C3PA 4QAWA 5FJHA 1DQ2A 2BFUS 3HNBM 5JOYA 3J9SA 3H7YA 2CU5A 1DGRA 2ZHMA 5CNAA 2ZHLA 3WP3A 2JIJA 4U2AA 5A7PA 4FPLA 4FPEA 5CA6A 4YNIA 1I9RA 1V9U2 2PXJA 3MF6A 5GM0A 1GNHA 3WNLA 2GNBA 4LNVA 4UFMA 1CAUA 2GP3A 2VMHA 4JDOA 3ZXLA 5CKMA 5FPUA 4LIVA 1KJRA 4LO4B 3DPRB 1BKZA 2GMEA 3WQ1A 3ZM8A 5GJ6A 5DUWA 4ZZ5A 1KJLA 5EIYB 1I6XA 1UOFA 2WLQA 4H2AA 4R9BA 5F6KA 1LKNA 3USSA 1GMMA 4PI0A 5BNPA 1L7RA 2XJTA 3BVCA 3S6PA 4PJYA 3K4DA 1WBFA 3GBFA 4ASLA 3A7QA 1VRH2 3ZR6A 4CDXA 2X09A 3L2YA 4GH4B 5FZLA 2G9GA 3FBMA 3ME2A 4NE9A 3ZKYA 3D82A 3MIEA 3B9CA 4YVWC 4FPJA 5LK5A 3ETPA 4Q0UA 2VUAA 1XU2A 2QQVA 1D4M2 3KMHA 4S2HA 5JZGC 1HX6A 1HJFA 2FCVA 2VCMA 4PBPA 4DRRA 2X8KA 3VKFC 5GZFA 4BLJA 5A3LA 1KEXA 1NUKA 1DF0A 2DCZA 2AGSA 3HOBA 4Z2WA 4E4DX 2HWE2 5HCAA 4ZY9A 1FXZA 5FYTA 4XC9A 1JZ2A 4ARXA 4E4HA 2HWB3 2YV8A 4R52A 3IPVB 4RFT0 5T3NA 1O4YA 1QXPA 1YNAA 5K0UC 1V6IA 3I59A 4CA9A 3DECA 3OBTA 1QJEA 1KFUL 1C8NA 3DEMA 2RDSA 4AEKA 5L9BA 2OZJA 1UKRA 2CY6A 5L7OB 3BUCA 2VJXA 1KDMA 3C8XA 3CF6E 4UFLA 3IDBB 4CP9B 1IS5A 1N1SA 1PIV3 4YZ5A 4XCAA 3VBSA 1AXZA 4BPZA 3K3OA 4LBMA 3T0AA 2ORZA 2VVEA 1PO13 2H6BA 3RI9A 4BWOA 3GALA 3ZR5A 2VMCA 3NNLA 4QGLA 2VCAA 3VB9A 5CFDB 4EZHA 2WT2A 1O6UA 1AYM3 2W91A 4CP0A 1RUF3 3KSCA 1QDCA 4GKXA 4ISRA 1U5ZA 1FT9A 1NG0A 4BQ2A 4UW4A 1HRI2 5FP8A 1OOPC 1QY4A 3MLKA 1ULOA 3ZXGA 1V6OA 4FQ4A 4A2UA 1X8EA 2MEV1 1OPMA 5KHKA 3MF9A 5FZFA 4IETA 2WFPA 1NZCA 1V9U3 1OH3A 4QMAA 1UXZA 3RYPA 3E6BA 4ITCA 2D6PA 1UCXA 2HWC2 2JB8A 3TB0A 2EIEA 2AENA 4ZU4A 5IYYA 2DF7A 3ACIA 1RXFA 4GB33 3FX3A 4E8CA 4BK4A 1HQNA 4FP3A 3AB0A 1XNCA 1RGSA 4WVMA 3H1YA 1RUJ3 3TBDA 3NKGA 1TNRA 1JTZX 4Q4V1 1HDKA 4IL7A 3GF6A 3N9QA 3AKPA 4AHWA 2FDIA 4AZZA 3RZZA 2UWBA 2R042 4BQ4A 1QQP1 4BQ3A 5IWFA 1QH7A 4OVEA 2J42A 1NLQA 4QXKA 5DN2A 3VZOA 1MEC2 1ND2A 3OY8B 4P5HA 3VBRA 4ASMB 1W8NA 4OHZA 4W8JA 5FMCA 1C8M1 2A71A 5DG1A 1CONA 2WYSA 4N7UA 5T54A 5IFPA 2WABA 1NCRC 1UU5A 2D44A 3IDAA 1RUD3 4HPKA 5A32A 1DYKA 2IVJA 4NAMA 3HBZA 1O8SA 2R30A 4PIYA 4I0BA 4XUOA 4BQXA 3WW1A 4LBLA 3P5BA 4MH0E 2HJIA 1R091 2R0FA 1ZZ8A 4U36A 2Z79A 3PIJA 2C24A 3V0BA 1AR72 1IOAA 5FY1A 4XACA 1EY2A 2C1FA 2R062 2EXKA 1DGLA 3LEKA 2W0XA 4D6QA 2XJPA 2IXHA 3ZFGA 1KGYA 2VBPA 4OUMA 4Q4X2 5FZDA 2Z69A 3RMYA 1UYXA 2P3KA 1LOFC 1VBE3 2GSYA 1R081 1GP4A 3THPA 2GC3A 3T2PA 3S57A 2BJSA 2NLRA 3SNMA 1LAJA 1OFSA 2VZOA 4FPOB 1W8TA 1H8TB 5JMCA 4OQ8A 2W1WA 4PCRA 1LGBA 5FP7A 2E31A 1PO22 2EALA 1WWYA 1QIQA 5C4WA 1EYBA 2Z2SB 4JVAA 4C1WA 4YG0A 1OHFA 2EXJA 1JZ5A 4OI0A 1PK6C 1VPHA 1ZYBA 4LBJA 4ES8A 2E7TA 2W92A 4R8HA 3ZPOA 3BODA 4YWAA 2FDKA 2YC2A 1RUG3 4QGMA 1K3IA 2ZX0A 3WDWA 5KHHA 5LZ6A 2JECA 2E32A 1GQGA 1POV3 3AL5A 4HLTA 4HMZA 4K8FA 2O1QA 4LKFA 4IV3C 1DQ0A 2YC4A 3HEIA 2HWC3 1XNAA 2UURA 4AEDA 4QDQA 3HBKA 4D0QA 1YCIA 3A22A 3ZFEA 2ARCA 4DQAA 4RR3C 2Y33A 1AHSA 1ENXA 3TN91 1Y9MA 3PIGA 5KBFA 1PHMA 4LO7A 4IUGA 4HXCA 1ASJ3 4PF5A 4LA3A 5A33B 2RDQA 2OUHA 3VLBB 1KXGA 3POWA 1TVGA 3OB8A 4Q4Y1 5T52A 3P1IA 3ILRA 3PVOA 3HPNA 3NV2A 4XDQA 2R043 4QPIA 2GP5A 2G19A 3S30A 1H2LA 1W28A 4XDPA 4XJAA 5FYUA 1CX4A 1MEC3 3PNAA 3OYWA 4AI0A 1IG0A 1CAWB 3VDDA 2XJRA 5C8WA 4QU1A 4Y1UA 3T4HB 4IGPA 5K7PA 4M4PA 4LXLA 3I49A 1ZZBA 4XJ9A 3RZHA 4ONUA 4IE6A 3I2HA 5A3OA 4CCCA 4YFZA 5AFBA 5B4NA 3IIIA 3PUHA 