2PHTA

Pterocarpus angolensis lectin (p l) in complex with man-7d3
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
240
structure length
240
Chain Sequence
b'EDSLSFGFPTFPSDQKNLIFQGDAQIKNNAVQLTKTDSNGNPVASTVGRILFSAQVHLWEKSSSRVANFQSQFSFSLKSPLSNGADGIAFFIAPPDTTIPSGSGGGLLGLFAPGTAQNTSANQVIAVEFDTFYAQDSNTWDPNYPHIGIDVNSIRSVKTVKWDRRDGQSLNVLVTFNPSTRNLDVVATYSDGTRYEVSYEVDVRSVLPEWVRVGFSAASGEQYQTHTLESWSFTSTLLYT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lectin
publication title How a plant lectin recognizes high mannose oligosaccharides
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 53
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2phtA00
5AVAA 2AH2A 3OBRA 4LBJA 1V6MA 4XBLA 4FPOB 2GN7A 2NMOA 2UWAA 5CB7A 3ZSLA 2LALA 1H9PA 2BQPA 2HYKA 4RL7A 4L8QA 4GWNA 2H0BA 3WUDA 2DUOA 2EXKA 2A6ZA 2GNDA 2ZKNA 2EXIA 4K1ZA 2ZMNA 3VUOA 4LBNA 1GZWA 1V6OA 5JOYA 4AVTA 5KXCA 1J1TA 3OJBA 1A8DA 3ENRA 2LTNA 1V6LA 3O0VA 1YYNA 2TEPA 2A71A 4PBOA 1JW6A 3WDWA 1MZ6A 3NV2A 5H9RA 1DIWA 2WT1A 5T50A 1C1FA 4XJ8A 1FNZA 3SNMA 2FHRA 5FRAA 2UU8A 1GZCA 1GNHA 4GKXA 4ASMB 3USUA 1EPWA 2VW0A 1WCSA 3ASIA 3M2MA 3N7MA 5GALA 4LBMA 4C1XA 2ZGOA 1DQ0A 3IKWA 4YZ3A 1MS3A 1PZ7A 2ZGPA 3AX4A 1QGLA 1HQLA 2DTYA 4U36A 4WZFA 4YGBA 1AVBA 4H55A 2R0FA 4Q8LA 3WG4A 2OW4A 4YZ4A 1KJLA 3U4XA 1MS1A 4FP3A 2ZHNA 4Y22A 1GANA 4LBQD 1UZZA 4XIKA 3WHTA 3VKFC 3BTAA 5T5PA 5CNAA 4TZDA 4BQ1A 3AP5A 2JDZA 1TEIA 2SBAA 5JLVA 1DQ4A 4BM8A 1DQ2A 5KXBA 3RG0A 2ZMLA 4JRAA 1SBEA 4BLIA 5EYYA 1N1YA 4FPCA 2ARXA 1FX5A 1G9FA 1GLHA 2JD4A 2VH9A 2W52A 2RHPA 1GV9A 3MPPG 2CY6A 3IN9A 3ZYRA 1DYKA 3R4SA 1BXHA 2V5YA 4CRQA 4LBOA 3N3HA 4DRRA 1IS5A 1LJ7A 1HDKA 5BYNA 2NP0A 2DURA 5HCAA 1YO8A 1UMZA 2R49A 1OFSA 2A70A 2DYCA 2PELA 2ZGQA 2WT0A 3AZZA 2ZGUA 4XXAA 2ZA9A 2JJ6A 5E88A 5L73A 3NWKA 1YIFA 5SV8A 4Q2FA 3APBA 2A3YA 3N36A 4ATEA 1LULA 5GLWA 3JU9A 1KITA 3OY8B 1QOTA 3V0AB 5CBLA 4PCRA 2PHXA 1JUIA 1VAVA 2DVBA 2EAKA 4Y1YA 1LHWA 1I3HA 3PVNA 4YM1A 3WUCA 2KM2A 3IPVA 2UWCA 4FQ4A 1WW7A 3B9CA 1G9BA 3WHUA 2V73A 1WBLA 2ZBJA 4XJWA 2DUQA 1WBFA 5IK7A 1UL9A 1F31A 1QF3A 2P3IA 1MZ5A 2CWMA 2DVFA 5KXDA 5DZEA 3HN1A 2PHFA 1Q8OA 2GMEA 3ZSJA 1W6OB 3M3CA 1AX0A 1LOGA 3UJQA 5FREA 1R1ZA 1Y7BA 3D6EA 1UPSA 4FPLA 1W6NB 5GZFA 3WDYA 5DUVA 3DGTA 1HLCA 3QLQA 4YW3A 4R9AA 5CA6A 1IS3A 2A6VA 1N3OA 4K1YA 5KXEA 1ULFA 1OQ1A 2W39A 3FBYA 1UAIA 3AYCA 4UW5A 4XE9A 5IUQA 4BMEA 1JXNA 2GN3A 1S0JA 2JECA 2GNBA 1IOAA 1CVNA 4GA9A 3FUQA 2ZGSA 3HMYA 1CJPA 2GMMA 5IK8A 2A6XA 2A6WA 2I2SA 3N7KA 4PF5A 4YG6A 1RINA 1LEMA 4FPHA 2D3RA 4XTMA 3UL2A 4P9YA 4BOWA 2ZABA 4YG0A 2GNMA 4TYSA 4P9XA 2WQZC 3SLIA 1DFQA 1BYHA 4D69A 4U2AA 3Q9OA 5HCFA 3BODA 4XDQA 1N1TA 1V6KA 1AX1A 3VKLA 2A75A 1AXZA 3WCSA 1W6MB 1W6QB 2DWRA 3SH4A 1MS9A 1SLTA 3AXEA 1LHOA 1N1VA 1MR5A 2D6OX 5DG2A 1V6NA 2UWBA 2ZHLA 5E8AA 5GJ6A 3B3QE 4YZ5A 4ISRA 3OYWB 1FNYA 2ZHKA 2D3PA 2DVGA 3POYA 1KJRA 2PHRA 4IQPA 3ZXKA 3RMYA 1IKQA 1O4YA 5GZGA 1S0EA 3ZSMA 4Q26A 1QMJA 1N3PA 1QU0A 3WDVA 2ZGRA 4FVVA 2P34A 1CR7A 3RMXA 2JE9A 3RS6A 3FLPA 2NM1A 3KM5A 1GSLA 4FPFA 4Y1ZA 2A6YA 2WJSA 4XBNA 1HKDA 3FUOA 4LBKA 3ZXEA 2DVDA 1SLBA 3A4UA 4XXPA 4Y1UA 5T5JA 4YW5A 1Q8PA 2E7TA 2Q5TA 4ZKTB 1A78A 1NXD1 5T5LA 5EXOA 3RSJA 3WDTA 3VKOA 3KQRA 3A0KA 3PVOA 2VY0A 3WVJA 3AK0A 1W6PB 1WW4A 1Q8SA 1FATA 1G9CA 2P2KA 2YROA 2WT2A 5JVVA 3OPZA 1LHVA 2PHUA 1LENA 4K21A 1BZWA 3I4IA 2EF6A 1LOEA 1LOFC 2D44A 3V0BB 4XJAA 3MW4A 1LOAA 4YZ2A 4Y26A 2AGSA 4FOYA 1V6IA 1IKPA 3I8TA 3AYDA 3VKNA 3ZYPA 2DU1A 1MS0A 5GLVA 1A3KA 4SLIA 1C57A 2CNAA 3M3OA 5T5OA 3FFZA 4CZSA 2W08A 3IMNA 4Y1XA 1URXA 1SCRA 3AZXA 3AP6A 1MS8A 3O5SA 1WD4A 3AYEA 4YZ1A 1VAMA 1GYKA 2JE7A 4NOTA 4XZPA 4AGGA 4FPGA 4M3CB 2A5ZA 4UW6A 4FOVA 4FP2A 3HR9A 3OY8A 3V0AA 3L2YA 4XIOA 4XTPA 1G86A 5JOXA 1CPMA 4HANA 1V00A 3WCRA 1MS4A 1G9DA 4UW4A 1LOBA 3RQ0A 4XJ9A 1QKQA 4YM0A 1GBGA 3WZ1A 2CL2A 2E51A 1WLCA 4BLJA 2ZACA 1CONA 4FPKA 3UJOA 2YMZA 1DQ1A 1ULGA 2E6VA 3R05A 1WUVA 2A7AA 4Q1PA 4XILA 1W6OA 1FAYA 2ZHMA 1ENQA 2PHTA 1LU2A 3AZWA 4YW1A 2EIGA 4AGVA 2OUHA 2G4IA 1W0PA 5GLTA 3OBTA 5DZGA 3WG2A 4DS0A 1GICA 1W6NA 4K20A 4YW4A 1LGBA 1LHNA 1NLSA 5H9PA 1Z0HA 3AP7A 2JKBA 4M01A 1V6JA 4YLZA 5DZFA 5E89A 1RIRA 4LBQB 1MACA 3O0WA 1KDMA 3IM0A 3LSEA 4YG3A 1MS5A 3N35A 3GALA 1WW6A 2GNTA 1C1LA 4FQZA 2OVUA 2CTVA 1GZ9A 1LTEA 4CTEA 4NO4A 5T52A 4DPNA 2GMPA 1LOCA 1ULCA 3WV6A 4RA0A 4PQ9A 1LEDA 1LGNA 3AXDA 3FLRA 2VU9A 1YRZA 1CESA 1Q56A 2DV9A 3MW2A 2WSVA 2OUJA 1APNA 1LOFA 1CQ9A 5DUUA 4YGDA 2WKKA 1S0DA 4FOWA 4GWMA 2VUAA 4R9BA 1WLWA 5T55A 1W6MA 2D6LX 3W58A 1AZDA 3MEPA 1W6QA 3VKMA 1FV3A 2ZGTA 4Y20B 4Y1VA 1UZYA 2R1DA 4LBLA 1B09A 3ILNA 1O4ZA 5H9QA 1LCLA 3PMEA 1SFYA 1CPNA 2ERFA 1JYIA 4YFZA 1LHUA 3OYWA 1IS6A 3C2UA 2P3KA 1S0CA 4XHXA 1DLLA 4P14A 5EWSA 2EALA 2P37A 4FOQA 5F5QA 1X50A 4FPJA 4P9WA 2GALA 2ZGKA 1FV2A 3WNXA 4M3CF 2A3WA 2D3SA 1GNZA 3M3EA 5LK5A 2DU0A 3SH5A 3V64A 3R4UA 2ZZJA 1Q8QA 3QCWA 3D4KA 4HL0A 4YM2A 1SCSA 4JC1A 4AYUA 4GALA 1BKZA 2GDFA 3WOGA 1S1AA 4XBQA 1JHNA 1DHKB 2YXSA 1AJOA 2ARBA 2ENRA 5GLUA 1MVEA 5JOZA 1SLIA 3LCPA 1LGCA 2AREA 2DTWA 2NYYA 3OGGA 2AENA 1GKBA 2D6KA 5DUWA 5GM0A 3WG3A 3AJYA 1HQWA 2WSUA 3ILFA 3ZXJA 