2PI0A

Crystal structure of irf-3 bound to the prdiii-i regulatory element of the human interferon-b enhancer
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
106
structure length
98
Chain Sequence
b'KPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PRDIII-I region of human interferon-B promoter strand 1
publication title Structure of IRF-3 bound to the PRDIII-I regulatory element of the human interferon-beta enhancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription activator/dna
total genus 24
structure length 98
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00605 IRF Interferon regulatory factor transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2pi0A01
2PFBA 1SMTA 4CZZA 2D1VA 1MD0A 4M9XA 5D6EA 4R1HA 2GXGA 4HYEA 1D8KA 3FM5A 3I59A 3E6CC 3B02A 3COAC 2L54A 5D6FA 4LK0F 1IRFA 1UHMA 2ZFWA 4G9YA 2H27A 4RB0A 2QZ8A 3ELKA 3SXYA 4A5NA 5LGUA 4KDPA 4U7DA 1K78B 1S7OA 1IRGA 4MTDA 5E8GA 4A0YA 1B1BA 4MTEA 2Y75A 1HSTA 2DU9A 2DQLA 2GZWA 4S05A 3F72A 3WGGA 3H3ZA 4BHPA 3DQVC 4FX0A 2HR3A 3PQKA 3DF8A 5E1WA 2QBYB 2FBKA 4P9UA 4KN4X 4N0BA 4EQQA 2ZJ2A 5CJ9A 4FX4A 4KMUX 2IRFG 1R1TA 2BBYA 1XMKA 1XDUA 2OQGA 2DPDA 4Q5SF 4IHTA 3DFGA 2A3SA 3E97A 2H09A 2BEOA 2EV0A 3LSTA 4HQMA 2MC3A 4MQVA 2YU3A 3KLOA 1MJ9A 4PGHA 3R60A 2NAZA 2F5DA 4RGXA 3FF5A 2F5EA 3K1NA 3KP4A 3T0YA 2GIVA 4TV7A 2ETHA 3CLOA 3CUQB 2NS0A 5K5RA 2P7VB 2CQKA 2QVOA 4I7HA 4LGWA 3HSEA 1LDKB 2Q0OA 1G4DA 3ZMTA 1J5YA 5LLQA 2E1NA 4ZZLA 3F8BA 1RI7A 2QLZA 4I09A 4LB6B 5K1YA 4A0ZA 5LRRA 3L2CA 3TOAA 2MLKA 5L3GA 3F8NA 2VT2A 2FF4A 4HW0A 3NEUA 3V8LA 1YW8A 3GZ6A 3I0TA 1D5VA 1BI0A 1ULYA 3HSFA 2VC1A 2X4HA 1KQ0A 3L09A 3OV8A 5K5QA 4YFKF 3ZMZA 5HLGA 1IXCA 2LSOA 5JI6A 2Z5UA 1EH8A 4EJOA 4EJUA 5A2QK 1XCVA 1FYLA 2P6TA 5BS6A 1XD7A 5A2QZ 5JVTA 3C1DA 1IAWA 1ZGJA 5LHIA 4ENNA 3LFKA 5D5VB 5L3FA 4GYGA 2AS5F 1I1SA 1HKSA 1O3SA 1QZZA 4HX4A 1U78A 4ZYHA 2RV8A 1BI1A 2GXBA 2G9WA 1R5GA 4HV5A 4JBAA 1LB2A 1F4KA 1CGPA 5FGMA 5K5OA 1O7LA 1H9TA 4G6DA 3MEXA 2XUBA 3K1PA 3L9FA 4FHTA 4DQ2A 5E17F 3CUQA 4L9VA 1L3LA 5LEKA 4Q48A 3DEUA 4OIPF 3IWZA 5FLXK 1O3TA 5L3BA 4G7HF 3HHGA 1T39A 1TW3A 1GXQA 2P8TA 2KRFA 2BE5F 1B59A 4N9HA 1QNTA 2NNYA 1G3TA 4CICA 3F8MA 4M71A 2FNPA 2OU2A 4EM2A 3JTHA 2CSOA 2IVMA 4A0XA 4IF4A 4GYIA 5HLHA 5D8LB 2VBYA 1FNNA 2UXNA 2ELHA 2VONA 4LG0A 1WSUA 3KEQA 2HTJA 2PMHA 3L00A 2KIMA 2WV0A 1SMYF 3WG9A 4ESJA 4AD9A 5ILVA 1ZARA 2W24A 1T38A 1I1GA 3RIRA 4JK1X 4K2EA 2D1HA 1YO5C 2B0LA 3TO6A 3SQNA 3L7WA 1LDJA 1BIAA 2KJBA 4BHCA 1TQPA 3MFKA 5LRSA 2YX7A 1PP7U 4I0BA 4BYYA 1MZBA 4EJWA 1FC3A 2QQBA 4HV6A 2ADUA 4OINF 2VOPA 1XGSA 4LD5A 3DKWA 1U6GA 1FSHA 3KLNA 1UCRA 1YQAA 4GCVA 1KYZA 3HRTA 4CO8A 3EUHA 3C18A 4ENKA 3ZQ7A 1XGNA 1S8NA 2CW0F 1LQ1A 1A04A 5DV5A 4PGGA 2DBBA 2V1UA 3E5UA 5D4SA 3WGIA 4P9FA 3MAJA 2HYFA 4L5JA 3KP6A 3AAFA 3R0AA 2GA1A 3GEZA 4AIKA 1JGSA 2EV6A 1WQ2A 1SFXA 4P96A 3EYYA 4KIBA 2XHKA 1TNSA 3BROA 2LKPA 1FBUA 4EVIA 5BQTA 1Z05A 3J81Z 2XAGA 4HLYA 4G8XA 4Z2YA 1ODDA 2PBIA 2VBWA 4LK1F 3HRMA 2WWYA 2F5FA 1DUXC 3ZMDA 1KA8A 3K0LA 5CVIA 4HF2A 2O03A 1K7AA 2IA1A 3HTUA 1XSVA 2FRHA 2VN2A 5L3CA 5LGNA 4I01A 4LLNA 4L9NA 5HOOA 3O6BB 2X0LA 3G3ZA 1XCBA 3TDZC 2IT0A 5AIQA 1FX7A 2OAZA 4NQWA 3V7RA 3KP2A 3TOBA 2QQ9A 2HFHA 3I64A 2K27A 4HF1A 4NHJA 1IXSB 1FZPB 3IC7A 1ZLJA 1YW7A 2OQRA 5HS8A 4IVNA 2RGVA 1VTNC 2M87A 2QWWA 4IRGA 5BPDA 2E7WA 1O3RA 3T8TA 3DV8A 3F6OA 1Z9CA 2KIFA 3DXJF 3HYIA 3M9AA 6PAXA 2BGCA 1BIBA 1OPCA 4DNCA 3F3XA 4MEYF 4XBFA 2FQ3A 1DDNA 4AVPA 1FYKA 4XSZF 2C6YA 5L3DA 3R6SA 2JZYA 4PDKA 2HS5A 3JTGA 1KU3A 1FOKA 3QU6A 3J7AO 5E18F 2HWVA 3HOTA 4IXAA 4UHTA 5BOXA 4Y17A 3BDDA 3U1DA 3FX3A 2GAUA 4KMFA 1W4MA 2J5OA 1WRJA 1UHWA 3R4KA 1GXPA 2J5PA 4OU0A 2K4BA 1HKQA 1FBSA 4PZJA 2UWMA 1MJAA 3SFZA 3KETA 1PP8F 2EK5A 3WTWC 2IW5A 4RB2C 1ONVA 3TGNA 2XAJA 3V7CA 4QWQA 2OBPA 3G73A 4LLLA 1Z1DA 2HYGD 2Z33A 1HSJA 1KGSA 3T5XA 4A2UA 4XRFA 2Z9OA 1SD4A 5H6RA 3C3WA 4UXNA 5AIPA 1XMAA 4RB1A 3GFIA 4M6XA 3GFJA 2EV5A 1XGMA 1T98A 3GZ5A 3K1MA 3PQJA 1IUYA 2COMA 3BZ6A 2K4JA 3T8RA 4ZYGA 4E70A 4EJTA 1F1ZA 3CTAA 4UV9A 2EFWA 2CG4A 4O6JA 4HA8A 1JHHA 2Z99A 4HBLA 4GXOA 5HDNA 3BJ6A 5D8KB 5CYVA 5E1XA 4G7ZF 4ZYDA 2IPQX 4O3MA 1FWZA 1XSDA 3ECOA 4L9TA 4D0PA 2XVCA 3GO5A 2FOKA 4M73A 1FLIA 3HSRA 4ETSA 3FZVA 4HLXA 3F23A 3I4PA 4XSXF 1RUOA 2W84A 5TJJA 3ZPLA 4MGRA 4GO1A 4KICA 4KA4A 4P5OA 2ESHA 1R00A 1J0RA 2VOOA 4B09A 1QBJA 2DPUA 4BHBA 3EETA 3RTRA 2OZ6A 2F2EA 3FXUA 3SHFA 1E2XA 4KUMA 1BI2A 4KN7X 1TLHB 3M8FA 3VFZA 4AIJA 4WX9A 1Z6RA 2DT5A 5ILUA 1XB4A 2OZUA 2MD5A 5DD4A 5LHHA 4LG0B 3P9CA 2A69F 3LQRA 5H6QA 4RGUA 4Q47A 5DD8A 2M5WA 3VODA 3N4MA 4M72A 1HW5A 1K79A 2A07F 3J80K 3F21A 4HZFA 5HLIA 2VC0A 3J80Z 3ABTA 1FY7A 2LDUA 1R5HA 4BNCA 3BP8A 5ERIA 4KYWA 1R23A 3GYHX 1FP1D 2FSWA 2EJRA 4WK8F 1O3QA 3TKYA 2MBFA 3BOQA 1WKMA 5D5WB 1HQCA 4XLNF 3ECHA 4N9IA 1YLFA 3KZZA 1ZHFA 1ON1A 1XGOA 1BC7C 4EM1A 3R61A 3WODF 2ZKZA 5EEHA 2H6BA 2QENA 2O3FA 2TDXA 4G6QA 1SFEA 3E5QA 3VOEA 2V1DA 4UV8A 3P7NA 2PLYA 2Z3YA 2XAFA 1OR7A 4ENMA 4CYDA 1F9NA 4I02A 4WWCA 1W7PD 3DPTA 3E5XA 4ESBA 1P92A 3Q5FA 2PN6A 2K86A 3ROUA 1OYIA 2EFPA 3GUDA 2AXLA 1YG2A 3HRUA 2XASA 4MNUA 2K02A 3RI4A 4QLCU 4U0YA 4KNYA 4BH9A 1MJBA 4CDGA 1PUEE 2O8XA 3MQ0A 4L0YB 2ZMEB 1ZG3A 2ZXJA 4OIRF 4WCGA 1Z6TA 2DTRA 3JW4A 2DK5A 4Y15A 3VB2A 3FMQA 2RVCA 5FB2A 2FXAA 4CGZA 2ISYA 4A6DA 3LWFA 2OD5A 1XDSA 1B9MA 2F5CA 1RZ4A 2A61A 2ESNA 3P9KA 2PMUA 1ZGAA 3IL2A 3FXQA 1Y0UA 1CF7B 2NYXA 3U9GA 3RDIA 1J75A 4G7OF 5IT9Z 1V4RA 1G3YA 1HKTA 2V79A 2OA4A 3RKWA 4EGZA 3WE2A 2HQRA 2XAQA 2QUFA 1SAXA 4M9ZA 5J6XA 4HX8A 4L5IA 2VE8A 4CXFA 4HDVA 4KIGA 1QQIA 5EEGA 3O3KA 4G94A 5LHGA 1KQ9A 2QQAA 1LVAA 3WTSC 3IRRA 2YR2A 2MA3A 3KP7A 3I71A 1J2XA 1W5SA 4LLGF 3TO7A 4H0EA 1AOYA 2O61A 5FO5A 4R79A 5J8FA 1JXSA 2E1CA 2FBIA 3MWMA 4A12A 1S6LA 4U7BA 1S7AA 2ZCWA 5HS9A 3RJPA 4A6EA 4YFXF 4OMZA 3J81K 2V6CA 3EDPA 2STWA 1REPC 5ED4A 2ZMEA 1IN6A 3ML6A 3KEOA 1SD7A 4I0AA 1Z91A 1P4AA 1IN7A 2D45A 1T6SA 3QP5A 1YS7A 1AWCA 4L9JA 3ZMUA 1WI9A 4OIQF 5JHUA 1YIOA 2IJLA 1ON2A 4RS8A 4KT5C 5JFRA 4IJAA 1X3UA 2BYVE 1CF7A 3QPHA 2IA2A 5TRDA 1JE8A 3B73A 4HQEA 3ABUA 2DFIA 1I6XA 5ILSA 2VT3A 1DPUA 3JSOA 3RYPA 4HAMA 3GVAA 2D2WA 3JAMZ 1ZRCA 1B9NA 3MCZA 3I58A 2KJCA 2PQ8A 2XROA 1KU7A 2HTSA 4EJVA 4U88A 2Q8KA 1Z7UA 1IF1A 1WWXA 1EV7A 1USTA 1ZYRF 2W25A 1NHAA 1FBQA 2M1BA 1O57A 2PI0A 1EH7A 1R1UA 1S29A 2JT1A 3I53A 1UFMA 2GA2A 2FE3A 5E8IA 1ZG1A 1I5ZA 2KKOA 2FA5A 4HOBA 1ZREA 4B8XA 2MH2A 3IRQA 4O5VA 3ZP5A 5KK1A 2O6GE 4M74A 3V7SA 4L18B 4MQ9F 3RPUA 3P9IA 2HKOA 1SFUA 1DP7P 3CUOA 2LF8A 3GXOA 3K2ZA 4RB3C 1FSEA 5DEQA 4LB5A 2A68F 5KVRA 3WU0A 1YFHA 1S3JA 4BAYA 2P4WA 2PG4A 3R0JA 3LQQA 2FU4A 2Q2EA 2UZKA 1G3SA 3M8EA 4IHSA 3WGHA 3LAPA 3WTXC 5LEJA 1STZA 2E7XA 1T2KA 3KCCA 2YSRA 1YW9A 1IN8A 2HZTA 3TO9A 1ZRDA 1TQIA 4XLPF 4I2OA 4PCQA 3NRVA 1TQMA 3F8FA 3K9TA 5H20A 2DW4A 1BN5A 3DPLC 3FM3A 4GGGA 3QP6A 3F22A 1R36A 2V9VA 3SZTA 2EA4A 3F8CA 2XKOA 2VXZA 3C7JA 4KFCA 3H3UA 2WC2A 1J7KA 1E17A 2XIGA 2R7FA 4FT8A 1LDDA 4P55A 1G3WA 1YS6A 3Q9VA 2CGPA 1U3EM 2L4MA 2EA2A 1ZRFA 1BM9A 5JR3A 2XAHA 4LJZF 3U2RA 2CFXA 1T0FA 4YIFA 1FP2A 4JQFA 1J9IA 3ULQB 4UNOA 2EFNA 3KE2A 4U0VA 3ZN1A 3O2PE 5D5UB 1IXRC 2XGXA 5ICCA 4M9SA 1B4AA 3Q9SA 2H94A 3EQLF 4YG2F 3LA2A 3QRFF 4MEXF 5DCMB 3KP5A 5ICGA 4IPAA 2EFQA 3PFIA 3RPQA 5BPIA 1RUNA 1XSXA 3LAJA 5E1ZB 2Y48A 1OKRA 3TDUC 3QAHA 3V4GA 2IP2A 2JRTA 1IN4A 3HHHA 1LEBA 3CDHA 5CVJA 2M45A 2DAOA 1IZ1A 2DI3A 3MZHA 1PDNC 2NRAC 1ZLKA 2ZNYA 1K78A 2P6SA 1JHFA 2ACJA 1IW7F 4HX7A 4RAZA 1P2FA 4ESFA 2ZNZA 1XN7A 2L01A 4HF0A 4WXHA 2DLLA 2EB7A 4AWXB 1W7PB 2P5KA 2YX4A 2PJPA 2LF7A 4UVCA 1P4XA 4LFUA 5D5XB 5DDGA 2JTVA 1HW1A 4UVAA 1YTYA 3WTUC 2QBYA 4KIFA 3QPTA 1Q1HA 4A5MA 1LNWA 3E6BA 2CWEA 4CHUA 4WXCA 2MH9A 2RKHA 1TW2A 2EWNA 2H6CA 4EGYA 2G7HA 1BJAA 1EH6A 3WTTC 2R3SA 2QM3A 1U5TB 5ICEA 4ZH4F 4MHGA 2MLGA 5DCMA 3GX4X 1B6AA 2HGCA 5BMZA 2V1XA 3REOA 5ICFA 1IN5A 4ENJA 5F6FA 3DP7A 2KIUA 3FMSA 2HOEA 3RKYA 4AIHA 3KZYA 2XKPA 2FMLA 3GWZA 1KQ8A 3BWGA 5HVQC 1HXDA 4IRIA 2W85A 3W6KB 1MDMB 1OYWA 5HS7A 4LMYA 4IRHA 3CUQC 1UB9A 4UUVA 1QO0D 3ZMVA 2G7UA 3HIFA 1ZH5A 5FLXZ 1SD6A 2GQQA 3FHZA 3KFWX 3V8JA 1LJ9A 2RN7A 3V8KA 1P4WA 3QU3A 3WTYC 3GF2A 2VBXA 3WTVC 4Q4ZF 2WTEA 5E20A 2IA0A 4BQAA 3IHUA 3JSPA 1U8RA 5FD6A 1W7PA 1MGTA 4M6YA 3ERED 1FT9A 4OMYA 1HW2A 3ISPA 3VEPA 3I54A 1QZYA 3IKVA 2K7LA 1QPMA 3ZN0A 4OOIA 2M8EA 1H0MA 3HOSA 2GWRA 1I27A 2L3DA 2DK8A 2VBZA 1MKMA 1OMIA 2M30A 2VE9A 2L4AA 3IWFA 5IT9K 1D3YA 2FEZA 1ZG5A 1TTYA 1DPRA 2CO5A 1U5TA 5HDGA 2DQRA 1R22A 3BJAA 4YIIA 5IT3A 4WF2A 4EM0B 2HKXA 1U5TC 1H9GA 2A6EF 3ZMSA 4Y13A 4ON0A 5F1RA 4RGSA 1BBYA 4UVBA 3KP3A 5FFXA 5DUIA 1ZN2A 2A5YB 4RAYA 1V3FA 1J59A 2DO7A 1TBXA 1RNLA 1QGPA 2YPRA 3GFLA 2NNNA 2EFOA 1TNTA 2RDPA 3N97A 1MDMA 3WU1B 3GFMA 1C0WA 4I98B 1R1VA 2JPCA 5F64A 2FBHA 4U0WA 4EMSA 5FD5A 1BI3A 5CVRA 2CYYA 3OOPA 2W57A 3D0SA 2O0YA 2PEXA 1R58A 5LBQA 2RQPA 4R8HA 3CO7C 4WXDA 3E3VA 5CVVA 2XRNA 3BJOA 1U2WA 1FYMA 3WTZA 1HBXG 3S2WA 2UXXA 2XV4S 4HDUA 2ZBKA 5DUKA 4L0ZB 2RC4A 1OYYA 4S04A 1P6RA 2P5LC 1O7FA 3M1EA 3I5UA 3FWEA 3T1BA 1D8JA 5HDKA 3BY6A 1KU9A 1SD5A 3H92A 5AONA 1F5TA 2FMYA 3BPXA 5CLSA 3I59B 2BV6A 3SZPA 2QYOA 1KU2A 5FFZA 2A6HF 1ZAOA 5DCFA 3F6VA 3JAMK 3HTSB 1R7JA 3WE3A 2ISZA 2STTA 1W5TA 3CJNA 3NQOA 4BXUA 2VODA 5D4RA 5DYMA 2JPBA 2HQNA 3FMRA 3CO6C 3GW2A 1BC8C 3HRSA 1YYVA 3K69A 3HUGA 1L0OC 3GLXA 3W6JB 2JSCA 3MZYA 5J8CA 3M7GA 1FPQA 3BPVA 3FXRA 5L3EA 1GHCA 3LA7A 1KYWA 3RYRA 1USSA 2L02A 1LEAA 2Y0MA 3D5LA 3EYIA 3IKTA 2HDCA 2ZO4A 4EV0A 1K6OA 1GVJA 2R7DA 2P5VA 3LA3A 1RIOH 4NB5A 4F7ZA 3QOPA 3RKXA 5CVUA 2FNAA 3E6DA 4ASNA 3E6MA 1BOAA 1G6NA 4ZZDA 2P7CB 4ZYEA 4YFNF 2LNBA 3TQNA 4RGRA 4OIOF 2RNJA 5LGTA 2HEOA
chains in the Genus database with same CATH superfamily
2PFBA 9ANTA 3BTLA 5F0CA 3PM1A 1SMTA 4CZZA 2QSGX 2D1VA 1MD0A 4B47A 2ZJPF 1GLNA 3OOUA 5FKMA 2ELKA 4M9XA 1Y1WJ 4RA2A 5D6EA 3S8PA 4R1HA 3DU6A 5EZGA 2GXGA 1S5LC 4RMNA 3U1KA 1TC3C 4HYEA 2E35A 4C3HJ 5JVGF 2YS9A 2M0CA 5BNGA 1D8KA 3FM5A 4M3EA 3I59A 4ZDOA 4MLOA 3S15J 3E6CC 3IAS2 5J1UA 3B02A 3A01B 1YRNB 3COAC 2L54A 5D6FA 4LK0F 2XPUA 1GV2A 1IRFA 1UHMA 2CV2A 2ZFWA 4G9YA 2MC4A 2H27A 2K40A 4RB0A 4XK4A 1K4SA 2QZ8A 5F0FA 3ELKA 3SXYA 1D0YA 4FE4A 4A5NA 4KITB 4DZJA 2LP0A 1ZTRA 1RR8C 3H5NA 5LGUA 1XPXA 4KDPA 3KYDB 4U7DA 1K78B 4XLEA 2X85A 1S7OA 2RAEA 4XOPA 1IRGA 4FCYA 4MTDA 5E8GA 1KONA 4A0YA 1B1BA 5DS9A 1V54H 4MTEA 2DMNA 2Y75A 1HOMA 1HSTA 2DU9A 2DQLA 2GZWA 4S05A 2F4IA 3F72A 2Z16A 3WGGA 3H3ZA 4D5CA 4BHPA 5IP9J 4DGWB 2EILH 3DQVC 2GOMA 3S16J 2WV1A 1R71A 4FX0A 2B9SA 2HOSA 2HR3A 1BL0A 3S1NJ 2HNHA 5DM7F 3PQKA 3DF8A 5E1WA 1A6IA 2ZB9A 2K3FA 1VQ4I 2QBYB 2PJRA 1DP3A 2FBKA 2CQXA 4P9UA 4KN4X 4HRIA 2IGNA 2LFBA 2VL8A 3OY9A 1IGNA 4N0BA 3JRHA 2X1EA 4EQQA 3JRDA 1UJ8A 3FISA 1T95A 3SFIA 5FKOA 3H9JA 2DA7A 3GTOJ 1IG7A 4UB6C 2AHQA 2ZJ2A 1QA6A 2CUFA 5CJ9A 4FX4A 3M1CA 4KMUX 3K4LA 5DM6F 2IRFG 1R1TA 2E1OA 2BBYA 3D5RC 1GUUA 3Q0WA 1W0UA 1XMKA 1XDUA 1RETA 2VQLA 4PJNA 2OQGA 2DPDA 4ITVA 4Q5SF 4BQOA 4IO9F 3BCAA 2FQ4A 4IHTA 2ZSHB 3DFGA 2A3SA 3DKYA 3E97A 2H09A 2KHMA 5FROA 2BEOA 2EV0A 3FIWA 3LSTA 1S72I 4HQMA 5HNHA 2MC3A 1VQKI 2L0KA 4JX4A 4MQVA 2YU3A 2F48A 1MJ9A 3KLOA 4PGHA 3I9V2 4DBQA 3R60A 2NAZA 2F5DA 2LYCA 2NVXJ 2LVSA 2CMPA 1MMGA 4RGXA 3FF5A 2F5EA 4PUSA 3K1NA 3KP4A 3L2UA 3T0YA 2GIVA 4BBRJ 5IYDJ 2DMQA 2A6TA 4TV7A 2R7TA 2I5UA 2ETHA 4XR6A 3OS0A 1YHQI 3EPZA 4BQNA 4IL6C 3H1CA 2EINH 3CLOA 3CUQB 2NS0A 5K5RA 2P7VB 2CQKA 3A01A 1YRNA 3ABLH 2O9LA 3LSJA 2QVOA 1JT6A 4I7HA 2ZXIA 3HSEA 4LGWA 1LDKB 1MBKA 2XB0X 4B1RA 2Q0OA 1G4DA 4M3BA 3ZMTA 1J5YA 2ZXHA 4AYBN 5LLQA 2E1NA 4ZZLA 3F8BA 2DXIA 4CCLA 1OFCX 1RI7A 5EJCA 4A3LJ 1OCOH 1XX5A 2QLZA 3BCBA 4I09A 1NK2P 2NOGA 1OISA 4LB6B 5K1YA 4A0ZA 5LRRA 2L9RA 3TOAA 2MLKA 