4FPFA 1WCKA 1HN0A 2QQUA 1JBCA 1RUOA 5A3TA 5LBEA 4CDUC 3THDA 1PK6B 2R063 4DEQA 1YFWA 5EPAA 2WNEA 1CAUB 4LORA 3H3UA 3J7MA 3FMGA 5CBLA 5JOWA 3WNPA 1H9WA 3K75B 2BERA 4QPGA 4LO6B 4Q4X3 5E8AA 3RG0A 3RWKX 4OUSA 4XEZA 1M4WA 2ZEXA 4FOVA 3I7DA 4FXGB 2OVUA 1F9KA 4IV3B 4J6GA 4WM7C 1AL22 3WY6A 2K2SA 4Y1YA 5CYYA 3B69A 4K7JA 2WA4A 3DN7A 4Q0SA 4Q8LA 4YGCA 3RNSA 1UD1A 3ZXKA 4C90A 3PURA 2LW8A 3BTZA 1LB2A 4QX3A 2VNVA 4M0NA 2WDBA 4R9AA 1JYCA 2VZRA 3MFAA 4ATEA 5I0RA 1H6YA 3QH7A 2C5DA 5LBCA 5FXXA 3GJBA 1WD3A 5FPZA 4LPLA 4NPMA 1GQPA 2JDMA 4HFSA 5LWBA 5I8TA 3VL9A 1UYYA 2ZABA 3B02A 5CFCA 3T4VA 4R4XA 3GYDA 4MYEA 2HWB1 4PBOA 1NA1B 3RYRA 5KC6A 1W9YA 4YZ3A 1RUI2 1IS4A 2JG8B 1SFYA 3I59B 1NOVA 2DCTA 3AMNA 3K46A 1TME2 4YM2A 5HV0A 3ZIWA 3WF3A 3KT4A 5F37A 4PQQA 5FP4A 1Q8VA 1WD4A 2EIDA 4NPLA 3V0AA 4IV1B 3VDCA 2D97A 4BQWA 1MS0A 2A73B 5DAXA 3OSDA 4GA9A 4GMP0 3IDCB 3K4AA 1DZRA 1CAVA 5DAVA 1PIV1 4EWAA 4KGQA 1FX5A 4LLFA 4Q8KA 3AKQA 1QNYA 2QQOA 2D40A 2DTYA 4H3WA 1PO11 1JS9A 1ZZ7A 2B8MA 2XGXA 4KGGA 4LE3A 5DUUA 4DEVA 3MYXA 4OI4A 4Q29A 3J7NA 3VZLA 1YQ6A 3ZDVA 2A6VA 3HMYA 2ET7A 2QZ2A 4FAGA 1AYM1 2PLV2 2J1UA 1VAVA 1RUF1 2ZAHA 4RQPC 1UZZA 1XSRA 2PHRA 2GNDA 2BVBA 3PUSA 4LITA 5FUNA 2P3YA 4BYYA 5JCTA 1W6OA 3W58A 4I2OA 4XUNA 4AGRA 5F3EA 4F83A 2UYBA 5FXVA 5SV5A 5L36A 1O7FA 2VZUA 4LHSA 1V9U1 4IEXA 4CEYB 3ZYHA 4DFSA 3FZ3A 1U0AA 1GV9A 1DYPA 3FFQA 3LE0A 4YW3A 3IMMA 4C0BA 5KXBA 4LKSA 3OUJA 4GWNA 1G8WA 2J1RA 4FQZA 2VCBA 4GB31 1W6NA 3AZWA 1AL23 4N8MA 5F32A 1OFNA 4OZXA 1RUJ1 1Y3TA 3U75A 2FD8A 5CADA 4R4ZA 1VAKA 2H0BA 4LO8A 4CEWA 2Y6KA 1BVP1 1WCSA 2IXLA 4R9CA 3ZFFC 4B4PA 3BB6A 4Z8BA 1H30A 3AX4A 3MDPA 3WT3A 4RGKA 2Y0IA 3KV5A 1CX1A 5J36A 4CDQA 4O65A 1UKGA 3B93A 3EYPA 5F9TA 1RUD1 5KHGA 3KV6A 5FWEA 5HXVA 5F39A 5FXZA 3J7HA 1APNA 4EROA 2C9KA 4COZA 1PGW1 4KI5M 1NT0A 5EJ3A 5HCBA 2QVSB 5D8AC 5FZIA 3HVDA 4XUPA 4IEWA 5DUVA 4X8PA 3ZO0B 4R9DA 4CVUA 2AREA 5KXDA 1AF9A 2VBDA 2BTVC 1RL3A 5FZOB 2Q8DA 2VNRA 1OUSA 3O0XA 4RS5C 5FZ3A 3I2JA 4MGYE 1CD3G 1QF3A 1GOHA 1BYHA 1PNFA 4XBLA 4J1XA 3M3IA 3WQ0A 2RVAA 1VBE1 2L9LA 4JZRA 1K5MA 5CIRA 4ZHNA 5JVVA 2VY0A 1VBD2 5JXHA 5C8CA 1NXD1 3B5LB 2KA3A 3C7GA 1ZM1A 2VZVA 4RYDA 1DP0A 1XE7A 3RI8A 3U4SA 4Y1VA 3FLRA 3WX5A 5AC92 2PLV3 2LTNA 1TQ5A 1D2QA 1F15A 5DAQA 2HLEA 1IQDC 1US3A 2ZGOA 3WW2A 4F7ZA 4A7ZA 5KHIA 2JIGA 1B35C 1XBFA 4XIOA 1RUG1 3RWNA 1U5XA 5JSRA 1R1A3 2P5BA 1POV1 4WM8C 4EJRA 2UYAA 2HWC1 4M3CA 4AEDB 1SHWB 2BRTA 2WNVC 5IJRA 3W9AA 1JOBA 2RDNA 3OUHA 3VBOB 1WW4A 2MEV2 4LK7A 3ZFEB 1JODA 1N3PA 1NCQC 1XRUA 2K9ZA 4CP1A 4B7EA 2NZ9A 4INDA 5A6QA 1OLRA 3ST7A 1PMJX 4I30A 5JSOA 1ASJ1 2H0VA 2RR13 3LPGA 1FOD3 3M8LA 2RS12 3POSA 2ZPXA 1WW5A 1CIWA 1QMJA 1BK1A 1OA3A 3PMEA 5HCFA 4WVWA 5JOXA 3OF1A 1LGNA 1O3SA 4DY5A 2BWAA 2GNTA 2R041 3I2OA 1LOAA 4HOOA 2UU8A 2YYOA 4OHWA 1MEC1 2EICA 4O9GA 1JYTA 4QX7A 4DINB 1U5IA 3WEZA 1J83A 4L97A 5ABJA 4K3UA 2WN3A 5GZEA 2OS2A 3RZLA 2VOKA 1K45A 2BFUL 2RJ2A 3J8F3 3TEXA 1OQ1A 1ZBE2 4ZPIA 2K46A 2PHWA 3BU7A 1QQP2 2X29A 3KF5A 4LBQA 4NIDA 3S0MA 3ZMOA 2VH9A 4Y3OA 4FI9A 1C8M2 1OLME 1PVC3 5CAZA 2DUPA 1RB8G 1YIFA 5A7SA 4QM9A 4MXWA 2WZPP 3WDUA 5DAWA 5FZ9A 4QU2A 2R061 3W20A 3GZUC 1W0PA 5T5PA 3BCWA 1QJU2 2WWSA 4HN0A 4COUA 5M0TA 1REDA 1LEDA 4Q4X1 1R64A 