1DQ5A 3UK9A 5GLZA 1GZWB 2NZ9A 3JUUA 4ITCA 1ENRA 1W6PA 1XQNA 3POSA 1ULEA 1LODA 1JBCA 3N7JA 4AGRA 4BPZA 1SLCA 1CIWA 4YM3A 1JOJA 1N3QA 1LU1A 1WD3A 3H0OA 4KBBA 1DGLA 1KRIA 2ZGLA 1UX6A 2ZGNA 5HCBA 3ILRA 1SLLA 1I1EA 4W65A 3V0BA 1IS4A 4I30A 1SBDA 2CWSA 5DG1A 5IK5A 4R9DA 1LECA 3T1MA 3B01A 3LSDA 1QDCA 1SBFA 1SACA 1H30A 3USUB 3WG1A 1AX2A 3SISA 3D5OA 3GNEA 5EYXA 2D6NA 3RRDA 1G9AA 1AXYA 3INAA 4JCKA 3ZXLA 5F9TA 2YV8A 3TAYA 3PJQA 4Q8KA 1Q8VA 2PHWA 1D2SA 4M3CA 3WDUA 3NV4A 3WDXA 4Z8BA 1UN1A 3AP9A 3SITA 1C4RA 3M1HA 3W59A 2EXJA 4F83A 3AZVA 4Y22B 4Q1RA 4YGEA 1D0HA 1DQ6A 4DRVA 4M00A 4XJZA 3O12A 1S0IA 4WV8A 4OZXA 4DQAA 2FMDA 1DZQA 1UKGA 2UURA 1ZA4A 4Y24A 5DUXA 1WLDA 3AFKA 4GKYA 2VW2A 2XB6C 4XOGA 4WVWA 4XJUA 5CAZA 1YI7A 1JYCA 1QNYA 3NV3A 3AP4A 4Q27A 1ONAA 1S0GA 1S0BA 1QOOA 2DUPA 4AWDA 5IK4A 5GZDA 3BIWE 4XMAA 4YGCA 3DUIA 4AVVA 1DBNA 3ATGA 5H9SA 2ES3A 4LBQA 4ATFA 4GXLA 5JDBA 4MYEA 1VLNA 1H9WA 1W0OA 4ISQA 1QOSA 1PZ8A 1AF9A 1N47A 1VALA 3VV1A 2C5DA 2W68A 5GZCA 2B7YA 1FYUA 2WLQA 1QNWA 3WLUA 1F9KA 2NMNA 4AVSA 3ZSKA 2YZ4A 2XG3A 1AXKA 1JN2P 3T2TA 2D6PA 2Z42A 3AZYA 1N1SA 3POWA 2AYHA 2NN8A 4XMIA 1BQPA 3ZVXA 1QDOA 1PZ9A 1RITA 3T1LA 2VW1A 3IPVB 1Z78A 4ZXKA 1ULDA 1OKQA 1F5FA 1MVQA 2A3XA 3O0XA 4PBPA 1KDKA 2CYFA 5JOWA 1U0AA 2SLIA 2AUYA 4FPEA 1G7YA 5DXDA 4FPYA 2E7QA 3BOPA 1ENSA 4XHBA 1G8WA 3ZPYA 3MW3A 2WNEA 4Y20A 5JMCA 2E53A 2EXHA 2ZGMA 3A0NA 4DFSA 2R1BA 4XYXA 4YW2A 3CNAA 4WVVA 2D43A 2P3JA 5T54A 2VXRA 3PVEA 1BJQA 3V65A 4C1WA 3SH3A 4BMBA 2ZMKA 4M3CE 3B00A 1AJKA 2C9AA 2ZAAA 3TB0A 1LESA 1WW5A 1YXWA 1ZM1A 2D6MA 3M3QA 2AR6A 3NV1A 1VIWB 3N7LA 4UW3A 2YY1A 1DYPA 4YFWA 1SLAA 2D7FA 3AYAA 1KQRA 4R9CA 3ZXFA 2R0HA 3FLTA 2DVAA 3B69A 1CN1A 2R16A 3AJZA 5IT6A 1S0FA 5GZEA
chains in the Genus database with same CATH superfamily
4KWJA 5F2WA 2GN7A 2NMOA 2XBO2 3LEGA 3ZSLA 2HYKA 4RL7A 2VMCA 1W9YA 3WUDA 2Q1MA 3MUY1 3RPQA 4FT8A 4LIVA 3HN3A 4CU8A 1ZBA2 2IVJA 5JOYA 3V56A 4B1LA 2J1AA 4AHZA 4AVTA 4RR3A 3NAPC 3OJBA 1RC6A 2R6QA 1PGSA 3LF7A 2LTNA 2XKPA 5C3RA 3UKNA 4JGZB 5H9RA 3TEXA 2K9ZA 2WT1A 1C1FA 3ZSEA 2FHRA 4LJHA 4LXLA 4B7EA 3MBWA 1I5ZA 3MIEA 1O91A 3H3ZA 4PT6A 1OOPB 2QVSB 4CUAA 1EPWA 3W21A 1WCSA 2F17A 5FZOA 3R4DB 4QXHA 2GH8A 2WO7A 4C1XA 1CZTA 1OHFA 4DZGA 1BK0A 4QPGA 5FZAA 1DLCA 4GH4A 4YGBA 4COWA 3KV6A 1SPPA 5A7PA 2ARCA 4MZUA 2EICA 2RM23 4RHV3 1KJLA 1TG7A 4YZ4A 3TOJA 4CDQB 4Y22A 2JDMA 3VBUC 1GANA 3MGUA 4MXWA 1UZZA 3IDBB 3CKHA 2VNOA 1CX4A 4Y33A 4P9LA 3OB8A 5I0TA 1K12A 2GU9A 2HWB1 4IEVA 5J98B 2W1QA 5D21A 2W1UA 1C3HA 2VBDA 3BN6A 3LPGA 5LBBA 2E9QA 4ARYA 4NWWA 3AKSA 1WCQA 1UWWA 1H4HA 5DMYA 1DQ2A 5FO9B 2W46A 2W3JA 5EYYA 1OPMA 1I9RA 1N1YA 1GLHA 4AQ2A 2ZX4A 4BQXA 2X10A 5JR2A 2RMU1 5JIAA 3OEAA 1DYOA 3RZLA 1FPN1 4CRQA 4DRRA 1LJ7A 3OD4A 1SFPA 4AHXA 1UMZA 5A33A 1POQA 1AR93 1COV1 5C4WB 4JGZC 3LE0A 2PQQA 1RUI1 2WT0A 1ZBE1 4CEWB 2JJ6A 1PM7A 1QJY1 4Q2FA 5SV8A 2HWB2 1PMHX 5FJKA 1JYTA 5GLWA 2OA2A 4NHLA 4COZA 2DBNA 5A7SA 1VRH1 2GP3A 2ZX3A 3PTRB 5APAA 4QQPA 1JU3A 4PCRA 4Y1YA 4LUMA 3LOIA 2C0ZA 5F5IA 1RTVA 4YM1A 5BNOB 1ZRRA 1LRHA 2WRAA 3U11A 4FQ4A 1O3QA 1G9BA 2XJRA 2V73A 1WBLA 2K2SA 2RMU2 2R30A 3MYXA 4K8FA 2FDKA 5IK7A 1UL9A 4PIXA 3KZ4C 3NQHA 1HB1A 4RS5B 5KXDA 4FI9A 4UXAA 5DZEA 3HN1A 4CDQC 1W6OB 3U14A 3WW1A 3THPA 1AYN1 4BIFA 1RUI2 3S5QA 1ZBE2 2JG9C 4IV1B 1Y7BA 2VUDA 1UPSA 3BCWA 3D6EA 4FPLA 4QGMA 1W6NB 5GZFA 4OUMA 3U4SA 4L99A 2HKXA 1STMA 3DGTA 2FQPA 4DXTA 4AL9A 3QLQA 1VRH2 4CP0A 4WM7B 1IS3A 2A6VA 3G7DA 4BISA 2WO2A 3T30A 1UYZA 4IXLA 3THCA 2OQ7A 1QQP1 1GU3A 1J3QA 2JECA 1C28A 3FWEA 3MPBA 1V70A 3ME2A 2OXBA 3OUJA 3ZOIA 4OMCA 4P5YA 2GMMA 3QH7A 1OSGA 1W9WA 2YDEA 3N7KA 4KG0A 4LKFA 4PF5A 4CXWA 5IK8A 4FPHA 1H8VA 1HQNA 2G1MA 2VECA 1UY1A 5C4WC 1D4M1 5AVPA 2WQZC 5JZGC 1T2XA 1REFA 1YJLA 3BODA 2VOTA 2VM9A 4AQ6A 1CZSA 4A6SA 1V6KA 1AX1A 3OUHA 2A75A 1AXZA 1UF2C 5A1AA 4URTA 1W6MB 1WMEA 2Q30A 4P5HA 1L3JA 3WW3A 1SLTA 1AR82 3AXEA 2VQAA 4OVEA 3DYOA 5FUIA 3M8LA 1KEXA 1M4WA 1QQP2 2UWBA 1CAVA 1XNCA 1QH7A 3ZFFC 4Z2WA 3IBMA 2B4KA 2Y6KA 4ISRA 2W91A 1SEFA 1TQ5A 2D3PA 5EQUA 3TN91 1NLQA 5IJRA 2Q0AA 1KJRA 2JIJA 3H50A 4IGQA 4E4HA 2PHRA 3WF2A 2ZOEB 3RMYA 1NCRC 5GZGA 4B29A 2XHKA 4LITA 3E6CC 1RXFA 4Q26A 3ZSMA 1VBB1 1FOD1 1D4M2 1A6CA 1JUHA 1Q3EA 2WNUA 5FP9A 2ZGRA 5FOJB 4LHLA 4GWIA 5B2GB 3RMXA 2JE9A 1GWMA 2TBVA 3KM5A 3RS6A 1GSLA 5A7WB 1JZ7A 5L7OA 2VTXA 2A6YA 2WJSA 4LULA 2XKOA 3GZTB 4WM7C 5LEJA 4XXPA 3A4UA 4TLGA 1NQJA 5T5JA 1NY71 2E7TA 2RDNA 2Z69A 1HXS1 1W99A 1AR63 1QJU3 1UZVA 3HNBM 3LFMA 1GOHA 3HQRA 4Q4V1 5T5LA 4JGYA 1C5HA 3RSJA 4UBHA 4LIUA 3GCXA 1PVXA 2OPKA 1W6PB 2RG4A 1WW4A 3P5BA 4JDNA 1G9CA 4QXKA 4E4ZA 1VBB2 1FOD2 3KV4A 2HLEA 1FT9A 1K5MA 5I0SA 3I4IA 2EF6A 1HJGA 1LOFC 2JX9A 3VDDA 1LOAA 4KH9A 4Y26A 3TBDA 3D0JA 4QD2A 4FOYA 3VKNA 3KF5A 1O3SA 2WS93 2XUMA 1A3KA 4IEOA 5F3GA 4NIAA 2W1SA 3OD0A 5T5OA 3VBRA 3FN9A 4CZSA 1J83A 1H8TB 1POV3 3IMNA 1HXS2 4Y1XA 4OCTA 4Q4V2 2W5FA 3ZFEB 4FPGA 4HBNA 3GDBA 3I3QA 2RJLA 2QJVA 2XWJB 4FOVA 4PJYA 4JZRA 3GBGA 5FLJA 4NIGA 3OTFA 3L2YA 4XTPA 5FPLA 1OKOA 1RHI2 2V09A 3LQCA 3WCRA 1MS4A 1W8OA 4Q0UA 3RQ0A 2JG8B 1QKQA 2XJQA 1GP5A 4CP9B 5IAVA 1ODMA 2GH2A 2Y38A 