5L3GA 3F8NA 3L2CA 2VT2A 2FF4A 3BG3A 1U0JA 4HW0A 2CUJA 3NEUA 1YW8A 3V8LA 3GZ6A 3I0TA 2MFZA 4N4OB 1D5VA 4IEJA 1BI0A 1ULYA 1S9HA 3HSFA 3RZOJ 3RQIA 1OQYA 2VC1A 2X4HA 2FOWA 1D5YA 1KQ0A 2R7RA 1RR7A 3DTIA 3L09A 2HQ5A 3OV8A 5K5QA 4YFKF 3MKLA 4ABZA 3ZMZA 1GT0C 5HLGA 2M9HA 1IXCA 2LSOA 1VQNI 2OPTA 1TWCJ 5JI6A 2XC7A 2Z5UA 5B3SH 3O8GA 2GLOA 2R92J 1EH8A 2Y9YA 4EJOA 3BR6A 4EJUA 5FJ8J 1QZEA 4QTRA 5A2QK 1XCVA 2BY3A 1ZR4A 1JKQC 1FYLA 2KT0A 2P6TA 5TISC 5BS6A 2NVUB 1XD7A 2UV1A 5A2QZ 3OSGA 1VQMI 5JVTA 1X1PA 3C1DA 1IAWA 2DA4A 1ZGJA 5F08A 5LHIA 4ENNA 3LFKA 5D5VB 1E3OC 5L3FA 2DOFA 4GYGA 2AS5F 1I1SA 5FRMA 1HKSA 3W2WA 1O3SA 1FOWA 3ASOH 1QZZA 3CCUI 4HX4A 1U78A 5EF6A 4XICA 2HVRA 4ZYHA 1TP4A 3CCRI 2RV8A 1BI1A 2GXBA 2G9WA 2XSDC 1R5GA 4CZCA 3B6AA 4HV5A 4JBAA 1LB2A 4BKXA 5JLXA 3G1OA 4B48A 5C4JJ 1BW5A 4BJTA 1JKOC 1MW7A 1F4KA 1CGPA 2MABA 2E71A 3OIPA 5FGMA 2IS6A 1FMVA 4C2MJ 3ERMA 2L7KA 2IGOA 5K5OA 1O7LA 3C2GA 1YOVB 1H9TA 4G6DA 3MEXA 2DA2A 1SFOJ 2XUBA 3K1PA 1FOXA 3L9FA 4FHTA 3S3OA 2DJNA 5F1JA 3DPUA 4V2GA 4DQ2A 2JJ7A 2JWTA 5E17F 4IQJA 3OYLA 2E60A 1HF0A 3CUQA 4J01A 3S3MA 1MH4A 3A0BC 4L9VA 1L3LA 2PMZA 4NUBA 1JTYA 5LEKA 3AG2H 1UMQA 4Q48A 5IOYA 3DEUA 4OIPF 3IWZA 5FLXK 4X6AJ 1O3TA 5L3BA 3IUOA 1NH3A 1AKHA 4KJZA 4YRVA 1ENHA 4G7HF 3HHGA 1T39A 1TW3A 1MH3A 1GXQA 2P8TA 2KRFA 2KPMA 2BE5F 2JSPA 1B59A 3HG9A 4N9HA 1D1AA 1QNTA 3OL4A 3TP0A 3QOEA 1X1AA 1ZGWA 2NNYA 1OR7C 1G3TA 3GTLJ 3M3YJ 4CICA 1T08B 3F8MA 2B63J 4M71A 3HOZJ 2R7ZJ 1ETOA 2FNPA 2DFFA 2OU2A 2VUMJ 4EM2A 2X6OA 3JTHA 2CSOA 5EYRA 2IVMA 4A0XA 1SAUA 4C30A 4IF4A 4GYIA 2GIZA 2CFOA 4C9YA 2VKDA 5HLHA 2DMPA 5D8LB 2VBYA 3S3NA 4B4CA 1FNNA 2UXNA 4NBQA 1X2NA 2EQRA 3HXLA 2ELHA 2PX9A 4LG3A 3BG7A 2VONA 4LG0A 1WSUA 1VNDA 3KEQA 5EG0B 2NXNB 2HTJA 4X0GA 4IHXA 2LOOA 2PMHA 1WJFA 5KAIC 2HYJA 3JRCA 2WADA 3L00A 2LY9A 2KIMA 2WV0A 1SMYF 3WG9A 2IGKA 4ESJA 2M2EA 2M8GX 2PMZN 1B72B 3EUKL 4UB8C 4AD9A 2R93J 5ILVA 1ZARA 1LVKA 4M3DA 2W24A 1T38A 2K9QA 1I1GA 3RIRA 3CDLA 4JK1X 3CJQB 1EJ9A 3ZQGA 2R5ZB 4K2EA 2D1HA 2V4JC 2BHZA 4DZPA 1YO5C 1HCRA 4BU2A 2M7BA 1A6QA 2B0LA 3TO6A 4BDYA 3A4CA 1YITI 3SQNA 2AQFA 2HXIA 5J1RA 3ZQLA 3L7WA 2JMWA 1XG1A 2JUCA 1AHDP 1LDJA 2WBMA 1BIAA 2W4SA 4BDZA 2KJBA 3D1NI 4BHCA 4W1UA 1TQPA 3MFKA 3BQZA 3QPLA 3E1SA 5LRSA 2YX7A 1IRXA 4I0BA 3M8JA 2OCCH 4BYYA 1PP7U 2BY0A 4NQWB 2VXDA 3HUGB 5F0HA 1MZBA 4RLQA 4EJWA 2XPWA 2HOTA 1FC3A 2AO9A 1MNMC 2QQBA 4HV6A 4E7KA 3M07A 2OJED 2ADUA 4OINF 2VOPA 1XGSA 4LD5A 1JUMA 4CYCA 3V42A 3DKWA 3G6EI 2E34A 1U6GA 2CW8A 3K10A 4KT6A 3L2WA 1FSHA 3KLNA 1UCRA 1YQAA 4GCVA 1RC9A 1ERDA 1KYZA 2KFDA 3HRTA 4CO8A 3EUHA 3C18A 4ENKA 3ZQ7A 1XGNA 3CP2A 1S8NA 2K9LA 2CW0F 2ECCA 3WG7H 3H0DA 1LQ1A 2VJJA 1A04A 1D0XA 3PUBA 5DV5A 1R9TJ 2X48A 4PGGA 5JHFA 2DBBA 2V1UA 3E5UA 3G2BA 5D4SA 2COBA 3WGIA 4P9FA 3MAJA 1Z3YA 4I99C 3GTPJ 3S2HJ 2HYFA 3C2HA 1PUFB 4L5JA 3KP6A 3AAFA 2CRGA 2GA1A 3R0AA 3GEZA 4D7NA 4AIKA 3H9QA 1JGSA 2EV6A 1WQ2A 1SFXA 3BR2A 4P96A 2Y0SA 4XM3A 1VZ0A 2LG4A 3EYYA 4KIBA 2XHKA 2ID6A 1TNSA 3BROA 2LKPA 4F93B 1FBUA 2M0MA 2MD0A 4EVIA 1EF4A 5BQTA 1Z05A 1BR2A 3CP8A 4A3FJ 4PK4A 3J81Z 2XAGA 3OR2C 4HLYA 3PNYA 1B72A 3HOWJ 4G8XA 4D9JA 4Z2YA 2OV7A 2ZMEC 1ODDA 1YJNI 2PBIA 2VBWA 4LK1F 3HRMA 2JA8J 2DA5A 4XONA 2WWYA 1QHGA 2F5FA 2R5ZA 2WAQA 3ZMDA 1DUXC 1QHHD 2VPRA 1KA8A 3DU5A 1S7EA 3K0LA 3SDBA 5CVIA 4HF2A 3CJTB 2Q1ZB 5B1AH 2VQCA 2O03A 5GTHC 1K7AA 2IA1A 5C4XJ 3HTUA 1DQUA 2WB1N 4CCKA 1XSVA 3MKWB 2FRHA 2VN2A 4MIMA 2NVYJ 5L3CA 5LGNA 4I01A 1YJ9I 2BHYA 4LLNA 4L9NA 5HOOA 3O6BB 2X0LA 3FXJA 3G3ZA 1XCBA 3TDZC 5C3EJ 2IT0A 5AIQA 1D0ZA 1FX7A 1LFBA 3Q0VA 2OAZA 4DW6A 4NQWA 3V7RA 3KP2A 4ANJA 1V5EA 1ETVA 3SZGA 3TOBA 2QQ9A 4X1EA 1E3PA 4A3MJ 2HFHA 3I64A 2K27A 3LSPA 3FXMA 4HF1A 4NHJA 1IXSB 3E7LA 1FZPB 3IC7A 1ZLJA 4BS9A 2EIMH 1YW7A 3VSLA 1H89C 2FUG2 2OQRA 5HS8A 4IZZA 2GM4A 4IVNA 2RGVA 1VTNC 3HC7A 1K6YA 4HNTA 2M87A 2QWWA 4IRGA 5BPDA 1T56A 3RPUD 3ZQCA 1NG6A 3K7AJ 2E7WA 1O3RA 3T8TA 1MMNA 3DV8A 3F6OA 1Z9CA 2KIFA 3RCOA 1Y1VJ 4BXFA 3DXJF 2I10A 2Y2ZA 2XAUA 3HYIA 3M9AA 3K4NA 6PAXA 1APLC 1QPIA 2EIJH 2BGCA 2CUEA 1BIBA 1WGXA 1OPCA 3OYCA 2IS4A 1TWGJ 4DNCA 3F3XA 4MEYF 1PYVA 3S1QJ 3BG9A 4XBFA 4CCJA 1QU3A 2FQ3A 1DDNA 4AVPA 1FEXA 1FYKA 3LL7A 4XSZF 1X58A 1PUFA 2C6YA 5L3DA 3R6SA 1FJLA 2JZYA 4G6TB 4PDKA 2R5YA 3HJEA 2HS5A 5CKTA 3JTGA 5J4VA 1KU3A 2OC6A 1FOKA 3M4OJ 4NC8A 4E7LA 3QU6A 3J7AO 4E7JA 5E18F 1JUPA 2NS7A 2HWVA 3HM5A 1WPKA 3HOTA 3OYNA 4IXAA 4UHTA 1I3AA 3HBLA 5BOXA 4Y17A 4OAZA 2XGEA 3BDDA 3CCYA 2DA6A 3U1DA 2QSHX 3FX3A 2GAUA 4KMFA 1W4MA 2J5OA 4GRIA 2QSFX 1WRJA 4J19A 1UHWA 3R4KA 1GXPA 2J5PA 1VQ6I 4OU0A 4A3CJ 5C44J 2K4BA 4FISA 4XLFA 1HKQA 3C2BA 1FBSA 3MKZA 4PZJA 3CC2I 2UWMA 2ID3A 3VPRA 1MJAA 3SFZA 3KETA 2R7SA 5DTDA 1PP8F 2EK5A 3WTWC 2JVGA 2CH0A 3VYTB 2H1LA 2IW5A 5IP7J 1I50J 4B44A 4RB2C 1ONVA 1Y56A 1RESA 3TGNA 3TEDA 2XAJA 3V7CA 4QWQA 5K7FA 4ZTFA 2OBPA 1D1CA 3G73A 5KNLA 3S1RJ 3FKJA 4LLLA 1Z1DA 2HYGD 2Z33A 1HSJA 1KGSA 4NC6A 3T5XA 4A2UA 4KISA 1ETWA 4XRFA 2Z9OA 1WVRA 1SD4A 1N25A 2MGQA 5H6RA 2KRCA 4L5EA 3C3WA 1E3HA 4UXNA 3JRAA 2HI3A 5AIPA 4UUTA 4BEHB 1XMAA 4IKFA 1Z77A 3K4KA 2FD5A 2X1DA 4RB1A 5EDNA 3GFIA 4M6XA 3GFJA 2EV5A 3K4CA 3SYTA 1T33A 1XGMA 1K61A 5J3LA 3K2AA 4PFOA 4YIRX 1T98A 3GZ5A 3K1MA 3PQJA 1JTXA 2KZGA 4XLAA 1IUYA 5TGTA 2COMA 4AYBA 3CZ6A 1RRJA 1V55H 1WI3A 2E5ZA 3BZ6A 2B7EA 2K4JA 3T8RA 4ZYGA 3ZQFA 4E70A 4EJTA 2M3AA 1F1ZA 3CTAA 4UV9A 2EFWA 4AM3A 3CESA 4XRSA 1VQ9I 2CG4A 4BJ6C 4O6JA 4HA8A 2F4MB 1JHHA 3QWLA 4AIDA 2Z99A 3JRGA 1T0FC 4HBLA 2CQNA 1CQTA 3BZKA 4GXOA 3OMYA 4XOTA 5HDNA 3BJ6A 5D8KB 5CYVA 2LBFB 3DLAA 5E1XA 4J00A 1FMWA 4G7ZF 4ZYDA 2IBDA 3GCMA 3I3LA 2IPQX 4O3MA 1J09A 1FWZA 1WJBA 2R7WA 1ZQ3P 1XSDA 2DMUA 2M4KA 3ECOA 4L9TA 4D0PA 2XVCA 3GO5A 4H4KC 2K5CA 2FOKA 2VKEA 2MW8A 4M73A 1FLIA 2HXOA 3HSRA 4ETSA 3FZVA 2D5VA 4HLXA 1FIAA 3F23A 2LK2A 3DBLB 1W36D 3I4PA 3K70D 1JT0A 4XSXF 5M5XJ 1RUOA 3HOVJ 2FX0A 2W84A 1X1CA 5TJJA 2XF7A 3ZPLA 3W3CA 4XKVA 4MGRA 1SVLA 1AKHB 4GO1A 4KICA 4Y7NJ 1A36A 4KA4A 4P5OA 1PVEA 2E2IJ 2ESHA 1R00A 1J0RA 3G71I 2VOOA 1H8AC 4B09A 1QBJA 2OTLI 2DPUA 1X3WB 3JRIA 2GOXB 4A3DJ 4BHBA 3EETA 2V9PA 3RTRA 3CCLI 3GTMJ 2OZ6A 2F2EA 3AG1H 1MNEA 3FXUA 3SHFA 1E2XA 4AVZA 3H5RA 2DOAA 3LNQA 3PFYA 1FIPA 4RBOA 4KUMA 1BI2A 4KN7X 1TLHB 3M8FA 2BXYA 3VFZA 1WCMJ 2MYSA 4QPOA 2ZJRF 4AIJA 4WX9A 3HPHA 1Z6RA 2DT5A 1SC7A 4BGDA 5ILUA 1XB4A 1VI0A 2DDBA 2MD5A 2OZUA 2Y31A 4BEHA 5DD4A 5LHHA 3S1MJ 4LG0B 3P9CA 4BY1J 2QGUA 2A69F 1VQLI 3JCUC 3LQRA 5H6QA 4RGUA 4A3GJ 1A5JA 1FTZA 5GPAA 2HVQA 3PSIA 4Q47A 1RKWA 2M5WA 5DD8A 3VODA 3N4MA 1E0EA 4FASD 4HPQA 2VJ4A 4M72A 2WY8Q 2M7AA 5IYBJ 2K9NA 1HW5A 3CCMI 1K79A 2A07F 3J80K 3F21A 3RQ4A 3OYKA 1B8IB 4HZFA 5HLIA 2FJ1A 2VC0A 1VQ8I 4LOCA 4B3XA 3J80Z 3HOYJ 3ABTA 1FY7A 2E19A 2LDUA 1R5HA 3S14J 4BNCA 3BP8A 5ERIA 3OYMA 4KYWA 1WH7A 1ZKGA 1MNDA 1R23A 2RNGA 4QIWN 3GYHX 3S2DJ 3CJRB 1FP1D 1G2HA 2FSWA 5CQGA 2EJRA 4WK8F 1O3QA 3TKYA 3PO2J 2VIXA 4S0HB 4AU7A 2ELJA 2MBFA 3BOQA 5IY5H 4BE2A 1WKMA 1LKXA 4BACA 1BR1A 1HQCA 5D5WB 4XLNF 4RM2A 1KZHA 3ECHA 2XF5A 4N9IA 1YJWI 2LBFA 4FTHA 1YLFA 3KZZA 1ZHFA 1ON1A 1XGOA 3FK6A 1BC7C 1K4TA 1Z3XA 4EM1A 3R61A 3ABMH 3WODF 2ZKZA 4C2UA 1DU6A 4XORA 5EEHA 1NG7A 2ICWG 2H6BA 2QENA 3CD6I 1IRZA 2O3FA 2HQAA 2TDXA 4G6QA 1SFEA 4CYCB 4LIUA 2E2JJ 2G0EA 3U21A 1Y8QB 2DCEA 4I6ZA 3E5QA 3VOEA 1VQ7I 2V1DA 4UV8A 3P7NA 2ME6A 2PLYA 2Z3YA 2XAFA 1OR7A 2HZDA 5B1BH 4ENMA 2H1KA 4CYDA 1F9NA 1POGA 3NARA 4PJJA 4CSWA 4I02A 4WWCA 1FTTA 4F52A 1W7PD 1YE9A 3DPTA 3E5XA 4ESBA 1P92A 2E1MC 4JOMA 3AKZA 3Q5FA 1MMSA 2PN6A 4XLCA 2K86A 3ROUA 2AXTC 2KL4A 2LY2A 2QQ8A 1OYIA 2EFPA 3GUDA 3EUAA 1JKPC 4HG2A 4CCMA 4GFBA 2AXLA 1YG2A 3N05A 3ZXSA 3HRUA 4HNVA 2XASA 2IEKA 4MNUA 3FBNB 3OYGA 2K02A 3IH2A 3RI4A 4QLCU 4U0YA 3BTJA 3G1LA 4BH9A 4KNYA 3AL0B 1RPWA 1MJBA 4CDGA 1PUEE 2O8XA 3SDGA 4D1QA 4CA0A 5B66C 3MQ0A 4L0YB 1MIJA 2ZMEB 1ZG3A 4DIQA 2ZXJA 4OIRF 4WCGA 3CQZJ 4G12A 1Z6TA 3VYRB 2DTRA 3JW4A 4CUGA 2CW7A 2DK5A 1OCZH 4Y15A 3TMOA 3VYUB 3VB2A 1X1BA 2RVCA 3FMQA 1B8IA 5FB2A 4C2TA 2FXAA 5CPRB 1ETKA 2ISYA 4RLFA 2QA4I 4CGZA 1R4NB 2Y9ZA 2O7OA 3K6GA 4A6DA 1O4XA 3LWFA 3NAUA 2OD5A 1Y6IA 2BVLA 4PFPA 1XDSA 1B9MA 2F5CA 3DBRB 3VDXA 1RZ4A 5JLWA 1LE8B 4UUSB 2A61A 5E3NA 3L1PA 2ESNA 3OWTA 2LR8A 3P9KA 3H35A 2PMUA 2XPVA 1ZGAA 3IL2A 3FXQA 1Y0UA 4N4NB 1CF7B 4BE1A 1WJ5A 2NYXA 2X1CA 3U9GA 3RDIA 1J75A 4G7OF 5IT9Z 1V4RA 3DCFA 1G3YA 2IXSA 3F9KA 1RKTA 3FXKA 1HKTA 2V79A 2OA4A 2LKSA 3RKWA 2W7NA 4EGZA 1OCCH 2VI6A 3CDIA 3WE2A 3MMYB 4Y4RA 5IYCJ 2DTZA 4HSTA 3OYIA 4FQGA 4QPQA 2HQRA 2XAQA 2QUFA 3E0JB 1SAXA 1W0TA 3ZR8X 3QYFA 4A3EJ 3OYAA 4M9ZA 5J6XA 4HX8A 4L5IA 2VE8A 1VQOI 4CXFA 4HDVA 2VKVA 4KIGA 1QQIA 4XKCA 3MN2A 3H3VK 1G59A 3GMEA 5EEGA 1YIJI 2VQGA 2XB5A 3O3KA 4G94A 1VQPI 5LHGA 5FKLA 1KQ9A 1X2MA 2QQAA 1LVAA 2OF7A 3WTSC 3IRRA 2YR2A 2MA3A 3KP7A 1Z7LA 2MG4A 2WB1A 3I71A 1J2XA 4HNUA 2Y69H 1W5SA 3DEEA 4LLGF 3TO7A 2CQ7A 1A31A 4H0EA 4EEFG 1AOYA 2W00A 4BXXJ 5FO5A 2O61A 2X6YA 1WJDA 3A1YA 2JN6A 2DODA 3PL8A 4R79A 5J8FA 1JXSA 1HA8A 2CUZA 5E3OA 2E1CA 2FBIA 3MWMA 3H0GJ 3PIOF 3BTCA 4A12A 2E5NA 1S6LA 1IV8A 4U7BA 2R5YB 3S93A 1S7AA 2ZCWA 5HS9A 3RJPA 3CMAI 1NK3P 3KIOA 2JUGA 4A6EA 1WZ2A 4YFXF 5LFAA 1UAAA 2BW3B 1WJEA 4OMZA 3J81K 2V6CA 3EDPA 1MBEA 2STWA 4E7SA 1REPC 3KZIC 2R0QC 5ED4A 2ZMEA 1IN6A 3AL0C 3ML6A 1WFXA 3ESWB 4A93J 3KEOA 4NC7A 1SD7A 2E36A 1P7IA 3HGGA 4I0AA 2H8WA 5GTIC 1I39A 3UR3C 1Z91A 1BR4A 3BR5A 1P4AA 4CH7A 1IJWC 2DT6A 4DOZA 1IN7A 3KEYA 2R7XA 2D45A 2XRLA 1T6SA 3QP5A 1TZLA 2Q2EB 1YS7A 1AWCA 4L9JA 4OAYA 3ZMUA 3QODA 1WI9A 4ZDPA 5J4YA 1TT0A 5KCMA 4OIQF 1LE8A 2WAEA 5M5YJ 4UUSA 5JHUA 3P5JA 1YIOA 5F27A 2IJLA 1ON2A 3KX2A 3ZRGA 5M3FJ 4RS8A 4KT5C 3TW7A 5JFRA 4IJAA 4II2A 1X3UA 2BYVE 3RZDJ 1CF7A 3VSKA 2HPMA 1DU0A 3QPHA 4XN0A 4CCOA 2NVTJ 4C3JJ 1A35A 2IA2A 5TRDA 1ACIA 1JE8A 3TW6A 3B73A 3H9GA 4HQEA 2DDAA 3ABUA 3CF2A 1WJAA 2DFIA 1I6XA 5ILSA 2HEOA 2VT3A 1DPUA 2KQRA 3JSOA 3RYPA 4IHVA 1NTCA 4HAMA 3ONQA 3GVAA 2D2WA 1D1BA 3JAMZ 1ZRCA 1B9NA 3MCZA 1HDPA 2V1NA 3I58A 3KYCB 3W2VA 3BLYA 5IOZA 2CV0A 2KJCA 2VLAA 1EA3A 2PQ8A 5LD2C 1VQ5I 2XROA 1KU7A 2WY7Q 2HTSA 2LKXA 4EJVA 3JRFA 3FKIJ 1XMXA 4JX5A 2L7MP 3L2QA 4U88A 2RQQA 2CQQA 2Q8KA 4U87A 4A69C 2DA3A 1IO2A 2LLKA 3SJMA 1Z7UA 1IF1A 4IQ4A 1WWXA 3L2VA 1TT5B 1OLTA 3KYLA 1EV7A 1BW6A 1USTA 1ZYRF 2W25A 1F36A 1NHAA 1FBQA 2M1BA 1O57A 3CMYA 1P9QC 3CF5F 2CV1A 3LSGA 3A02A 1JGGA 1EH7A 1R1UA 1S29A 2I8DA 2JT1A 2PI0A 4JYKA 3HPGA 2ME0A 3I53A 1UFMA 2GA2A 2FE3A 2P0WA 3HKZN 1I5ZA 5E8IA 1ZG1A 2KKOA 4BJ5C 2FA5A 4HOBA 4JP0A 3CCEI 4IX7A 1ZREA 1DGRM 4B8XA 5FRNA 4IOAF 2MH2A 1SVOA 4O5VA 5IPAA 3IRQA 3ZP5A 5E79C 5KK1A 3WHCA 3OYFA 2O6GE 4M74A 3V7SA 2A5WA 3PJRA 1I6HJ 4L18B 4MQ9F 3RPUA 4RDUA 1UG0A 2O5RA 1LFUP 3OYBA 3P9IA 2HKOA 1SFUA 2BW3A 3CUOA 1DP7P 4CCNA 2LF8A 3CMMA 1Z67A 3GXOA 4BE0A 1K83J 1G8XA 3GLLA 1WH5A 1FSEA 3K2ZA 5DEQA 4RB3C 3PO3J 4LB5A 1V5FA 3ZQHA 4XQFA 5FLMJ 2A68F 1ETXA 3ASNH 3PUFA 5GP9A 2VPLA 1R4MB 2ECBA 2KDOA 5KVRA 3WU0A 1S3JA 4BAYA 1YFHA 3GTQJ 2P4WA 1QRYA 2DT7B 3PIPF 2PG4A 4D5FA 1M1EB 3R0JA 4F55A 1LFPA 3LQQA 2FU4A 2Q2EA 2UZKA 1G3SA 3M8EA 4IHSA 2KP6A 5FLVA 3WGHA 3LAPA 2IGMA 1UG2A 2AQEA 2CU7A 1SFKA 1GV5A 3WTXC 3W2AA 5LEJA 1STZA 2E7XA 1T2KA 1Z21A 3QYBA 3GTKJ 3KCCA 2YSRA 1YW9A 1IN8A 2HZTA 3TO9A 1IC8A 1ZRDA 1TQIA 3FHNA 4XLPF 2R4GA 3MZ8A 4I2OA 4PCQA 3NRVA 1TQMA 3LSRA 3F8FA 3K9TA 5H20A 5H2FC 2DW4A 4D7MA 1N77A 1BN5A 3I4MJ 3OYJA 2QCOA 3DPLC 3OS2A 3FM3A 4GGGA 1H88C 4ZDLA 3QP6A 3F22A 1R36A 3OYHA 2V9VA 3WHBA 3SZTA 3TL4X 2EA4A 3F8CA 2XKOA 3AG4H 2VXZA 2L9VA 3C7JA 4KFCA 3H3UA 2BZTA 2XDVA 1LPQA 4E7IA 2M4GA 2GBYA 2WC2A 1J7KA 1P7JA 1Q1VA 2BVMA 2DFHA 1E17A 2XIGA 2R7FA 4FT8A 2O8KA 4ZC3A 1XC5A 3JRBA 1LDDA 4V2FA 4P55A 4E4HA 1G3WA 4OWRB 1YS6A 2K85A 3Q9VA 2CGPA 1U3EM 3IH3A 2L4MA 2EA2A 