4GULA 3GCWA 2O8OA 1R092 4FFGA 1HXS3 1RJ7A 4PLMA 3N36A 2R6QA 3DKWA 3I97A 4WM8B 5FK8A 5LASA 5TSWA 2NMOA 5T5OA 1VBD3 2WBKA 2LROA 4QX5A 4NIIA 2IC1A 2WNVB 4AVAA 2VVFA 4YRDA 1RJ8A 2XOMA 1W03A 1YFYA 2HBTA 5AC93 4TZDA 2QE3A 5E88A 2E51A 2DFCA 2RS32 2VL4A 4MHRA 1KD7A 3E1F1 5F3CA 1R082 4W6WA 2QDRA 4XUTA 2F17A 3FBYA 4KQ7A 3VD4A 3CL1A 1IQAA 1JYIA 3N7MA 2ZGMA 4GIQA 1FV3A 4IE0A 1W05A 1S2KA 2GALA 3KLSA 1UW8A 3POBA 1UZWA 1JYXA 5ANQA 4AF9A 3FFZA 2D6LX 2K0GA 3I2GA 1AYN2 1HB4A 3LFMA 5K4LA 3LDBA 2ZKNA 2BBAA 5A3PA 2HYXA 3O0VA 1WCUA 3LDRA 2IZWA 2ILMA 4MGTA 2VU9A 3V0AB 2JX9A 2X53S 2RS13 4LBOA 1ODNA 4OCTA 5E89A 2YC0A 2RHPA 4XFCA 1CAVB 1MQTC 1GSLA 2ZJCA 3ZOIA 1QWRA 4AI3A 2NM1A 4YZ1A 1VBC3 2VNGA 3A23A 1RC6A 3MIFA 3TN92 4IGQA 4OULA 4YVSC 4K1YA 1Q8SA 4B1LA 1NY71 1W6MB 5FIXA 2D5FA 5FYHA 3SHRA 4LA2A 2BNOA 4Q4Y2 4DIQA 3ZXAC 3THTA 1ZBE3 1TE1B 1JH5A 1A3KA 1W6OB 3I3BA 4YVWA 3U78A 1DQ1A 1TG7A 2Q4SA 3MZHA 1O3QA 1CAXA 5JDBA 3TAYA 2AC1A 3EMRA 5JZGA 3V65A 1Q5OA 3NJZA 4YW6A 3E5XA 1AXYA 1V6NA 2DDUA 4NAOA 1DG6A 4XVHA 1IS6A 2W9XA 2Y26A 4W50A 4XE9A 1QJU3 1YQ5A 1REFA 4AVSA 2LALA 3RFRA 1WUVA 1MS4A 1QJY3 2B39A 2JKXA 4MO3M 4AW7A 5BUVA 3VBFB 5FRAA 5C5UA 1AR93 1VB4A 1W6NB 1YJLA 2W68A 3EHKA 3CU7A 1LR5A 3WP6A 1AL21 2QDNA 3L9JT 3WQ7A 2BEOA 1BBT2 2XKPA 3IT8A 2G9ZA 3BOWA 1G9CA 4E27A 4NIAA 1OVSA 2GN3A 3NAPA 4QKDA 2JG9A 4CEWB 5JOZA 4JKMA 3IIAA 2W95A 2RS33 3VKLA 5J09A 2VXJA 2ZGUA 3IN9A 5DDJ3 3AMPA 4XBNA 3FWEA 1EP0A 3H7JA 5F2SA 4EN7B 3AFGA 2W08A 1MQTB 3ZX7A 4CDWA 3LOIA 2O0OA 4KU8A 3ZSLA 4CUGA 3OBRA 4UW5A 5GKAC 4XF0A 2Z42A 3H0OA 1AYN3 3X29B 4BMEA 3H8RA 4I3GA 1OOPA 5FZ0A 2R16A 1G9BA 3BIWE 3T3YA 4XFHA 3K51A 4JTOA 5FYMA 2QQKA 3RYKA 3BTAA 1WZXA 2CAVA 2EIGA 3DPRC 2QQNA 1WW6A 4A42A 3U0ZA 4Y33A 5FPVA 3TYJA 1DGRN 2GDFA 1W9SA 1XPWA 2HWB2 4B29A 2VM9A 1BEV3 3MIBA 2EAAA 1BVVA 2CGPA 5F5IA 4KG0A 4BA6A 2I74A 2YG0A 5C8CB 3OGGA 4GH4C 3H8OA 4MGSA 3BPSA 1UZYA 4XFAA 4XJZA 2PLV1 3I3DA 1PIV2 2WAAA 1ST8A 2Y6JA 4YW4A 1QOTA 1SCSA 5HCHA 1OH4A 3VKOA 3B3QE 3PUQA 1PO12 1YUDA 4KWJA 3BOPA 4L8QA 5JR7B 4META 2ZMLA 2TUNA 4B8EA 4QQHA 3NO8A 1QOSA 5KXCA 5L9VA 1R1A1 5BV6A 4NRMA 1V6LA 2R1DA 4IEOA 1H4GA 2CWMA 2TBVA 1S2EA 2GAUA 3UV9A 4EWDA 5IAXA 3FHAA 5A3UA 1RUF2 1UF2C 2ZX1A 4M3CB 2RM22 1JYVA 2O14A 2FZ1A 4AFMA 4AI8A 1NE4A 4OQ9A 5L7OC 3WOGA 2QQIA 1WCDJ 4XOGA 3RZGA 3WCRA 3SH3A 1PZ8A 4YW5A 2YB7A 3POFA 4DUVA 2RR11 1FOD1 1BBT3 2DCJA 4EN9B 2QFEA 1S0EA 3HR9A 2C0ZA 4NR1A 1OBNA 2ZGRA 4JGYB 2W46A 3SCFA 5CFDC 2EAKA 1LOFA 4GB32 2FZ2A 5FZEA 3LB9A 3H8XA 1WBLA 3U07A 5T55A 3AZYA 5DAPA 4YM0A 2WYFA 2JJ6A 3N4MA 1MS8A 1RUJ2 1I1EA 4E4SA 5LEJA 2EF6A 3LIGA 5IVJA 3J8F1 1JOPA 3LD8A 1W8OA 5IK4A 4AQ6A 2ZZQA 3ZN6B 2A6ZA 4UI9L 3J7LA 2XJUA 3PVBB 2PFWA 4QB1A 5C70A 4BM8A 1Q56A 5JMOA 1W8ZA 3OPTA 5FKBA 1HKDA 4AVBA 2HWF2 3WUDA 2GZWA 3NKTA 4LBQD 1PVC1 3NV3A 4MXWB 1W6QA 3NJYA 2OUJA 1RUD2 2AR6A 4B4RA 3T0DA 4A6OA 3RQ0A 2Y0OA 4JKKA 2WQ4A 1PGW2 5ISLA 3N3HA 3KGZA 1QJFA 3WNNA 1IZ3A 1HXS1 3IBMA 4AGVA 1ND3A 1FV2A 3R4SA 4WVZA 1VALA 3T30A 1VBD1 1W6PA 3DUIA 3MI8A 2PQSA 2HWD2 1S0BA 4BCUA 4IERA 1F31A 2FDJA 2Y6GA 2E53A 2JDAA 2D5HA 2VR4A 3B9IA 3D0SA 4F8AA 5AC91 4Q4W3 1ODMA 1PMIA 4UFKA 3IM0A 5FYYA 4O7XA 5FZCA 1VBE2 2VUCA 4XF4A 3O14A 2W1QA 1NAEA 1BQPA 2ZMKA 