1ZZ7A 5FZ0A 2XVKA 3WZ1A 2E51A 2YBPA 2KXLA 4CCLA 2ZACA 1CONA 2HBTA 3H8OA 1DQ1A 4RN5A 4AXOA 1ULGA 2E6VA 1OMIA 1WUVA 5L9VA 2A7AA 4N43C 4Q0VA 4Q1PA 1FMD1 2QQOA 1NA1C 1XYOA 1FAYA 3AZWA 2PHTA 1LU2A 4LR4A 2G4IA 2JEMA 3PLQA 3WF3A 5A1LA 5HV4A 1CD3G 4QX0A 4HVRA 4I0BA 5JI7A 3KV9A 1NLSA 3JCIA 5H9PA 1E5RA 4CDWA 1V6JA 1MQTC 4Q4Y3 5E89A 1RIRA 1MACA 4COUA 3ETQA 1B35A 2XWBB 5IVFA 4JDMA 4MLOA 5K0UA 1J84A 1JI6A 3AKPA 5FZMA 1GR3A 2C24A 3GJBA 1W8HA 5F3EA 5A3LA 2VXJA 3GALA 5KHHA 1FI2A 2O8QA 3OGRA 4CCOA 4FAGA 1ST8A 3OPTA 4FQZA 5FZBA 5ACA1 1VBA2 1ALYA 1ULCA 2WR9A 3WV6A 2JWPA 4BQYA 1LEDA 3TNPB 3ZMOA 4MGKE 1W03A 3FLRA 3PNAA 1FMD2 1H8TC 2VU9A 1YRZA 4LE3A 3VD7A 1Q56A 5FPBA 2MEV3 4QQOA 5JXIA 3I59A 2YC2A 1C8M2 2BWAA 3VD5A 5T3NA 4GWMA 1UXZA 1H6YA 2VUAA 4R9BA 3HVDA 2VAUA 1AZDA 3CBNA 5TSWA 3NNLA 3SCFA 1J58A 2OZ6A 4Y20B 1OQDA 1UOJA 5BPXA 2JG8C 2WUHA 4DMIA 1O4ZA 3PMEA 5ACA2 4GMP0 4OI1A 1V9U3 1DZTA 5EWSA 2P37A 4CP1A 5LA1A 1QXPA 1X50A 4P9WA 4RQPA 3ZYIB 1GNZA 3M3EA 5LBFA 4MV2A 4QU2A 3R4UA 3V64A 1GQHA 1Q8QA 4K8RB 4LNVA 3VBSB 4K3UA 1O8SA 3D4KA 3KGZA 4Q0PA 3ZN4A 1BKZA 1RUD1 3WOGA 4IW3A 5JSOA 4XBQA 3TEZA 1LNSA 5CEHA 5BNQA 5C3QA 1RUJ1 4MVTA 5DAWA 3PJYA 3OGGA 1ZZCA 5FZLA 3S5AA 2VZOA 1GKBA 2D6KA 4K9SA 5IVVA 5FLHA 3T0DA 3ILFA 3UK9A 1QXJA 1XC6A 1GZWB 3DXUA 2QCSB 3J7LA 1E57A 1ENRA 2R061 2EIEA 2WWSA 3JUUA 3LDBA 4ITCA 4BE3A 1ND2A 1JBCA 5AC91 3CMGA 3GZAA 2QQPA 1RUG3 3JB4C 4RSUA 5FXZA 4IEQA 4KBBA 1HRI1 4NMIA 1KRIA 2ZGLA 1R1A1 3KD4A 3VHOA 3V0BA 1SLLA 2NLRA 1O3TA 4CCKA 1RL3A 4JHZA 1RUD2 1RUE2 2CWSA 2R043 5IK5A 2B5HA 2OT7A 2EA7A 4KL1A 2XJTA 3RDIA 4NPRA 5C5TA 5CFDC 3SISA 3GNEA 2CGPA 3EB7A 4LO5B 2IUWA 3WNLA 2WQ4A 3TAYA 2BZDA 1CAWA 1OUSA 4GIQA 3LEKA 5A6ZA 5FYZA 4Q29A 3FJSA 2BBVA 2CHHA 1RYYA 2PHWA 4W6WA 1J3PA 5DAQA 2NQYA 2PLV1 2R062 3NV4A 3WDXA 4YVSC 4MXVA 5I93A 1OA2A 4BH9A 1VBD2 1RUH1 3K3OA 1U5XA 2EXJA 3Q8BA 3TRSB 1QIQA 4Q1RA 1OH3A 1RUC3 4YGEA 4B4RA 1HRI2 4IE6A 1R1A2 5ABJA 4EZHA 4BCUA 1BBT2 2FMDA 4CEYA 2E32A 2XLGA 4Y24A 1WLDA 5FP4A 5C8CA 3VHNA 5FPZA 4OQ8A 2XB6C 4XOGA 3F2ZA 5KR7A 2AACA 4FTSA 3DYMA 1XBFA 2QZ2A 1UYYA 4YNIA 2VCAA 3VZNA 1PIV1 1RMU1 3NV3A 4BIOA 4YYOA 1K45A 3JXSA 1ONAA 2ZEYA 2BRTA 1S0BA 1QOOA 2DUPA 2VUCA 1W8FA 3CDZB 1XJAA 4YGCA 2PLV2 3ZYBA 1IG3A 3WQBA 3CIHA 3HWJA 3FBMA 1VBE1 2BGOA 3RZJA 1QOSA 1PZ8A 3LWCA 1AF9A 5EPAA 4N7IA 2W68A 4ES8A 1ASJ1 4AI8A 2X29A 3DXTA 2OPWA 4E27A 4DXRA 4N53B 5D8AC 3ZXAC 2NMNA 3IAPA 2X05A 3VDAA 2MPFA 4P00B 4QGLA 2D6PA 2VZPA 2LW8A 3T2TA 3POWA 2B46X 1J1LA 1EUTA 1W8WA 2QQJA 3GBFA 4XMIA 2A1XA 4HOOA 4MO3M 1IQAA 2WA3A 1QDOA 2V4VA 1PZ9A 3KQ4B 3ZVXA 1PIV2 1RMU2 5CFCB 5KHIA 1OKQA 1O7FA 5FDBA 4AR2A 2RR11 1SDWA 5BNPA 1W28A 1FPN3 1QY4A 4IE5A 4OI0A 2ADEA 3FMGA 1DG6A 4FPYA 3LDKA 3SCHA 5JXGA 1VBE2 1G8WA 4LHSA 1NCQC 5A3WA 3MW3A 2WNEA 4H7LA 4YW6A 4DY5A 1COV3 3CJIA 2ZGMA 3A0NA 1F15A 1XU1A 3CLPA 4LKEA 3VBFA 5KWRA 4XF0A 5C3SA 1QJY3 2P3JA 3I2KA 2VXRA 3PVEA 1BJQA 5LA9A 5IYYA 2DCZA 4M0NA 3DPRA 1JZ6A 4K6BA 2VQ0A 1AJKA 3U78A 3D0SA 4YPJA 3C3VA 1KS5A 1YWKA 3WNKA 5JPNB 3ZIWA 5FYIA 3TEWA 1YLLA 4QHZA 1DYPA 4YFWA 2HWF3 3S0MA 2RR12 3GBWA 4XDOA 4R9CA 5CYYA 3VBOB 3ZXFA 5BXXA 2XPJA 2WABA 2LS6A 3B69A 3AJZA 1S0FA 2W0XA 4NHMA 1U12A 2AH2A 3OBRA 4LBJA 2VULA 1MPXA 1JMUB 2F4PA 3BB6A 4FPOB 1CAUB 3T09A 2RS51 2UWAA 1IPSA 1AYN3 2LALA 3D3AA 4ASLA 2IXCA 4GWNA 1JZ3A 2EXKA 5I91A 2A6ZA 2GNDA 2Z2SB 1QHDA 2EXIA 2V4AA 4K1ZA 4HZFA 1V6OA 4QPYA 3WT3A 3RYPA 4DEVA 4HKLA 2ARAA 1DF0A 1V6LA 3LAGA 3VL9A 5CFCC 2B42B 5LASA 3CEWA 2PFWA 2TEPA 3ZR6A 2A71A 3IZOA 2KA3A 1JW6A 4EE2A 1ND3A 1W8TA 3NV2A 4NHYA 1U5IA 2E33A 1DIWA 2WNOA 4WM8A 2AC1A 4QPIC 2UY9A 2YHJA 3NKGA 2J1EA 1C8NA 5FRAA 1RUF2 1GP6A 4ZZ5A 4PIYA 4D7SA 5A70A 2P4EA 1GZCA 2UU8A 5FYSA 2JENA 4GKXA 2VW0A 2RS52 2RDRA 3M2MA 4IESA 5CU1A 3N7MA 4JTOA 5GALA 4AI2A 2ZGOA 4PLNA 3JBG1 1DQ0A 1DGWX 2JB8A 1UD1A 2ZS6B 5CISA 4WZFA 3AX4A 3ACGA 1QGLA 2DTYA 3RZKA 3LOBA 4QM9A 2Z4FA 1T6BX 2R0FA 3WG4A 2OW4A 4QT6A 1UX7A 3M70A 4J6GA 2DCKA 5CNAA 3VBOC 4BQ1A 3TN93 3HOBA 4PDWC 4YVWB 1TEIA 4A7ZA 5FZ4A 1R091 4N8MA 5C8WA 1NOVA 2SBAA 5FZ6A 5JLVA 3I49A 1J3RA 1EUUA 4HPKA 1LAJA 4XAAA 5FZGA 4HLTA 3RG0A 1UIKA 1SBEA 3A21A 3U1XA 4CDXA 4NIDA 4FPCA 3N9NA 4BB3A 4MGSA 4ZY9A 4OUSA 2W52A 2RV9A 2Y33A 1UY0A 3NJYA 1GV9A 3MPPG 2CY6A 3IIIA 3B93A 1UYXA 3ZM8A 3H7JA 3UNPA 3S7IA 1IS5A 4QXBA 3PUIA 2NP0A 2DURA 4KGQA 4LE4A 4XVHA 1YO8A 4CDUC 3T0AA 1SG3A 4EN6B 1GQPA 3NNGA 1W04A 2ID4A 4J1WA 3NWKA 5E88A 4AQSA 4CP2A 2W87A 2JD9A 4XCBA 4OMDA 1LULA 2G9GA 3I3EA 3JU9A 1KITA 1EPZA 3DEMA 3NAPA 4B8EA 3I97A 3IAQA 1TNRA 2EAKA 1H0BA 1LHWA 4RGKA 4L9BA 4AEDC 3PVNA 1UNBA 3WUCA 5M0TA 2KM2A 3IPVA 4MGTA 4YSFA 3B9CA 3N9PA 3O1TA 3VDCA 3WINE 2ZBJA 3BUCA 2ATFA 4WVMA 1TE1B 1NG0A 4ZPIA 1ZRCA 1F31A 1QF3A 2YFZA 4FXGB 1JOPA 2FCUA 2P3IA 3LIHA 2J1TA 2CWMA 1OFNA 4IE7A 4QX1A 5CKQA 1U5YA 3RYRA 3WW2A 4LEJA 5I0RA 1LKNA 2J1UA 1FXZA 5FIXA 1AR73 3M3CA 4UFHA 3ES1A 2FBEA 1LOGA 3RZHA 4Y5Z0 4NRPA 5A3MA 4XFGA 1DP0A 2VMEA 1CZVA 4ZU4A 1CAXA 1ULPA 4FO9A 4WZCA 4XUPA 1RGSA 5E6HA 1HLCA 1SFNA 4DIQA 4IEUA 3ACHA 3C7FA 4FFIA 4NRQA 5CA6A 3LIGA 4HVQA 1ULFA 2W39A 3FHQA 5BY5A 3AYCA 1OF4A 4UW5A 4XE9A 5IUQA 