2PI3O

The crystal structure of ospa mutant
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
246
structure length
246
Chain Sequence
b'NSVSVDLPGSMKVLVSKSSNADGKYDLIATVDALELSGTSDKNNGSGVLEGVKADASKVKLTISDDLGQTTLEVFKSDGSTLVSKFVTSKDKSSTFEKFNEKGEVSEKFITRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGEVSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTSSNTITVQQYDSNGTSLEGSAVEITKLDEIKNALK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer surface protein A
publication title Aromatic cluster mutations produce focal modulations of beta-sheet structure.
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags Membrane protein
total genus 47
structure length 246
sequence length 246
ec nomenclature
pdb deposition date 2007-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.160 Mainly Beta Beta Barrel Lipocalin C1 set domains (antibody constant domain-like) 2pi3O01
3.90.930.1 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Outer Surface Protein A; domain 3 2pi3O02
2I5VO 2I5ZO 3CKGA 2AF5A 1OSPO 2OL8O 1P4PA 3CKFA 2HKDA 2PI3O 2OY5O 2OY7A 2OY8A 5B11O 3EC5A 5B3MO 2OY1O 2G8CO 2FKJA 2OL6O 2OL7A 1FJ1E 2FKGA 2OYBO 5B2AO 5B10O 3AUMO
chains in the Genus database with same CATH superfamily
3J7ZG 1HY2A 2IZFB 1MUPA 4IMNA 3ZW0A 3C76X 4KIIA 3NQKA 1BLRA 4I3DA 1GT1A 3KFGA 2C1QA 4JHQA 4O4UA 1KL4A 3TGBA 3ZQ3A 3PEDA 1SWLA 1LKEA 5AEOA 2OFBA 4DNEA 1RXJA 1SWNA 2ZJQE 4QGVA 1LDOA 4YFRA 4KC8A 2MO5A 2R74A 1SLFB 2I5ZO 1E5PA 1QFTA 3CCEE 2LBVA 2EU7X 3FR4A 3MG5A 1JJ2E 1SREA 4MVKA 4CPHB 2X34A 2WQ9A 2GH7A 3RWXA 1Y52X 2HLVA 3VPJE 1PEEA 3I17A 1RJLC 2RQ0A 2L68A 4YH0A 2G78A 2GTLO 2A3FX 1JBHA 4ES7A 4XMHA 3PIOE 4GGRA 3HWFA 1GX3A 2FRSA 5LJEA 4GNYA 1A57A 4HPDA 1Y9LA 4YDBA 4BQUA 2CBSA 1SY0A 5KICA 4ML7B 4XMGA 4ORSA 4GUZA 1OPBA 2WUTA 1KXOA 1EPAA 4CK4A 2JGSA 1STSB 2IZEB 4A8ZA 1HBQA 3K3LA 4INNA 3P6HA 3F6ZB 3P02A 2GC9A 5FQ6E 5HCEC 4BX6B 1G7NA 3FEKA 1N0SA 2A2GA 