2XH6A 3VZJA 2QUOA 2HEWF 2RE9A 3EJKA 1VMFA 2QBXA 3VBHA 1DHKB 5CG8A 1J84A 2J1TA 3T1MA 4A45A 1URXA 2VOVA 2FDHA 4ZKTB 4JGZB 2RM23 4AWDA 2BV4A 5FQ0A 1GZTA 2W2IA 4CXXA 3WG3A 5F5QA 2R073 3CJIB 4L9BA 3BYWA 3C7OA 1RUG2 2ARBA 2DU0A 2XXZA 3BN6A 4DB5A 5FPAA 4CDUA 4ZONA 2WQ8A 1PNGA 4BXFA 3ILNA 2RS11 1T2XA 3AZZA 4GQ7A 1VLNA 4CRQA 2VCCA 1AX2A 1RYYA 3NMBA 4NIHA 1H8TC 1GLHA 3PDQA 3WDVA 2RV9A 1DFQA 4I0WB 3UYJA 2BU9A 2V4AA 3ENRA 3AP5A 1VBC1 2RG4A 1T6BX 2WRAA 4W65A 4Y22A 3I3QA 3ON7A 3T2OA 3VBUC 4XMIA 2RDRA 1QOOA 1AXKA 4WM7A 5A80A 5IATA 1NKGA 1ASJ2 3E97A 5FPBA 2SBAA 2YU2A 3BALA 1C4RA 2VW2A 1ZBE1 4LHNA 1CZVA 1I3HA 4A7YA 5I93A 1H2KA 5IHRA 4OMCA 1CESA 2HBUA 2PYTA 2R32A 2YPDA 3R4UA 4Y4YA 5LA1A 1YEWA 1EAH2 2HWF3 2YMZA 3HQXA 5DPNA 2J1AA 5FMDA 1WLDA 3APBA 1WLWA 2PTMA 2C26A 1WA6X 1QJU1 5GLUA 1AX0A 1X33A 1YQ8A 4YGBA 1QJY1 1YI9A 3UJQA 2WIIB 3AJYA 4BQ5A 2A6YA 2D43A 2NPIA 2X5IB 4WBBA 4CPBD 1AR91 3V64A 1WMXA 4PDWA 4F3JA 1SFNA 4RHV2 1OD5A 2HWD3 1H2NA 3KWVA 1LTEA 4AHYA 3M1HA 3IMNA 3DYPA 2XVLA 3NAPB 4GWIA 3I8TA 3MO4A 2VZTA 4LEJA 1VBA2 2WSVA 1ULEA 2BNMA 2V5YA 3PTRB 1SBFA 1E5SA 4GJZA 1A6CA 2RS31 3CIHA 1XOYA 3UJOA 1J59A 1EUTA 5DDJ1 1JOJA 4XTMA 2N7GA 1GOGA 2WINB 5FYIA 5SV8A 3ATGA 3OBAA 4K20A 4MGZE 3BIEA 5LCWL 1H0BA 3ALQA 3KQ4B 4XJWA 3ZYIB 1AR63 3AKSA 3M4FA 1ACCA 3VBUB 5IAVA 5A3WA 1YWKA 1AYN1 5FZGA 5EJ1B 1IPSA 4L99A 1JUIA 3B01A 4EN8B 5T5JA 4XFGA 2MHFA 1ZRDA 2BNNA 2B46X 1MS1A 1SEFA 3USUB 3FJSA 4QXCA 1VMJA 3EB7A 5FAXA 2FQPA 3ETQA 4B1MA 2ZAAA 4JHZA 4UWDA 2J22A 2RS52 4AFDA 2CGNA 3EXUA 2P6CA 2CHHA 2VO5A 4UBGA 3IKWA 1BEV1 3O0WA 3T08A 1UWWA 1XB9A 4OHXA 3QD6A 1LU1A 2ETEA 2IXKA 2WA3A 1GNZA 3RS6A 1YHFA 4YM1A 4X6QB 2DBIA 3MW2A 2ERFA 2D93A 1IKPA 2BOIA 4JAAA 1S1AA 4RN5A 5F6LB 4HKLA 5GLVA 4ES9A 1QHDA 4XQDA 2DVDA 1UL9A 1U5YA 3NNFA 2NP0A 1GR3A 3ASIA 1EAH3 1Q8QA 2XQRA 3DXUA 3ZN5A 5FR3A 1OI6A 1X9PA 1SQ4A 1NA1C 4GD4A 1NY72 4K1ZA 4XETA 2HEYF 2JG8C 1RINA 1HV0A 2ZGPA 1OMIA 1CVNA 5FZ4A 1LHUA 3KCCA 1QDOA 2Q1MA 3GHNA 1HB3A 4RL7A 1SZBA 5FPXA 5D8AA 1V70A 4M0HA 4IV1C 1LU2A 1W0OA 5FO8B 4W6YA 2JDPA 1PZ9A 5FDBA 3EQEA 2MPFA 2D7FA 5BNNA 1N1YA 4DY3A 1LHWA 4RHV3 1BBT1 1G7YA 3UKVA 2UWAA 1SPPA 4AAPA 2YY1A 2Y6HA 1BMV1 1VBA3 2Y38A 1LEMA 3UGHA 1WKYA 3PL0A 2PQQA 2XWBB 4IESA 2OX0A 2O8QA 3PU3A 2Y6LA 3A0KA 3Q8CA 2WNUA 5H9QA 3T2TA 2VTXJ 4AAXA 4AXOA 3CEWA 1GZCA 1CZSA 5BNPB 1XYPA 2XBO3 3AVSA 3RVHA 4QB6A 3WF0A 3WR0A 3VDBA 1FPN2 4CDXB 2C4XA 1QXRA 1IS3A 4FTBA 4ZU5A 1RIRA 4CEYC 5IW0A 1ZRIA 3WF4A 1WMFA 2D3PA 2DFBA 3D3AA 4Y26A 4OZOA 1FAYA 1W6QB 2JDHA 4XFIA 4WZCA 2WO3A 2PA7A 2C9AA 1CQ9A 1RTVA 2RS53 4YW2A 3VD7A 3JXSA 2A3XA 3D4KA 1Q43A 2Q8OA 3AK0A 5DMYA 1ZBA3 1WW7A 2LRPA 3H42B 1ND3B 1T6GC 4UW3A 5A6ZA 1NCQA 3WP4A 1BXHA 5J98B 1JZ7A 1W6PB 3WVJA 1CPNA 3ZXDA 5J48A 5JAXA 4YW7A 3N9NA 4BJ0A 3CNAA 3I2IA 4IEYA 2ZX4A 2LUWA 2VQUA 4ZZ8A 1GFF2 5DZGA 5J37A 1AR82 2ARXA 3GNEA 3VZKA 4B3NA 3NL1A 4Q4W1 3VBSB 5JXJA 1XYOA 3T09A 5G05L 3UKNA 2JKBA 4FPCA 4KBZA 3R05A 1R1ZA 4W6XA 4JX0A 2QQLA 4FCAA 4FO9A 3ZYJB 4IE7A 4D94A 3VBHB 3FC0A 2ZX3A 4CCKA 5BNOA 4Y24A 4MSVA 5A7QA 3KGLA 4UF0A 1GZWA 4YSFA 2RM21 4H55A 2B5HA 1YJKA 1TMF3 1Y9QA 2R071 4XZPA 5FYZA 4FTEA 3Q8FA 1WLTA 4HETA 4AHZA 1HLCA 4HANA 5F7UA 1R1A2 4KH9A 4YZ4A 4LKEA 4M3CE 2D98A 