4SBVA 1MEC2 4LO4B 1S0JA 3S30A 5BNNB 2R072 4URAA 5JCTA 1IOAA 2Y6GA 2ET1A 1H2MA 3VBUB 2YGMA 3FUQA 3MV11 3HMYA 4INDA 4EWEA 1YQCA 3OOXA 1JZ4A 5F5AA 3RZGA 2A6XA 2I2SA 2JDYA 2RS13 4YG6A 4AFDA 1QJX1 1LR5A 2D3RA 2IVIB 1PK6B 4Q4W1 4YG0A 2HJIA 5F39A 3O14A 4BQ4A 1DFQA 3FZ3A 4D69A 3Q9OA 2HWC1 1HW5A 2CV6A 4XDQA 3WNNA 1N1TA 4QAWA 5FKCA 1WKYA 3VKLA 4CUCA 4EJRA 4TTGA 1M06G 1CWPA 4CE8A 3WCSA 4MG2A 1NKGA 1GMMA 2BOIA 3FHIB 4M4RA 1RJ7A 1VP6A 3IMMA 1MS9A 1D2QA 3ACIA 5F6LB 1LHOA 4Z2AA 2LRPA 4IEZA 3AVRA 4NIIA 1V6NA 2VD7A 5BV6A 4JGZA 3LFIA 2ZHLA 1HN0A 5GJ6A 5IVCA 3BKZA 3ZYGA 4Q4X1 4CSWA 4DO0A 3OYWB 4FTEA 2JE8A 1RUOA 3KT7A 5HV0A 1ZZ8A 4IQPA 4OFGA 1O4YA 1OOPA 1QJX2 5FYYA 4Q4W2 5LW9A 2PAMA 1QU0A 5CKMA 3USSA 3WQ1A 4UWDA 5J37A 1W3VA 4FVVA 1AL23 2HWC2 2P34A 4XETA 2JDUA 3K4ZA 3F95A 3T0BA 4QB1A 2W1WA 2DFCA 4XBNA 1HV1A 2JDKA 2VNVA 4IE4A 3FE5A 4NAOA 2ZAHA 1ZNPA 2WN3A 4KU8A 5G04L 3UYJA 5IVJA 4CDQA 5ERLA 2ZEXA 1A78A 4LMFA 4ONUA 3C7HA 1NXD1 4CUBA 1NAEA 4PHZA 5EXOA 4Q4X2 5F3IA 4AEMA 5BNNC 4IL7A 4XEZA 3KQRA 3A0KA 3J7NA 2C6SA 3LEMA 3PVOA 5FK8A 5FUNA 3WVJA 1KGYA 4BHPA 1JHJA 1Q8SA 5LRRA 3ZYFA 2JG9B 1S55A 5FCCA 5FKBA 4MGZE 1PK6C 3B9IA 4KMQA 3RVHA 1LENA 4K21A 1X8MA 4EN8B 1UO9A 3H7YA 4Q0QA 3NNFA 2Y8KA 3MW4A 4YZ2A 2DCJA 1JYVA 4LUKA 2P1BA 4OQ9A 1WWYA 3ZYPA 1CGPA 3DV8A 3GJAA 4DXSA 2G9FA 2TNFA 1RUJ3 1C57A 1OC1A 3M3OA 4Y5TA 5L9BA 3SQOA 4KGGA 1H2KA 5LBCA 4CPBA 4KQ7A 1OXCA 1D4VB 2XR4A 1URXA 5C4WA 3KGLA 3AP6A 2JICA 2CDOA 4CEWA 3AYEA 2VVDA 5DAXA 1GYKA 2JE7A 4XZPA 1RUNA 2RS33 4M3CB 1R64A 4FP2A 3RFRA 5AC93 2XJUA 2VOKA 1KS4A 5JZGB 5JOXA 1G86A 1YJKA 3L2HA 2AEZA 2XLAA 2VZSA 2YFUA 1PMJX 2YPDA 4XJ9A 5BNOA 3KWVA 2PA7A 1HIXA 4YM0A 1PM4A 1AUYA 5FPVA 3MIGA 3WX5A 3E5XA 4BLJA 4AK3A 4FPKA 3KVAA 2YMZA 2ZZQA 3K3NA 3D82A 4RS5A 3ZFFB 1VB2A 3PDQA 5KC5A 4XILA 1W6OA 2VGDA 2ZHMA 2CDPA 4RR3C 4YW1A 4AGVA 1UKRA 3N4MA 3WG2A 5GLTA 1XOYA 4IV1A 1PNFA 5DZGA 1NCRB 1W6NA 2FD8A 1LHNA 4HG6B 4M01A 5DZFA 2J42A 4LK6A 4YLZA 4LBQB 3I54A 3PIJA 1RUH3 2BUKA 1ENXA 1Z7S2 4WM7A 5J09A 3IM0A 1YQ6A 4L92A 1TMF3 5FMOL 4YG3A 1X7NA 2VQUA 5A7QA 4RGAA 3UETA 1YUDA 3KT1A 1Y43B 1BEV1 4I3PA 3VD3A 1WW6A 3UGGA 3WNPA 4E9KA 1UCXA 1AR81 1GZ9A 1VAKA 3PMSA 4NO4A 3NL1A 4CTEA 2QZ3A 1W3XA 3NJXA 1LOCA 5L9RA 5IAXA 5AFEA 5A3TA 5EJZB 1O6UA 3P3NA 4JTNA 4X8PA 5F8PA 3AXDA 3MFAA 4HT1T 3T4HB 4GH4C 1VJ2A 3W5NA 1VBC1 3BIEA 5A1FA 3KSCA 2OS2A 2ZXQA 3PU8A 3I3BA 2OUJA 3M7AA 3HT2A 1LOFA 1CQ9A 4HKWA 4NPLA 5LCWL 4LTAA 2YB7A 4TLFA 2WNVB 1W6MA 2D6LX 1VBE3 4FTBA 2ZX1A 2WZR1 3OF1A 1O4TA 4IUGA 3ZKYA 2VJXA 2ZEZA 2QQLA 2XQRA 1ASJ3 3ILNA 3ZPOA 1BEV2 5EIYB 5GKAC 3W20A 2HWE1 1LCLA 1PMIA 2Q8CA 2F6BA 4YFZA 3J4UH 4D7YA 1LHUA 3T2OA 3C2UA 3WP5A 1S0CA 5JMOA 5FTTC 3AVSA 2EALA 4FOQA 3QD6A 2PMWB 2GALA 3AMMA 2ZGKA 2VMHA 3IDAA 3U10A 1XE8A 4M3CF 2A3WA 1QJZA 1VBC2 4HK9A 1HX6A 3WNXA 3E5QA 2HWD1 4QMAA 4EN0A 2BVVA 5EHDA 5EP9A 3H8UA 5A7WA 4W50A 4Z1VA 3AMNA 4C8DA 1RVF1 1O8PA 3BPSA 1XB9A 1HB2A 5FXWA 3ZN6B 2PHLA 1JHNA 2WZR2 2E7AA 2E26A 2VMGA 4A44A 2YXSA 4IDZA 5FZ7A 2GZWA 1WMFA 5GLUA 3ZLIA 3KCCA 4IE0A 5JOZA 1UOFA 3LCPA 2NYYA 2DTWA 2HWE2 2WO1A 3AJYA 2WSUA 3FX3A 3T3YA 1U5ZA 3DL3A 3HNYM 4N43B 5GLZA 4W6YA 1NA1B 3DYPA 1W6PA 1NZCA 1ULEA 3N7JA 4AGRA 2YGLA 1HRV1 1X36A 4LKSA 1CIWA 1RXGA 3GZEA 2YBKA 1NXMA 3AB0A 2HWD2 3VB9A 1ZX5A 1MQTB 2ZGNA 2WINB 1UU4A 2YBSA 4W65A 1RHI1 5ANNA 1GOFA 2E63A 2F4LA 2WNVC 1RVF2 2ETEA 4OHXA 5IHRA 1LECA 2WFF3 3VBHB 2QQNA 3MO4A 1SBFA 1SACA 1H30A 3USUB 3WG1A 5EYXA 3RRDA 1H8TA 2IFRA 3HQXA 3POGA 1WLTA 3RGBA 4JCKA 3ZXLA 5F9TA 1TME3 4P08A 3IWZA 4KG8A 5F32A 2YC4A 4MUVA 3ZFEA 4UOJA 5J96B 3UKVA 3SITA 2D93A 4DB5A 2Q8OA 1HRV2 2FZ1A 4Y4RA 4HK8A 1MZFA 3PL0A 2PYTA 2XDVA 4ARXA 1D7PM 2JG8A 1YCIA 1PO23 1S0IA 1R081 4CP9A 4J25A 3MICA 3OPWA 3RI8A 1TZOA 4AF9A 1UQXA 2IFWA 4AHYA 3POJA 5F2SA 4WVWA 1SHWB 3VZLA 4IEWA 1VBA1 4YRDA 4BDVB 2WBKA 4E2QA 3AC0A 1QNYA 4JKLA 3DECA 3JBG3 4BJ0A 4MGYE 2X8KA 1WCUA 3CO2A 1PO11 1S0GA 2R7EB 2P6HA 4IEPA 3S57A 5GZDA 4A7YA 3C7GA 3DUIA 4B4PA 1DBNA 1V0AA 3ATGA 3LA7A 2I45A 1SDDB 2YUEA 4XPVA 3HEIA 1C8M1 2VNRA 3GZUC 4MYEA 1D0GA 3E6BA 1NQDA 3KT4A 3OCPA 4XZUG 4EN7B 5GZCA 1ZREA 4MHUA 2DCYA 3BU7A 1R082 3WLUA 1PGW1 4Y4YA 4CYDA 4J1XA 5IVYA 1R093 5LK7B 1US3A 2WNUC 3VBHC 2BJSA 3CHXA 1F35A 5LA2A 2NN8A 4V2VA 4QX2A 4C0HA 2HYXA 2IXJA 4JVAA 2YU2A 2ZJCA 4NVPA 5FZDA 5AFBA 5HI0A 1Z78A 3WP3A 2BU9A 5DDJ2 1ULDA 1PO12 1F5FA 1MVQA 2BFUS 3O0XA 4PLOA 4V1PA 1U0AA 4D0QA 4GB33 5J36A 1G7YA 3KS7A 4DY3A 1WZXA 1Y4WA 3B02A 4XHBA 4E8CA 1W2OA 4Y20A 2OYZA 2EXHA 5JMCA 2FDGA 2XHNA 3E97A 4KWUA 2WA4A 5FYMA 4XYXA 4OLLA 1PGW2 2PTMA 3CNAA 3KCXA 4IETA 1JZ5A 2D43A 1AYM2 4IEYA 5FP8A 5IVEA 5CFDB 3GGLA 2LROA 2XGXA 5FP7A 1UU6A 3CZUA 2ZMKA 4BMBA 4MSVA 4M3CE 4KWKA 2C9AA 2XJPA 3EO6A 3TB0A 1LESA 1WW5A 2D6MA 1ZM1A 2XUEA 3M3QA 5LB6A 1OD3A 4OYUA 3E1F1 3U75A 4TWTA 5EFUA 1VIWB 5A6YA 3VBSA 1SLAA 4YVSB 3JD73 2QQIA 1ULOA 1IPKA 3VBRC 1O5LA 2R0HA 3WP4A 3FLTA 4UF0B 2BFUL 3HD8B 4UFKA 3H8XA 4JRLA 5IT6A 3I2HA 5AVAA 1PX4A 3J7MA 4A3ZA 4XBLA 4AEJA 1RUE1 3ZYHA 2BQPA 3THTA 4L8QA 2H0BA 2ZKNA 4PQQA 2ZMNA 2XBO3 5FP3A 2BNNA 5E1RA 2VNGA 3QOPA 5FYVA 1GZWA 5B4XA 4ASKA 2ZEWA 3RWKX 