5GAGJ 1ZRFA 2NVQJ 1BM9A 5JR3A 2XAHA 4EATA 4LJZF 3U2RA 4A3JJ 2R7OA 3TP3A 2CFXA 1T0FA 2X51A 2K3PA 4YIFA 2DFEA 1SVMA 1FP2A 3BR3A 4JQFA 1J9IA 1TWFJ 3ULQB 4UNOA 3O8HA 2EFNA 3KE2A 4U0VA 1IV6A 2EZLA 3ZN1A 3O2PE 5D5UB 3CLQA 1IXRC 2XGXA 4M9SA 5ICCA 1B4AA 3AG3H 3Q9SA 4FE7A 2H94A 3EQLF 4YG2F 3LA2A 4AC0A 1DGWY 1MSFC 3QRFF 4MEXF 1QVUA 3KPHA 4BBSJ 5DCMB 3ABKH 2KMUA 4XKBA 3BT9A 3KP5A 3GBGA 5ICGA 2HDWA 2QEXI 2TRTA 4IPAA 5HNFA 2EFQA 3PFIA 3LMMA 5EZHA 2M34A 3RPQA 3CCVI 3BR1A 4XKWA 5BPIA 1RUNA 4PJLA 1XSXA 3LAJA 3HOUJ 5E1ZB 2Y48A 5KAFC 2HPIA 1OKRA 3TDUC 3CC7I 3CCJI 3S32A 1Y8RB 2YU9J 2JA6J 3ZOBA 3QAHA 3HOXJ 3PNVA 3V4GA 4XRMA 2IAIA 5FKKA 2GXAA 2E1MB 2IP2A 3OYDA 2JRTA 2VB6A 1IN4A 3HHHA 3H36A 1X3ZB 5B5EC 3OIQA 1LEBA 3QPSA 3CC4I 2UUZA 3CDHA 5CVJA 3I4NJ 3ZQQA 2M45A 3PSFA 4HSRA 2E2HJ 3JR9A 2DAOA 1IZ1A 4HEA2 1IUFA 2CJJA 2YUSA 2DI3A 3MZHA 1PDNC 3LOCA 4I76A 3QYEA 2NRAC 1ZLKA 2ZNYA 2KLOA 2NS8A 2P6SA 1JHFA 2ACJA 1K78A 1IW7F 4HX7A 1I3QJ 4RAZA 1P2FA 1TWAJ 4F91B 4IHWA 2EPFA 3K4MA 3TBIA 2A05A 4ESFA 2ZNZA 1XN7A 2L01A 4HF0A 3OR1C 2HOAA 4ZTJA 2V9KA 1MBHA 1W36C 3OYEA 4WXHA 3K70C 2DLLA 2K9MA 2EB7A 4AWXB 1W7PB 2P5KA 2YX4A 3DKXA 3IH4A 2PJPA 2LF7A 2BXZA 4UVCA 3CCSI 1JJ6C 1P4XA 2VQHA 4LFUA 5D5XB 3H5AA 2W48A 2JTVA 5DDGA 1HW1A 4UVAA 1BA5A 3IAM2 1YTYA 3WTUC 2QBYA 4KIFA 3QPTA 1Q1HA 4A5MA 4BUPA 1LNWA 4XMYA 3E6BA 1OCTC 2JQ7A 4YEJA 2CWEA 4CHUA 3ZGKA 4WXCA 2MH9A 3BTIA 1UZCA 2L5QA 2RKHA 2X9DA 1TW2A 2EWNA 2W1OA 2H6CA 4EGYA 4B43A 1HC8A 2G7HA 5GADJ 1QVTA 1BJAA 1EH6A 1U9NA 2IS2A 3WTTC 2R3SA 1W1WE 2R7VA 2QM3A 2XF6A 3D5SC 1U5TB 5ICEA 1OJLA 1SANA 4ZH4F 1VF9A 4MHGA 2EH3A 2MLGA 4GDFA 5M5WJ 1WJCA 5DCMA 3GX4X 1B6AA 2HGCA 5BMZA 3A2KA 1TL8A 4ZJZA 1JUSA 4JX6A 2JA7J 1Z0XA 3W6VA 2OUMA 2V1XA 3REOA 2DOEA 5ICFA 1IN5A 3LSKA 3G1MA 4DYCA 4ENJA 1AA7A 5F6FA 2JA2A 3DP7A 1ETQA 3J7ZI 2KIUA 3HEFA 4LITA 2XGCA 3FMSA 2HOEA 3RKYA 4AIHA 3KZYA 3HB9A 1R6RA 2XKPA 2DA1A 2FMLA 3GWZA 4BL0B 1U8BA 2KZVA 1KQ8A 2R7UA 3B6CA 3BWGA 5HVQC 3OIOA 1HXDA 4IRIA 1OCPA 3FK7A 2W85A 5HODA 3W6KB 3MKYB 1U9OA 1SEUA 1JKRC 3OL3A 1MDMB 1OYWA 4MFDA 3VYSB 3FXOA 5E3MA 2KIQA 5HS7A 4LMYA 4IRHA 3CUQC 1UB9A 4M3GA 5CQEA 4UUVA 4E7HA 5J40A 1QO0D 3ZMVA 2P81A 1ZR2A 1ETYA 2QKLB 1Y39A 2G7UA 3HIFA 1ZH5A 5FLXZ 1SD6A 2GQQA 3IV5A 3FHZA 3KFWX 4IOCF 4II3A 3SEQA 1HDDC 2QF7A 3GTJJ 3A0HC 4XL9A 4Z6YA 3L2RA 3V8JA 1YI2I 1LJ9A 1WHUA 2RREA 4XLHA 2RN7A 3V8KA 1P4WA 3Q3SA 2BY1A 1XS9A 3QU3A 2XGDA 3WTYC 2XSJC 4XNFA 3GF2A 2HDDA 2VBXA 3CCQI 2ZXWH 3FDYA 3WTVC 4Q4ZF 2WTEA 5E20A 1ZK8A 2Y30A 2IA0A 4BQAA 1UELB 3IHUA 3CMEI 3JSPA 1U8RA 3X2QH 5FD6A 1W7PA 2BOLA 4MFEA 3NWTA 4NDLA 1MGTA 1UHSA 2JK3A 4M6YA 3ERED 4PSWA 1F43A 1FT9A 1OCRH 4OMYA 1HW2A 3ISPA 3VEPA 3I54A 2VJIA 4XRSG 1QZYA 3IKVA 2K7LA 3DEWA 1QPMA 3RKQA 1N78A 3ZN0A 4OOIA 2M8EA 3AFHA 1H0MA 3HOSA 2LMDA 4Y33A 3I55I 3FBIB 2L7ZA 2GWRA 1I27A 4E6KG 1MSEC 3RSNA 3BC8A 2VJ5A 4F92B 2L3DA 2DK8A 2HU9A 2VBZA 1ITYA 1MKMA 1OMIA 2M30A 4RAGA 2VE9A 2IS1A 3G4SI 2L4AA 3IWFA 5IT9K 3VWBA 1D3YA 4V19K 2OTJI 2DYRH 3HGYA 2FEZA 3HL2A 1BJZA 2JRMA 2VKHA 5GAHJ 1ZG5A 1TTYA 3UKGA 1DPRA 2CO5A 1U5TA 5M3MJ 4C3IJ 2N8GA 2DQRA 5HDGA 1R22A 3BJAA 3A03A 4YIIA 2NOJB 5IT3A 4WF2A 3BR0A 4EM0B 1VFCA 2HKXA 2X6WA 2EZHA 2BY2A 4XIDA 3HDDA 1U5TC 1H9GA 2A6EF 3ZMSA 4Y13A 4ON0A 5F1RA 4IHYA 4RGSA 4FETA 1BBYA 4UVBA 3Q0UA 2OCEA 3KP3A 5FFXA 5DUIA 1ZN2A 1YX3A 2A5YB 2X6XA 4RAYA 4BY7J 1V3FA 1J59A 5EEAA 2KRHA 1GDTA 2DO7A 2V7FA 1TBXA 1RNLA 3JREA 1QGPA 1GVDA 1MMDA 2YPRA 4DYQA 3BG5A 3GFLA 2NNNA 3HZJA 2F6CA 2EFOA 3DTEA 5K7HA 2ZJQF 1TNTA 3IP4B 2RDPA 4A3KJ 2JVHA 3N97A 1MDMA 3WU1B 2LRDA 3GFMA 1C0WA 1YX5A 4NNJA 3SEZA 4I98B 4XN3A 1R1VA 2JPCA 3LSMA 4Y3OA 2FBHA 5F64A 3PNTA 1ZELA 4PJ0C 4U0WA 4EMSA 3FXLA 2L7FP 5FD5A 1BI3A 1X19A 1X4OA 2EZIA 2QKMB 5CVRA 1BOBA 2CYYA 3I56I 3ZCOA 3OOPA 4MO7A 4W97A 2W57A 5J47A 3OSFA 4RM3A 3D0SA 1IDZA 1MBFA 2O0YA 2PEXA 4LIVA 4M6VA 2WA0A 3OS1A 5HLTA 1R58A 2L2OA 3EUHC 5LBQA 4PSXA 2RQPA 2WAFA 4R8HA 3CO7C 2R7QA 4UY8I 4WXDA 2V6EA 1AU7A 3E3VA 5CVVA 2XRNA 2DN0A 1MBGA 5EGOB 3BJOA 4B3AA 3BZCA 1U2WA 1FYMA 4BQQA 3WTZA 1HBXG 2LD5A 3S2WA 3BQYA 2Z1DA 2UXXA 2XV4S 2LREA 4A3BJ 4HDUA 3DWLE 2V26A 2ZBKA 5DUKA 4L0ZB 2RC4A 1OYYA 5EG0A 2KDZA 3MD2A 4S04A 1P6RA 2P5LC 4RAFA 4PJMA 1O7FA 3WU2C 1TWHJ 3M1EA 3I5UA 3FWEA 3T1BA 3BG6A 4YELA 1D8JA 3DLLF 5HDKA 2EBIA 3BY6A 1KU9A 1SD5A 3H92A 3DBHB 5AONA 2ZC2A 2HVSA 5GPCA 1XTAA 3HKZA 3NWSA 1F5TA 3BPXA 2FMYA 3I59B 5CLSA 2BV6A 3SZPA 2QYOA 1KU2A 2EIKH 1LUJB 1JI8A 5FFZA 1R5ID 2Z2SB 1JJ8C 2F4OB 2MSYA 2A6HF 1ZAOA 5DCFA 4A3IJ 3F6VA 3JAMK 3HTSB 1R7JA 2KISA 4M3FA 3WE3A 1T8IA 2ISZA 1PJRA 2STTA 1MMAA 1MBJA 1W5TA 3QQAA 4ZYAA 3CJNA 1N75A 2ZSIB 3F0CA 3LFUA 3NQOA 2K9SA 4BXUA 4DYRA 2JA5J 4AUXA 2VODA 3DTKA 5D4RA 3LSIA 2CS3A 5DYMA 2JPBA 2HQNA 2VASA 3FMRA 3CO6C 2W82A 4DJAA 3GW2A 3K4JA 1BC8C 2DJIA 1FOYA 3HRSA 4Y52J 3UNGC 1YYVA 1EKEA 3HUGA 3K69A 5E3LA 4E7ZA 4DBRA 1R49A 5J1YA 1L0OC 3GLXA 3W6JB 2JSCA 3MZYA 3LSHA 5J8CA 1HLVA 2Y0SN 3M7GA 5FKNA 3S17J 1FPQA 3BPVA 3FXRA 5L3EA 1GHCA 3LA7A 1KYWA 3RYRA 1USSA 1ORKA 2L02A 1LEAA 3K4BA 2Y0MA 3D5LA 5F04A 5IP6A 4P1WA 3EYIA 3IKTA 2LTPA 2HDCA 2ZO4A 4EV0A 1W5CC 1K6OA 1GVJA 2R7DA 1X4PA 2DYSH 2P5VA 4QSHA 2PJRB 3LA3A 2L9NA 1RIOH 4NB5A 2L9SA 3MVPA 4F7ZA 3QOPA 3RKXA 5CVUA 2FNAA 2LY1A 2WAQN 3E6DA 4ASNA 4F3QA 2H8RA 1X1DA 5K7ZA 3J7YJ 3E6MA 1BOAA 3J7AY 1G6NA 2DMTA 4ZZDA 3ZQIA 2P7CB 4ZYEA 4YFNF 2TCTA 2LNBA 3TQNA 2EZKA 5EGOA 2LC2A 2ZFUA 4RGRA 1Y0NA 1V5GA 2LH9A 5KHDA 4OIOF 3GZNB 5GAEJ 3GTGJ 1IDYA 2RNJA 5LGTA 2F5VA
chains in the Genus database with same CATH topology
2PFBA 1SMTA 4CZZA 2D1VA 1MD0A 4M9XA 5D6EA 4R1HA 2GXGA 4HYEA 1D8KA 3FM5A 3I59A 3E6CC 3B02A 3COAC 2L54A 5D6FA 4LK0F 1IRFA 1UHMA 2ZFWA 4G9YA 2H27A 4RB0A 2QZ8A 3ELKA 3SXYA 4A5NA 5LGUA 4KDPA 4U7DA 1K78B 1S7OA 1IRGA 4MTDA 5E8GA 4A0YA 1B1BA 4MTEA 2Y75A 1HSTA 2DU9A 2DQLA 2GZWA 4S05A 3F72A 3WGGA 3H3ZA 4BHPA 3DQVC 4FX0A 2HR3A 3PQKA 3DF8A 5E1WA 2QBYB 2FBKA 4P9UA 4KN4X 4N0BA 4EQQA 2ZJ2A 5CJ9A 4FX4A 4KMUX 2IRFG 1R1TA 2BBYA 1XMKA 1XDUA 2OQGA 2DPDA 4Q5SF 4IHTA 3DFGA 2A3SA 3E97A 2H09A 2BEOA 2EV0A 3LSTA 4HQMA 2MC3A 4MQVA 2YU3A 3KLOA 1MJ9A 4PGHA 3R60A 2NAZA 2F5DA 4RGXA 3FF5A 2F5EA 3K1NA 3KP4A 3T0YA 2GIVA 4TV7A 2ETHA 3CLOA 3CUQB 2NS0A 5K5RA 2P7VB 2CQKA 2QVOA 4I7HA 4LGWA 3HSEA 1LDKB 2Q0OA 1G4DA 3ZMTA 1J5YA 5LLQA 2E1NA 4ZZLA 3F8BA 1RI7A 2QLZA 4I09A 4LB6B 5K1YA 4A0ZA 5LRRA 3L2CA 3TOAA 2MLKA 5L3GA 3F8NA 2VT2A 2FF4A 4HW0A 3NEUA 3V8LA 1YW8A 3GZ6A 3I0TA 1D5VA 1BI0A 1ULYA 3HSFA 2VC1A 2X4HA 1KQ0A 3L09A 3OV8A 5K5QA 4YFKF 3ZMZA 5HLGA 1IXCA 2LSOA 5JI6A 2Z5UA 1EH8A 4EJOA 4EJUA 5A2QK 1XCVA 1FYLA 2P6TA 5BS6A 1XD7A 5A2QZ 5JVTA 3C1DA 1IAWA 1ZGJA 5LHIA 4ENNA 3LFKA 5D5VB 5L3FA 4GYGA 2AS5F 1I1SA 1HKSA 1O3SA 1QZZA 4HX4A 1U78A 4ZYHA 2RV8A 1BI1A 2GXBA 2G9WA 1R5GA 4HV5A 4JBAA 1LB2A 1F4KA 1CGPA 5FGMA 5K5OA 1O7LA 1H9TA 4G6DA 3MEXA 2XUBA 3K1PA 3L9FA 4FHTA 4DQ2A 5E17F 3CUQA 4L9VA 1L3LA 5LEKA 4Q48A 3DEUA 4OIPF 3IWZA 5FLXK 1O3TA 5L3BA 4G7HF 3HHGA 1T39A 1TW3A 1GXQA 2P8TA 2KRFA 2BE5F 1B59A 4N9HA 1QNTA 2NNYA 1G3TA 4CICA 3F8MA 4M71A 2FNPA 2OU2A 4EM2A 3JTHA 2CSOA 2IVMA 4A0XA 4IF4A 4GYIA 5HLHA 5D8LB 2VBYA 1FNNA 2UXNA 2ELHA 2VONA 4LG0A 1WSUA 3KEQA 2HTJA 2PMHA 3L00A 2KIMA 2WV0A 1SMYF 3WG9A 4ESJA 4AD9A 5ILVA 1ZARA 2W24A 1T38A 1I1GA 3RIRA 4JK1X 4K2EA 2D1HA 1YO5C 2B0LA 3TO6A 3SQNA 3L7WA 1LDJA 1BIAA 2KJBA 4BHCA 1TQPA 3MFKA 5LRSA 2YX7A 1PP7U 4I0BA 4BYYA 1MZBA 4EJWA 1FC3A 2QQBA 4HV6A 2ADUA 4OINF 2VOPA 1XGSA 4LD5A 3DKWA 1U6GA 1FSHA 3KLNA 1UCRA 1YQAA 4GCVA 1KYZA 3HRTA 4CO8A 3EUHA 3C18A 4ENKA 3ZQ7A 1XGNA 1S8NA 2CW0F 1LQ1A 1A04A 5DV5A 4PGGA 2DBBA 2V1UA 3E5UA 5D4SA 3WGIA 4P9FA 3MAJA 2HYFA 4L5JA 3KP6A 3AAFA 3R0AA 2GA1A 3GEZA 4AIKA 1JGSA 2EV6A 1WQ2A 1SFXA 4P96A 3EYYA 4KIBA 2XHKA 1TNSA 3BROA 2LKPA 1FBUA 4EVIA 5BQTA 1Z05A 3J81Z 2XAGA 4HLYA 4G8XA 4Z2YA 1ODDA 2PBIA 2VBWA 4LK1F 3HRMA 2WWYA 2F5FA 1DUXC 3ZMDA 1KA8A 3K0LA 5CVIA 4HF2A 2O03A 1K7AA 2IA1A 3HTUA 1XSVA 2FRHA 2VN2A 5L3CA 5LGNA 4I01A 4LLNA 4L9NA 5HOOA 3O6BB 2X0LA 3G3ZA 1XCBA 3TDZC 2IT0A 5AIQA 1FX7A 2OAZA 4NQWA 3V7RA 3KP2A 3TOBA 2QQ9A 2HFHA 3I64A 2K27A 4HF1A 4NHJA 1IXSB 1FZPB 3IC7A 1ZLJA 1YW7A 2OQRA 5HS8A 4IVNA 2RGVA 1VTNC 2M87A 2QWWA 4IRGA 5BPDA 2E7WA 1O3RA 3T8TA 3DV8A 3F6OA 1Z9CA 2KIFA 3DXJF 3HYIA 3M9AA 6PAXA 2BGCA 1BIBA 1OPCA 4DNCA 3F3XA 4MEYF 4XBFA 2FQ3A 1DDNA 4AVPA 1FYKA 4XSZF 2C6YA 5L3DA 3R6SA 2JZYA 4PDKA 2HS5A 3JTGA 1KU3A 1FOKA 3QU6A 3J7AO 5E18F 2HWVA 3HOTA 4IXAA 4UHTA 5BOXA 4Y17A 3BDDA 3U1DA 3FX3A 2GAUA 4KMFA 1W4MA 2J5OA 1WRJA 1UHWA 3R4KA 1GXPA 2J5PA 4OU0A 2K4BA 1HKQA 1FBSA 4PZJA 2UWMA 1MJAA 3SFZA 3KETA 1PP8F 2EK5A 3WTWC 2IW5A 4RB2C 1ONVA 3TGNA 2XAJA 3V7CA 4QWQA 2OBPA 3G73A 4LLLA 1Z1DA 2HYGD 2Z33A 1HSJA 1KGSA 3T5XA 4A2UA 4XRFA 2Z9OA 1SD4A 5H6RA 3C3WA 4UXNA 5AIPA 1XMAA 4RB1A 3GFIA 4M6XA 3GFJA 2EV5A 1XGMA 1T98A 3GZ5A 3K1MA 3PQJA 1IUYA 2COMA 3BZ6A 2K4JA 3T8RA 4ZYGA 4E70A 4EJTA 1F1ZA 3CTAA 4UV9A 2EFWA 2CG4A 4O6JA 4HA8A 1JHHA 2Z99A 4HBLA 4GXOA 5HDNA 3BJ6A 5D8KB 5CYVA 5E1XA 4G7ZF 4ZYDA 2IPQX 4O3MA 1FWZA 1XSDA 3ECOA 4L9TA 4D0PA 2XVCA 3GO5A 2FOKA 4M73A 1FLIA 3HSRA 4ETSA 3FZVA 4HLXA 3F23A 3I4PA 4XSXF 1RUOA 2W84A 5TJJA 3ZPLA 4MGRA 4GO1A 4KICA 4KA4A 4P5OA 2ESHA 1R00A 1J0RA 2VOOA 4B09A 1QBJA 2DPUA 4BHBA 3EETA 3RTRA 2OZ6A 2F2EA 3FXUA 3SHFA 1E2XA 4KUMA 1BI2A 4KN7X 1TLHB 3M8FA 3VFZA 4AIJA 4WX9A 1Z6RA 2DT5A 5ILUA 1XB4A 2OZUA 2MD5A 5DD4A 5LHHA 4LG0B 3P9CA 2A69F 3LQRA 5H6QA 4RGUA 4Q47A 5DD8A 2M5WA 3VODA 3N4MA 4M72A 1HW5A 1K79A 2A07F 3J80K 3F21A 4HZFA 5HLIA 2VC0A 3J80Z 3ABTA 1FY7A 2LDUA 1R5HA 4BNCA 3BP8A 5ERIA 4KYWA 1R23A 3GYHX 1FP1D 2FSWA 2EJRA 4WK8F 1O3QA 3TKYA 2MBFA 3BOQA 1WKMA 5D5WB 1HQCA 4XLNF 3ECHA 4N9IA 1YLFA 3KZZA 1ZHFA 1ON1A 1XGOA 1BC7C 4EM1A 3R61A 3WODF 2ZKZA 5EEHA 2H6BA 2QENA 2O3FA 2TDXA 4G6QA 1SFEA 3E5QA 3VOEA 2V1DA 4UV8A 3P7NA 2PLYA 2Z3YA 2XAFA 1OR7A 4ENMA 4CYDA 1F9NA 4I02A 4WWCA 1W7PD 3DPTA 3E5XA 4ESBA 1P92A 3Q5FA 2PN6A 2K86A 3ROUA 1OYIA 2EFPA 3GUDA 2AXLA 1YG2A 3HRUA 2XASA 4MNUA 2K02A 3RI4A 4QLCU 4U0YA 4KNYA 4BH9A 1MJBA 4CDGA 1PUEE 2O8XA 3MQ0A 4L0YB 2ZMEB 1ZG3A 2ZXJA 4OIRF 4WCGA 1Z6TA 2DTRA 3JW4A 2DK5A 4Y15A 3VB2A 3FMQA 2RVCA 5FB2A 2FXAA 4CGZA 2ISYA 4A6DA 3LWFA 2OD5A 1XDSA 1B9MA 2F5CA 1RZ4A 2A61A 2ESNA 3P9KA 2PMUA 1ZGAA 3IL2A 3FXQA 1Y0UA 1CF7B 2NYXA 3U9GA 3RDIA 1J75A 4G7OF 5IT9Z 1V4RA 1G3YA 1HKTA 2V79A 2OA4A 3RKWA 4EGZA 3WE2A 2HQRA 2XAQA 2QUFA 1SAXA 4M9ZA 5J6XA 4HX8A 4L5IA 2VE8A 4CXFA 4HDVA 4KIGA 1QQIA 5EEGA 3O3KA 4G94A 5LHGA 1KQ9A 2QQAA 1LVAA 3WTSC 3IRRA 2YR2A 2MA3A 3KP7A 3I71A 1J2XA 1W5SA 4LLGF 3TO7A 4H0EA 1AOYA 2O61A 5FO5A 4R79A 5J8FA 1JXSA 2E1CA 2FBIA 3MWMA 4A12A 1S6LA 4U7BA 1S7AA 2ZCWA 5HS9A 3RJPA 4A6EA 4YFXF 4OMZA 3J81K 2V6CA 3EDPA 2STWA 1REPC 5ED4A 2ZMEA 1IN6A 3ML6A 3KEOA 1SD7A 4I0AA 1Z91A 1P4AA 1IN7A 2D45A 1T6SA 3QP5A 1YS7A 1AWCA 4L9JA 3ZMUA 1WI9A 4OIQF 5JHUA 1YIOA 2IJLA 1ON2A 4RS8A 4KT5C 5JFRA 4IJAA 1X3UA 2BYVE 1CF7A 3QPHA 2IA2A 5TRDA 1JE8A 3B73A 4HQEA 3ABUA 2DFIA 1I6XA 5ILSA 2VT3A 1DPUA 3JSOA 3RYPA 4HAMA 3GVAA 2D2WA 3JAMZ 1ZRCA 1B9NA 3MCZA 3I58A 2KJCA 2PQ8A 2XROA 1KU7A 2HTSA 4EJVA 4U88A 2Q8KA 1Z7UA 1IF1A 1WWXA 1EV7A 1USTA 1ZYRF 2W25A 1NHAA 1FBQA 2M1BA 1O57A 2PI0A 1EH7A 1R1UA 1S29A 2JT1A 3I53A 1UFMA 2GA2A 2FE3A 5E8IA 1ZG1A 1I5ZA 2KKOA 2FA5A 4HOBA 1ZREA 4B8XA 2MH2A 3IRQA 4O5VA 3ZP5A 5KK1A 2O6GE 4M74A 3V7SA 4L18B 4MQ9F 3RPUA 3P9IA 2HKOA 1SFUA 1DP7P 3CUOA 2LF8A 3GXOA 3K2ZA 4RB3C 1FSEA 5DEQA 4LB5A 2A68F 5KVRA 3WU0A 1YFHA 1S3JA 4BAYA 2P4WA 2PG4A 3R0JA 3LQQA 2FU4A 2Q2EA 2UZKA 1G3SA 3M8EA 4IHSA 3WGHA 3LAPA 3WTXC 5LEJA 1STZA 2E7XA 1T2KA 3KCCA 2YSRA 1YW9A 1IN8A 2HZTA 3TO9A 1ZRDA 1TQIA 4XLPF 4I2OA 4PCQA 3NRVA 1TQMA 3F8FA 3K9TA 5H20A 2DW4A 1BN5A 3DPLC 3FM3A 4GGGA 3QP6A 3F22A 1R36A 2V9VA 3SZTA 2EA4A 