5MLCH 3G71E 4TQ2A 5H1SI 5FQ7E 1SRHA 1H91A 1VWFB 1KD1G 2GJ5A 5LJDA 3WJFA 1A3YA 4Y0SA 1KT7A 2A5BA 1VQ9E 3BRNA 2KTSA 2UZ2A 2AF5A 5H9NA 4FBRA 4BX5A 2IFBA 5CE4A 5GAHG 4YVBA 2RTCB 1LNMA 2WEXA 4GETA 2KT4B 4WFAE 2OF8A 4PSQA 1B4MA 1O8VA 2IZBA 2HZQA 3FYFA 2MF6A 1E02A 4YMYA 2CBRA 2QA4E 1JJJA 3VE2A 1OBQA 1VQKE 2QO5A 3HWEA 2FWVA 3B2HA 4YKMA 1SWBA 5B2AO 3I56E 2G5LA 1VQ7E 4CDFA 2LBAA 5D8JA 1PBYA 1ICNA 3B2LA 1Q82G 1VPRA 2IZAA 3D96A 5L8NA 3PECA 1SY3A 4GK9A 1JZUA 1VWPB 1Y9TA 1EIIA 3D97A 4BJ8A 4I60A 1TVQA 3EBKA 2PI3O 3CXCE 2ACPX 4IOAE 4Y59A 4YGGA 4NNSA 1SXYA 2QOSC 1LIBA 1RXKA 3CR6A 5HWZA 4GJVA 4ALOA 2ALLX 2CZUA 3TGCA 1YUPA 3WJDA 5AJBA 2RTQB 1SWSA 1VWHB 2Q2PA 4QAEA 1SWFA 1RBPA 1X8OA 2R73A 4ZGUA 1VWBB 4GZVA 1CBSA 1NQMA 1N8RG 2OVEA 2W2FA 4FBOA 4O3XB 3CCLE 3SZJA 1FELA 2OY1O 2A8GA 2VDFA 1KT5A 1VQPE 4NP1A 4ZHDA 1K24A 1VWMB 4L3RA 3KFHA 1VWDB 1E2TA 5KIDA 4ODDA 4MIRA 5BVSA 1STRB 5HA1A 2AL0X 2QO6A 4D6BA 1G5WA 1RAVA 2Z4IA 1IKJA 1S2PA 3L4RA 2RTAA 1MX8A 2BHVA 1K8AG 4WF9E 2OVDA 1IW2A 2AKQA 3PK2A 1VWGB 2CM9A 1VWKB 4GU8A 1K3BA 5HCCC 2RN4A 3HOLA 3S5XA 1DZJA 1BSQA 2K62A 3ELZA 2BT9A 4AZPA 2M4LA 1CBQA 1CJ5A 1WBIA 1NJIG 2FS6A 5B11O 2FKJA 4YGZA 1QWDA 4IAXA 1L6MA 2L5PA 3CC2E 5AN9B 3VHHA 2I5VO 1N43A 1Q86G 2RTGB 1BRQA 1WUBA 3RDMA 5DG4A 5LJKA 2FTBA 2RTMA 4CPHA 5HTEA 2KTDA 3NQ9A 4R0BA 4O9SA 4BOEA 1QY1A 3T6LA 4CV7A 1HQQA 2MHDA 1OPAA 3SZHA 1R0UA 1ALBA 1LIEA 5CSEA 3CQNA 2BLGA 2G7BA 4DQ4A 3H3IA 2RTNB 4Z2VA 4TNNA 2HYSA 1SLDB 3BX8A 4IB8A 4WBKA 1LCZA 3B2KA 1X71A 4KC7A 4FGIB 3WVMA 2IZHB 4JNJA 3N91A 1GGLA 5CHKA 1LFOA 3ZI8A 4O49A 2R56A 3WJEA 3ZUOA 3C77X 3CMPA 4BX6A 3IG9A 1VWJB 2F01A 3WXQA 4EFGA 3FA6A 1LCVA 4KCAA 4OELA 5IRWA 3CMAE 3BS2A 3CCSE 3NADA 3ZW1B 2A2UA 5FFHA 3STNA 3CF5E 3U03A 4YDAA 1A2DA 3FDCA 3BY0A 3PDFA 1T0VA 1HXLA 2MJIA 4ORWA 2QO4A 4ZH6A 5GADG 2FT9A 4U8UO 3T2WA 5IO7A 5EEDA 1TW4A 4COTA 5HZ8A 3IGEA 1SMPI 4WHIA 2E4JA 3B2IA 3CQRA 2DM5A 3CC7E 1Z24A 3SLOA 2DJFA 1OBPA 5H9AA 1RSUB 3UEVA 