5FXXA 3B7MA 5FZ9A 1ZBA3 1ZYBA 3BOWA 1YYNA 2BV4A 3I3MA 1UW8A 3WDWA 1VBD1 1EV11 2VOXA 2P6CA 4NHKA 1FNZA 3SNMA 5J48A 4XACA 5FY9A 1OA3A 2VZ3A 2YPJA 4N7UA 4D6QA 4GMP3 1BBT1 4ASMB 1O59A 2BDRA 5D8AB 2ET7A 4EQVA 4LORA 2X5IB 4RGGA 5FMBA 4CDWC 5A6XA 2VMIA 4LBMA 2FDHA 1TNFA 2WC2A 2QQUA 3ACFA 4AHWA 1PVC1 2RM22 5C3OA 4YZ3A 1MS3A 1PZ7A 2ZGPA 2QQVA 1HQLA 2A73B 2OZJA 3HT1A 4IGPA 1AVBA 1XNDA 4QDSA 4D7TA 5HXMA 4FXKB 4Q8LA 3O1UA 2GC2A 1NT0A 2GC3A 3QH6A 3ZFGC 4QHOA 4XFFA 1YHFA 1MS1A 4Q0SA 4K40A 1NX9A 1IPJA 5CVRA 3ACLA 3WHTA 3HBZA 3BTAA 4Q4X3 3O1SA 1EV12 1NCQB 4UFLA 4UFJA 4XUQA 3AP5A 2I07B 4G3YC 3I2DA 3THDA 2G9ZA 2BWCA 4BQWA 5LBEA 3MLLA 2Y26A 1CJDA 4NJ4A 5JUVA 4DXZA 3CL1A 5KXBA 2ZMLA 3LA3A 2IXKA 1FX5A 2JD4A 2VH9A 5FOBB 1PVC2 2ILMA 2RHPA 1NZIA 5DPNA 5IVBA 2BNMA 3KLSA 1BXHA 2V5YA 3AKQA 3OGJA 4LBOA 3P1IA 2WWJA 2WAOA 1GZTA 3MUZ1 2FDIA 4EN9B 3I2OA 3MIDA 3PVBB 4V2WA 4AG4A 2R49A 2BOJA 4RFRB 1OFSA 2A70A 1X9PA 3ES4A 3CU7A 2WYFA 4GJZA 5EJ3A 2PELA 4UT5A 2ZA9A 4N53A 4ET7A 5L73A 4RQPC 2VUJA 3APBA 3K46A 4LQRA 3PUAA 5JXJA 1W39A 2P3YA 3SCGA 4AFBA 3ECQA 3OY8B 3ZO0B 5A3PA 3V0AB 2FZ2A 2PHXA 2HWB3 1JUIA 2X5IC 1DGRN 5CFCA 4JX0A 1BLZA 3WNMA 4BQ3A 3U0ZA 4QX8A 4A2UA 2UWCA 2Y6LA 3SEPA 4CA9A 1UOBA 5CADA 1WBFA 3K2OA 4JQRA 1S2BA 1MZ5A 2QUOA 2DVFA 5LY2A 2RMU3 2D5HA 3DCQA 3G6JB 2C9KA 3JB8A 4ORFA 1Q8OA 4QPIB 4XFCA 5FV3A 4I2OA 2XJSA 3UJQA 4AQTA 4H14A 5FREA 1R1ZA 1PNGA 4XAEA 3N9LA 1WA4A 4QB2A 4MOAA 3WNOA 2Q1ZB 4XQ4A 4CU9A 1RUI3 1ZA7A 1ZBE3 4YW3A 5FPAA 2DDUA 4CXYA 2VR4A 1N3OA 4K1YA 4TXWA 3SXWA 5KXEA 4JKMA 3K4DA 1UAIA 2ADDA 1F2NA 2G19A 1VRH3 4L0PA 2ZX0A 4R8HA 5ISLA 1JXNA 4ZU7A 4IGOA 1VR3A 5FQ0B 3VBOA 5F6KA 4HXCA 5A32B 2ZGSA 5F3CA 1VPHA 1W2NA 2NPIA 3JQXA 4M0HA 4QKNA 5IATA 2QBXA 3HIFA 4XTMA 1CAUA 2MHFA 4NROA 1OVPA 2ZABA 4PDWB 1L7RA 2GNMA 1RUF1 3WSOA 2X53S 4OHWA 3RYKA 3SLIA 5C9AB 4U2AA 4UBGA 5HCFA 4A3XA 1H1IA 4CCCA 1OVSA 2ZKLA 2LM3A 5ABJC 2D40A 2IC1A 1W6QB 1AR61 1QJU1 2VZRA 3GHMA 4CEYC 5JAXA 2N7GA 3IDCB 1UXXX 3NVCA 1W90A 2WQ8A 3OG2A 1N1VA 1MR5A 2BYVE 3NSTA 1BEV3 4NRMA 3K4AA 2H6BA 1AR83 4S2HA 4CVUA 1FNYA 2ZHKA 4E4SA 4CDUB 1QQP3 2HH9A 3VDBA 3VHRA 5JR7B 1IKQA 2DCTA 1JS9A 4HN0A 1NLRA 1QMJA 1VBC3 2VO5A 4D3WA 4GD4A 5K4LA 3WDVA 3KB5A 4XF9A 5FZ1A 2Z5WA 3POEA 5FMCA 1CR7A 5FO7B 5KBFA 3FLPA 2NM1A 1RJ8A 3ZMNA 4HKOA 2Y64A 3GF6A 1D4M3 4QPWA 5K9YA 2O1QA 1POV1 3FUOA 4AEDB 1MZEA 3WF0A 5C33A 1QJU2 1AR62 1YEWA 1SLBA 2VMDA 4Y1UA 5HPOA 2Q5TA 1QEXA 2Q8EA 2J1VA 3FFQA 5SV5A 4CXXA 3WDTA 4AEKA 5IFPA 3VKOA 4YVWA 3Q8AA 4UI9L 5B4NA 1KXGA 2RE9A 3O7OA 3JQWA 2P2KA 2YROA 2WZ8A 3MF9A 2WT2A 4QGNA 5FJHA 5JVVA 1LHVA 5FY1A 5BNPC 2PHUA 1BZWA 2C1FA 3N9OA 5C9AC 1DGRA 1LOEA 2WS92 2D44A 3O1MA 3VD9A 2YU1A 3OBAA 1VBB3 1FOD3 1XRUA 2AGSA 4MHRA 1W9SA 1E5SA 1RVF3 1V6IA 1IKPA 3AYDA 4YWAA 2DU1A 1MS0A 1KD7A 1JYWA 4SLIA 4PIZA 4P02B 1CX1A 1H1AA 2CNAA 2Y34A 1X33A 5JIUA 2W08A 3DPRC 3HBKA 2UYBA 3AZXA 4NR1A 3RJ2X 3VZMA 4EROA 1MS8A 3O5SA 1WD4A 4YZ1A 4NOTA 4QDQA 1XSQA 3BYWA 1HXS3 3P3PA 4B1MA 2A5ZA 2RJ2A 1HB3A 4LO7A 4Q4V3 4XIOA 2VBBA 3J8F1 2BW8A 1CPMA 1F5JA 4HANA 1V00A 2DBIA 1LOBA 3PUQA 5G05L 4CUGA 5ANQA 1RHI3 3KMHA 3NMBA 4XQWA 3H8RA 1GBGA 1BMV1 1WLCA 1I5PA 2Q8DA 3K48A 3UJOA 1MEC1 3DKWA 5L36A 3R05A 4QQ2A 5EV7A 4CCNA 2R071 3VD4A 3AMQA 5FPXA 3EXUA 3SKVA 4Q4Y2 3T2PA 3B94A 1GICA 4K20A 2H6CA 1LGBA 3EMRA 5A3UA 3GCWA 1UZWA 1Z0HA 3AP7A 4IV3B 4AE2A 1ND3C 4RFT0 3J8F2 4WM8C 5D2AA 2O0OA 2RVAA 2VC9A 1V9U1 4LA2A 4PI0A 3ORJA 1R083 4BQ2A 2JXAA 1C1LA 5FK7A 2Q4SA 4DPNA 5BNNA 1NUKA 4LLFA 1BMV2 1E5HA 4ZU5A 5FR3A 1XU2A 3VBUA 3WQ7A 4YW7A 3ZFGB 4RA0A 4D6SA 1JZ2A 4FFGA 1LGNA 1VBA3 5DAPA 1W2TA 1PK6A 1CESA 2WWUA 2DV9A 2YG0A 3I3DA 5DQ0A 2QTWB 2WSVA 3PHMA 1I6XA 1W9FA 4QDRA 3MV01 4LPLA 4CU6A 1YQ2A 4QHBA 1FMD3 5DUUA 4NWVA 4YGDA 2WKKA 1O3RA 4FOWA 3QACA 5FZCA 4XDPA 1WLWA 5T55A 3W58A 1C8M3 2WN2A 3MEPA 1VE0A 3B5LB 3VKMA 4A4AA 2EAAA 2ZGTA 2VZUA 2R1DA 1V9U2 1OLRA 1B09A 4QWNA 5FY4A 3C8XA 4ZXEA 3S6PA 3ZDVA 5H9QA 4D6RA 1CPNA 1GP4A 1YC61 5F37A 2VTXJ 3OYWA 5JXHA 3DKQA 1YI9A 1RUG1 2TUNA 2P3KA 2E31A 3H3LA 5FZ3A 1EYBA 4CDXC 4I01A 3URFA 5ACA3 4JKKA 3IIAA 1FV2A 2D3SA 5LK5A 2GP5A 2DU0A 3SH5A 2J7MA 1OD5A 2R041 4GJYA 4OI4A 4HMZA 3QCWA 4HL0A 4D94A 4L97A 3EYPA 4MX3A 1IG0A 1OF3A 4GALA 4AYUA 1IQDC 4IV3C 2L9LA 3J9SA 4Q5OA 2W94A 1S1AA 4OHYA 1OT5A 2AEYA 1DHKB 3HQUA 4UFMA 4N9IA 2ARBA 2ENRA 3O1VA 1MVEA 1Q5OA 4S2GA 4X8NA 3WR0A 1GOGA 1LGCA 2AENA 4H2AA 4FFHA 4HFSA 4JHTA 2FCVA 3CJXA 1HQWA 1W8ZA 3ZYJB 4LO6B 1DQ5A 2GC0A 1RUG2 2NZ9A 3AM2A 2XMLA 1RUC1 4LOSA 4O9EA 3C7OA 1DU3D 1XQNA 3M3IA 3POSA 4RR3B 1LODA 1P8JA 4XF4A 3TEYA 2JG9A 2XXZA 3ITQA 1IGOA 4QX5A 1WD3A 2V72A 1QH6A 2K46A 4W6XA 5JPMB 1K3IA 2R042 1F4HA 4XQDA 5LEKA 5HCBA 3ILRA 1I1EA 1K5JA 2QDNA 4I30A 2JDAA 1OQEA 2H0VA 3Q8CA 5DG1A 4R9DA 3MIHA 3OGVA 3AMPA 2EIDA 3AKRA 5FZOB 1OH4A 1RUD3 1ZRDA 2D6NA 1RUE3 2VBPA 4GQ7A 1AXYA 3TYJA 5C7GA 1W2UA 3PJQA 4Q8KA 5JSPA 1Q43A 1Q8VA 2JB4A 3WQ0A 4QPGB 2Y0IA 3NW4A 4GH4B 4M3CA 5CZKA 1RUC2 3VZJA 3WF1A 1AL0G 4Z8BA 1SPPB 2P5BA 4I0AA 5A3OA 1C4RA 3U07A 4TSVA 5JZGA 3T2QA 4F83A 4QX3A 2R063 4Y22B 1H1MA 4G9SB 1DQ6A 2GSYA 4M00A 4MXWB 3O12A 4XJZA 5FMOS 5FYHA 