2E33A 3JB8A 3LQCA 2QZ3A 4FSJA 1UYPA 3JQXA 3UKTA 1W8HA 2IXJA 3HN1A 4FPKA 4E2QA 3AP9A 1U12A 3QH6A 3AMMA 5I8SA 2CTVA 5FP3A 5F2WA 4MUVA 4XDOA 3U37A 4FBFA 3KHBA 2VMGA 3ITQA 3WW4A 5EP9A 4BIOA 3AJZA 3KT7A 1Z7S3 4G3YC 2RR12 4WVMB 1FOD2 1YFXA 4IEUA 1L7QA 2PHDA 1N1TA 1FPN3 5C33A 4QX2A 3TEZA 1UY2A 4V1PA 1GP5A 2WT1A 1NXMA 1AJOA 1X7NA 4UW6A 4D3WA 4LTAA 2LM3A 1ND2B 3VBRB 3AXDA 2HWF1 1GP6A 2HKXA 1DBNA 4AEDC 3WW3A 2W1UA 4HPKB 5A32B 2VMIA 3GZTB 3VBOC 3J8F2 1Q8OA 3ZFEC 4XABA 1CGPA 3O1MA 3LOBA 4XPVA 5DUXA 2YUEA 3JBG2 1Z0HA 4XUQA 1XE0A 1SLIA 3V0BB 2JD4A 2YFZA 3ACLA 4PDWB 3BTYA 1OPOA 1PVC2 1WCQA 2DV9A 1ZZ9A 3O5SA 2VQTA 4JHTA 2HWD1 2Y64A 4YLZA 3HNYM 1CIYA 2OT7A 4ISQA 3ZFGB 1AR83 2OPWA 3KS7A 4AVCA 5A7NA 1LGCA 4IGOA 1HXS2 1WMDA 2ZMNA 1N47A 4QDSA 1GICA 2WO7A 3ACHA 3F2ZA 1PM7A 2CYFA 5GLWA 3JD73 5LW9A 2KXLA 4AVVA 3VKNA 1LULA 4QHZA 1AR61 1AVBA 4DNYA 2FMYA 2Y6FA 3ZXEA 1H9PA 1UY4A 5D1IA 5C4WB 2ES3A 2PAMA 2HH9A 4Z1VA 3SH5A 4AGGA 2QQPA 1WLCA 4NIGA 2D6KA 2WN2A 1JI6A 4HL0A 3HQRA 3AXEA 4EV0A 4K8RB 4Q1PA 2EIBA 3UGFA 5BY5A 5D2AA 2ZGNA 1RMU2 1FATA 4KWLA 2ZA9A 2P3IA 1S0CA 4I01A 4CCDA 1CPMA 1LCLA 4N9IA 3PLQA 3OEBA 3AP4A 4WVVA 3OGSA 4L2NA 2EVXA 3JUUA 1HV1A 2XONA 4XJ8A 1V00A 1LOGA 1JYWA 2IXCA 2GH2A 5C9AA 2JDZA 1OT5A 1ULCA 2A1XA 2R1BA 3OOXA 4Z07A 3ZLIA 1ZX5A 1LECA 2W1SA 2WO2A 5HV4A 4QDRA 1PX4A 1RUE3 4L92A 4DUXA 3ORJA 5T50A 4QPIB 1RHI3 3RZMA 2QQJA 4K21A 3WXPA 1DQ4A 1VBC2 3DL3A 1OQEA 3H1MA 3OYWB 4FPYA 4N43A 1EAH1 1SCRA 2UY9A 3OG2A 5FXWA 1YQ2A 3TRSB 3VDDB 4BZ4A 2XR4A 5DZEA 1JN2P 3K48A 3LF7A 5FLHA 5A1FA 4CYDA 1PGSA 1Y4WA 1LHNA 3HWJA 5FTTC 2YPJA 1UMHA 3C7FA 3AFKA 3JBG3 4QWNA 4XFFA 4MGKE 3SEEA 4DO0A 2YROA 3I2DA 1A8DA 2ATFA 4H14A 3HT2A 4IEPA 4AYUA 3MPBA 1YIPA 3WQBA 3WD5A 5IUQA 1DCSA 5DQ0A 3ZXJA 3NSTA 5FKCA 2EXIA 5A6XA 3AYDA 2G4IA 4G9SB 4RHV1 1VRBA 3DPRA 4CE8A 5JSPA 3GZAA 1FMD2 1DZQA 4RSUA 1LODA 2P1BA 4QPGB 3BI3A 1UZ0A 1DQ5A 1QJY2 1VBA1 4QKFA 4PIXA 4FAHA 5IT6A 1NLRA 2PHUA 2Q1FA 3CZJA 3MW4A 4QHOA 1H1IA 1JHNA 4UBHA 3WLUA 4AEMA 5A3MA 3ILFA 1AR92 1YYNA 1KS4A 3AYAA 5CKNA 2WNUB 4Q5OA 4XBQA 5EHDA 2XBO1 2QQMA 2AACA 1S0JA 2Q8CA 4E4ZA 4EZ4A 1IPKA 1JYNA 2ORXA 2VZQA 4IE4A 4OUEA 5DDJ2 4AQ2A 2DVAA 1LENA 4TN7A 4N53A 1RUH3 1OUXA 3POYA 5FY9A 1OQDA 1JZ8A 4OFGA 3I3EA 4LBKA 2ZGQA 1J3PA 1ULFA 3IPVA 3ZDSA 3N9LA 1VMHA 1YRZA 3VBFC 1RMU3 1GU3A 4LLOA 2RS51 5CFCB 1MZ5A 3ELNA 5B4XA 2JEMA 3ZYGA 1O5UA 1XC6A 3H3ZA 1ZBA1 1O5LA 2IXIA 4D7SA 4CEWC 3NNGA 1J3RA 1OXCA 1UYZA 5C3RA 2PHFA 4CP9A 4QXBA 3FUOA 1RVF3 1UZVA 1UAIA 2GC2A 1ENRA 2B42B 4QHBA 2A6WA 3PHMA 5FUPA 1FNYA 1TZOA 4KWUA 2VW0A 3KD4A 1S0FA 1GOFA 1POV0 3AMQA 3R6SA 2JXAA 1BEV2 1BK0A 2ZEWA 3IB3A 5CFDA 2CDPA 4Q0QA 5JI7A 1JMUB 1LOCA 4JDNA 4NPRA 4XQ4A 1GQHA 1MR5A 2ADDA 3H8UA 5DXDA 3ZYBA 1K5JA 3ZSMA 2XL9A 1UOGA 5BNOB 2BW8A 1UMIA 3CMGA 4UF0B 4EWEA 4XMAA 2GH8A 4AVTA 4CXWA 1TMF1 3NVCA 3PJYA 5K9YA 4HKOA 2C6SA 2GU9A 2P34A 5FK7A 1DQ6A 1PX3A 1O59A 3CZUA 3IZOA 2NN8A 4YG6A 4YM3A 1ZA7A 1MZEA 4XAAA 2D6MA 3GZEA 5J96B 2YBPA 2J1VA 4UXAA 3MPPG 4LR4A 1FMD3 2GMMA 2XLGA 2A7AA 2W94A 1NQDA 2P37A 2PAKA 2WS92 4FPHA 5FY4A 2OW4A 4GWJA 4HSJA 4PLOA 4CPBA 4EQVA 5C8CC 1W3XA 3DKQA 3BPZA 1GWMA 1YC61 1K42A 2P6HA 5K0UA 2QKDA 1NX9A 5FO9B 4MXVA 1Z7S1 1O8PA 1XYNA 3GXUA 4FVVA 