5LKFA 3FEPA 1Y55X 3VG4A 3D95A 3Q6LA 5B5GA 3DTQA 1YWAA 2RTFB 3RY1A 4UY8G 5HTDA 4AZQA 1GT5A 2G8CO 1OEKA 1HXZA 3BLGA 4FQBB 4AZOA 2VFBA 4NLJA 1YI2E 1I05A 3OD9A 5LJHA 3CBCA 1Q7YG 3JS1A 4LKPA 2RTKA 4MISA 3GE2A 1HMTA 4B55A 2KW1A 3EMMA 3CCQE 4U67E 1KQXA 4AZRA 3LHNA 2Y32A 1LIFA 2IZCB 1PM1X 2OVAA 5BVTA 5F6BA 3RE5A 2X8TA 2HNXA 4IB9A 4CPFA 1KL5A 1O1VA 3HWDA 1CBRA 1YITE 3P6CA 5D47A 2RA6A 1N9YA 2JU8A 1FTPA 2OZQA 2OL7A 1NC9A 1EIOA 1ACDA 2RTJA 3AKMA 1AVDA 3WZNA 1NP4A 4UU3A 5H9LA 3PPTA 4LZVA 4YFPA 4ZFXA 3CCVE 1AVGI 3I0AA 3AEHA 4O3YA 3T1DA 1EQDA 2CZTA 4ORYA 1ZNGA 4ZH9A 1W6FA 3SLTA 1X89A 1VQOE 1Y53X 2Y3EA 1ZRYA 4N7CA 4I95A 1VWQB 3FR5A 3APUA 3PQUA 3P6FA 1VYFA 2RTIB 4NV8A 3Q34A 5FENA 1VQLE 1MK5A 5LJCA 1JV4A 3ZW0B 4Z6JA 3RDSA 2NNDA 1SWQA 3AUMO 3NP1A 4I3BA 1G85A 1KQWA 4MVEA 2HKDA 1UREA 3P24A 3CCRE 1IKEA 1YWDA 1SXWA 5LJGA 1RLBE 2JN3A 1ZNLA 4OMWA 3NBXX 2QCBA 3FA9A 1SRGA 5HL7E 1SLGB 1M90G 1GT3A 5L8IA 3T2XA 3P6DA 4KT5A 2JW1A 5IRUA 3WJGA 1X8UA 1SRFA 4BCSA 4EDEA 1S72E 5D4AA 5F6ZA 3APVA 1ADLA 3G4SE 3NX2A 1OSPO 2RTEB 2OL8O 2F09A 1KZWA 3VHIA 2RCTA 4Z28A 1ZNEA 4YGHA 4OS3A 4WCEE 1NBXA 4EXZA 3E3CA 3WJBA 3WZQA 4GH7A 2CAMA 1QQSA 5D48A 1JJXA 3STKA 2C1SA 2WPUA 1YWCA 3BX7A 5EDBA 3TZSA 1DF3A 3OW2E 4BGFA 4ZR2A 4QNIA 1VWCB 3BU1A 1ERBA 2OYBO 2POAA 5HZ6A 4CSBA 3HPEA 2N93A 1SWUA 3VG5A 3FLLA 1N9MA 3S26A 1NP1A 3EC5A 1IJ8A 2X45A 2Z4HA 2C4IA 5L3YA 3SLJA 3EW2A 4Y0RA 3OJYC 2JU7A 5F58A 4DCBA 3F8AA 5DM7E 2GTLM 2AT6X 1VWRB 2LKKA 3RDQA 4C5PA 1UZ2X 1B8EA 5EDCA 4QYPA 4QGWA 2A5CA 2YMSA 2MWHA 2ZAGA 1VQNE 4HPAA 1UYOX 2X4MA 1ZNKA 1QG5A 3HK1A 1BSOA 4BX5B 2OFAA 1BBPA 2RTLA 1YP6A 3LV4A 1ZNDA 5HZ5A 5HA0A 5IO6A 1SWRA 3CD6E 2G79A 1SXUA 1D2UA 1TOUA 4RUUA 4D6AA 4M7MA 3VG6A 2A0AA 3RZYA 1LICA 1BJ7A 4IAWA 1YIJE 3ZZVA 1A18A 1LELA 1GKAA 2Y3FA 1BWYA 5H8TA 1MM9A 4HPCA 4LQZA 5LKEA 3OE3A 3EBWA 3LTWA 1CBIA 1SWCA 3G7XA 4U3QA 3STMX 1U18A 3I55E 3WZOA 1HMSA 4O3WA 2P8GA 5C0NA 4LZUA 4ZHGA 3ZW1A 2AVIA 3VG7A 4TKJA 