3F8CA 2XKOA 2VXZA 3C7JA 4KFCA 3H3UA 2WC2A 1J7KA 1E17A 2XIGA 2R7FA 4FT8A 1LDDA 4P55A 1G3WA 1YS6A 3Q9VA 2CGPA 1U3EM 2L4MA 2EA2A 1ZRFA 1BM9A 5JR3A 2XAHA 4LJZF 3U2RA 2CFXA 1T0FA 4YIFA 1FP2A 4JQFA 1J9IA 3ULQB 4UNOA 2EFNA 3KE2A 4U0VA 3ZN1A 3O2PE 5D5UB 1IXRC 2XGXA 5ICCA 4M9SA 1B4AA 3Q9SA 2H94A 3EQLF 4YG2F 3LA2A 3QRFF 4MEXF 5DCMB 3KP5A 5ICGA 4IPAA 2EFQA 3PFIA 3RPQA 5BPIA 1RUNA 1XSXA 3LAJA 5E1ZB 2Y48A 1OKRA 3TDUC 3QAHA 3V4GA 2IP2A 2JRTA 1IN4A 3HHHA 1LEBA 3CDHA 5CVJA 2M45A 2DAOA 1IZ1A 2DI3A 3MZHA 1PDNC 2NRAC 1ZLKA 2ZNYA 1K78A 2P6SA 1JHFA 2ACJA 1IW7F 4HX7A 4RAZA 1P2FA 4ESFA 2ZNZA 1XN7A 2L01A 4HF0A 4WXHA 2DLLA 2EB7A 4AWXB 1W7PB 2P5KA 2YX4A 2PJPA 2LF7A 4UVCA 1P4XA 4LFUA 5D5XB 5DDGA 2JTVA 1HW1A 4UVAA 1YTYA 3WTUC 2QBYA 4KIFA 3QPTA 1Q1HA 4A5MA 1LNWA 3E6BA 2CWEA 4CHUA 4WXCA 2MH9A 2RKHA 1TW2A 2EWNA 2H6CA 4EGYA 2G7HA 1BJAA 1EH6A 3WTTC 2R3SA 2QM3A 1U5TB 5ICEA 4ZH4F 4MHGA 2MLGA 5DCMA 3GX4X 1B6AA 2HGCA 5BMZA 2V1XA 3REOA 5ICFA 1IN5A 4ENJA 5F6FA 3DP7A 2KIUA 3FMSA 2HOEA 3RKYA 4AIHA 3KZYA 2XKPA 2FMLA 3GWZA 1KQ8A 3BWGA 5HVQC 1HXDA 4IRIA 2W85A 3W6KB 1MDMB 1OYWA 5HS7A 4LMYA 4IRHA 3CUQC 1UB9A 4UUVA 1QO0D 3ZMVA 2G7UA 3HIFA 1ZH5A 5FLXZ 1SD6A 2GQQA 3FHZA 3KFWX 3V8JA 1LJ9A 2RN7A 3V8KA 1P4WA 3QU3A 3WTYC 3GF2A 2VBXA 3WTVC 4Q4ZF 2WTEA 5E20A 2IA0A 4BQAA 3IHUA 3JSPA 1U8RA 5FD6A 1W7PA 1MGTA 4M6YA 3ERED 1FT9A 4OMYA 1HW2A 3ISPA 3VEPA 3I54A 1QZYA 3IKVA 2K7LA 1QPMA 3ZN0A 4OOIA 2M8EA 1H0MA 3HOSA 2GWRA 1I27A 2L3DA 2DK8A 2VBZA 1MKMA 1OMIA 2M30A 2VE9A 2L4AA 3IWFA 5IT9K 1D3YA 2FEZA 1ZG5A 1TTYA 1DPRA 2CO5A 1U5TA 5HDGA 2DQRA 1R22A 3BJAA 4YIIA 5IT3A 4WF2A 4EM0B 2HKXA 1U5TC 1H9GA 2A6EF 3ZMSA 4Y13A 4ON0A 5F1RA 4RGSA 1BBYA 4UVBA 3KP3A 5FFXA 5DUIA 1ZN2A 2A5YB 4RAYA 1V3FA 1J59A 2DO7A 1TBXA 1RNLA 1QGPA 2YPRA 3GFLA 2NNNA 2EFOA 1TNTA 2RDPA 3N97A 1MDMA 3WU1B 3GFMA 1C0WA 4I98B 1R1VA 2JPCA 5F64A 2FBHA 4U0WA 4EMSA 5FD5A 1BI3A 5CVRA 2CYYA 3OOPA 2W57A 3D0SA 2O0YA 2PEXA 1R58A 5LBQA 2RQPA 4R8HA 3CO7C 4WXDA 3E3VA 5CVVA 2XRNA 3BJOA 1U2WA 1FYMA 3WTZA 1HBXG 3S2WA 2UXXA 2XV4S 4HDUA 2ZBKA 5DUKA 4L0ZB 2RC4A 1OYYA 4S04A 1P6RA 2P5LC 1O7FA 3M1EA 3I5UA 3FWEA 3T1BA 1D8JA 5HDKA 3BY6A 1KU9A 1SD5A 3H92A 5AONA 1F5TA 2FMYA 3BPXA 5CLSA 3I59B 2BV6A 3SZPA 2QYOA 1KU2A 5FFZA 2A6HF 1ZAOA 5DCFA 3F6VA 3JAMK 3HTSB 1R7JA 3WE3A 2ISZA 2STTA 1W5TA 3CJNA 3NQOA 4BXUA 2VODA 5D4RA 5DYMA 2JPBA 2HQNA 3FMRA 3CO6C 3GW2A 1BC8C 3HRSA 1YYVA 3K69A 3HUGA 1L0OC 3GLXA 3W6JB 2JSCA 3MZYA 5J8CA 3M7GA 1FPQA 3BPVA 3FXRA 5L3EA 1GHCA 3LA7A 1KYWA 3RYRA 1USSA 2L02A 1LEAA 2Y0MA 3D5LA 3EYIA 3IKTA 2HDCA 2ZO4A 4EV0A 1K6OA 1GVJA 2R7DA 2P5VA 3LA3A 1RIOH 4NB5A 4F7ZA 3QOPA 3RKXA 5CVUA 2FNAA 3E6DA 4ASNA 3E6MA 1BOAA 1G6NA 4ZZDA 2P7CB 4ZYEA 4YFNF 2LNBA 3TQNA 4RGRA 4OIOF 2RNJA 5LGTA 2HEOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PFB A;  1SMT A;  4CZZ A;  2D1V A;  1MD0 A;  4M9X A;  5D6E A;  4R1H A;  2GXG A;  4HYE A;  1D8K A;  3FM5 A;  3I59 A;  3E6C C;  3B02 A;  3COA C;  2L54 A;  5D6F A;  4LK0 F;  1IRF A;  1UHM A;  2ZFW A;  4G9Y A;  2H27 A;  4RB0 A;  2QZ8 A;  3ELK A;  3SXY A;  4A5N A;  5LGU A;  4KDP A;  4U7D A;  1K78 B;  1S7O A;  1IRG A;  4MTD A;  5E8G A;  4A0Y A;  1B1B A;  4MTE A;  2Y75 A;  1HST A;  2DU9 A;  2DQL A;  2GZW A;  4S05 A;  3F72 A;  3WGG A;  3H3Z A;  4BHP A;  3DQV C;  4FX0 A;  2HR3 A;  3PQK A;  3DF8 A;  5E1W A;  2QBY B;  2FBK A;  4P9U A;  4KN4 X;  4N0B A;  4EQQ A;  2ZJ2 A;  5CJ9 A;  4FX4 A;  4KMU X;  2IRF G;  1R1T A;  2BBY A;  1XMK A;  1XDU A;  2OQG A;  2DPD A;  4Q5S F;  4IHT A;  3DFG A;  2A3S A;  3E97 A;  2H09 A;  2BEO A;  2EV0 A;  3LST A;  4HQM A;  2MC3 A;  4MQV A;  2YU3 A;  3KLO A;  1MJ9 A;  4PGH A;  3R60 A;  2NAZ A;  2F5D A;  4RGX A;  3FF5 A;  2F5E A;  3K1N A;  3KP4 A;  3T0Y A;  2GIV A;  4TV7 A;  2ETH A;  3CLO A;  3CUQ B;  2NS0 A;  5K5R A;  2P7V B;  2CQK A;  2QVO A;  4I7H A;  4LGW A;  3HSE A;  1LDK B;  2Q0O A;  1G4D A;  3ZMT A;  1J5Y A;  5LLQ A;  2E1N A;  4ZZL A;  3F8B A;  1RI7 A;  2QLZ A;  4I09 A;  4LB6 B;  5K1Y A;  4A0Z A;  5LRR A;  3L2C A;  3TOA A;  2MLK A;  5L3G A;  3F8N A;  2VT2 A;  2FF4 A;  4HW0 A;  3NEU A;  3V8L A;  1YW8 A;  3GZ6 A;  3I0T A;  1D5V A;  1BI0 A;  1ULY A;  3HSF A;  2VC1 A;  2X4H A;  1KQ0 A;  3L09 A;  3OV8 A;  5K5Q A;  4YFK F;  3ZMZ A;  5HLG A;  1IXC A;  2LSO A;  5JI6 A;  2Z5U A;  1EH8 A;  4EJO A;  4EJU A;  5A2Q K;  1XCV A;  1FYL A;  2P6T A;  5BS6 A;  1XD7 A;  5A2Q Z;  5JVT A;  3C1D A;  1IAW A;  1ZGJ A;  5LHI A;  4ENN A;  3LFK A;  5D5V B;  5L3F A;  4GYG A;  2AS5 F;  1I1S A;  1HKS A;  1O3S A;  1QZZ A;  4HX4 A;  1U78 A;  4ZYH A;  2RV8 A;  1BI1 A;  2GXB A;  2G9W A;  1R5G A;  4HV5 A;  4JBA A;  1LB2 A;  1F4K A;  1CGP A;  5FGM A;  5K5O A;  1O7L A;  1H9T A;  4G6D A;  3MEX A;  2XUB A;  3K1P A;  3L9F A;  4FHT A;  4DQ2 A;  5E17 F;  3CUQ A;  4L9V A;  1L3L A;  5LEK A;  4Q48 A;  3DEU A;  4OIP F;  3IWZ A;  5FLX K;  1O3T A;  5L3B A;  4G7H F;  3HHG A;  1T39 A;  1TW3 A;  1GXQ A;  2P8T A;  2KRF A;  2BE5 F;  1B59 A;  4N9H A;  1QNT A;  2NNY A;  1G3T A;  4CIC A;  3F8M A;  4M71 A;  2FNP A;  2OU2 A;  4EM2 A;  3JTH A;  2CSO A;  2IVM A;  4A0X A;  4IF4 A;  4GYI A;  5HLH A;  5D8L B;  2VBY A;  1FNN A;  2UXN A;  2ELH A;  2VON A;  4LG0 A;  1WSU A;  3KEQ A;  2HTJ A;  2PMH A;  3L00 A;  2KIM A;  2WV0 A;  1SMY F;  3WG9 A;  4ESJ A;  4AD9 A;  5ILV A;  1ZAR A;  2W24 A;  1T38 A;  1I1G A;  3RIR A;  4JK1 X;  4K2E A;  2D1H A;  1YO5 C;  2B0L A;  3TO6 A;  3SQN A;  3L7W A;  1LDJ A;  1BIA A;  2KJB A;  4BHC A;  1TQP A;  3MFK A;  5LRS A;  2YX7 A;  1PP7 U;  4I0B A;  4BYY A;  1MZB A;  4EJW A;  1FC3 A;  2QQB A;  4HV6 A;  2ADU A;  4OIN F;  2VOP A;  1XGS A;  4LD5 A;  3DKW A;  1U6G A;  1FSH A;  3KLN A;  1UCR A;  1YQA A;  4GCV A;  1KYZ A;  3HRT A;  4CO8 A;  3EUH A;  3C18 A;  4ENK A;  3ZQ7 A;  1XGN A;  1S8N A;  2CW0 F;  1LQ1 A;  1A04 A;  5DV5 A;  4PGG A;  2DBB A;  2V1U A;  3E5U A;  5D4S A;  3WGI A;  4P9F A;  3MAJ A;  2HYF A;  4L5J A;  3KP6 A;  3AAF A;  3R0A A;  2GA1 A;  3GEZ A;  4AIK A;  1JGS A;  2EV6 A;  1WQ2 A;  1SFX A;  4P96 A;  3EYY A;  4KIB A;  2XHK A;  1TNS A;  3BRO A;  2LKP A;  1FBU A;  4EVI A;  5BQT A;  1Z05 A;  3J81 Z;  2XAG A;  4HLY A;  4G8X A;  4Z2Y A;  1ODD A;  2PBI A;  2VBW A;  4LK1 F;  3HRM A;  2WWY A;  2F5F A;  1DUX C;  3ZMD A;  1KA8 A;  3K0L A;  5CVI A;  4HF2 A;  2O03 A;  1K7A A;  2IA1 A;  3HTU A;  1XSV A;  2FRH A;  2VN2 A;  5L3C A;  5LGN A;  4I01 A;  4LLN A;  4L9N A;  5HOO A;  3O6B B;  2X0L A;  3G3Z A;  1XCB A;  3TDZ C;  2IT0 A;  5AIQ A;  1FX7 A;  2OAZ A;  4NQW A;  3V7R A;  3KP2 A;  3TOB A;  2QQ9 A;  2HFH A;  3I64 A;  2K27 A;  4HF1 A;  4NHJ A;  1IXS B;  1FZP B;  3IC7 A;  1ZLJ A;  1YW7 A;  2OQR A;  5HS8 A;  4IVN A;  2RGV A;  1VTN C;  2M87 A;  2QWW A;  4IRG A;  5BPD A;  2E7W A;  1O3R A;  3T8T A;  3DV8 A;  3F6O A;  1Z9C A;  2KIF A;  3DXJ F;  3HYI A;  3M9A A;  6PAX A;  2BGC A;  1BIB A;  1OPC A;  4DNC A;  3F3X A;  4MEY F;  4XBF A;  2FQ3 A;  1DDN A;  4AVP A;  1FYK A;  4XSZ F;  2C6Y A;  5L3D A;  3R6S A;  2JZY A;  4PDK A;  2HS5 A;  3JTG A;  1KU3 A;  1FOK A;  3QU6 A;  3J7A O;  5E18 F;  2HWV A;  3HOT A;  4IXA A;  4UHT A;  5BOX A;  4Y17 A;  3BDD A;  3U1D A;  3FX3 A;  2GAU A;  4KMF A;  1W4M A;  2J5O A;  1WRJ A;  1UHW A;  3R4K A;  1GXP A;  2J5P A;  4OU0 A;  2K4B A;  1HKQ A;  1FBS A;  4PZJ A;  2UWM A;  1MJA A;  3SFZ A;  3KET A;  1PP8 F;  2EK5 A;  3WTW C;  2IW5 A;  4RB2 C;  1ONV A;  3TGN A;  2XAJ A;  3V7C A;  4QWQ A;  2OBP A;  3G73 A;  4LLL A;  1Z1D A;  2HYG D;  2Z33 A;  1HSJ A;  1KGS A;  3T5X A;  4A2U A;  4XRF A;  2Z9O A;  1SD4 A;  5H6R A;  3C3W A;  4UXN A;  5AIP A;  1XMA A;  4RB1 A;  3GFI A;  4M6X A;  3GFJ A;  2EV5 A;  1XGM A;  1T98 A;  3GZ5 A;  3K1M A;  3PQJ A;  1IUY A;  2COM A;  3BZ6 A;  2K4J A;  3T8R A;  4ZYG A;  4E70 A;  4EJT A;  1F1Z A;  3CTA A;  4UV9 A;  2EFW A;  2CG4 A;  4O6J A;  4HA8 A;  1JHH A;  2Z99 A;  4HBL A;  4GXO A;  5HDN A;  3BJ6 A;  5D8K B;  5CYV A;  5E1X A;  4G7Z F;  4ZYD A;  2IPQ X;  4O3M A;  1FWZ A;  1XSD A;  3ECO A;  4L9T A;  4D0P A;  2XVC A;  3GO5 A;  2FOK A;  4M73 A;  1FLI A;  3HSR A;  4ETS A;  3FZV A;  4HLX A;  3F23 A;  3I4P A;  4XSX F;  1RUO A;  2W84 A;  5TJJ A;  3ZPL A;  4MGR A;  4GO1 A;  4KIC A;  4KA4 A;  4P5O A;  2ESH A;  1R00 A;  1J0R A;  2VOO A;  4B09 A;  1QBJ A;  2DPU A;  4BHB A;  3EET A;  3RTR A;  2OZ6 A;  2F2E A;  3FXU A;  3SHF A;  1E2X A;  4KUM A;  1BI2 A;  4KN7 X;  1TLH B;  3M8F A;  3VFZ A;  4AIJ A;  4WX9 A;  1Z6R A;  2DT5 A;  5ILU A;  1XB4 A;  2OZU A;  2MD5 A;  5DD4 A;  5LHH A;  4LG0 B;  3P9C A;  2A69 F;  3LQR A;  5H6Q A;  4RGU A;  4Q47 A;  5DD8 A;  2M5W A;  3VOD A;  3N4M A;  4M72 A;  1HW5 A;  1K79 A;  2A07 F;  3J80 K;  3F21 A;  4HZF A;  5HLI A;  2VC0 A;  3J80 Z;  3ABT A;  1FY7 A;  2LDU A;  1R5H A;  4BNC A;  3BP8 A;  5ERI A;  4KYW A;  1R23 A;  3GYH X;  1FP1 D;  2FSW A;  2EJR A;  4WK8 F;  1O3Q A;  3TKY A;  2MBF A;  3BOQ A;  1WKM A;  5D5W B;  1HQC A;  4XLN F;  3ECH A;  4N9I A;  1YLF A;  3KZZ A;  1ZHF A;  1ON1 A;  1XGO A;  1BC7 C;  4EM1 A;  3R61 A;  3WOD F;  2ZKZ A;  5EEH A;  2H6B A;  2QEN A;  2O3F A;  2TDX A;  4G6Q A;  1SFE A;  3E5Q A;  3VOE A;  2V1D A;  4UV8 A;  3P7N A;  2PLY A;  2Z3Y A;  2XAF A;  1OR7 A;  4ENM A;  4CYD A;  1F9N A;  4I02 A;  4WWC A;  1W7P D;  3DPT A;  3E5X A;  4ESB A;  1P92 A;  3Q5F A;  2PN6 A;  2K86 A;  3ROU A;  1OYI A;  2EFP A;  3GUD A;  2AXL A;  1YG2 A;  3HRU A;  2XAS A;  4MNU A;  2K02 A;  3RI4 A;  4QLC U;  4U0Y A;  4KNY A;  4BH9 A;  1MJB A;  4CDG A;  1PUE E;  2O8X A;  3MQ0 A;  4L0Y B;  2ZME B;  1ZG3 A;  2ZXJ A;  4OIR F;  4WCG A;  1Z6T A;  2DTR A;  3JW4 A;  2DK5 A;  4Y15 A;  3VB2 A;  3FMQ A;  2RVC A;  5FB2 A;  2FXA A;  4CGZ A;  2ISY A;  4A6D A;  3LWF A;  2OD5 A;  1XDS A;  1B9M A;  2F5C A;  1RZ4 A;  2A61 A;  2ESN A;  3P9K A;  2PMU A;  1ZGA A;  3IL2 A;  3FXQ A;  1Y0U A;  1CF7 B;  2NYX A;  3U9G A;  3RDI A;  1J75 A;  4G7O F;  5IT9 Z;  1V4R A;  1G3Y A;  1HKT A;  2V79 A;  2OA4 A;  3RKW A;  4EGZ A;  3WE2 A;  2HQR A;  2XAQ A;  2QUF A;  1SAX A;  4M9Z A;  5J6X A;  4HX8 A;  4L5I A;  2VE8 A;  4CXF A;  4HDV A;  4KIG A;  1QQI A;  5EEG A;  3O3K A;  4G94 A;  5LHG A;  1KQ9 A;  2QQA A;  1LVA A;  3WTS C;  3IRR A;  2YR2 A;  2MA3 A;  3KP7 A;  3I71 A;  1J2X A;  1W5S A;  4LLG F;  3TO7 A;  4H0E A;  1AOY A;  2O61 A;  5FO5 A;  4R79 A;  5J8F A;  1JXS A;  2E1C A;  2FBI A;  3MWM A;  4A12 A;  1S6L A;  4U7B A;  1S7A A;  2ZCW A;  5HS9 A;  3RJP A;  4A6E A;  4YFX F;  4OMZ A;  3J81 K;  2V6C A;  3EDP A;  2STW A;  1REP C;  5ED4 A;  2ZME A;  1IN6 A;  3ML6 A;  3KEO A;  1SD7 A;  4I0A A;  1Z91 A;  1P4A A;  1IN7 A;  2D45 A;  1T6S A;  3QP5 A;  1YS7 A;  1AWC A;  4L9J A;  3ZMU A;  1WI9 A;  4OIQ F;  5JHU A;  1YIO A;  2IJL A;  1ON2 A;  4RS8 A;  4KT5 C;  5JFR A;  4IJA A;  1X3U A;  2BYV E;  1CF7 A;  3QPH A;  2IA2 A;  5TRD A;  1JE8 A;  3B73 A;  4HQE A;  3ABU A;  2DFI A;  1I6X A;  5ILS A;  2VT3 A;  1DPU A;  3JSO A;  3RYP A;  4HAM A;  3GVA A;  2D2W A;  3JAM Z;  1ZRC A;  1B9N A;  3MCZ A;  3I58 A;  2KJC A;  2PQ8 A;  2XRO A;  1KU7 A;  2HTS A;  4EJV A;  4U88 A;  2Q8K A;  1Z7U A;  1IF1 A;  1WWX A;  1EV7 A;  1UST A;  1ZYR F;  2W25 A;  1NHA A;  1FBQ A;  2M1B A;  1O57 A;  2PI0 A;  1EH7 A;  1R1U A;  1S29 A;  2JT1 A;  3I53 A;  1UFM A;  2GA2 A;  2FE3 A;  5E8I A;  1ZG1 A;  1I5Z A;  2KKO A;  2FA5 A;  4HOB A;  1ZRE A;  4B8X A;  2MH2 A;  3IRQ A;  4O5V A;  3ZP5 A;  5KK1 A;  2O6G E;  4M74 A;  3V7S A;  4L18 B;  4MQ9 F;  3RPU A;  3P9I A;  2HKO A;  1SFU A;  1DP7 P;  3CUO A;  2LF8 A;  3GXO A;  3K2Z A;  4RB3 C;  1FSE A;  5DEQ A;  4LB5 A;  2A68 F;  5KVR A;  3WU0 A;  1YFH A;  1S3J A;  4BAY A;  2P4W A;  2PG4 A;  3R0J A;  3LQQ A;  2FU4 A;  2Q2E A;  2UZK A;  1G3S A;  