1OKQA 2GNMA 3OY8A 3S7EA 1AJKA 1FPN1 1BMV2 1KQRA 4KG8A 2VOWA 1K12A 3M3OA 2JDUA 3RPQA 3E5UA 1ZRFA 2FDGA 5F5CA 4Y20A 2WLPA 2VD7A 2CV6A 3RRDA 5FY7A 2JWPA 4A7KA 1RUNA 5I0UA 1RUC2 4I0AA 4CDQB 5FFOC 4UFJA 3M7AA 1X8MA 1BLZA 1MZFA 3KV4A 3SCGA 4C8DA 5LA0A 4QQOA 4URTA 3ABZA 1OVPA 1VBB2 1SBDA 4CXYA 2ZHKA 2P17A 4URAA 5IVBA 4ARYA 3U1XA 2JICA 2V72A 5K8SA 3CQOA 4JGYC 4A6SA 3J4UH 1ZNPA 2ENRA 1UMZA 5A3NA 2WNOA 1BZWA 1QNWA 5FYSA 1UN1A 1W3VA 3O12A 4SBVA 5I0SA 5LA2A 1AX1A 1OA4A 4CUCA 1AR81 3KB5A 3GJAA 1KFXL 3M3QA 5EYXA 3NJVA 1EPWA 1H8TA 4QX8A 3WHTA 1K5MB 3LKJA 4ZS2A 1EV13 3OJBA 4QX1A 4UFIA 5HXMA 5J1XA 1CR7A 3JD71 1LRHA 1X36A 4QQ2A 3VHNA 1F35A 5FP9A 1I5PA 1Y9GA 5I0DA 1IGOA 2GN7A 4FOQA 4BQ1A 3D8CA 2A3WA 1OSGA 3HJRA 4Q4W2 4OI1A 3Q8EA 2V09A 1UY1A 3FHIB 1ULPA 3ZSEA 4AHXA 4GMP3 4IEZA 2DUQA 1H6XA 3ACFA 3MW3A 3UGGA 5C3OA 4CU7A 5BPXA 1J1LA 3AZVA 2BWCA 1IPJA 1W8WA 1NCRA 2ZS6B 2Q1ZB 2VOTA 2ZZJA 4X8NA 4BHPA 4PF1A 1E5RA 5A7WA 1KDKA 4CU8A 5GZGA 3W5NA 1L3JA 4LUMA 2WS93 1A8MA 3VN4A 1XJAA 4HN1A 3SH4A 1MVEA 2R072 3ZMNA 3QLQA 3C7EA 1HQWA 1UX7A 1S2BA 2VE1A 4OYUA 5C9AB 4N7IA 4XIKA 2VZSA 2WWJA 3GBWA 1W2OA 3OD4A 4GZ9A 4BLIA 4DPNA 1RUE1 2SLIA 1CAWA 3AMHA 4D69A 1UU6A 1ZRRA 5IVVA 4QT6A 2ZGTA 2XUEA 1RHI1 1QGLA 2ZGKA 3CBNA 1BJQA 4SLIA 4N43B 4FFFA 4JGZC 2WZR2 4QKBA 4B7KA 4DS0A 1ZREA 1RUC3 1UO9A 5D21A 5ABJB 3AKTA 3OGVA 1G6NA 3CJIC 3AYEA 3ZYPA 1IG3A 5FYVA 3VHOA 5IFTA 1S55A 1OKOA 3K2OA 2VGDA 1I5ZA 2Z5WA 3C7HA 2IUWA 1VBB3 3JBG1 4LBQB 1PK6A 3A21A 4LOTA 1UPIA 4P5YA 3H50A 2BZDA 4QQLA 2VOXA 1GZ9A 4N90A 2YBSA 3DYOA 4W4ZA 3RMXA 4YARA 4FTSA 1JHJA 3AC0A 5FZHA 1HRV3 3FL7A 1UY3A 3WV6A 4HVRA 4IV3A 3SCHA 2VMFA 2B4KA 1LNSA 1GNYA 3I2FA 2XG3A 5KHJA 1GUIA 3WF2A 3LA2A 4Y4RA 4RR3A 1UOBA 1ZZCA 4Q2FA 3EBRA 2G1MA 2D3RA 4XILA 4AR2A 5GALA 4A41A 4BH9A 5E1RA 1NQJA 1Z78A 2ZXQA 1NLSA 5F3IA 4P9XA 5CKQA 4TXWA 2ZBJA 2FMDA 4S2FA 3VD3A 4AE2A 2Y34A 5AVAA 4N53B
chains in the Genus database with same CATH topology
1RUH1 1ULDA 2PHLA 3A0NA 4Z82A 2VECA 2ZCWA 1LHOA 1NA1A 1ZA4A 2FHRA 1AR62 4EN0A 2W39A 2ZHNA 5L19A 1RMU1 2JG8A 2UY8A 2X5IC 4X6RB 4AEJA 1SLBA 3ZSKA 4XQWA 1DZTA 2BPA2 2WFF3 4IV1A 3NAPC 1YI7A 2JG9C 4QPYA 2XWJB 1RVF1 4LHKA 1WA4A 4NHMA 3ZVXA 4DRVA 4D7YA 2BQPA 3AZXA 3NWKA 3SISA 4NOTA 4AQSA 4CDWC 1TEIA 4L11A 1NYWA 1AL0G 4ATFA 3OTFA 5FMOS 1YXWA 2WZR3 2YDEA 2E7AA 1QJX2 4Q0VA 3TOJA 1IKQA 3CLPA 5LEKA 3SITA 3VKMA 1O4TA 4P9GA 2WKKA 4CEYA 4YVWB 4GWMA 3R0RA 1CAXB 5CB7A 4COWA 5JZGB 5FO7B 4C91A 4QGNA 3KCXA 5LK7B 3MLLA 3A4UA 4AFBA 3HIFA 4XHBA 1FMD1 3B7MA 1SLAA 4XHXA 3MIHA 3JZVA 2I07B 2BUKA 2HYKA 1ONAA 3VHPA 1SLCA 5K0UB 1VR3A 1F5JA 1GBGA 1V6KA 1VRH3 4YYOA 2F4PA 1DGWA 2XB6C 1D4M3 1DIWA 2JG9B 4OLLA 1Y7BA 3DV8A 5C6CA 2IFRA 1O4ZA 1O91A 4Y20B 5BNQA 1VAMA 2HWE3 2UWCA 5JI9A 5KC5A 2XLAA 5JIUA 3U10A 1C28A 4XXAA 1Q3EA 4CDWB 3WCSA 1D2SA 2RMU2 2XBO2 2F6BA 2ZOEB 4DXZA 3DF0A 3PVEA 2XJVA 4RQPA 4TWTA 3URFA 4NWWA 1DU3D 4AK3A 4E2SA 1H4HA 1OOPB 2JENA 2NYYA 4M00A 2R0HA 4P9LA 5DG2A 1C1LA 5BYNA 1UX6A 3ECQA 2RJLA 3RDIA 1G9FA 2A5ZA 1XXNA 2DUOA 3GHMA 1ZBA2 3QACA 5BNPC 1EV11 4QM8A 4CDXC 2QNKA 3SXWA 1HRI3 1QJX3 2V73A 2ZACA 4FPGA 2D6OX 4TSVA 4O9EA 1GKBA 3ZFFA 2R49A 5KWRA 4GMP1 4I02A 2BVVA 3M2MA 3TNPB 1B09A 3CO2A 1REEA 1XQNA 2A3YA 