3FW4A 1XKIA 3MX7A 1HBPA 3FENA 2NP1A 1LF7A 4I9SA 2BS6A 2ANSA 3WBGA 2IZIA 3C78X 3P6GA 1O1UA 1FJ1E 2ZSCA 1OEEA 5DPQA 4XMCA 4Z2OA 1BM5A 2RTDB 2OFMX 4L1NA 4DQ3A 4QGXA 2FR3A 2L9CA 4TKHA 1HMRA 4OKAA 3ELXA 3VG3A 2OL6O 2XSTA 1SWTA 4BX7B 1I04A 3V8UA 1YP7A 3U0DA 1KQSE 3SAOA 4OEMA 3UEWA 3VG2A 2ZJPE 1MVGA 4EKVA 4GRJA 2X8FA 5IXGA 2IZJA 3O19A 5B10O 2Q4NA 5EZ2A 3GAQA 3CC4E 5GAGG 3NR3A 1AVEA 3WYQA 3DSZA 4O4XA 4GGTA 4BBOA 4Z2PA 1DF8A 2IZKA 2XKLA 1P6PA 1HQPA 3FIDA 2A13A 2OTJE 5FQ8E 1STPA 4QZUA 3MBTA 4WFUA 5IO5A 1JYDA 1AB0A 4YFQA 1XCAA 1M1KG 1TXLA 3D4RA 3CCUE 1DC9A 3NX1A 1PTSA 3T6FA 3KQ0A 4K19A 1K9MG 4GD9A 5K06A 2X32A 2ZJRE 5CYBA 4PJ2A 1VQ4E 4YBUA 3CMEE 4Y5DA 5B27A 4IBAA 3HOEA 4GJSA 1VQ6E 2Q9SA 3WJCA 1ML7A 4YCEA 5K68A 1SWKA 2W2BA 1Q81G 2OF9A 1QY2A 4QQ1A 5BYPA 4IABA 2BSZA 1JQPA 3OBLA 5F2BA 1GX8A 3X00A 2CQLA 4JGLA 1UYNX 1SXXA 2VFCA 2NNEA 3O2YA 1KL3A 3RKGA 2RTPB 2AH7X 1PBOA 4IMOA 1VWNB 3FELA 3IA8A 3CCJE 5HCDC 1VYOA 4N7DA 5B3MO 4CDCA 4BVMA 2K23A 2GTFX 2LA7A 2AMMX 2IZLB 5FAZA 2KD2A 1RXHA 3APXA 4NLIA 4MVLA 1SWPA 5JR8A 1OBUA 2DJGA 3FMZA 1DZPA 4O4SA 3PP6A 1YHQE 1SA8A 2MM3A 3IFBA 5B29A 2QOMA 1ICMA 4ID2A 5EEEA 3DLLE 1FDQA 3FA7A 4XMFA 1FENA 5H9KA 1EXSA 1P4PA 1SWAA 1G74A 2O62A 2FS7A 4Y0QA 1QVFE 1W5RA 3EM0A 4NYRA 1X8PA 2AT8X 3KZAA 5HZ9A 3UEXA 3EW1A 4GKCA 1I78A 1IFCA 2FHLA 1KZXA 2Q2MA 1LPJA 4OS8A 4NW4A 1RSTB 3PH6A 3FR2A 1MOYA 1VYGA 2NNQA 1VWEB 3B2JA 1S44A 4WFNE 1YJNE 1YIVA 3AKNA 5AJCA 4QYNA 1KT4A 2RTBB 2FR2A 1VQ5E 2OY7A 4GDAA 3TGAA 4NYQA 5LJBA 1EW3A 1DV9A 1VQ8E 1SWOA 2CM4A 3KFFA 1DFVA 4ZHCA 5KHPA 1SWJA 2IZDB 1QY0A 3PH5A 1QFVA 2ACOA 2UYWA 4M6SA 2LB6A 4A60A 1DZKA 2OVSA 4Z27A 1SY1A 3VHMA 4TKBA 1B0OA 1FE3A 1VWIB 4UU2A 3RSWA 4OS0A 3VGWA 2HZRA 5HBSA 1VWAB 3F9DA 3PQSA 2JU3A 3CCME 1CRBA 3CPWE 4A1YA 1FEMA 4CPIA 3P6EA 3HWGA 4U9CA 2RCQA 5L8OA 3WZPA 2F73A 3NPOA 1ZNHA 2QEXE 4RUNA 2FGSA 3RBYA 2HMBA 4ON1A 3O22A 1Y0GA 1U17A 4IOCE 3WYPA 1JIWI 1I9HA 4IO9E 3JQOA 4ORUA 3FA8A 1SWHA 