3M8E A;  4IHS A;  3WGH A;  3LAP A;  3WTX C;  5LEJ A;  1STZ A;  2E7X A;  1T2K A;  3KCC A;  2YSR A;  1YW9 A;  1IN8 A;  2HZT A;  3TO9 A;  1ZRD A;  1TQI A;  4XLP F;  4I2O A;  4PCQ A;  3NRV A;  1TQM A;  3F8F A;  3K9T A;  5H20 A;  2DW4 A;  1BN5 A;  3DPL C;  3FM3 A;  4GGG A;  3QP6 A;  3F22 A;  1R36 A;  2V9V A;  3SZT A;  2EA4 A;  3F8C A;  2XKO A;  2VXZ A;  3C7J A;  4KFC A;  3H3U A;  2WC2 A;  1J7K A;  1E17 A;  2XIG A;  2R7F A;  4FT8 A;  1LDD A;  4P55 A;  1G3W A;  1YS6 A;  3Q9V A;  2CGP A;  1U3E M;  2L4M A;  2EA2 A;  1ZRF A;  1BM9 A;  5JR3 A;  2XAH A;  4LJZ F;  3U2R A;  2CFX A;  1T0F A;  4YIF A;  1FP2 A;  4JQF A;  1J9I A;  3ULQ B;  4UNO A;  2EFN A;  3KE2 A;  4U0V A;  3ZN1 A;  3O2P E;  5D5U B;  1IXR C;  2XGX A;  5ICC A;  4M9S A;  1B4A A;  3Q9S A;  2H94 A;  3EQL F;  4YG2 F;  3LA2 A;  3QRF F;  4MEX F;  5DCM B;  3KP5 A;  5ICG A;  4IPA A;  2EFQ A;  3PFI A;  3RPQ A;  5BPI A;  1RUN A;  1XSX A;  3LAJ A;  5E1Z B;  2Y48 A;  1OKR A;  3TDU C;  3QAH A;  3V4G A;  2IP2 A;  2JRT A;  1IN4 A;  3HHH A;  1LEB A;  3CDH A;  5CVJ A;  2M45 A;  2DAO A;  1IZ1 A;  2DI3 A;  3MZH A;  1PDN C;  2NRA C;  1ZLK A;  2ZNY A;  1K78 A;  2P6S A;  1JHF A;  2ACJ A;  1IW7 F;  4HX7 A;  4RAZ A;  1P2F A;  4ESF A;  2ZNZ A;  1XN7 A;  2L01 A;  4HF0 A;  4WXH A;  2DLL A;  2EB7 A;  4AWX B;  1W7P B;  2P5K A;  2YX4 A;  2PJP A;  2LF7 A;  4UVC A;  1P4X A;  4LFU A;  5D5X B;  5DDG A;  2JTV A;  1HW1 A;  4UVA A;  1YTY A;  3WTU C;  2QBY A;  4KIF A;  3QPT A;  1Q1H A;  4A5M A;  1LNW A;  3E6B A;  2CWE A;  4CHU A;  4WXC A;  2MH9 A;  2RKH A;  1TW2 A;  2EWN A;  2H6C A;  4EGY A;  2G7H A;  1BJA A;  1EH6 A;  3WTT C;  2R3S A;  2QM3 A;  1U5T B;  5ICE A;  4ZH4 F;  4MHG A;  2MLG A;  5DCM A;  3GX4 X;  1B6A A;  2HGC A;  5BMZ A;  2V1X A;  3REO A;  5ICF A;  1IN5 A;  4ENJ A;  5F6F A;  3DP7 A;  2KIU A;  3FMS A;  2HOE A;  3RKY A;  4AIH A;  3KZY A;  2XKP A;  2FML A;  3GWZ A;  1KQ8 A;  3BWG A;  5HVQ C;  1HXD A;  4IRI A;  2W85 A;  3W6K B;  1MDM B;  1OYW A;  5HS7 A;  4LMY A;  4IRH A;  3CUQ C;  1UB9 A;  4UUV A;  1QO0 D;  3ZMV A;  2G7U A;  3HIF A;  1ZH5 A;  5FLX Z;  1SD6 A;  2GQQ A;  3FHZ A;  3KFW X;  3V8J A;  1LJ9 A;  2RN7 A;  3V8K A;  1P4W A;  3QU3 A;  3WTY C;  3GF2 A;  2VBX A;  3WTV C;  4Q4Z F;  2WTE A;  5E20 A;  2IA0 A;  4BQA A;  3IHU A;  3JSP A;  1U8R A;  5FD6 A;  1W7P A;  1MGT A;  4M6Y A;  3ERE D;  1FT9 A;  4OMY A;  1HW2 A;  3ISP A;  3VEP A;  3I54 A;  1QZY A;  3IKV A;  2K7L A;  1QPM A;  3ZN0 A;  4OOI A;  2M8E A;  1H0M A;  3HOS A;  2GWR A;  1I27 A;  2L3D A;  2DK8 A;  2VBZ A;  1MKM A;  1OMI A;  2M30 A;  2VE9 A;  2L4A A;  3IWF A;  5IT9 K;  1D3Y A;  2FEZ A;  1ZG5 A;  1TTY A;  1DPR A;  2CO5 A;  1U5T A;  5HDG A;  2DQR A;  1R22 A;  3BJA A;  4YII A;  5IT3 A;  4WF2 A;  4EM0 B;  2HKX A;  1U5T C;  1H9G A;  2A6E F;  3ZMS A;  4Y13 A;  4ON0 A;  5F1R A;  4RGS A;  1BBY A;  4UVB A;  3KP3 A;  5FFX A;  5DUI A;  1ZN2 A;  2A5Y B;  4RAY A;  1V3F A;  1J59 A;  2DO7 A;  1TBX A;  1RNL A;  1QGP A;  2YPR A;  3GFL A;  2NNN A;  2EFO A;  1TNT A;  2RDP A;  3N97 A;  1MDM A;  3WU1 B;  3GFM A;  1C0W A;  4I98 B;  1R1V A;  2JPC A;  5F64 A;  2FBH A;  4U0W A;  4EMS A;  5FD5 A;  1BI3 A;  5CVR A;  2CYY A;  3OOP A;  2W57 A;  3D0S A;  2O0Y A;  2PEX A;  1R58 A;  5LBQ A;  2RQP A;  4R8H A;  3CO7 C;  4WXD A;  3E3V A;  5CVV A;  2XRN A;  3BJO A;  1U2W A;  1FYM A;  3WTZ A;  1HBX G;  3S2W A;  2UXX A;  2XV4 S;  4HDU A;  2ZBK A;  5DUK A;  4L0Z B;  2RC4 A;  1OYY A;  4S04 A;  1P6R A;  2P5L C;  1O7F A;  3M1E A;  3I5U A;  3FWE A;  3T1B A;  1D8J A;  5HDK A;  3BY6 A;  1KU9 A;  1SD5 A;  3H92 A;  5AON A;  1F5T A;  2FMY A;  3BPX A;  5CLS A;  3I59 B;  2BV6 A;  3SZP A;  2QYO A;  1KU2 A;  5FFZ A;  2A6H F;  1ZAO A;  5DCF A;  3F6V A;  3JAM K;  3HTS B;  1R7J A;  3WE3 A;  2ISZ A;  2STT A;  1W5T A;  3CJN A;  3NQO A;  4BXU A;  2VOD A;  5D4R A;  5DYM A;  2JPB A;  2HQN A;  3FMR A;  3CO6 C;  3GW2 A;  1BC8 C;  3HRS A;  1YYV A;  3K69 A;  3HUG A;  1L0O C;  3GLX A;  3W6J B;  2JSC A;  3MZY A;  5J8C A;  3M7G A;  1FPQ A;  3BPV A;  3FXR A;  5L3E A;  1GHC A;  3LA7 A;  1KYW A;  3RYR A;  1USS A;  2L02 A;  1LEA A;  2Y0M A;  3D5L A;  3EYI A;  3IKT A;  2HDC A;  2ZO4 A;  4EV0 A;  1K6O A;  1GVJ A;  2R7D A;  2P5V A;  3LA3 A;  1RIO H;  4NB5 A;  4F7Z A;  3QOP A;  3RKX A;  5CVU A;  2FNA A;  3E6D A;  4ASN A;  3E6M A;  1BOA A;  1G6N A;  4ZZD A;  2P7C B;  4ZYE A;  4YFN F;  2LNB A;  3TQN A;  4RGR A;  4OIO F;  2RNJ A;  5LGT A;  2HEO A; 
#chains in the Genus database with same CATH topology
 2PFB A;  9ANT A;  3BTL A;  5F0C A;  3PM1 A;  1SMT A;  4CZZ A;  2QSG X;  2D1V A;  1MD0 A;  4B47 A;  2ZJP F;  1GLN A;  3OOU A;  5FKM A;  2ELK A;  4M9X A;  1Y1W J;  4RA2 A;  5D6E A;  3S8P A;  4R1H A;  3DU6 A;  5EZG A;  2GXG A;  1S5L C;  4RMN A;  3U1K A;  1TC3 C;  4HYE A;  2E35 A;  4C3H J;  5JVG F;  2YS9 A;  2M0C A;  5BNG A;  1D8K A;  3FM5 A;  4M3E A;  3I59 A;  4ZDO A;  4MLO A;  3S15 J;  3E6C C;  3IAS 2;  5J1U A;  3B02 A;  3A01 B;  1YRN B;  3COA C;  2L54 A;  5D6F A;  4LK0 F;  2XPU A;  1GV2 A;  1IRF A;  1UHM A;  2CV2 A;  2ZFW A;  4G9Y A;  2MC4 A;  2H27 A;  2K40 A;  4RB0 A;  4XK4 A;  1K4S A;  2QZ8 A;  5F0F A;  3ELK A;  3SXY A;  1D0Y A;  4FE4 A;  4A5N A;  4KIT B;  4DZJ A;  2LP0 A;  1ZTR A;  1RR8 C;  3H5N A;  5LGU A;  1XPX A;  4KDP A;  3KYD B;  4U7D A;  1K78 B;  4XLE A;  2X85 A;  1S7O A;  2RAE A;  4XOP A;  1IRG A;  4FCY A;  4MTD A;  5E8G A;  1KON A;  4A0Y A;  1B1B A;  5DS9 A;  1V54 H;  4MTE A;  2DMN A;  2Y75 A;  1HOM A;  1HST A;  2DU9 A;  2DQL A;  2GZW A;  4S05 A;  2F4I A;  3F72 A;  2Z16 A;  3WGG A;  3H3Z A;  4D5C A;  4BHP A;  5IP9 J;  4DGW B;  2EIL H;  3DQV C;  2GOM A;  3S16 J;  2WV1 A;  1R71 A;  4FX0 A;  2B9S A;  2HOS A;  2HR3 A;  1BL0 A;  3S1N J;  2HNH A;  5DM7 F;  3PQK A;  3DF8 A;  5E1W A;  1A6I A;  2ZB9 A;  2K3F A;  1VQ4 I;  2QBY B;  2PJR A;  1DP3 A;  2FBK A;  2CQX A;  4P9U A;  4KN4 X;  4HRI A;  2IGN A;  2LFB A;  2VL8 A;  3OY9 A;  1IGN A;  4N0B A;  3JRH A;  2X1E A;  4EQQ A;  3JRD A;  1UJ8 A;  3FIS A;  1T95 A;  3SFI A;  5FKO A;  3H9J A;  2DA7 A;  3GTO J;  1IG7 A;  4UB6 C;  2AHQ A;  2ZJ2 A;  1QA6 A;  2CUF A;  5CJ9 A;  4FX4 A;  3M1C A;  4KMU X;  3K4L A;  5DM6 F;  2IRF G;  1R1T A;  2E1O A;  2BBY A;  3D5R C;  1GUU A;  3Q0W A;  1W0U A;  1XMK A;  1XDU A;  1RET A;  2VQL A;  4PJN A;  2OQG A;  2DPD A;  4ITV A;  4Q5S F;  4BQO A;  4IO9 F;  3BCA A;  2FQ4 A;  4IHT A;  2ZSH B;  3DFG A;  2A3S A;  3DKY A;  3E97 A;  2H09 A;  2KHM A;  5FRO A;  2BEO A;  2EV0 A;  3FIW A;  3LST A;  1S72 I;  4HQM A;  5HNH A;  2MC3 A;  1VQK I;  2L0K A;  4JX4 A;  4MQV A;  2YU3 A;  2F48 A;  1MJ9 A;  3KLO A;  4PGH A;  3I9V 2;  4DBQ A;  3R60 A;  2NAZ A;  2F5D A;  2LYC A;  2NVX J;  2LVS A;  2CMP A;  1MMG A;  4RGX A;  3FF5 A;  2F5E A;  4PUS A;  3K1N A;  3KP4 A;  3L2U A;  3T0Y A;  2GIV A;  4BBR J;  5IYD J;  2DMQ A;  2A6T A;  4TV7 A;  2R7T A;  2I5U A;  2ETH A;  4XR6 A;  3OS0 A;  1YHQ I;  3EPZ A;  4BQN A;  4IL6 C;  3H1C A;  2EIN H;  3CLO A;  3CUQ B;  2NS0 A;  5K5R A;  2P7V B;  2CQK A;  3A01 A;  1YRN A;  3ABL H;  2O9L A;  3LSJ A;  2QVO A;  1JT6 A;  4I7H A;  2ZXI A;  3HSE A;  4LGW A;  1LDK B;  1MBK A;  2XB0 X;  4B1R A;  2Q0O A;  1G4D A;  4M3B A;  3ZMT A;  1J5Y A;  2ZXH A;  4AYB N;  5LLQ A;  2E1N A;  4ZZL A;  3F8B A;  2DXI A;  4CCL A;  1OFC X;  1RI7 A;  5EJC A;  4A3L J;  1OCO H;  1XX5 A;  2QLZ A;  3BCB A;  4I09 A;  1NK2 P;  2NOG A;  1OIS A;  4LB6 B;  5K1Y A;  4A0Z A;  5LRR A;  2L9R A;  3TOA A;  2MLK A;  5L3G A;  3F8N A;  3L2C A;  2VT2 A;  2FF4 A;  3BG3 A;  1U0J A;  4HW0 A;  2CUJ A;  3NEU A;  1YW8 A;  3V8L A;  3GZ6 A;  3I0T A;  2MFZ A;  4N4O B;  1D5V A;  4IEJ A;  1BI0 A;  1ULY A;  1S9H A;  3HSF A;  3RZO J;  3RQI A;  1OQY A;  2VC1 A;  2X4H A;  2FOW A;  1D5Y A;  1KQ0 A;  2R7R A;  1RR7 A;  3DTI A;  3L09 A;  2HQ5 A;  3OV8 A;  5K5Q A;  4YFK F;  3MKL A;  4ABZ A;  3ZMZ A;  1GT0 C;  5HLG A;  2M9H A;  1IXC A;  2LSO A;  1VQN I;  2OPT A;  1TWC J;  5JI6 A;  2XC7 A;  2Z5U A;  5B3S H;  3O8G A;  2GLO A;  2R92 J;  1EH8 A;  2Y9Y A;  4EJO A;  3BR6 A;  4EJU A;  5FJ8 J;  1QZE A;  4QTR A;  5A2Q K;  1XCV A;  2BY3 A;  1ZR4 A;  1JKQ C;  1FYL A;  2KT0 A;  2P6T A;  5TIS C;  5BS6 A;  2NVU B;  1XD7 A;  2UV1 A;  5A2Q Z;  3OSG A;  1VQM I;  5JVT A;  1X1P A;  3C1D A;  1IAW A;  2DA4 A;  1ZGJ A;  5F08 A;  5LHI A;  4ENN A;  3LFK A;  5D5V B;  1E3O C;  5L3F A;  2DOF A;  4GYG A;  2AS5 F;  1I1S A;  5FRM A;  1HKS A;  3W2W A;  1O3S A;  1FOW A;  3ASO H;  1QZZ A;  3CCU I;  4HX4 A;  1U78 A;  5EF6 A;  4XIC A;  2HVR A;  4ZYH A;  1TP4 A;  3CCR I;  2RV8 A;  1BI1 A;  2GXB A;  2G9W A;  2XSD C;  1R5G A;  4CZC A;  3B6A A;  4HV5 A;  4JBA A;  1LB2 A;  4BKX A;  5JLX A;  3G1O A;  4B48 A;  5C4J J;  1BW5 A;  4BJT A;  1JKO C;  1MW7 A;  1F4K A;  1CGP A;  2MAB A;  2E71 A;  3OIP A;  5FGM A;  2IS6 A;  1FMV A;  4C2M J;  3ERM A;  2L7K A;  2IGO A;  5K5O A;  1O7L A;  3C2G A;  1YOV B;  1H9T A;  4G6D A;  3MEX A;  2DA2 A;  1SFO J;  2XUB A;  3K1P A;  1FOX A;  3L9F A;  4FHT A;  3S3O A;  2DJN A;  5F1J A;  3DPU A;  4V2G A;  4DQ2 A;  2JJ7 A;  2JWT A;  5E17 F;  4IQJ A;  3OYL A;  2E60 A;  1HF0 A;  3CUQ A;  4J01 A;  3S3M A;  1MH4 A;  3A0B C;  4L9V A;  1L3L A;  2PMZ A;  4NUB A;  1JTY A;  5LEK A;  3AG2 H;  1UMQ A;  4Q48 A;  5IOY A;  3DEU A;  4OIP F;  3IWZ A;  5FLX K;  4X6A J;  1O3T A;  5L3B A;  3IUO A;  1NH3 A;  1AKH A;  4KJZ A;  4YRV A;  1ENH A;  4G7H F;  3HHG A;  1T39 A;  1TW3 A;  1MH3 A;  1GXQ A;  2P8T A;  2KRF A;  2KPM A;  2BE5 F;  2JSP A;  1B59 A;  3HG9 A;  4N9H A;  1D1A A;  1QNT A;  3OL4 A;  3TP0 A;  3QOE A;  1X1A A;  1ZGW A;  2NNY A;  1OR7 C;  1G3T A;  3GTL J;  3M3Y J;  4CIC A;  1T08 B;  3F8M A;  2B63 J;  4M71 A;  3HOZ J;  2R7Z J;  1ETO A;  2FNP A;  2DFF A;  2OU2 A;  2VUM J;  4EM2 A;  2X6O A;  3JTH A;  2CSO A;  5EYR A;  2IVM A;  4A0X A;  1SAU A;  4C30 A;  4IF4 A;  4GYI A;  2GIZ A;  2CFO A;  4C9Y A;  2VKD A;  5HLH A;  2DMP A;  5D8L B;  2VBY A;  3S3N A;  4B4C A;  1FNN A;  2UXN A;  4NBQ A;  1X2N A;  2EQR A;  3HXL A;  2ELH A;  2PX9 A;  4LG3 A;  3BG7 A;  2VON A;  4LG0 A;  1WSU A;  1VND A;  3KEQ A;  5EG0 B;  2NXN B;  2HTJ A;  4X0G A;  4IHX A;  2LOO A;  2PMH A;  1WJF A;  5KAI C;  2HYJ A;  3JRC A;  2WAD A;  3L00 A;  2LY9 A;  2KIM A;  2WV0 A;  1SMY F;  3WG9 A;  2IGK A;  4ESJ A;  2M2E A;  2M8G X;  2PMZ N;  1B72 B;  3EUK L;  4UB8 C;  4AD9 A;  2R93 J;  5ILV A;  1ZAR A;  1LVK A;  4M3D A;  2W24 A;  1T38 A;  2K9Q A;  1I1G A;  3RIR A;  3CDL A;  4JK1 X;  3CJQ B;  1EJ9 A;  3ZQG A;  2R5Z B;  4K2E A;  2D1H A;  2V4J C;  2BHZ A;  4DZP A;  1YO5 C;  1HCR A;  4BU2 A;  2M7B A;  1A6Q A;  2B0L A;  3TO6 A;  4BDY A;  3A4C A;  1YIT I;  3SQN A;  2AQF A;  2HXI A;  5J1R A;  3ZQL A;  3L7W A;  2JMW A;  1XG1 A;  2JUC A;  1AHD P;  1LDJ A;  2WBM A;  1BIA A;  2W4S A;  4BDZ A;  2KJB A;  3D1N I;  4BHC A;  4W1U A;  1TQP A;  3MFK A;  3BQZ A;  3QPL A;  3E1S A;  5LRS A;  2YX7 A;  1IRX A;  4I0B A;  3M8J A;  2OCC H;  4BYY A;  1PP7 U;  2BY0 A;  4NQW B;  2VXD A;  3HUG B;  5F0H A;  1MZB A;  4RLQ A;  4EJW A;  2XPW A;  2HOT A;  1FC3 A;  2AO9 A;  1MNM C;  2QQB A;  4HV6 A;  4E7K A;  3M07 A;  2OJE D;  2ADU A;  4OIN F;  2VOP A;  1XGS A;  4LD5 A;  1JUM A;  4CYC A;  3V42 A;  3DKW A;  3G6E I;  2E34 A;  1U6G A;  2CW8 A;  3K10 A;  4KT6 A;  3L2W A;  1FSH A;  3KLN A;  1UCR A;  1YQA A;  4GCV A;  1RC9 A;  1ERD A;  1KYZ A;  2KFD A;  3HRT A;  4CO8 A;  3EUH A;  3C18 A;  4ENK A;  3ZQ7 A;  1XGN A;  3CP2 A;  1S8N A;  2K9L A;  2CW0 F;  2ECC A;  3WG7 H;  3H0D A;  1LQ1 A;  2VJJ A;  1A04 A;  1D0X A;  3PUB A;  5DV5 A;  1R9T J;  2X48 A;  4PGG A;  5JHF A;  2DBB A;  2V1U A;  3E5U A;  3G2B A;  5D4S A;  2COB A;  