1VBD3 3M4FA 1EV13 3X29B 4DQAA 1Z7S1 2PXJA 4AFCA 1HRI3 1NYWA 4DUVA 1R1A3 2XONA 3ZR5A 3ZFFA 1BBT3 4OZOA 1W2AX 4XJUA 4XW3A 5CAZA 2IZWA 1YI7A 4NPMA 2Y0OA 4Z82A 2DFBA 4JAAA 1GWKA 5FYBA 4CCJA 1PVC3 4AWDA 1NCRA 1H6XA 1QXRA 4XMAA 2LUWA 1GQGA 2PHDA 4AVVA 5H9SA 2ES3A 4N90A 1OA4A 3BALA 4LBQA 4ATFA 4DEQA 4GXLA 1YQ5A 1VLNA 1H9WA 2PLV3 1EAH1 1N47A 3VV1A 5A33B 2C5DA 4YARA 3FL7A 1UYPA 2QNKA 1OOPC 4GZ9A 3BU0A 4HN1A 1VMJA 2FDJA 2YZ4A 3BTXA 4UYBA 4A6OA 3L9JT 1OLMA 4JV4A 1AXKA 2Z42A 4DUXA 2AYHA 4QXCA 3BGAA 1BQPA 2HWF1 2OX0A 3RNSA 4O61A 1RITA 4E2SA 1FPN2 4ZXKA 4QX7A 2YC0A 2A3XA 5CG9A 4PBPA 4QPGC 4FPEA 1PIV3 1RMU3 2ORXA 1COV2 2WNVA 2FCTA 2BVBA 2E7QA 3BOPA 1ZRIA 3MLJA 3ETPA 3NO8A 3ZPYA 4AI1A 4AFAA 4DNYA 3TWIA 1QJY2 2E53A 2HBUA 1EAH2 3KHCA 3CZJA 4DFSA 4CCMA 3J26N 4GAZA 3O1PA 2BGPA 3POFA 1LB2A 5T54A 4C90A 4CCDA 3SH3A 2P17A 1XXNA 3AL6A 3KHBA 4BYYA 3ABZA 4ZS2A 2VE1A 1SZBA 3Q8EA 4LLOA 4OULA 2ZAAA 4BZ4A 1YXWA 5FZIA 2HWF2 4AW7A 2ZTNA 1A34A 2QQWA 1X82A 2YY1A 4F3JA 3AYAA 4WVZA 2WIIB 5D1IA 4A45A 1UIJA 4DOUA 3H42B 3IDEA 1AYN2 3ZN6A 5GZEA 4CEWC 4Z92B 1TVGA 2HEVF 2RR13 3ZXGA 1V6MA 3AKTA 3LD8A 5E16A 5IWFA 4A41A 5CB7A 2FDFA 1H9PA 3DF0A 2DUOA 5J3UA 3UT0A 3CF6E 2BGCA 4LBNA 3KF3A 4NUBA 1PHMA 1XSRA 4N43A 5FZHA 1NA1A 5BNOC 5KXCA 1J1TA 3NJVA 1ZZ6A 2Q1FA 4L11A 3AL5A 1DZRA 3MLKA 4CPBD 1A8DA 3ENRA 3MI8A 3O0VA 4BU2A 3GHNA 3J7HA 5FY5A 4Z07A 1MQTA 1BCXA 1CAVB 1MZ6A 2WO3A 4PBOA 4RS5C 4F8AA 3ALQA 5T50A 4XJ8A 5A7NA 2GC1A 4XC9A 5DABA 1POV0 2PAKA 3HNMA 3PUSA 3VBHA 4IV1C 2R32A 1GNHA 3USUA 3ASIA 5KC6A 1RUF3 2WNUB 4UAPA 5FWJA 2D5FA 1J59A 4A7KA 1F8VA 1L7QA 3IKWA 2IXLA 2RS53 3PUHA 3MIBA 3W59A 4U36A 5L7OB 3T4VA 4H55A 1HB4A 4QKFA 1HV0A 2CU5A 3U4XA 4FP3A 2CGOA 1UPIA 4XABA 2ZHNA 1W0NA 3TN92 4NAMA 2XH6A 2O8OA 4LBQD 3ZIXA 2IXIA 4XIKA 3VKFC 5T5PA 4L2NA 2B9UA 4JGYB 4TZDA 2JDZA 3H3UA 3MZHA 5LRSA 1DQ4A 1ODNA 1YFXA 4BM8A 4BLIA 4JRAA 1K5MB 1S2KA 4FSJA 3MF6A 1OI6A 1KFXL 2ARXA 2C26A 2JDNA 1G9FA 4H7MA 3VDDB 2IXHA 5FMDA 1NY72 1JTZX 3LZZA 3IN9A 3ZYRA 1DYKA 1AR71 3R4SA 2Z79A 4XF1A 3BI3A 3N3HA 1S4CA 1YFWA 5DDJ1 4JDOA 1HDKA 5BYNA 3VBRB 5HCAA 2DYCA 3GXUA 2ZGQA 3AZZA 2ZGUA 4XXAA 4D8MA 1YIFA 2A3YA 3PTYA 3SKJE 5FO8B 4BK5A 3N36A 4ATEA 3LB9A 1QOTA 5CBLA 4K7JA 1AYM1 2XLFA 2ZCWA 1VAVA 2DVBA 1W06A 4XCAA 5KHJA 1UU5A 1O5UA 2AZ5A 1I3HA 2JIGA 5EJ1B 3SC7X 3WW4A 4C91A 1WW7A 3KV5A 1IZ3A 4IERA 3WHUA 4I0WB 2RS11 4XJWA 5KHGA 4BQ5A 2DUQA 3LEIA 5L7OC 1L7LA 4ZS3A 5LZ6A 1AR72 3MHZA 4GWJA 1GFF2 4MGQA 4LHKA 2PHFA 1UOGA 2GMEA 2XL7A 1WGPA 3ZSJA 1UZ0A 1AX0A 4P9GA 4W4ZA 2OQ6A 4JGYC 3WDYA 2VPVA 4G4FA 3MDPA 5DUVA 5CFDA 3ZX7A 4CDWB 1XNBA 1VB4A 3K75B 5JSRA 3RJRA 4HVOA 3J8F3 1B35B 4R9AA 1UMHA 4MADA 5J7MA 4XUOA 5K0UB 1OQ1A 2C4XA 2VZTA 3FBYA 1K5MC 1W8UA 4QQHA 2OKXA 3VGIA 2CAVA 4H3WA 1K42A 4BMEA 2W2IA 4YVSA 2GN3A 3VDDC 5FZKA 2QFEA 2GNBA 2RS12 3ELNA 3I2GA 1XNAA 2ORZA 3FHAA 1CVNA 3JZVA 3PIGA 3OGSA 4GA9A 4MH0E 4UF0A 3LA2A 1MEC3 5K7PA 1CJPA 2A6WA 2RJKA 3PURA 4NHXA 1RINA 2R073 1AL21 1LEMA 3UL2A 4BOWA 3ZFEC 4P9YA 5IFTA 1UY2A 5FBZA 1ZVFA 3RI9A 4BK4A 4TYSA 4P9XA 3UGHA 4EYUA 3I59B 1BYHA 4W8JA 5I8TA 2Y6FA 4I09A 5HCHA 2BBAA 4I02A 5FFOC 4P9IA 2DWRA 2VTFA 1XPWA 3MFCA 3SH4A 4FBFA 1REDA 2RM21 4RHV1 2D6OX 4Y5SA 1Y3TA 4LOTA 5DG2A 1QWRA 3VL8A 2B39A 4LA3A 4HETA 4X6RB 3B3QE 3EQEA 5E8AA 4XFHA 3VHPA 2VCCA 3EJKA 4YZ5A 1ZRFA 4AVBA 2QKDA 1EP0A 3FC0A 2MNGA 2DVGA 2VCBA 1GUIA 1T6GC 1SQ4A 2VOWA 3POYA 1XE7A 2BPA2 4FFFA 2EVXA 3OUIA 3ZXKA 2WAAA 4BXFA 1AL22 1VRBA 5D8AA 4RQPB 1S0EA 4P9JA 2X5IA 1N3PA 4OUEA 1OLME 3E6DA 3BTZA 4R4XA 5FYUA 3I2FA 2WLPA 3WP6A 1QJX3 5C3PA 5FYCA 3I7DA 4HONA 4Q4W3 1ZZ9A 4FPFA 4Y1ZA 5JWPA 5HXVA 1HKDA 4F7ZA 4LBKA 1B35C 2HWC3 3ZXEA 2DVDA 5IW0A 5K0UC 4RHV2 2VZQA 4YW5A 1Q8PA 4OHVA 4ZKTB 5KHKA 2RS31 1AR91 3SHRA 4TN7A 5EZWA 2BP6A 2J1RA 1NCQA 3ZKUA 3T08A 4QB6A 4C0BA 2WZEA 3POIA 4GULA 4LO8A 4M4PA 5FZFA 2VY0A 3N9MA 4WBBA 1PX3A 2Y6HA 3AK0A 1ND2B 4AOCA 1FATA 4B4QA 1F4AA 3OPZA 1DDLA 1BK1A 3P6BA 1A8MA 5FY0A 2BERA 3E5UA 3V0BB 4XJAA 4NE9A 1RUJ2 1XYNA 1DGWA 4JQTA 3I8TA 1KFUL 1WMDA 2KD7A 4XURA 5GLVA 2VCMA 3RZZA 4B7KA 2QDRA 3FFZA 2XJVA 3OBZA 1YFYA 2VL4A 2BNOA 2RS32 4O9GA 1AR92 1SCRA 2Y6JA 3D8CA 4FCAA 1JYXA 5AC92 1CAWB 5FAXA 3POBA 4UFIA 5FY7A 1VAMA 3UESA 4AGGA 4AI0A 5L19A 1C5IA 1TMF1 4KBZA 4NIHA 2WZPP 4AAPA 2VMFA 3GM8A 4UW6A 3VBSC 1NE4A 1ZZBA 3HR9A 3OY8A 3V0AA 5A80A 3EBRA 4DINB 4ZZ8A 1OUXA 4LHNA 3ST7A 5FY8A 4IEXA 1G9DA 4UW4A 1US2A 4I3GA 4HSLA 2XVLA 4CCEA 2VZ1A 5I0DA 5ABJB 2JDPA 4CEYB 2RDQA 2KR2A 5C8CB 2CL2A 4MGIE 3C7EA 3RWNA 5A6QA 3LGRA 5FUPA 1OPOA 5C70A 1UY3A 5FWEA 4QPIA 1BVP1 4AI9A 1ENQA 2EIGA 3CQOA 2OUHA 3WEZA 1AHSA 1W0PA 3OBTA 3VUOA 5LA0A 4DS0A 1RUH2 2W95A 4YW4A 1XE0A 1TMF2 3VZKA 2JKBA 3ZDSA 4XFBA 1ND2C 4RD7A 3O0WA 3R0RA 5FPUA 1KDMA 4A42A 3LSEA 1MS5A 5C5UA 1ACCA 3N35A 1S2EA 3NNMA 3AFGA 3H1WA 4COVA 2W92A 1Z7S3 2GNTA 2VZVA 3I2JA 2OVUA 1JODA 4AZZA 2CTVA 1LTEA 5FQ0A 4KNCA 5I8YA 1WCKA 1X8EA 2GMPA 5T52A 4X6QB 4BXSV 4CU7A 5A32A 4ZONA 1JH5A 3ON7A 4PQ9A 5J1XA 2PQSA 4EZ4A 5CG8A 4PDWA 1HJFA 3IB3A 5BUVA 3MW2A 4KI5M 3O1OA 3VN4A 3UV9A 2XL9A 2PN5A 5C9AA 2EIBA 1APNA 4QM8A 2GAUA 3QBQA 2D97A 1S0DA 4O65A 5BNPB 