1NCRB 1JUHA 1ALYA 1ND3C 3EO6A 5L73A 3VBOA 4CP2A 1DDLA 1X82A 1OA2A 1XU1A 2WS91 1UPSA 2DURA 1S0GA 1TMF2 1YO8A 3O7OA 1VIWB 2H6CA 1XE8A 4ORFA 1C1FA 2JE7A 1LOBA 3WZ1A 4AI2A 4Q1RA 2OZ6A 4JV4A 2DVGA 3VBSC 1GANA 3N7KA 2Q0AA 5IK8A 4C0HA 4RS5A 1PGL1 3VBHC 3W59A 3E5QA 2ZGLA 1YFUA 3ROUA 2E63A 4TYSA 1J58A 3DGTA 4YW1A 1RUC1 3LA3A 1Z7S2 5FOJB 2RMU3 4PQ9A 4D7TA 3J26N 4LO5B 1AR73 1H2MA 1H8VA 1VBB1 3KCYA 2B45X 4G4FA 1N3QA 4XJUA 3U4XA 2NQYA 3TNQA 1B35A 4M3CF 2BYVE 1HQLA 2PELA 1HRV1 1HIXA 1FI2A 3KZ4C 2KM2A 4WM8A 1H1MA 2MNGA 3E6DA 2TEPA 4FT8A 2DWRA 5EV7A 3QCWA 1QXJA 1UU4A 4AI1A 3FUQA 4JRLA 2WNVA 3AM2A 1SDWA 2ZX2A 1PO23 4RR3B 1COV2 5JPMB 2CWSA 3WG2A 4HK9A 1N1VA 2VXRA 2WQZC 5FLIA 2P2KA 4J1WA 1IHMA 1ND2C 3VBRC 3VUOA 3T1LA 5CU1A 5LRSA 1QJZA 4K40A 4DOUA 4WZFA 4A3XA 2GMPA 4LBNA 3OCPA 4KBBA 4RGGA 3JD72 3H1WA 1D0HA 2DCYA 4PDWC 5T5LA 1PVXA 1UIJA 3C3VA 3WDYA 4HVQA 4EN6B 1JXNA 1O3TA 5FQ0B 4TLFA 2ET1A 2WFF1 2DYCA 5GLZA 3ZFGC 4P14A 3D6EA 3MIDA 4CDUB 2AUYA 2E6VA 5FOBB 1X50A 5ACA2 3R4DB 1DGWX 1ENQA 1J3QA 2QJVA 3JQWA 3MLJA 2D3SA 3VL8A 2D6NA 5GZDA 5I8YA 1W6MA 1VB2A 4YG3A 5C4WC 3MGUA 4Y22B 4QQPA 4WM7B 2WZR1 4Q26A 3VGIA 2Q5TA 3H9AA 1NE6A 1KS5A 5CG9A 1RUE2 2VULA 3M3EA 5BXXA 4LT5A 1RHI2 4H7LA 3WP5A 3B94A 4OHVA 2GC0A 2BBVA 1FNZA 2GC1A 1S0IA 4E2GA 3VV1A 1TNFA 3P3PA 3VBFA 5JWPA 1M06G 4YZ2A 4AQTA 1LOEA 3ZYRA 5CVRA 2WJSA 4XF9A 5AFEA 4CZSA 4HK8A 4KU7A 1COV3 4NN0A 1MVQA 3MIGA 1VRH1 3TWIA 4QPIC 4BE3A 3D0JA 4IEVA 1ZRCA 1ENSA 5H9PA 1XNDA 5I91A 3VDDC 1D4M1 5EWSA 1CJPA 1V6MA 4YGDA 1MQTA 1LJ7A 3WG1A 1ZZ6A 5JIAA 3ZPYA 2HWE1 2WL1A 1MS3A 3OGJA 3B00A 3GBGA 1E57A 4YVSA 4Q27A 4XXPA 3HT1A 3S7IA 3WG4A 3LAGA 1RUI3 1D0GA 1TME3 4Q0PA 4RQPB 5BNNC 4GALA 3N35A 4RD7A 2DCKA 4KNCA 3N7LA 5J3UA 1RUH2 1WGPA 2VQAA 4Y5Z0 1FYUA 2YZ4A 4QPGC 4XW3A 3P3NA 5J7MA 2IWGB 4HVOA 4OI2A 5ACA3 2WNUC 3FLTA 2TNFA 4P9JA 4ZU7A 2NMNA 4B4QA 4XTPA 1RVF2 3LGRA 5GZCA 1HRI1 1QJX1 4MX3A 1D4VB 3U11A 5AVPA 4Z92B 2ZGSA 3HAGA 4AG4A 3ZFFB 3JB4C 2YGMA 3KM5A 2AYHA 4XFBA 3PTYA 3VHRA 1KRIA 3UK9A 1MS5A 2I2SA 5CFCC 1F8VA 4HZFA 1Y43B 3PJQA 4XF3A 4KL1A 2OPKA 2WC2A 2YGLA 4AI8A 2XL7A 4RA0A 1C57A 2VPVA 5JLVA 1QU0A 3AYCA 5EYYA 2CNAA 4N9HA 3MEPA 1C5HA 2IFWA 5D8AB 1XNKA 4COYA 3M70A 4DMIA 2DVFA 3LSDA 4WV8A 3G7DA 5BNNB 5LRRA 3M3CA 5EZWA 4JGYA 3ES4A 4MV2A 2PHXA 4PIZA 3ZN4A 2FBEA 1AUYA 4RS5B 3CJXA 4GKYA 3NW4A 2XVKA 3LA7A 4Q4V2 3ES1A 5BNOC 1J1TA 3WINE 4NVPA 4YFWA 3ZN6A 4GH4A 4H7MA 1MACA 2RMU1 3LCPA 1F2NA 4C1XA 1AR71 1VJ2A 5E16A 5H9SA 1A78A 2RJKA 5I0TA 1G9AA 1MS9A 1B35B 4QD2A 4CTEA 4IEQA 2B7YA 1SACA 4RGAA 1KITA 1OLQA 3RJ2X 3WNXA 4GXLA 4BIFA 1CN1A 1BCXA 2W52A 4BMBA 4MLOA 4NO4A 1XNBA 3RJRA 1N3OA 2XUMA 1H1AA 1NCQB 1PO21 5L7OA 2QCSB 2Q30A 1F5FA 2G9FA 4HT1T 5GLTA 4S2GA 2XJQA 2CL2A 2PHTA 4K6BA 4I3PA 2OYZA 1W39A 2JE9A 5KXEA 2P3JA 2PAEA 1SMVA 4CDQC 3ZSJA 3UL2A 1UIKA 1EV12 3LSEA 4JGZA 2BGCA 2XVGA 4K9SA 5EFUA 2E7QA 2PN5A 3INAA 5FCCA 1QH6A 2A70A 2I45A 4P9IA 2A6XA 1SBEA 2MEV3 3CJIA 4LHLA 4HSLA 5EXOA 2AH2A 5HBAA 5IK5A 1ULGA 4P9YA 1GZWB 4IXLA 3VZMA 5JPNB 2DU1A 3NV4A 3IWZA 4NHLA 3KT1A 3FE5A 3IDEA 5IK7A 2VUJA 4E9KA 3JU9A 1VP6A 3FLPA 4BOWA 1K5MC 2WT0A 2OA2A 3N7JA 3G6JB 3MFCA 3C2UA 2AZ5A 3WDXA 2XKOA 2YXSA 5B2GB 5FMOL 2XHKA 4Q4V3 2EA7A 4MGIE 4HBNA 