3WGI A;  4P9F A;  3MAJ A;  1Z3Y A;  4I99 C;  3GTP J;  3S2H J;  2HYF A;  3C2H A;  1PUF B;  4L5J A;  3KP6 A;  3AAF A;  2CRG A;  2GA1 A;  3R0A A;  3GEZ A;  4D7N A;  4AIK A;  3H9Q A;  1JGS A;  2EV6 A;  1WQ2 A;  1SFX A;  3BR2 A;  4P96 A;  2Y0S A;  4XM3 A;  1VZ0 A;  2LG4 A;  3EYY A;  4KIB A;  2XHK A;  2ID6 A;  1TNS A;  3BRO A;  2LKP A;  4F93 B;  1FBU A;  2M0M A;  2MD0 A;  4EVI A;  1EF4 A;  5BQT A;  1Z05 A;  1BR2 A;  3CP8 A;  4A3F J;  4PK4 A;  3J81 Z;  2XAG A;  3OR2 C;  4HLY A;  3PNY A;  1B72 A;  3HOW J;  4G8X A;  4D9J A;  4Z2Y A;  2OV7 A;  2ZME C;  1ODD A;  1YJN I;  2PBI A;  2VBW A;  4LK1 F;  3HRM A;  2JA8 J;  2DA5 A;  4XON A;  2WWY A;  1QHG A;  2F5F A;  2R5Z A;  2WAQ A;  3ZMD A;  1DUX C;  1QHH D;  2VPR A;  1KA8 A;  3DU5 A;  1S7E A;  3K0L A;  3SDB A;  5CVI A;  4HF2 A;  3CJT B;  2Q1Z B;  5B1A H;  2VQC A;  2O03 A;  5GTH C;  1K7A A;  2IA1 A;  5C4X J;  3HTU A;  1DQU A;  2WB1 N;  4CCK A;  1XSV A;  3MKW B;  2FRH A;  2VN2 A;  4MIM A;  2NVY J;  5L3C A;  5LGN A;  4I01 A;  1YJ9 I;  2BHY A;  4LLN A;  4L9N A;  5HOO A;  3O6B B;  2X0L A;  3FXJ A;  3G3Z A;  1XCB A;  3TDZ C;  5C3E J;  2IT0 A;  5AIQ A;  1D0Z A;  1FX7 A;  1LFB A;  3Q0V A;  2OAZ A;  4DW6 A;  4NQW A;  3V7R A;  3KP2 A;  4ANJ A;  1V5E A;  1ETV A;  3SZG A;  3TOB A;  2QQ9 A;  4X1E A;  1E3P A;  4A3M J;  2HFH A;  3I64 A;  2K27 A;  3LSP A;  3FXM A;  4HF1 A;  4NHJ A;  1IXS B;  3E7L A;  1FZP B;  3IC7 A;  1ZLJ A;  4BS9 A;  2EIM H;  1YW7 A;  3VSL A;  1H89 C;  2FUG 2;  2OQR A;  5HS8 A;  4IZZ A;  2GM4 A;  4IVN A;  2RGV A;  1VTN C;  3HC7 A;  1K6Y A;  4HNT A;  2M87 A;  2QWW A;  4IRG A;  5BPD A;  1T56 A;  3RPU D;  3ZQC A;  1NG6 A;  3K7A J;  2E7W A;  1O3R A;  3T8T A;  1MMN A;  3DV8 A;  3F6O A;  1Z9C A;  2KIF A;  3RCO A;  1Y1V J;  4BXF A;  3DXJ F;  2I10 A;  2Y2Z A;  2XAU A;  3HYI A;  3M9A A;  3K4N A;  6PAX A;  1APL C;  1QPI A;  2EIJ H;  2BGC A;  2CUE A;  1BIB A;  1WGX A;  1OPC A;  3OYC A;  2IS4 A;  1TWG J;  4DNC A;  3F3X A;  4MEY F;  1PYV A;  3S1Q J;  3BG9 A;  4XBF A;  4CCJ A;  1QU3 A;  2FQ3 A;  1DDN A;  4AVP A;  1FEX A;  1FYK A;  3LL7 A;  4XSZ F;  1X58 A;  1PUF A;  2C6Y A;  5L3D A;  3R6S A;  1FJL A;  2JZY A;  4G6T B;  4PDK A;  2R5Y A;  3HJE A;  2HS5 A;  5CKT A;  3JTG A;  5J4V A;  1KU3 A;  2OC6 A;  1FOK A;  3M4O J;  4NC8 A;  4E7L A;  3QU6 A;  3J7A O;  4E7J A;  5E18 F;  1JUP A;  2NS7 A;  2HWV A;  3HM5 A;  1WPK A;  3HOT A;  3OYN A;  4IXA A;  4UHT A;  1I3A A;  3HBL A;  5BOX A;  4Y17 A;  4OAZ A;  2XGE A;  3BDD A;  3CCY A;  2DA6 A;  3U1D A;  2QSH X;  3FX3 A;  2GAU A;  4KMF A;  1W4M A;  2J5O A;  4GRI A;  2QSF X;  1WRJ A;  4J19 A;  1UHW A;  3R4K A;  1GXP A;  2J5P A;  1VQ6 I;  4OU0 A;  4A3C J;  5C44 J;  2K4B A;  4FIS A;  4XLF A;  1HKQ A;  3C2B A;  1FBS A;  3MKZ A;  4PZJ A;  3CC2 I;  2UWM A;  2ID3 A;  3VPR A;  1MJA A;  3SFZ A;  3KET A;  2R7S A;  5DTD A;  1PP8 F;  2EK5 A;  3WTW C;  2JVG A;  2CH0 A;  3VYT B;  2H1L A;  2IW5 A;  5IP7 J;  1I50 J;  4B44 A;  4RB2 C;  1ONV A;  1Y56 A;  1RES A;  3TGN A;  3TED A;  2XAJ A;  3V7C A;  4QWQ A;  5K7F A;  4ZTF A;  2OBP A;  1D1C A;  3G73 A;  5KNL A;  3S1R J;  3FKJ A;  4LLL A;  1Z1D A;  2HYG D;  2Z33 A;  1HSJ A;  1KGS A;  4NC6 A;  3T5X A;  4A2U A;  4KIS A;  1ETW A;  4XRF A;  2Z9O A;  1WVR A;  1SD4 A;  1N25 A;  2MGQ A;  5H6R A;  2KRC A;  4L5E A;  3C3W A;  1E3H A;  4UXN A;  3JRA A;  2HI3 A;  5AIP A;  4UUT A;  4BEH B;  1XMA A;  4IKF A;  1Z77 A;  3K4K A;  2FD5 A;  2X1D A;  4RB1 A;  5EDN A;  3GFI A;  4M6X A;  3GFJ A;  2EV5 A;  3K4C A;  3SYT A;  1T33 A;  1XGM A;  1K61 A;  5J3L A;  3K2A A;  4PFO A;  4YIR X;  1T98 A;  3GZ5 A;  3K1M A;  3PQJ A;  1JTX A;  2KZG A;  4XLA A;  1IUY A;  5TGT A;  2COM A;  4AYB A;  3CZ6 A;  1RRJ A;  1V55 H;  1WI3 A;  2E5Z A;  3BZ6 A;  2B7E A;  2K4J A;  3T8R A;  4ZYG A;  3ZQF A;  4E70 A;  4EJT A;  2M3A A;  1F1Z A;  3CTA A;  4UV9 A;  2EFW A;  4AM3 A;  3CES A;  4XRS A;  1VQ9 I;  2CG4 A;  4BJ6 C;  4O6J A;  4HA8 A;  2F4M B;  1JHH A;  3QWL A;  4AID A;  2Z99 A;  3JRG A;  1T0F C;  4HBL A;  2CQN A;  1CQT A;  3BZK A;  4GXO A;  3OMY A;  4XOT A;  5HDN A;  3BJ6 A;  5D8K B;  5CYV A;  2LBF B;  3DLA A;  5E1X A;  4J00 A;  1FMW A;  4G7Z F;  4ZYD A;  2IBD A;  3GCM A;  3I3L A;  2IPQ X;  4O3M A;  1J09 A;  1FWZ A;  1WJB A;  2R7W A;  1ZQ3 P;  1XSD A;  2DMU A;  2M4K A;  3ECO A;  4L9T A;  4D0P A;  2XVC A;  3GO5 A;  4H4K C;  2K5C A;  2FOK A;  2VKE A;  2MW8 A;  4M73 A;  1FLI A;  2HXO A;  3HSR A;  4ETS A;  3FZV A;  2D5V A;  4HLX A;  1FIA A;  3F23 A;  2LK2 A;  3DBL B;  1W36 D;  3I4P A;  3K70 D;  1JT0 A;  4XSX F;  5M5X J;  1RUO A;  3HOV J;  2FX0 A;  2W84 A;  1X1C A;  5TJJ A;  2XF7 A;  3ZPL A;  3W3C A;  4XKV A;  4MGR A;  1SVL A;  1AKH B;  4GO1 A;  4KIC A;  4Y7N J;  1A36 A;  4KA4 A;  4P5O A;  1PVE A;  2E2I J;  2ESH A;  1R00 A;  1J0R A;  3G71 I;  2VOO A;  1H8A C;  4B09 A;  1QBJ A;  2OTL I;  2DPU A;  1X3W B;  3JRI A;  2GOX B;  4A3D J;  4BHB A;  3EET A;  2V9P A;  3RTR A;  3CCL I;  3GTM J;  2OZ6 A;  2F2E A;  3AG1 H;  1MNE A;  3FXU A;  3SHF A;  1E2X A;  4AVZ A;  3H5R A;  2DOA A;  3LNQ A;  3PFY A;  1FIP A;  4RBO A;  4KUM A;  1BI2 A;  4KN7 X;  1TLH B;  3M8F A;  2BXY A;  3VFZ A;  1WCM J;  2MYS A;  4QPO A;  2ZJR F;  4AIJ A;  4WX9 A;  3HPH A;  1Z6R A;  2DT5 A;  1SC7 A;  4BGD A;  5ILU A;  1XB4 A;  1VI0 A;  2DDB A;  2MD5 A;  2OZU A;  2Y31 A;  4BEH A;  5DD4 A;  5LHH A;  3S1M J;  4LG0 B;  3P9C A;  4BY1 J;  2QGU A;  2A69 F;  1VQL I;  3JCU C;  3LQR A;  5H6Q A;  4RGU A;  4A3G J;  1A5J A;  1FTZ A;  5GPA A;  2HVQ A;  3PSI A;  4Q47 A;  1RKW A;  2M5W A;  5DD8 A;  3VOD A;  3N4M A;  1E0E A;  4FAS D;  4HPQ A;  2VJ4 A;  4M72 A;  2WY8 Q;  2M7A A;  5IYB J;  2K9N A;  1HW5 A;  3CCM I;  1K79 A;  2A07 F;  3J80 K;  3F21 A;  3RQ4 A;  3OYK A;  1B8I B;  4HZF A;  5HLI A;  2FJ1 A;  2VC0 A;  1VQ8 I;  4LOC A;  4B3X A;  3J80 Z;  3HOY J;  3ABT A;  1FY7 A;  2E19 A;  2LDU A;  1R5H A;  3S14 J;  4BNC A;  3BP8 A;  5ERI A;  3OYM A;  4KYW A;  1WH7 A;  1ZKG A;  1MND A;  1R23 A;  2RNG A;  4QIW N;  3GYH X;  3S2D J;  3CJR B;  1FP1 D;  1G2H A;  2FSW A;  5CQG A;  2EJR A;  4WK8 F;  1O3Q A;  3TKY A;  3PO2 J;  2VIX A;  4S0H B;  4AU7 A;  2ELJ A;  2MBF A;  3BOQ A;  5IY5 H;  4BE2 A;  1WKM A;  1LKX A;  4BAC A;  1BR1 A;  1HQC A;  5D5W B;  4XLN F;  4RM2 A;  1KZH A;  3ECH A;  2XF5 A;  4N9I A;  1YJW I;  2LBF A;  4FTH A;  1YLF A;  3KZZ A;  1ZHF A;  1ON1 A;  1XGO A;  3FK6 A;  1BC7 C;  1K4T A;  1Z3X A;  4EM1 A;  3R61 A;  3ABM H;  3WOD F;  2ZKZ A;  4C2U A;  1DU6 A;  4XOR A;  5EEH A;  1NG7 A;  2ICW G;  2H6B A;  2QEN A;  3CD6 I;  1IRZ A;  2O3F A;  2HQA A;  2TDX A;  4G6Q A;  1SFE A;  4CYC B;  4LIU A;  2E2J J;  2G0E A;  3U21 A;  1Y8Q B;  2DCE A;  4I6Z A;  3E5Q A;  3VOE A;  1VQ7 I;  2V1D A;  4UV8 A;  3P7N A;  2ME6 A;  2PLY A;  2Z3Y A;  2XAF A;  1OR7 A;  2HZD A;  5B1B H;  4ENM A;  2H1K A;  4CYD A;  1F9N A;  1POG A;  3NAR A;  4PJJ A;  4CSW A;  4I02 A;  4WWC A;  1FTT A;  4F52 A;  1W7P D;  1YE9 A;  3DPT A;  3E5X A;  4ESB A;  1P92 A;  2E1M C;  4JOM A;  3AKZ A;  3Q5F A;  1MMS A;  2PN6 A;  4XLC A;  2K86 A;  3ROU A;  2AXT C;  2KL4 A;  2LY2 A;  2QQ8 A;  1OYI A;  2EFP A;  3GUD A;  3EUA A;  1JKP C;  4HG2 A;  4CCM A;  4GFB A;  2AXL A;  1YG2 A;  3N05 A;  3ZXS A;  3HRU A;  4HNV A;  2XAS A;  2IEK A;  4MNU A;  3FBN B;  3OYG A;  2K02 A;  3IH2 A;  3RI4 A;  4QLC U;  4U0Y A;  3BTJ A;  3G1L A;  4BH9 A;  4KNY A;  3AL0 B;  1RPW A;  1MJB A;  4CDG A;  1PUE E;  2O8X A;  3SDG A;  4D1Q A;  4CA0 A;  5B66 C;  3MQ0 A;  4L0Y B;  1MIJ A;  2ZME B;  1ZG3 A;  4DIQ A;  2ZXJ A;  4OIR F;  4WCG A;  3CQZ J;  4G12 A;  1Z6T A;  3VYR B;  2DTR A;  3JW4 A;  4CUG A;  2CW7 A;  2DK5 A;  1OCZ H;  4Y15 A;  3TMO A;  3VYU B;  3VB2 A;  1X1B A;  2RVC A;  3FMQ A;  1B8I A;  5FB2 A;  4C2T A;  2FXA A;  5CPR B;  1ETK A;  2ISY A;  4RLF A;  2QA4 I;  4CGZ A;  1R4N B;  2Y9Z A;  2O7O A;  3K6G A;  4A6D A;  1O4X A;  3LWF A;  3NAU A;  2OD5 A;  1Y6I A;  2BVL A;  4PFP A;  1XDS A;  1B9M A;  2F5C A;  3DBR B;  3VDX A;  1RZ4 A;  5JLW A;  1LE8 B;  4UUS B;  2A61 A;  5E3N A;  3L1P A;  2ESN A;  3OWT A;  2LR8 A;  3P9K A;  3H35 A;  2PMU A;  2XPV A;  1ZGA A;  3IL2 A;  3FXQ A;  1Y0U A;  4N4N B;  1CF7 B;  4BE1 A;  1WJ5 A;  2NYX A;  2X1C A;  3U9G A;  3RDI A;  1J75 A;  4G7O F;  5IT9 Z;  1V4R A;  3DCF A;  1G3Y A;  2IXS A;  3F9K A;  1RKT A;  3FXK A;  1HKT A;  2V79 A;  2OA4 A;  2LKS A;  3RKW A;  2W7N A;  4EGZ A;  1OCC H;  2VI6 A;  3CDI A;  3WE2 A;  3MMY B;  4Y4R A;  5IYC J;  2DTZ A;  4HST A;  3OYI A;  4FQG A;  4QPQ A;  2HQR A;  2XAQ A;  2QUF A;  3E0J B;  1SAX A;  1W0T A;  3ZR8 X;  3QYF A;  4A3E J;  3OYA A;  4M9Z A;  5J6X A;  4HX8 A;  4L5I A;  2VE8 A;  1VQO I;  4CXF A;  4HDV A;  2VKV A;  4KIG A;  1QQI A;  4XKC A;  3MN2 A;  3H3V K;  1G59 A;  3GME A;  5EEG A;  1YIJ I;  2VQG A;  2XB5 A;  3O3K A;  4G94 A;  1VQP I;  5LHG A;  5FKL A;  1KQ9 A;  1X2M A;  2QQA A;  1LVA A;  2OF7 A;  3WTS C;  3IRR A;  2YR2 A;  2MA3 A;  3KP7 A;  1Z7L A;  2MG4 A;  2WB1 A;  3I71 A;  1J2X A;  4HNU A;  2Y69 H;  1W5S A;  3DEE A;  4LLG F;  3TO7 A;  2CQ7 A;  1A31 A;  4H0E A;  4EEF G;  1AOY A;  2W00 A;  4BXX J;  5FO5 A;  2O61 A;  2X6Y A;  1WJD A;  3A1Y A;  2JN6 A;  2DOD A;  3PL8 A;  4R79 A;  5J8F A;  1JXS A;  1HA8 A;  2CUZ A;  5E3O A;  2E1C A;  2FBI A;  3MWM A;  3H0G J;  3PIO F;  3BTC A;  4A12 A;  2E5N A;  1S6L A;  1IV8 A;  4U7B A;  2R5Y B;  3S93 A;  1S7A A;  2ZCW A;  5HS9 A;  3RJP A;  3CMA I;  1NK3 P;  3KIO A;  2JUG A;  4A6E A;  1WZ2 A;  4YFX F;  5LFA A;  1UAA A;  2BW3 B;  1WJE A;  4OMZ A;  3J81 K;  2V6C A;  3EDP A;  1MBE A;  2STW A;  4E7S A;  1REP C;  3KZI C;  2R0Q C;  5ED4 A;  2ZME A;  1IN6 A;  3AL0 C;  3ML6 A;  1WFX A;  3ESW B;  4A93 J;  3KEO A;  4NC7 A;  1SD7 A;  2E36 A;  1P7I A;  3HGG A;  4I0A A;  2H8W A;  5GTI C;  1I39 A;  3UR3 C;  1Z91 A;  1BR4 A;  3BR5 A;  1P4A A;  4CH7 A;  1IJW C;  2DT6 A;  4DOZ A;  1IN7 A;  3KEY A;  2R7X A;  2D45 A;  2XRL A;  1T6S A;  3QP5 A;  1TZL A;  2Q2E B;  1YS7 A;  1AWC A;  4L9J A;  4OAY A;  3ZMU A;  3QOD A;  1WI9 A;  4ZDP A;  5J4Y A;  1TT0 A;  5KCM A;  4OIQ F;  1LE8 A;  2WAE A;  5M5Y J;  4UUS A;  5JHU A;  3P5J A;  1YIO A;  5F27 A;  2IJL A;  1ON2 A;  3KX2 A;  3ZRG A;  5M3F J;  4RS8 A;  4KT5 C;  3TW7 A;  5JFR A;  4IJA A;  4II2 A;  1X3U A;  2BYV E;  3RZD J;  1CF7 A;  3VSK A;  2HPM A;  1DU0 A;  3QPH A;  4XN0 A;  4CCO A;  2NVT J;  4C3J J;  1A35 A;  2IA2 A;  5TRD A;  1ACI A;  1JE8 A;  3TW6 A;  3B73 A;  3H9G A;  4HQE A;  2DDA A;  3ABU A;  3CF2 A;  1WJA A;  2DFI A;  1I6X A;  5ILS A;  2HEO A;  2VT3 A;  1DPU A;  2KQR A;  3JSO A;  3RYP A;  4IHV A;  1NTC A;  4HAM A;  3ONQ A;  3GVA A;  2D2W A;  1D1B A;  3JAM Z;  1ZRC A;  1B9N A;  3MCZ A;  1HDP A;  2V1N A;  3I58 A;  3KYC B;  3W2V A;  3BLY A;  5IOZ A;  2CV0 A;  2KJC A;  2VLA A;  1EA3 A;  2PQ8 A;  5LD2 C;  1VQ5 I;  2XRO A;  1KU7 A;  2WY7 Q;  2HTS A;  2LKX A;  4EJV A;  3JRF A;  3FKI J;  1XMX A;  4JX5 A;  2L7M P;  3L2Q A;  4U88 A;  2RQQ A;  2CQQ A;  2Q8K A;  4U87 A;  4A69 C;  2DA3 A;  1IO2 A;  2LLK A;  3SJM A;  1Z7U A;  1IF1 A;  4IQ4 A;  1WWX A;  3L2V A;  1TT5 B;  1OLT A;  3KYL A;  1EV7 A;  1BW6 A;  1UST A;  1ZYR F;  2W25 A;  1F36 A;  1NHA A;  1FBQ A;  2M1B A;  1O57 A;  3CMY A;  1P9Q C;  3CF5 F;  2CV1 A;  3LSG A;  3A02 A;  1JGG A;  1EH7 A;  1R1U A;  1S29 A;  2I8D A;  2JT1 A;  2PI0 A;  4JYK A;  3HPG A;  2ME0 A;  3I53 A;  1UFM A;  2GA2 A;  2FE3 A;  2P0W A;  3HKZ N;  1I5Z A;  5E8I A;  1ZG1 A;  2KKO A;  4BJ5 C;  2FA5 A;  4HOB A;  4JP0 A;  3CCE I;  4IX7 A;  1ZRE A;  1DGR M;  4B8X A;  5FRN A;  4IOA F;  2MH2 A;  1SVO A;  4O5V A;  5IPA A;  3IRQ A;  3ZP5 A;  5E79 C;  5KK1 A;  3WHC A;  3OYF A;  2O6G E;  4M74 A;  