3O1RA 5FBJA 5HBAA 1ASJ2 4LK7A 1H4GA 4XFAA 1YQ8A 1W6QA 3K77A 3LPFA 4OI2A 4Y3OA 5C71A 1RB8G 1FV3A 4Y1VA 1EAH3 1UZYA 2X09A 3CJIB 3I2IA 4LBLA 1QJFA 5FYTA 3VBFB 1SFYA 2ERFA 1JYIA 1QJEA 3NNJA 2VVEA 5C8CC 3RZMA 1IS6A 2YYOA 4CDUA 2ZX2A 4XHXA 3DPRB 1DLLA 4P14A 5F5QA 4FPJA 2K0GA 2VG9A 1JZ8A 5LY1A 2RDSA 2ZZJA 3WXPA 2WFF1 1WCDJ 4PLMA 2JDHA 4YM2A 1SCSA 4RYDA 1H2LA 4JC1A 3LDRA 5LWBA 1WMXA 2GDFA 3LKJA 4AEDA 1OBNA 3OSDA 2WS91 4FAHA 1BHGA 1TME1 2W9XA 4N53C 5CKNA 1AJOA 4KWLA 4ZHNA 4AAXA 5FLIA 1SLIA 2AREA 4BWOA 1W9TA 2WZR3 3K51A 1HN1A 5DUWA 5GM0A 3WG3A 2Y60A 3ZXJA 3DN7A 4PI2A 2B8MA 2O14A 5DN2A 2HWE3 3KCYA 2HEYF 5FZEA 4BPZA 4KU7A 4LKDA 1PO21 1G6NA 4S2DA 5CIRA 1SLCA 5A7OA 4YM3A 1JOJA 3NKTA 1N3QA 1LU1A 1JU4A 3BPZA 3H0OA 5FZ8A 1DGLA 2PAEA 2WDBA 3BVCA 4XFIA 1YIPA 1ND3B 1UX6A 2WFF2 4QKDA 4WM8B 3A23A 1IS4A 4DUWA 1SBDA 2HWD3 1VMHA 3ZN5A 4ES9A 2XQXA 3T1MA 3B01A 1XYPA 3LSDA 1QDCA 1TME2 3MIFA 5I0UA 1UMIA 5A3NA 5K8SA 1AX2A 3D5OA 3CJIC 2B45X 3GYDA 1G9AA 4AVAA 3INAA 3VBFC 2YV8A 1YFUA 4R4ZA 2QQKA 3EHKA 1D2SA 3TNQA 1WA6X 3S7EA 3WDUA 2J1SA 1OURA 1UN1A 3AP9A 4Q4Y1 2VQTA 1PO22 2B9VA 2XVGA 3M1HA 3AZVA 4BA6A 1XNTA 1D0HA 3NRUA 5C6CA 4DRVA 2D98A 3H1MA 2FMYA 4WV8A 4OZXA 1HRV3 3WF4A 1JOBA 2J22A 1DZQA 1UKGA 2UURA 4EV0A 1XNKA 1ZA4A 4E4DX 5DUXA 4AFMA 3AFKA 4GKYA 2VW2A 1CIYA 1Y9QA 2BTVC 3UGFA 3JBG2 3HAGA 4HPKB 1DCSA 3NJZA 4O7XA 3ZXDA 4AI3A 2VVFA 5DAVA 1JYCA 4GB31 4EWAA 4CDXB 3AP4A 1Y9GA 2MEV1 4HSJA 4Q27A 4QQLA 5IK4A 3U37A 1EY2A 3BIWE 4NN0A 5F5CA 4E8DA 3SEEA 4IV3A 1REEA 4QU1A 3A7QA 4META 5JDBA 1BVVA 3IT8A 4E2GA 1W0OA 2CGNA 4ISQA 2HEWF 1VALA 4S2FA 1R092 1W05A 4XF3A 5I8SA 2B7YA 1FYUA 2WLQA 1QNWA 1PGL1 3R6SA 1F9KA 4AVSA 2ZPXA 1IHMA 3ZSKA 3H9AA 3W5MA 2XG3A 2V5DA 1JN2P 3ZFGA 3AZYA 4B3NA 1N1SA 3NAPB 4QKBA 5F1RA 1OLQA 3H1YA 3JD71 3VLBB 2JKXA 3VZOA 3HJRA 3Q8FA 4GB32 3T1LA 1UY4A 2VW1A 1X9TA 5LATA 2MEV2 3IPVB 3AMHA 5JI9A 2CSGA 2UYAA 2DF7A 2OIIA 1KDKA 2CYFA 2VOVA 3N9QA 2SLIA 2AUYA 4WVMB 5JOWA 4OHZA 5DXDA 3HPNA 5FXVA 2UY8A 1ENSA 1PO13 2WFPA 5DDJ3 1SMVA 2I74A 3WD5A 1VMFA 4XUTA 4YVWC 3W9AA 2XBO1 1Y9MA 1NE6A 3PU3A 3UKTA 2R1BA 1PGL2 4YW2A 4WVVA 3V65A 1CAXB 2WYSA 1GWLA 2W47A 1H2NA 4C1WA 1ZBA1 3A22A 4PF1A 1W8NA 2QQMA 4AVCA 3OEBA 4LT5A 3B00A 1GNYA 4XUNA 3ROUA 3WY6A 1AYM3 4EWDA 3JD72 3NV1A 2AR6A 1JYNA 2IWGB 2XOMA 3N7LA 2QE3A 3KVBA 4UW3A 4N9HA 5F7UA 1YNAA 2D7FA 4COYA 1KQRA 4GMP1 3SMHA 3BTYA 2DVAA 1E5IA 2CAUA 1CN1A 2BEOA 2R16A 4R52A 2WL1A
chains in the Genus database with same CATH topology
4KWJA 2GN7A 2NMOA 2XBO2 3ZSLA 2HYKA 4RL7A 3WUDA 2Q1MA 3RPQA 4FT8A 1ZBA2 5JOYA 3V56A 4AHZA 4AVTA 4RR3A 3NAPC 3OJBA 1RC6A 2R6QA 1PGSA 2LTNA 2XKPA 3UKNA 4JGZB 5H9RA 2K9ZA 2WT1A 1C1FA 3ZSEA 2FHRA 4B7EA 1I5ZA 3MIEA 1O91A 3H3ZA 1OOPB 2QVSB 1EPWA 1WCSA 3R4DB 2GH8A 4C1XA 1OHFA 4DZGA 4QPGA 4GH4A 4YGBA 4COWA 4MZUA 2RM23 4RHV3 4YZ4A 1KJLA 3TOJA 4CDQB 4Y22A 3VBUC 1GANA 3MGUA 4MXWA 1UZZA 3IDBB 2VNOA 1CX4A 4P9LA 5I0TA 2GU9A 2HWB1 4IEVA 5J98B 1C3HA 2E9QA 4NWWA 3AKSA 1H4HA 1DQ2A 5FO9B 5EYYA 1OPMA 1I9RA 1N1YA 1GLHA 4AQ2A 2ZX4A 2RMU1 5JIAA 1FPN1 4CRQA 4DRRA 1LJ7A 3OD4A 4AHXA 1UMZA 5A33A 1AR93 1COV1 5C4WB 4JGZC 2PQQA 1RUI1 2WT0A 1ZBE1 4CEWB 2JJ6A 1PM7A 1QJY1 4Q2FA 5SV8A 2HWB2 5GLWA 2OA2A 4NHLA 4COZA 1VRH1 2ZX3A 4QQPA 4PCRA 4Y1YA 4LUMA 3LOIA 2C0ZA 1RTVA 4YM1A 5BNOB 1ZRRA 1LRHA 3U11A 4FQ4A 1O3QA 1G9BA 2XJRA 2V73A 1WBLA 2K2SA 2RMU2 2R30A 3MYXA 4K8FA 5IK7A 1UL9A 4PIXA 3KZ4C 4RS5B 5KXDA 4UXAA 5DZEA 3HN1A 4CDQC 1W6OB 3WW1A 3THPA 1AYN1 4BIFA 1RUI2 1ZBE2 2JG9C 4IV1B 1Y7BA 3BCWA 1UPSA 3D6EA 4FPLA 4QGMA 1W6NB 5GZFA 4OUMA 4L99A 2HKXA 3DGTA 2FQPA 3QLQA 1VRH2 4CP0A 4WM7B 1IS3A 2A6VA 3G7DA 4IXLA 1QQP1 1J3QA 2JECA 1C28A 3FWEA 3MPBA 1V70A 3ME2A 2GMMA 3QH7A 1OSGA 2YDEA 3N7KA 4KG0A 4PF5A 5IK8A 4FPHA 1H8VA 1HQNA 2VECA 5C4WC 1D4M1 5AVPA 2WQZC 5JZGC 1REFA 1YJLA 3BODA 4AQ6A 1V6KA 1AX1A 2A75A 1AXZA 1UF2C 4URTA 1W6MB 1WMEA 2Q30A 4P5HA 1L3JA 3WW3A 1SLTA 1AR82 3AXEA 2VQAA 4OVEA 3M8LA 1M4WA 2UWBA 1QQP2 3ZFFC 1CAVA 1XNCA 1QH7A 4Z2WA 3IBMA 4ISRA 1SEFA 1TQ5A 2D3PA 3TN91 2Q0AA 1KJRA 3H50A 2PHRA 2ZOEB 3RMYA 1NCRC 5GZGA 4B29A 2XHKA 3E6CC 3ZSMA 4Q26A 1VBB1 1FOD1 1D4M2 1JUHA 1A6CA 1Q3EA 2WNUA 2ZGRA 5FOJB 4LHLA 5B2GB 3RMXA 2JE9A 2TBVA 3KM5A 3RS6A 1GSLA 5L7OA 2A6YA 2WJSA 4LULA 2XKOA 3GZTB 4WM7C 5LEJA 4XXPA 3A4UA 1NQJA 5T5JA 1NY71 2E7TA 2Z69A 1HXS1 1AR63 1QJU3 4Q4V1 5T5LA 3RSJA 4JGYA 1C5HA 4UBHA 1PVXA 2OPKA 1W6PB 1WW4A 1G9CA 4JDNA 4QXKA 4E4ZA 1VBB2 1FOD2 1FT9A 1K5MA 5I0SA 3I4IA 2EF6A 1LOFC 2JX9A 3VDDA 1LOAA 4KH9A 4Y26A 3TBDA 3D0JA 4QD2A 4FOYA 3VKNA 1O3SA 2WS93 2XUMA 1A3KA 4IEOA 3OD0A 5T5OA 3VBRA 4CZSA 1H8TB 1POV3 3IMNA 1HXS2 4Y1XA 4Q4V2 3ZFEB 4FPGA 4HBNA 2RJLA 2QJVA 2XWJB 4FOVA 4PJYA 5FLJA 3GBGA 3OTFA 3L2YA 4XTPA 1RHI2 2V09A 3WCRA 1MS4A 4Q0UA 3RQ0A 2JG8B 1QKQA 2XJQA 2GH2A 2Y38A 1ZZ7A 3WZ1A 2XVKA 2E51A 2KXLA 2ZACA 1CONA 1DQ1A 4AXOA 1ULGA 2E6VA 1OMIA 1WUVA 2A7AA 4N43C 4Q0VA 4Q1PA 1FMD1 1NA1C 1XYOA 1FAYA 3AZWA 2PHTA 1LU2A 4LR4A 2G4IA 2JEMA 3PLQA 1CD3G 4HVRA 4I0BA 5JI7A 1NLSA 3JCIA 5H9PA 4CDWA 1V6JA 1MQTC 4Q4Y3 5E89A 1RIRA 1MACA 4COUA 3ETQA 1B35A 2XWBB 4JDMA 4MLOA 5K0UA 3AKPA 1GR3A 5A3LA 3GALA 