1QQP3 4FOWA 1C8M3 3RSJA 2CGOA 1PGL2 2DVBA 2VNOA 2XJSA 1C3HA 5H9RA 1WMEA 4PLNA 3SLIA 1G9DA 1AZDA 3WHUA 1R093 1HW5A 4MVTA 2X5IA 2WSUA 3WDTA 5C9AC 4P9WA 1QKQA 2HEVF 3KQRA 5FLJA 4JCKA 3ZXFA 3AP6A 2DTWA 1PZ7A 4XF1A 2ZKLA 4S2DA 1COV1 4YGEA 3I54A 4LUKA 1HRV2 3WUCA 3L2HA 5DZFA 1R083 2VVDA 4N43C 4JTNA 2YHJA 4JRAA 4M01A 3MICA 5ABJC 1ZVFA 4AFAA 2VG9A 3V56A 2EXHA 1W2UA 3I4IA 3VBUA 3D5OA 4YVSB 5FREA 1CJDA 1RUI1 2OIIA 4DZGA 1TME1 1YLLA 3USUA 3NV1A 1O3RA 2E9QA 4XYXA 2VQ0A 1RITA 5F1RA 1LHVA 1SLTA 3PMSA 4HKWA 1DLLA 1LESA 4LULA 3LWCA 3ZIXA 4ZXKA 4KWKA 3AP7A 4COVA 3SMHA 1SLLA 3QOPA 4NWVA 5FBZA 3LZZA 5ACA1 3AKRA 2B9UA 3TN93 4IQPA 3OPZA 1C5IA 2VW1A 1GYKA 3QBQA 2WFF2 5A33A 1Q8PA 3OD0A 3PVNA 4JDMA 4Q4Y3 3HD8B 4Y1ZA 1EPZA 2CAUA 5HI0A 1V6JA 1G86A 1JW6A 4Y1XA 2XPJA 4N53C 4OHYA 4FP2A 3E6CC 2XLFA 4FXKB 1S0DA 3VZNA 1MZ6A 4MZUA 2A75A 3Q9OA 4LE4A 4FOYA 4I09A 4AFCA 4JC1A 3JCIA 1AYM2 4NHKA 4JQRA 2ZTNA 1DQ2A 2BFUS 3J9SA 3H7YA 1DGRA 2ZHMA 5CNAA 2ZHLA 3WP3A 4U2AA 5CA6A 4FPLA 4FPEA 4YNIA 1I9RA 1V9U2 3MF6A 5GM0A 1GNHA 2GNBA 4LNVA 1CAUA 2VMHA 4JDOA 3ZXLA 1KJRA 4LO4B 3DPRB 1BKZA 2GMEA 3WQ1A 5GJ6A 5DUWA 1KJLA 1I6XA 4R9BA 2WLQA 5F6KA 3USSA 1LKNA 5BNPA 2XJTA 3S6PA 4PJYA 1WBFA 3GBFA 4ASLA 1VRH2 4CDXA 3L2YA 4GH4B 2G9GA 3FBMA 3ME2A 3D82A 3MIEA 3B9CA 4YVWC 4FPJA 5LK5A 4Q0UA 2VUAA 1XU2A 3KMHA 1D4M2 4S2HA 5JZGC 1HX6A 4PBPA 4DRRA 5A3LA 2X8KA 3VKFC 5GZFA 4BLJA 2DCZA 1DF0A 2AGSA 4Z2WA 4E4DX 2HWE2 5HCAA 1FXZA 2HWB3 2YV8A 4R52A 3IPVB 4RFT0 5T3NA 1O4YA 1QXPA 1YNAA 5K0UC 1V6IA 3I59A 3OBTA 1KFUL 1C8NA 4AEKA 2OZJA 1UKRA 2CY6A 5L7OB 1KDMA 3CF6E 3IDBB 1IS5A 1N1SA 1PIV3 4YZ5A 3VBSA 1AXZA 4BPZA 4LBMA 2VVEA 1PO13 2H6BA 3RI9A 4BWOA 3GALA 4QGLA 5CFDB 2WT2A 1AYM3 4CP0A 1RUF3 3KSCA 1QDCA 4GKXA 4ISRA 1U5ZA 1FT9A 1NG0A 4UW4A 1HRI2 1OOPC 1QY4A 3MLKA 3ZXGA 5KHKA 1V6OA 4FQ4A 4A2UA 1X8EA 2MEV1 1OPMA 3MF9A 4IETA 2WFPA 1NZCA 1V9U3 4QMAA 3RYPA 3E6BA 4ITCA 2D6PA 1UCXA 2HWC2 3TB0A 2AENA 4ZU4A 2DF7A 4GB33 3FX3A 1HQNA 4FP3A 3AB0A 1XNCA 1RGSA 4WVMA 3H1YA 1RUJ3 3TBDA 3NKGA 1TNRA 1JTZX 4Q4V1 1HDKA 4IL7A 3GF6A 3AKPA 4AHWA 3RZZA 2UWBA 2R042 1QQP1 1QH7A 4OVEA 3VZOA 4QXKA 1MEC2 1ND2A 3OY8B 4P5HA 3VBRA 4ASMB 4OHZA 1C8M1 2A71A 5DG1A 1CONA 4N7UA 5T54A 1NCRC 1UU5A 2D44A 4HPKA 1RUD3 5A32A 1DYKA 3HBZA 2R30A 4PIYA 4I0BA 3WW1A 4LBLA 4MH0E 2HJIA 1R091 2R0FA 1ZZ8A 4U36A 2Z79A 3V0BA 1AR72 1IOAA 1EY2A 2C1FA 2R062 2EXKA 1DGLA 2W0XA 2XJPA 2IXHA 3ZFGA 4OUMA 4Q4X2 2Z69A 3RMYA 2P3KA 1LOFC 1VBE3 2GSYA 1R081 3THPA 2GC3A 2NLRA 3SNMA 1OFSA 4FPOB 5JMCA 1H8TB 4PCRA 1LGBA 2EALA 1PO22 5C4WA 1EYBA 2Z2SB 4JVAA 4C1WA 4YG0A 1OHFA 2EXJA 4OI0A 1PK6C 1ZYBA 4LBJA 4ES8A 2E7TA 4R8HA 3BODA 1RUG3 4QGMA 2ZX0A 3WDWA 5KHHA 2JECA 1GQGA 1POV3 4HLTA 4HMZA 4K8FA 2O1QA 4IV3C 1DQ0A 2HWC3 2UURA 4AEDA 1YCIA 3ZFEA 4DQAA 4RR3C 1AHSA 1ENXA 3TN91 5KBFA 1PHMA 4LO7A 1ASJ3 4PF5A 4LA3A 5A33B 2OUHA 3VLBB 1KXGA 3POWA 4Q4Y1 5T52A 3ILRA 3PVOA 3NV2A 4XDQA 2R043 4QPIA 3S30A 1H2LA 4XJAA 1CX4A 1MEC3 3PNAA 3OYWA 4AI0A 1CAWB 3VDDA 2XJRA 5C8WA 4Y1UA 5K7PA 1ZZBA 4XJ9A 4ONUA 4YFZA 5AFBA 4FPFA 1WCKA 1JBCA 1RUOA 4CDUC 1PK6B 2R063 1YFWA 2WNEA 1CAUB 3H3UA 3FMGA 5CBLA 5JOWA 1H9WA 4QPGA 5E8AA 4LO6B 4Q4X3 3RG0A 4OUSA 4XEZA 1M4WA 4FOVA 3I7DA 4FXGB 2OVUA 1F9KA 4IV3B