3V7S A;  2A5W A;  3PJR A;  1I6H J;  4L18 B;  4MQ9 F;  3RPU A;  4RDU A;  1UG0 A;  2O5R A;  1LFU P;  3OYB A;  3P9I A;  2HKO A;  1SFU A;  2BW3 A;  3CUO A;  1DP7 P;  4CCN A;  2LF8 A;  3CMM A;  1Z67 A;  3GXO A;  4BE0 A;  1K83 J;  1G8X A;  3GLL A;  1WH5 A;  1FSE A;  3K2Z A;  5DEQ A;  4RB3 C;  3PO3 J;  4LB5 A;  1V5F A;  3ZQH A;  4XQF A;  5FLM J;  2A68 F;  1ETX A;  3ASN H;  3PUF A;  5GP9 A;  2VPL A;  1R4M B;  2ECB A;  2KDO A;  5KVR A;  3WU0 A;  1S3J A;  4BAY A;  1YFH A;  3GTQ J;  2P4W A;  1QRY A;  2DT7 B;  3PIP F;  2PG4 A;  4D5F A;  1M1E B;  3R0J A;  4F55 A;  1LFP A;  3LQQ A;  2FU4 A;  2Q2E A;  2UZK A;  1G3S A;  3M8E A;  4IHS A;  2KP6 A;  5FLV A;  3WGH A;  3LAP A;  2IGM A;  1UG2 A;  2AQE A;  2CU7 A;  1SFK A;  1GV5 A;  3WTX C;  3W2A A;  5LEJ A;  1STZ A;  2E7X A;  1T2K A;  1Z21 A;  3QYB A;  3GTK J;  3KCC A;  2YSR A;  1YW9 A;  1IN8 A;  2HZT A;  3TO9 A;  1IC8 A;  1ZRD A;  1TQI A;  3FHN A;  4XLP F;  2R4G A;  3MZ8 A;  4I2O A;  4PCQ A;  3NRV A;  1TQM A;  3LSR A;  3F8F A;  3K9T A;  5H20 A;  5H2F C;  2DW4 A;  4D7M A;  1N77 A;  1BN5 A;  3I4M J;  3OYJ A;  2QCO A;  3DPL C;  3OS2 A;  3FM3 A;  4GGG A;  1H88 C;  4ZDL A;  3QP6 A;  3F22 A;  1R36 A;  3OYH A;  2V9V A;  3WHB A;  3SZT A;  3TL4 X;  2EA4 A;  3F8C A;  2XKO A;  3AG4 H;  2VXZ A;  2L9V A;  3C7J A;  4KFC A;  3H3U A;  2BZT A;  2XDV A;  1LPQ A;  4E7I A;  2M4G A;  2GBY A;  2WC2 A;  1J7K A;  1P7J A;  1Q1V A;  2BVM A;  2DFH A;  1E17 A;  2XIG A;  2R7F A;  4FT8 A;  2O8K A;  4ZC3 A;  1XC5 A;  3JRB A;  1LDD A;  4V2F A;  4P55 A;  4E4H A;  1G3W A;  4OWR B;  1YS6 A;  2K85 A;  3Q9V A;  2CGP A;  1U3E M;  3IH3 A;  2L4M A;  2EA2 A;  5GAG J;  1ZRF A;  2NVQ J;  1BM9 A;  5JR3 A;  2XAH A;  4EAT A;  4LJZ F;  3U2R A;  4A3J J;  2R7O A;  3TP3 A;  2CFX A;  1T0F A;  2X51 A;  2K3P A;  4YIF A;  2DFE A;  1SVM A;  1FP2 A;  3BR3 A;  4JQF A;  1J9I A;  1TWF J;  3ULQ B;  4UNO A;  3O8H A;  2EFN A;  3KE2 A;  4U0V A;  1IV6 A;  2EZL A;  3ZN1 A;  3O2P E;  5D5U B;  3CLQ A;  1IXR C;  2XGX A;  4M9S A;  5ICC A;  1B4A A;  3AG3 H;  3Q9S A;  4FE7 A;  2H94 A;  3EQL F;  4YG2 F;  3LA2 A;  4AC0 A;  1DGW Y;  1MSF C;  3QRF F;  4MEX F;  1QVU A;  3KPH A;  4BBS J;  5DCM B;  3ABK H;  2KMU A;  4XKB A;  3BT9 A;  3KP5 A;  3GBG A;  5ICG A;  2HDW A;  2QEX I;  2TRT A;  4IPA A;  5HNF A;  2EFQ A;  3PFI A;  3LMM A;  5EZH A;  2M34 A;  3RPQ A;  3CCV I;  3BR1 A;  4XKW A;  5BPI A;  1RUN A;  4PJL A;  1XSX A;  3LAJ A;  3HOU J;  5E1Z B;  2Y48 A;  5KAF C;  2HPI A;  1OKR A;  3TDU C;  3CC7 I;  3CCJ I;  3S32 A;  1Y8R B;  2YU9 J;  2JA6 J;  3ZOB A;  3QAH A;  3HOX J;  3PNV A;  3V4G A;  4XRM A;  2IAI A;  5FKK A;  2GXA A;  2E1M B;  2IP2 A;  3OYD A;  2JRT A;  2VB6 A;  1IN4 A;  3HHH A;  3H36 A;  1X3Z B;  5B5E C;  3OIQ A;  1LEB A;  3QPS A;  3CC4 I;  2UUZ A;  3CDH A;  5CVJ A;  3I4N J;  3ZQQ A;  2M45 A;  3PSF A;  4HSR A;  2E2H J;  3JR9 A;  2DAO A;  1IZ1 A;  4HEA 2;  1IUF A;  2CJJ A;  2YUS A;  2DI3 A;  3MZH A;  1PDN C;  3LOC A;  4I76 A;  3QYE A;  2NRA C;  1ZLK A;  2ZNY A;  2KLO A;  2NS8 A;  2P6S A;  1JHF A;  2ACJ A;  1K78 A;  1IW7 F;  4HX7 A;  1I3Q J;  4RAZ A;  1P2F A;  1TWA J;  4F91 B;  4IHW A;  2EPF A;  3K4M A;  3TBI A;  2A05 A;  4ESF A;  2ZNZ A;  1XN7 A;  2L01 A;  4HF0 A;  3OR1 C;  2HOA A;  4ZTJ A;  2V9K A;  1MBH A;  1W36 C;  3OYE A;  4WXH A;  3K70 C;  2DLL A;  2K9M A;  2EB7 A;  4AWX B;  1W7P B;  2P5K A;  2YX4 A;  3DKX A;  3IH4 A;  2PJP A;  2LF7 A;  2BXZ A;  4UVC A;  3CCS I;  1JJ6 C;  1P4X A;  2VQH A;  4LFU A;  5D5X B;  3H5A A;  2W48 A;  2JTV A;  5DDG A;  1HW1 A;  4UVA A;  1BA5 A;  3IAM 2;  1YTY A;  3WTU C;  2QBY A;  4KIF A;  3QPT A;  1Q1H A;  4A5M A;  4BUP A;  1LNW A;  4XMY A;  3E6B A;  1OCT C;  2JQ7 A;  4YEJ A;  2CWE A;  4CHU A;  3ZGK A;  4WXC A;  2MH9 A;  3BTI A;  1UZC A;  2L5Q A;  2RKH A;  2X9D A;  1TW2 A;  2EWN A;  2W1O A;  2H6C A;  4EGY A;  4B43 A;  1HC8 A;  2G7H A;  5GAD J;  1QVT A;  1BJA A;  1EH6 A;  1U9N A;  2IS2 A;  3WTT C;  2R3S A;  1W1W E;  2R7V A;  2QM3 A;  2XF6 A;  3D5S C;  1U5T B;  5ICE A;  1OJL A;  1SAN A;  4ZH4 F;  1VF9 A;  4MHG A;  2EH3 A;  2MLG A;  4GDF A;  5M5W J;  1WJC A;  5DCM A;  3GX4 X;  1B6A A;  2HGC A;  5BMZ A;  3A2K A;  1TL8 A;  4ZJZ A;  1JUS A;  4JX6 A;  2JA7 J;  1Z0X A;  3W6V A;  2OUM A;  2V1X A;  3REO A;  2DOE A;  5ICF A;  1IN5 A;  3LSK A;  3G1M A;  4DYC A;  4ENJ A;  1AA7 A;  5F6F A;  2JA2 A;  3DP7 A;  1ETQ A;  3J7Z I;  2KIU A;  3HEF A;  4LIT A;  2XGC A;  3FMS A;  2HOE A;  3RKY A;  4AIH A;  3KZY A;  3HB9 A;  1R6R A;  2XKP A;  2DA1 A;  2FML A;  3GWZ A;  4BL0 B;  1U8B A;  2KZV A;  1KQ8 A;  2R7U A;  3B6C A;  3BWG A;  5HVQ C;  3OIO A;  1HXD A;  4IRI A;  1OCP A;  3FK7 A;  2W85 A;  5HOD A;  3W6K B;  3MKY B;  1U9O A;  1SEU A;  1JKR C;  3OL3 A;  1MDM B;  1OYW A;  4MFD A;  3VYS B;  3FXO A;  5E3M A;  2KIQ A;  5HS7 A;  4LMY A;  4IRH A;  3CUQ C;  1UB9 A;  4M3G A;  5CQE A;  4UUV A;  4E7H A;  5J40 A;  1QO0 D;  3ZMV A;  2P81 A;  1ZR2 A;  1ETY A;  2QKL B;  1Y39 A;  2G7U A;  3HIF A;  1ZH5 A;  5FLX Z;  1SD6 A;  2GQQ A;  3IV5 A;  3FHZ A;  3KFW X;  4IOC F;  4II3 A;  3SEQ A;  1HDD C;  2QF7 A;  3GTJ J;  3A0H C;  4XL9 A;  4Z6Y A;  3L2R A;  3V8J A;  1YI2 I;  1LJ9 A;  1WHU A;  2RRE A;  4XLH A;  2RN7 A;  3V8K A;  1P4W A;  3Q3S A;  2BY1 A;  1XS9 A;  3QU3 A;  2XGD A;  3WTY C;  2XSJ C;  4XNF A;  3GF2 A;  2HDD A;  2VBX A;  3CCQ I;  2ZXW H;  3FDY A;  3WTV C;  4Q4Z F;  2WTE A;  5E20 A;  1ZK8 A;  2Y30 A;  2IA0 A;  4BQA A;  1UEL B;  3IHU A;  3CME I;  3JSP A;  1U8R A;  3X2Q H;  5FD6 A;  1W7P A;  2BOL A;  4MFE A;  3NWT A;  4NDL A;  1MGT A;  1UHS A;  2JK3 A;  4M6Y A;  3ERE D;  4PSW A;  1F43 A;  1FT9 A;  1OCR H;  4OMY A;  1HW2 A;  3ISP A;  3VEP A;  3I54 A;  2VJI A;  4XRS G;  1QZY A;  3IKV A;  2K7L A;  3DEW A;  1QPM A;  3RKQ A;  1N78 A;  3ZN0 A;  4OOI A;  2M8E A;  3AFH A;  1H0M A;  3HOS A;  2LMD A;  4Y33 A;  3I55 I;  3FBI B;  2L7Z A;  2GWR A;  1I27 A;  4E6K G;  1MSE C;  3RSN A;  3BC8 A;  2VJ5 A;  4F92 B;  2L3D A;  2DK8 A;  2HU9 A;  2VBZ A;  1ITY A;  1MKM A;  1OMI A;  2M30 A;  4RAG A;  2VE9 A;  2IS1 A;  3G4S I;  2L4A A;  3IWF A;  5IT9 K;  3VWB A;  1D3Y A;  4V19 K;  2OTJ I;  2DYR H;  3HGY A;  2FEZ A;  3HL2 A;  1BJZ A;  2JRM A;  2VKH A;  5GAH J;  1ZG5 A;  1TTY A;  3UKG A;  1DPR A;  2CO5 A;  1U5T A;  5M3M J;  4C3I J;  2N8G A;  2DQR A;  5HDG A;  1R22 A;  3BJA A;  3A03 A;  4YII A;  2NOJ B;  5IT3 A;  4WF2 A;  3BR0 A;  4EM0 B;  1VFC A;  2HKX A;  2X6W A;  2EZH A;  2BY2 A;  4XID A;  3HDD A;  1U5T C;  1H9G A;  2A6E F;  3ZMS A;  4Y13 A;  4ON0 A;  5F1R A;  4IHY A;  4RGS A;  4FET A;  1BBY A;  4UVB A;  3Q0U A;  2OCE A;  3KP3 A;  5FFX A;  5DUI A;  1ZN2 A;  1YX3 A;  2A5Y B;  2X6X A;  4RAY A;  4BY7 J;  1V3F A;  1J59 A;  5EEA A;  2KRH A;  1GDT A;  2DO7 A;  2V7F A;  1TBX A;  1RNL A;  3JRE A;  1QGP A;  1GVD A;  1MMD A;  2YPR A;  4DYQ A;  3BG5 A;  3GFL A;  2NNN A;  3HZJ A;  2F6C A;  2EFO A;  3DTE A;  5K7H A;  2ZJQ F;  1TNT A;  3IP4 B;  2RDP A;  4A3K J;  2JVH A;  3N97 A;  1MDM A;  3WU1 B;  2LRD A;  3GFM A;  1C0W A;  1YX5 A;  4NNJ A;  3SEZ A;  4I98 B;  4XN3 A;  1R1V A;  2JPC A;  3LSM A;  4Y3O A;  2FBH A;  5F64 A;  3PNT A;  1ZEL A;  4PJ0 C;  4U0W A;  4EMS A;  3FXL A;  2L7F P;  5FD5 A;  1BI3 A;  1X19 A;  1X4O A;  2EZI A;  2QKM B;  5CVR A;  1BOB A;  2CYY A;  3I56 I;  3ZCO A;  3OOP A;  4MO7 A;  4W97 A;  2W57 A;  5J47 A;  3OSF A;  4RM3 A;  3D0S A;  1IDZ A;  1MBF A;  2O0Y A;  2PEX A;  4LIV A;  4M6V A;  2WA0 A;  3OS1 A;  5HLT A;  1R58 A;  2L2O A;  3EUH C;  5LBQ A;  4PSX A;  2RQP A;  2WAF A;  4R8H A;  3CO7 C;  2R7Q A;  4UY8 I;  4WXD A;  2V6E A;  1AU7 A;  3E3V A;  5CVV A;  2XRN A;  2DN0 A;  1MBG A;  5EGO B;  3BJO A;  4B3A A;  3BZC A;  1U2W A;  1FYM A;  4BQQ A;  3WTZ A;  1HBX G;  2LD5 A;  3S2W A;  3BQY A;  2Z1D A;  2UXX A;  2XV4 S;  2LRE A;  4A3B J;  4HDU A;  3DWL E;  2V26 A;  2ZBK A;  5DUK A;  4L0Z B;  2RC4 A;  1OYY A;  5EG0 A;  2KDZ A;  3MD2 A;  4S04 A;  1P6R A;  2P5L C;  4RAF A;  4PJM A;  1O7F A;  3WU2 C;  1TWH J;  3M1E A;  3I5U A;  3FWE A;  3T1B A;  3BG6 A;  4YEL A;  1D8J A;  3DLL F;  5HDK A;  2EBI A;  3BY6 A;  1KU9 A;  1SD5 A;  3H92 A;  3DBH B;  5AON A;  2ZC2 A;  2HVS A;  5GPC A;  1XTA A;  3HKZ A;  3NWS A;  1F5T A;  3BPX A;  2FMY A;  3I59 B;  5CLS A;  2BV6 A;  3SZP A;  2QYO A;  1KU2 A;  2EIK H;  1LUJ B;  1JI8 A;  5FFZ A;  1R5I D;  2Z2S B;  1JJ8 C;  2F4O B;  2MSY A;  2A6H F;  1ZAO A;  5DCF A;  4A3I J;  3F6V A;  3JAM K;  3HTS B;  1R7J A;  2KIS A;  4M3F A;  3WE3 A;  1T8I A;  2ISZ A;  1PJR A;  2STT A;  1MMA A;  1MBJ A;  1W5T A;  3QQA A;  4ZYA A;  3CJN A;  1N75 A;  2ZSI B;  3F0C A;  3LFU A;  3NQO A;  2K9S A;  4BXU A;  4DYR A;  2JA5 J;  4AUX A;  2VOD A;  3DTK A;  5D4R A;  3LSI A;  2CS3 A;  5DYM A;  2JPB A;  2HQN A;  2VAS A;  3FMR A;  3CO6 C;  2W82 A;  4DJA A;  3GW2 A;  3K4J A;  1BC8 C;  2DJI A;  1FOY A;  3HRS A;  4Y52 J;  3UNG C;  1YYV A;  1EKE A;  3HUG A;  3K69 A;  5E3L A;  4E7Z A;  4DBR A;  1R49 A;  5J1Y A;  1L0O C;  3GLX A;  3W6J B;  2JSC A;  3MZY A;  3LSH A;  5J8C A;  1HLV A;  2Y0S N;  3M7G A;  5FKN A;  3S17 J;  1FPQ A;  3BPV A;  3FXR A;  5L3E A;  1GHC A;  3LA7 A;  1KYW A;  3RYR A;  1USS A;  1ORK A;  2L02 A;  1LEA A;  3K4B A;  2Y0M A;  3D5L A;  5F04 A;  5IP6 A;  4P1W A;  3EYI A;  3IKT A;  2LTP A;  2HDC A;  2ZO4 A;  4EV0 A;  1W5C C;  1K6O A;  1GVJ A;  2R7D A;  1X4P A;  2DYS H;  2P5V A;  4QSH A;  2PJR B;  3LA3 A;  2L9N A;  1RIO H;  4NB5 A;  2L9S A;  3MVP A;  4F7Z A;  3QOP A;  3RKX A;  5CVU A;  2FNA A;  2LY1 A;  2WAQ N;  3E6D A;  4ASN A;  4F3Q A;  2H8R A;  1X1D A;  5K7Z A;  3J7Y J;  3E6M A;  1BOA A;  3J7A Y;  1G6N A;  2DMT A;  4ZZD A;  3ZQI A;  2P7C B;  4ZYE A;  4YFN F;  2TCT A;  2LNB A;  3TQN A;  2EZK A;  5EGO A;  2LC2 A;  2ZFU A;  4RGR A;  1Y0N A;  1V5G A;  2LH9 A;  5KHD A;  4OIO F;  3GZN B;  5GAE J;  3GTG J;  1IDY A;  2RNJ A;  5LGT A;  2F5V A; 
#chains in the Genus database with same CATH homology