5KHHA 1FI2A 2O8QA 4FAGA 4FQZA 5ACA1 1VBA2 1ALYA 1ULCA 3WV6A 1LEDA 3TNPB 3ZMOA 4MGKE 3FLRA 3PNAA 1FMD2 1H8TC 2VU9A 1YRZA 4LE3A 1Q56A 2MEV3 4QQOA 3I59A 1C8M2 2BWAA 5T3NA 4GWMA 2VUAA 4R9BA 1AZDA 5TSWA 3SCFA 1J58A 2OZ6A 4Y20B 1OQDA 5BPXA 4DMIA 2JG8C 1O4ZA 3PMEA 5ACA2 4GMP0 4OI1A 1V9U3 1DZTA 5EWSA 2P37A 4CP1A 1QXPA 1X50A 4P9WA 4RQPA 3ZYIB 1GNZA 3M3EA 4MV2A 4QU2A 3R4UA 3V64A 1GQHA 1Q8QA 4LNVA 3VBSB 4K3UA 3D4KA 3KGZA 4Q0PA 3ZN4A 1BKZA 1RUD1 3WOGA 5JSOA 4XBQA 5BNQA 1RUJ1 4MVTA 3PJYA 3OGGA 1ZZCA 1GKBA 2D6KA 4K9SA 5FLHA 3ILFA 3UK9A 1QXJA 1GZWB 2QCSB 3JUUA 1E57A 1ENRA 2R061 2WWSA 4ITCA 4BE3A 1ND2A 1JBCA 5AC91 3GZAA 2QQPA 1RUG3 3JB4C 4RSUA 4IEQA 4KBBA 1HRI1 1KRIA 2ZGLA 1R1A1 3KD4A 3VHOA 3V0BA 1SLLA 2NLRA 1O3TA 1RL3A 1RUD2 1RUE2 2CWSA 2R043 5IK5A 2B5HA 4KL1A 2EA7A 2XJTA 3RDIA 4NPRA 5CFDC 3SISA 3GNEA 2CGPA 4LO5B 2WQ4A 3TAYA 1CAWA 4GIQA 4Q29A 3FJSA 2BBVA 2PHWA 4W6WA 1J3PA 2NQYA 2PLV1 2R062 3NV4A 3WDXA 4YVSC 4MXVA 5I93A 1OA2A 4BH9A 1VBD2 1RUH1 1U5XA 2EXJA 3TRSB 4Q1RA 1RUC3 4YGEA 4B4RA 1HRI2 1R1A2 5ABJA 4BCUA 1BBT2 2FMDA 4CEYA 2XLGA 4Y24A 5C8CA 1WLDA 3VHNA 5FPZA 2XB6C 4XOGA 4FTSA 4YNIA 2QZ2A 3VZNA 1PIV1 1RMU1 3NV3A 4BIOA 4YYOA 1ONAA 1S0BA 1QOOA 2DUPA 4YGCA 2PLV2 3HWJA 3FBMA 1VBE1 1QOSA 1PZ8A 3LWCA 1AF9A 4N7IA 2W68A 4ES8A 1ASJ1 4AI8A 2X29A 4E27A 4N53B 5D8AC 3ZXAC 2NMNA 2MPFA 3T2TA 4QGLA 2D6PA 3POWA 2B46X 1J1LA 3GBFA 4XMIA 1IQAA 2WA3A 1QDOA 3ZVXA 1PZ9A 5CFCB 1PIV2 1RMU2 5KHIA 1OKQA 1O7FA 5FDBA 2RR11 1SDWA 5BNPA 1FPN3 1QY4A 4OI0A 3FMGA 1DG6A 4FPYA 3SCHA 1VBE2 1G8WA 1NCQC 3MW3A 2WNEA 4H7LA 4DY5A 1COV3 3CJIA 2ZGMA 3A0NA 1XU1A 3CLPA 3VBFA 5KWRA 4XF0A 1QJY3 2P3JA 2VXRA 3PVEA 1BJQA 2DCZA 4M0NA 3DPRA 4K6BA 2VQ0A 1AJKA 3D0SA 3C3VA 1KS5A 1YWKA 5JPNB 3ZIWA 1YLLA 1DYPA 4YFWA 2HWF3 3S0MA 2RR12 3GBWA 3VBOB 4R9CA 3ZXFA 2XPJA 5BXXA 3B69A 3AJZA 1S0FA 2W0XA 4NHMA 1U12A 2AH2A 3OBRA 4LBJA 2VULA 2F4PA 3BB6A 4FPOB 1CAUB 2RS51 2UWAA 1AYN3 2LALA 4ASLA 2IXCA 4GWNA 2EXKA 5I91A 2A6ZA 2GNDA 2Z2SB 1QHDA 2EXIA 4K1ZA 4HZFA 1V6OA 4QPYA 3WT3A 3RYPA 4HKLA 3VL9A 1DF0A 1V6LA 3LAGA 5CFCC 2B42B 3CEWA 2PFWA 2TEPA 2A71A 2KA3A 1JW6A 1ND3A 3NV2A 1U5IA 1DIWA 4WM8A 4QPIC 2UY9A 2YHJA 3NKGA 1C8NA 5FRAA 1RUF2 4PIYA 4D7SA 2UU8A 1GZCA 2JENA 4GKXA 2VW0A 2RS52 3M2MA 4IESA 5CU1A 3N7MA 4JTOA 5GALA 4AI2A 2ZGOA 4PLNA 3JBG1 1DQ0A 1DGWX 1UD1A 2ZS6B 4WZFA 3AX4A 1QGLA 2DTYA 3LOBA 4QM9A 2R0FA 3WG4A 2OW4A 4QT6A 3M70A 4J6GA 2DCKA 5CNAA 3VBOC 4BQ1A 3TN93 4PDWC 4YVWB 5C8WA 1TEIA 4A7ZA 1R091 1NOVA 2SBAA 5JLVA 1J3RA 4HPKA 4HLTA 3RG0A 1UIKA 1SBEA 4CDXA 4FPCA 4OUSA 2W52A 1GV9A 3MPPG 2CY6A 3B93A 3H7JA 3S7IA 1IS5A 2NP0A 2DURA 4KGQA 4LE4A 1YO8A 4CDUC 4EN6B 4J1WA 5E88A 4CP2A 3NWKA 4AQSA 1LULA 2G9GA 3JU9A 1KITA 1EPZA 3NAPA 4B8EA 1TNRA 2EAKA 1H0BA 1LHWA 4L9BA 4AEDC 3PVNA 3WUCA 2KM2A 3IPVA 4YSFA 3B9CA 3WINE 2ZBJA 2ATFA 4WVMA 1TE1B 1NG0A 1ZRCA 1F31A 1QF3A 4FXGB 2P3IA 2CWMA 1OFNA 3RYRA 1U5YA 3WW2A 5I0RA 4LEJA 1LKNA 1FXZA 1AR73 3M3CA 3ES1A 2FBEA 1LOGA 4Y5Z0 5A3MA 4XFGA 4ZU4A 1CAXA 4FO9A 4WZCA 1RGSA 1HLCA 1SFNA 4IEUA 5CA6A 4HVQA 1ULFA 2W39A 5BY5A 3AYCA 4UW5A 4XE9A 5IUQA 4SBVA 1MEC2 4LO4B 1S0JA 3S30A 5BNNB 2R072 5JCTA 1IOAA 2ET1A 1H2MA 3VBUB 2YGMA 3FUQA 3HMYA 4INDA 4EWEA 2A6XA 2I2SA 4YG6A 2RS13 4AFDA 1QJX1 1LR5A 2D3RA 1PK6B 4Q4W1 4YG0A 2HJIA 3O14A 1DFQA 3FZ3A 4D69A 3Q9OA 2HWC1 1HW5A 2CV6A 4XDQA 1N1TA 4EJRA 3VKLA 1M06G 3WCSA 3FHIB 1RJ7A 1VP6A 1MS9A 1D2QA 5F6LB 1LHOA 4IEZA 1V6NA 5BV6A 4JGZA 2ZHLA 5GJ6A 3ZYGA 4Q4X1 3OYWB 4FTEA 1RUOA 3KT7A 1ZZ8A 4IQPA 4OFGA 1O4YA 1OOPA 1QJX2 4Q4W2 2PAMA 1QU0A 3USSA 5J37A 3WQ1A 4FVVA 1AL23 2HWC2 2P34A 4XETA 2DFCA 4XBNA 1HV1A 3FE5A 2ZAHA 1ZNPA 4KU8A 4CDQA 4ONUA 1A78A 1NXD1 5EXOA 4Q4X2 4AEMA 5BNNC 4IL7A 4XEZA 3KQRA 3A0KA 3PVOA 4BHPA 3WVJA 5LRRA 1Q8SA 2JG9B 1S55A 5FCCA 4MGZE 1PK6C 3B9IA 1LENA 4K21A 1X8MA 4EN8B 3H7YA 4Q0QA 3MW4A 4YZ2A 2DCJA 4LUKA 3ZYPA 1CGPA 3DV8A 2G9FA 2TNFA 1RUJ3 1C57A 3M3OA 4KGGA 1H2KA 4KQ7A 1D4VB 5C4WA 1URXA 3KGLA 3AP6A 2JICA 4CEWA 3AYEA 2VVDA 1GYKA 2JE7A 4XZPA 1RUNA 2RS33 4M3CB 4FP2A 5AC93 2XJUA 2VOKA 1KS4A 5JZGB 5JOXA 1G86A 1YJKA 3L2HA 2XLAA 4XJ9A 5BNOA 2PA7A 1HIXA 4YM0A 1AUYA 3MIGA 3WX5A 3E5XA 4BLJA 4AK3A 4FPKA 2YMZA 2ZZQA 4RS5A 3D82A 3ZFFB 1VB2A 5KC5A 4XILA 1W6OA 2VGDA 2ZHMA 4RR3C 4YW1A 4AGVA 1UKRA 3N4MA 3WG2A 5GLTA 4IV1A 5DZGA 1PNFA 1NCRB 1W6NA 1LHNA 4M01A 5DZFA 4YLZA 4LBQB 3I54A 1RUH3 2BUKA 1ENXA 1Z7S2 4WM7A 5J09A 3IM0A 4L92A 5FMOL 1TMF3 4YG3A 1X7NA 4RGAA 1YUDA 3KT1A 1Y43B 1BEV1 4I3PA 1WW6A 4E9KA 1UCXA 1AR81 1GZ9A 1VAKA 3PMSA 4NO4A 3NL1A 4CTEA 2QZ3A 1LOCA 5AFEA 3P3NA 4JTNA 4X8PA 3AXDA 3MFAA 4HT1T 4GH4C 1VJ2A 1VBC1 3KSCA 2OUJA 3M7AA 3HT2A 1LOFA 1CQ9A 4HKWA 4LTAA 4TLFA 2WNVB 1W6MA 2D6LX 1VBE3 4FTBA 2ZX1A 2WZR1 3OF1A 1O4TA 1ASJ3 3ILNA 1BEV2 5GKAC 2HWE1 1LCLA 1PMIA 2F6BA 4YFZA 3J4UH 4D7YA 1LHUA 3C2UA 3WP5A 1S0CA 5FTTC 2EALA 4FOQA 3QD6A 2GALA 3AMMA 2ZGKA 2VMHA 3U10A 3WNXA 1XE8A 4M3CF 2A3WA 1QJZA 1VBC2 4HK9A 1HX6A 3E5QA 2HWD1 4QMAA 4EN0A 2BVVA 3H8UA 4Z1VA 3AMNA 1RVF1 3ZN6B 2PHLA 1JHNA 2WZR2 2E7AA 2VMGA 2YXSA 5GLUA 2GZWA 1WMFA 3KCCA 5JOZA 3LCPA 2NYYA 2DTWA 2HWE2 3AJYA 2WSUA 3FX3A 1U5ZA 3DL3A 4N43B 5GLZA