 2PFB A;  1SMT A;  4CZZ A;  2D1V A;  1MD0 A;  4M9X A;  5D6E A;  4R1H A;  2GXG A;  4HYE A;  1D8K A;  3FM5 A;  3I59 A;  3E6C C;  3B02 A;  3COA C;  2L54 A;  5D6F A;  4LK0 F;  1IRF A;  1UHM A;  2ZFW A;  4G9Y A;  2H27 A;  4RB0 A;  2QZ8 A;  3ELK A;  3SXY A;  4A5N A;  5LGU A;  4KDP A;  4U7D A;  1K78 B;  1S7O A;  1IRG A;  4MTD A;  5E8G A;  4A0Y A;  1B1B A;  4MTE A;  2Y75 A;  1HST A;  2DU9 A;  2DQL A;  2GZW A;  4S05 A;  3F72 A;  3WGG A;  3H3Z A;  4BHP A;  3DQV C;  4FX0 A;  2HR3 A;  3PQK A;  3DF8 A;  5E1W A;  2QBY B;  2FBK A;  4P9U A;  4KN4 X;  4N0B A;  4EQQ A;  2ZJ2 A;  5CJ9 A;  4FX4 A;  4KMU X;  2IRF G;  1R1T A;  2BBY A;  1XMK A;  1XDU A;  2OQG A;  2DPD A;  4Q5S F;  4IHT A;  3DFG A;  2A3S A;  3E97 A;  2H09 A;  2BEO A;  2EV0 A;  3LST A;  4HQM A;  2MC3 A;  4MQV A;  2YU3 A;  3KLO A;  1MJ9 A;  4PGH A;  3R60 A;  2NAZ A;  2F5D A;  4RGX A;  3FF5 A;  2F5E A;  3K1N A;  3KP4 A;  3T0Y A;  2GIV A;  4TV7 A;  2ETH A;  3CLO A;  3CUQ B;  2NS0 A;  5K5R A;  2P7V B;  2CQK A;  2QVO A;  4I7H A;  4LGW A;  3HSE A;  1LDK B;  2Q0O A;  1G4D A;  3ZMT A;  1J5Y A;  5LLQ A;  2E1N A;  4ZZL A;  3F8B A;  1RI7 A;  2QLZ A;  4I09 A;  4LB6 B;  5K1Y A;  4A0Z A;  5LRR A;  3L2C A;  3TOA A;  2MLK A;  5L3G A;  3F8N A;  2VT2 A;  2FF4 A;  4HW0 A;  3NEU A;  3V8L A;  1YW8 A;  3GZ6 A;  3I0T A;  1D5V A;  1BI0 A;  1ULY A;  3HSF A;  2VC1 A;  2X4H A;  1KQ0 A;  3L09 A;  3OV8 A;  5K5Q A;  4YFK F;  3ZMZ A;  5HLG A;  1IXC A;  2LSO A;  5JI6 A;  2Z5U A;  1EH8 A;  4EJO A;  4EJU A;  5A2Q K;  1XCV A;  1FYL A;  2P6T A;  5BS6 A;  1XD7 A;  5A2Q Z;  5JVT A;  3C1D A;  1IAW A;  1ZGJ A;  5LHI A;  4ENN A;  3LFK A;  5D5V B;  5L3F A;  4GYG A;  2AS5 F;  1I1S A;  1HKS A;  1O3S A;  1QZZ A;  4HX4 A;  1U78 A;  4ZYH A;  2RV8 A;  1BI1 A;  2GXB A;  2G9W A;  1R5G A;  4HV5 A;  4JBA A;  1LB2 A;  1F4K A;  1CGP A;  5FGM A;  5K5O A;  1O7L A;  1H9T A;  4G6D A;  3MEX A;  2XUB A;  3K1P A;  3L9F A;  4FHT A;  4DQ2 A;  5E17 F;  3CUQ A;  4L9V A;  1L3L A;  5LEK A;  4Q48 A;  3DEU A;  4OIP F;  3IWZ A;  5FLX K;  1O3T A;  5L3B A;  4G7H F;  3HHG A;  1T39 A;  1TW3 A;  1GXQ A;  2P8T A;  2KRF A;  2BE5 F;  1B59 A;  4N9H A;  1QNT A;  2NNY A;  1G3T A;  4CIC A;  3F8M A;  4M71 A;  2FNP A;  2OU2 A;  4EM2 A;  3JTH A;  2CSO A;  2IVM A;  4A0X A;  4IF4 A;  4GYI A;  5HLH A;  5D8L B;  2VBY A;  1FNN A;  2UXN A;  2ELH A;  2VON A;  4LG0 A;  1WSU A;  3KEQ A;  2HTJ A;  2PMH A;  3L00 A;  2KIM A;  2WV0 A;  1SMY F;  3WG9 A;  4ESJ A;  4AD9 A;  5ILV A;  1ZAR A;  2W24 A;  1T38 A;  1I1G A;  3RIR A;  4JK1 X;  4K2E A;  2D1H A;  1YO5 C;  2B0L A;  3TO6 A;  3SQN A;  3L7W A;  1LDJ A;  1BIA A;  2KJB A;  4BHC A;  1TQP A;  3MFK A;  5LRS A;  2YX7 A;  1PP7 U;  4I0B A;  4BYY A;  1MZB A;  4EJW A;  1FC3 A;  2QQB A;  4HV6 A;  2ADU A;  4OIN F;  2VOP A;  1XGS A;  4LD5 A;  3DKW A;  1U6G A;  1FSH A;  3KLN A;  1UCR A;  1YQA A;  4GCV A;  1KYZ A;  3HRT A;  4CO8 A;  3EUH A;  3C18 A;  4ENK A;  3ZQ7 A;  1XGN A;  1S8N A;  2CW0 F;  1LQ1 A;  1A04 A;  5DV5 A;  4PGG A;  2DBB A;  2V1U A;  3E5U A;  5D4S A;  3WGI A;  4P9F A;  3MAJ A;  2HYF A;  4L5J A;  3KP6 A;  3AAF A;  3R0A A;  2GA1 A;  3GEZ A;  4AIK A;  1JGS A;  2EV6 A;  1WQ2 A;  1SFX A;  4P96 A;  3EYY A;  4KIB A;  2XHK A;  1TNS A;  3BRO A;  2LKP A;  1FBU A;  4EVI A;  5BQT A;  1Z05 A;  3J81 Z;  2XAG A;  4HLY A;  4G8X A;  4Z2Y A;  1ODD A;  2PBI A;  2VBW A;  4LK1 F;  3HRM A;  2WWY A;  2F5F A;  1DUX C;  3ZMD A;  1KA8 A;  3K0L A;  5CVI A;  4HF2 A;  2O03 A;  1K7A A;  2IA1 A;  3HTU A;  1XSV A;  2FRH A;  2VN2 A;  5L3C A;  5LGN A;  4I01 A;  4LLN A;  4L9N A;  5HOO A;  3O6B B;  2X0L A;  3G3Z A;  1XCB A;  3TDZ C;  2IT0 A;  5AIQ A;  1FX7 A;  2OAZ A;  4NQW A;  3V7R A;  3KP2 A;  3TOB A;  2QQ9 A;  2HFH A;  3I64 A;  2K27 A;  4HF1 A;  4NHJ A;  1IXS B;  1FZP B;  3IC7 A;  1ZLJ A;  1YW7 A;  2OQR A;  5HS8 A;  4IVN A;  2RGV A;  1VTN C;  2M87 A;  2QWW A;  4IRG A;  5BPD A;  2E7W A;  1O3R A;  3T8T A;  3DV8 A;  3F6O A;  1Z9C A;  2KIF A;  3DXJ F;  3HYI A;  3M9A A;  6PAX A;  2BGC A;  1BIB A;  1OPC A;  4DNC A;  3F3X A;  4MEY F;  4XBF A;  2FQ3 A;  1DDN A;  4AVP A;  1FYK A;  4XSZ F;  2C6Y A;  5L3D A;  3R6S A;  2JZY A;  4PDK A;  2HS5 A;  3JTG A;  1KU3 A;  1FOK A;  3QU6 A;  3J7A O;  5E18 F;  2HWV A;  3HOT A;  4IXA A;  4UHT A;  5BOX A;  4Y17 A;  3BDD A;  3U1D A;  3FX3 A;  2GAU A;  4KMF A;  1W4M A;  2J5O A;  1WRJ A;  1UHW A;  3R4K A;  1GXP A;  2J5P A;  4OU0 A;  2K4B A;  1HKQ A;  1FBS A;  4PZJ A;  2UWM A;  1MJA A;  3SFZ A;  3KET A;  1PP8 F;  2EK5 A;  3WTW C;  2IW5 A;  4RB2 C;  1ONV A;  3TGN A;  2XAJ A;  3V7C A;  4QWQ A;  2OBP A;  3G73 A;  4LLL A;  1Z1D A;  2HYG D;  2Z33 A;  1HSJ A;  1KGS A;  3T5X A;  4A2U A;  4XRF A;  2Z9O A;  1SD4 A;  5H6R A;  3C3W A;  4UXN A;  5AIP A;  1XMA A;  4RB1 A;  3GFI A;  4M6X A;  3GFJ A;  2EV5 A;  1XGM A;  1T98 A;  3GZ5 A;  3K1M A;  3PQJ A;  1IUY A;  2COM A;  3BZ6 A;  2K4J A;  3T8R A;  4ZYG A;  4E70 A;  4EJT A;  1F1Z A;  3CTA A;  4UV9 A;  2EFW A;  2CG4 A;  4O6J A;  4HA8 A;  1JHH A;  2Z99 A;  4HBL A;  4GXO A;  5HDN A;  3BJ6 A;  5D8K B;  5CYV A;  5E1X A;  4G7Z F;  4ZYD A;  2IPQ X;  4O3M A;  1FWZ A;  1XSD A;  3ECO A;  4L9T A;  4D0P A;  2XVC A;  3GO5 A;  2FOK A;  4M73 A;  1FLI A;  3HSR A;  4ETS A;  3FZV A;  4HLX A;  3F23 A;  3I4P A;  4XSX F;  1RUO A;  2W84 A;  5TJJ A;  3ZPL A;  4MGR A;  4GO1 A;  4KIC A;  4KA4 A;  4P5O A;  2ESH A;  1R00 A;  1J0R A;  2VOO A;  4B09 A;  1QBJ A;  2DPU A;  4BHB A;  3EET A;  3RTR A;  2OZ6 A;  2F2E A;  3FXU A;  3SHF A;  1E2X A;  4KUM A;  1BI2 A;  4KN7 X;  1TLH B;  3M8F A;  3VFZ A;  4AIJ A;  4WX9 A;  1Z6R A;  2DT5 A;  5ILU A;  1XB4 A;  2OZU A;  2MD5 A;  5DD4 A;  5LHH A;  4LG0 B;  3P9C A;  2A69 F;  3LQR A;  5H6Q A;  4RGU A;  4Q47 A;  5DD8 A;  2M5W A;  3VOD A;  3N4M A;  4M72 A;  1HW5 A;  1K79 A;  2A07 F;  3J80 K;  3F21 A;  4HZF A;  5HLI A;  2VC0 A;  3J80 Z;  3ABT A;  1FY7 A;  2LDU A;  1R5H A;  4BNC A;  3BP8 A;  5ERI A;  4KYW A;  1R23 A;  3GYH X;  1FP1 D;  2FSW A;  2EJR A;  4WK8 F;  1O3Q A;  3TKY A;  2MBF A;  3BOQ A;  1WKM A;  5D5W B;  1HQC A;  4XLN F;  3ECH A;  4N9I A;  1YLF A;  3KZZ A;  1ZHF A;  1ON1 A;  1XGO A;  1BC7 C;  4EM1 A;  3R61 A;  3WOD F;  2ZKZ A;  5EEH A;  2H6B A;  2QEN A;  2O3F A;  2TDX A;  4G6Q A;  1SFE A;  3E5Q A;  3VOE A;  2V1D A;  4UV8 A;  3P7N A;  2PLY A;  2Z3Y A;  2XAF A;  1OR7 A;  4ENM A;  4CYD A;  1F9N A;  4I02 A;  4WWC A;  1W7P D;  3DPT A;  3E5X A;  4ESB A;  1P92 A;  3Q5F A;  2PN6 A;  2K86 A;  3ROU A;  1OYI A;  2EFP A;  3GUD A;  2AXL A;  1YG2 A;  3HRU A;  2XAS A;  4MNU A;  2K02 A;  3RI4 A;  4QLC U;  4U0Y A;  4KNY A;  4BH9 A;  1MJB A;  4CDG A;  1PUE E;  2O8X A;  3MQ0 A;  4L0Y B;  2ZME B;  1ZG3 A;  2ZXJ A;  4OIR F;  4WCG A;  1Z6T A;  2DTR A;  3JW4 A;  2DK5 A;  4Y15 A;  3VB2 A;  3FMQ A;  2RVC A;  5FB2 A;  2FXA A;  4CGZ A;  2ISY A;  4A6D A;  3LWF A;  2OD5 A;  1XDS A;  1B9M A;  2F5C A;  1RZ4 A;  2A61 A;  2ESN A;  3P9K A;  2PMU A;  1ZGA A;  3IL2 A;  3FXQ A;  1Y0U A;  1CF7 B;  2NYX A;  3U9G A;  3RDI A;  1J75 A;  4G7O F;  5IT9 Z;  1V4R A;  1G3Y A;  1HKT A;  2V79 A;  2OA4 A;  3RKW A;  4EGZ A;  3WE2 A;  2HQR A;  2XAQ A;  2QUF A;  1SAX A;  4M9Z A;  5J6X A;  4HX8 A;  4L5I A;  2VE8 A;  4CXF A;  4HDV A;  4KIG A;  1QQI A;  5EEG A;  3O3K A;  4G94 A;  5LHG A;  1KQ9 A;  2QQA A;  1LVA A;  3WTS C;  3IRR A;  2YR2 A;  2MA3 A;  3KP7 A;  3I71 A;  1J2X A;  1W5S A;  4LLG F;  3TO7 A;  4H0E A;  1AOY A;  2O61 A;  5FO5 A;  4R79 A;  5J8F A;  1JXS A;  2E1C A;  2FBI A;  3MWM A;  4A12 A;  1S6L A;  4U7B A;  1S7A A;  2ZCW A;  5HS9 A;  3RJP A;  4A6E A;  4YFX F;  4OMZ A;  3J81 K;  2V6C A;  3EDP A;  2STW A;  1REP C;  5ED4 A;  2ZME A;  1IN6 A;  3ML6 A;  3KEO A;  1SD7 A;  4I0A A;  1Z91 A;  1P4A A;  1IN7 A;  2D45 A;  1T6S A;  3QP5 A;  1YS7 A;  1AWC A;  4L9J A;  3ZMU A;  1WI9 A;  4OIQ F;  5JHU A;  1YIO A;  2IJL A;  1ON2 A;  4RS8 A;  4KT5 C;  5JFR A;  4IJA A;  1X3U A;  2BYV E;  1CF7 A;  3QPH A;  2IA2 A;  5TRD A;  1JE8 A;  3B73 A;  4HQE A;  3ABU A;  2DFI A;  1I6X A;  5ILS A;  2VT3 A;  1DPU A;  3JSO A;  3RYP A;  4HAM A;  3GVA A;  2D2W A;  3JAM Z;  1ZRC A;  1B9N A;  3MCZ A;  3I58 A;  2KJC A;  2PQ8 A;  2XRO A;  1KU7 A;  2HTS A;  4EJV A;  4U88 A;  2Q8K A;  1Z7U A;  1IF1 A;  1WWX A;  1EV7 A;  1UST A;  1ZYR F;  2W25 A;  1NHA A;  1FBQ A;  2M1B A;  1O57 A;  2PI0 A;  1EH7 A;  1R1U A;  1S29 A;  2JT1 A;  3I53 A;  1UFM A;  2GA2 A;  2FE3 A;  5E8I A;  1ZG1 A;  1I5Z A;  2KKO A;  2FA5 A;  4HOB A;  1ZRE A;  4B8X A;  2MH2 A;  3IRQ A;  4O5V A;  3ZP5 A;  5KK1 A;  2O6G E;  4M74 A;  3V7S A;  4L18 B;  4MQ9 F;  3RPU A;  3P9I A;  2HKO A;  1SFU A;  1DP7 P;  3CUO A;  2LF8 A;  3GXO A;  3K2Z A;  4RB3 C;  1FSE A;  5DEQ A;  4LB5 A;  2A68 F;  5KVR A;  3WU0 A;  1YFH A;  1S3J A;  4BAY A;  2P4W A;  2PG4 A;  3R0J A;  3LQQ A;  2FU4 A;  2Q2E A;  2UZK A;  1G3S A;  3M8E A;  4IHS A;  3WGH A;  3LAP A;  3WTX C;  5LEJ A;  1STZ A;  2E7X A;  1T2K A;  3KCC A;  2YSR A;  1YW9 A;  1IN8 A;  2HZT A;  3TO9 A;  1ZRD A;  1TQI A;  4XLP F;  4I2O A;  4PCQ A;  3NRV A;  1TQM A;  3F8F A;  3K9T A;  5H20 A;  2DW4 A;  1BN5 A;  3DPL C;  3FM3 A;  4GGG A;  3QP6 A;  3F22 A;  1R36 A;  2V9V A;  3SZT A;  2EA4 A;  3F8C A;  2XKO A;  2VXZ A;  3C7J A;  4KFC A;  3H3U A;  2WC2 A;  1J7K A;  1E17 A;  2XIG A;  2R7F A;  4FT8 A;  1LDD A;  4P55 A;  1G3W A;  1YS6 A;  3Q9V A;  2CGP A;  1U3E M;  2L4M A;  2EA2 A;  1ZRF A;  1BM9 A;  5JR3 A;  2XAH A;  4LJZ F;  3U2R A;  2CFX A;  1T0F A;  4YIF A;  1FP2 A;  4JQF A;  1J9I A;  3ULQ B;  4UNO A;  2EFN A;  3KE2 A;  4U0V A;  3ZN1 A;  3O2P E;  5D5U B;  1IXR C;  2XGX A;  5ICC A;  4M9S A;  1B4A A;  3Q9S A;  2H94 A;  3EQL F;  4YG2 F;  3LA2 A;  3QRF F;  4MEX F;  5DCM B;  3KP5 A;  5ICG A;  4IPA A;  2EFQ A;  3PFI A;  3RPQ A;  5BPI A;  1RUN A;  1XSX A;  3LAJ A;  5E1Z B;  2Y48 A;  1OKR A;  3TDU C;  3QAH A;  3V4G A;  2IP2 A;  2JRT A;  1IN4 A;  3HHH A;  1LEB A;  3CDH A;  5CVJ A;  2M45 A;  2DAO A;  1IZ1 A;  2DI3 A;  3MZH A;  1PDN C;  2NRA C;  1ZLK A;  2ZNY A;  1K78 A;  2P6S A;  1JHF A;  2ACJ A;  1IW7 F;  4HX7 A;  4RAZ A;  1P2F A;  4ESF A;  2ZNZ A;  1XN7 A;  2L01 A;  4HF0 A;  4WXH A;  2DLL A;  2EB7 A;  4AWX B;  1W7P B;  2P5K A;  2YX4 A;  2PJP A;  2LF7 A;  4UVC A;  1P4X A;  4LFU A;  5D5X B;  5DDG A;  2JTV A;  1HW1 A;  4UVA A;  1YTY A;  3WTU C;  2QBY A;  4KIF A;  3QPT A;  1Q1H A;  4A5M A;  1LNW A;  3E6B A;  2CWE A;  4CHU A;  4WXC A;  2MH9 A;  2RKH A;  1TW2 A;  2EWN A;  2H6C A;  4EGY A;  2G7H A;  1BJA A;  1EH6 A;  3WTT C;  2R3S A;  2QM3 A;  1U5T B;  5ICE A;  4ZH4 F;  4MHG A;  2MLG A;  5DCM A;  3GX4 X;  1B6A A;  2HGC A;  5BMZ A;  2V1X A;  3REO A;  5ICF A;  1IN5 A;  4ENJ A;  5F6F A;  3DP7 A;  2KIU A;  3FMS A;  2HOE A;  3RKY A;  4AIH A;  3KZY A;  2XKP A;  2FML A;  3GWZ A;  1KQ8 A;  3BWG A;  5HVQ C;  1HXD A;  4IRI A;  2W85 A;  3W6K B;  1MDM B;  1OYW A;  5HS7 A;  4LMY A;  4IRH A;  3CUQ C;  1UB9 A;  4UUV A;  1QO0 D;  3ZMV A;  2G7U A;  3HIF A;  1ZH5 A;  5FLX Z;  1SD6 A;  2GQQ A;  3FHZ A;  3KFW X;  3V8J A;  1LJ9 A;  2RN7 A;  3V8K A;  1P4W A;  3QU3 A;  3WTY C;  3GF2 A;  2VBX A;  3WTV C;  4Q4Z F;  2WTE A;  5E20 A;  2IA0 A;  4BQA A;  3IHU A;  3JSP A;  1U8R A;  5FD6 A;  1W7P A;  1MGT A;  4M6Y A;  3ERE D;  1FT9 A;  4OMY A;  1HW2 A;  3ISP A;  3VEP A;  3I54 A;  1QZY A;  3IKV A;  2K7L A;  1QPM A;  3ZN0 A;  4OOI A;  2M8E A;  1H0M A;  3HOS A;  2GWR A;  1I27 A;  2L3D A;  2DK8 A;  2VBZ A;  1MKM A;  1OMI A;  2M30 A;  2VE9 A;  2L4A A;  3IWF A;  5IT9 K;  1D3Y A;  2FEZ A;  1ZG5 A;  1TTY A;  1DPR A;  2CO5 A;  1U5T A;  5HDG A;  2DQR A;  1R22 A;  3BJA A;  4YII A;  5IT3 A;  4WF2 A;  4EM0 B;  2HKX A;  1U5T C;  1H9G A;  2A6E F;  3ZMS A;  4Y13 A;  4ON0 A;  5F1R A;  4RGS A;  1BBY A;  4UVB A;  3KP3 A;  5FFX A;  5DUI A;  1ZN2 A;  2A5Y B;  4RAY A;  1V3F A;  1J59 A;  2DO7 A;  1TBX A;  1RNL A;  1QGP A;  2YPR A;  3GFL A;  2NNN A;  2EFO A;  1TNT A;  2RDP A;  3N97 A;  1MDM A;  3WU1 B;  3GFM A;  1C0W A;  4I98 B;  1R1V A;  2JPC A;  5F64 A;  2FBH A;  4U0W A;  4EMS A;  5FD5 A;  1BI3 A;  5CVR A;  2CYY A;  3OOP A;  2W57 A;  3D0S A;  2O0Y A;  2PEX A;  1R58 A;  5LBQ A;  2RQP A;  4R8H A;  3CO7 C;  4WXD A;  3E3V A;  5CVV A;  2XRN A;  3BJO A;  1U2W A;  1FYM A;  3WTZ A;  1HBX G;  3S2W A;  2UXX A;  2XV4 S;  4HDU A;  2ZBK A;  5DUK A;  4L0Z B;  2RC4 A;  1OYY A;  4S04 A;  1P6R A;  2P5L C;  1O7F A;  3M1E A;  3I5U A;  3FWE A;  3T1B A;  1D8J A;  5HDK A;  3BY6 A;  1KU9 A;  1SD5 A;  3H92 A;  5AON A;  1F5T A;  2FMY A;  3BPX A;  5CLS A;  3I59 B;  2BV6 A;  3SZP A;  2QYO A;  1KU2 A;  5FFZ A;  2A6H F;  1ZAO A;  5DCF A;  3F6V A;  3JAM K;  3HTS B;  1R7J A;  3WE3 A;  2ISZ A;  2STT A;  1W5T A;  3CJN A;  3NQO A;  4BXU A;  2VOD A;  5D4R A;  5DYM A;  2JPB A;  2HQN A;  3FMR A;  3CO6 C;  3GW2 A;  1BC8 C;  3HRS A;  1YYV A;  3K69 A;  3HUG A;  1L0O C;  3GLX A;  3W6J B;  2JSC A;  3MZY A;  5J8C A;  3M7G A;  1FPQ A;  3BPV A;  3FXR A;  5L3E A;  1GHC A;  3LA7 A;  1KYW A;  3RYR A;  1USS A;  2L02 A;  1LEA A;  2Y0M A;  3D5L A;  3EYI A;  3IKT A;  2HDC A;  2ZO4 A;  4EV0 A;  1K6O A;  1GVJ A;  2R7D A;  2P5V A;  3LA3 A;  1RIO H;  4NB5 A;  4F7Z A;  3QOP A;  3RKX A;  5CVU A;  2FNA A;  3E6D A;  4ASN A;  3E6M A;  1BOA A;  1G6N A;  4ZZD A;  2P7C B;  4ZYE A;  4YFN F;  2LNB A;  3TQN A;  4RGR A;  4OIO F;  2RNJ A;  5LGT A;  2HEO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...