3U9PC 4A1HA 2OFRX 4U8UM 1JJUA 2BC3A 2OY8A 1X8QA 2ASNX 4MEEA 2FHNX 1MDCA 1KT3A 3KFIA 3S60A 2RTHB 4CPEA 3SOTA 2AT0X 3BU9A 3UEUA 3MVFA 2JOZA 2LFOA 2WWPA 3VE1A 1DZMA 3BDRA 4HFOA 1GM6A 4ZJ0A 4U8UN 1MEPA 2W2AA 4LKTA 5JVHE 1NDJA 3QQ2A 4CDEA 4CDDA 4XMDA 2FLJA 2WR6A 2QM9A 4NNTA 4BX7A 3WOVA 3PIPE 1JMXA 1S7DA 1SWDA 1QABE 1LDQA 4IB7A 2IZGB 4NV7A 2OTLE 4ORXA 2QMIA 1YJ9E 4Y0PA 1VQME 3RE6A 2GTLN 1B56A 4YBPA 3ZUIA 3CKGA 4ALBA 1LUQA 1T8VA 1I06A 2JMBA 4ORRA 1KFFA 5BVQA 4ZHFA 4GE1A 1KGLA 2YG2A 4I3CA 1KOIA 1OEJA 4IB6A 4TLJA 4ZHHA 1TOWA 1SLEB 4O3ZA 3UAQA 1MX7A 1AELA 1ERXA 2X46A 1EPBA 5JVGE 1VWOB 1KC8G 1SRJA 5HAEA 1YWBA 4AYHA 1SWGA 3APWA 4ZGFA 3HTYA 4GNWA 1BRPA 5AQ6A 1JMZA 2WEWA 4ARHA 5IRAA 3ZWEA 3SZIA 2RTOB 1IFBA 1E00A 1JYJA 3G6EE 4EEJA 1X8NA 2AT3X 4HPBA 3FIQA 4AZMA 1SWEA 1PMPA 3VU1A 1N7YA 5B5FA 2PY1A 2X56A 3D9WA 4GDZA 4YCHA 1GXAA 4WFBE 4ZCBA 3FW5A 4TJZA 4U46A 3TF6A 3QKGA 4O4OA 2AT5X 3CKFA 5DM6E 4EQAC 4JO6A 1EI5A 1YJWE 4YKOA 4HWMA 5D45A 3NQ3A 3RY2A 1IIUA 1T68X 5EPQA 1RL6A 3S5VA 1W2BE 1AQBA 2FKGA 4GGZA 4QZTA 5K67A 1K73G 4AW8A 1LIDA 3MM0A 2OY5O 2L67A 4QRLA 3RDXA 2X55A 1NQNA 4FBVA 2BS5A 1LCWA 1D3SA 1I4UA 5F7GA 1VWLB 1KT6A 2WQAE 2RTRB 4IRWA 1U0XA 2Q39A 2X8SA 5F1EA 5JD2A 4WFVA 1SY2A 3EYCA 3RDUA 1GT4A 3ZW2A 1GKAB 1EALA 4AZNA 4I9RA 3CBSA 3JSQA 3BSZE 4KH8A 1W4TA 2ZAIA 1SRIA 1E06A 1NGLA 3RDOA 3CWKA 1BSYA 1EUOA 4MVIA 4I6SA 1BEBA 1HN2A 3KVNA 5HZQA 4XMEA 1N4JA 4OMXA 2WSJA 1QVGE 1GX9A 5GAEG 2RD7C
chains in the Genus database with same CATH topology
2I5VO 2I5ZO 3CKGA 2AF5A 1OSPO 3IG9A 2OL8O 1P4PA 3CKFA 2HKDA 3IGEA 2PI3O 2OY5O 2OY7A 2OY8A 5B11O 3EC5A 5B3MO 2OY1O 2G8CO 2FKJA 2OL6O 2OL7A 1FJ1E 2FKGA 2OYBO 1RJLC 5B2AO 5B10O 3AUMO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I5V O;  2I5Z O;  3CKG A;  2AF5 A;  1OSP O;  2OL8 O;  1P4P A;  3CKF A;  2HKD A;  2PI3 O;  2OY5 O;  2OY7 A;  2OY8 A;  5B11 O;  3EC5 A;  5B3M O;  2OY1 O;  2G8C O;  2FKJ A;  2OL6 O;  2OL7 A;  1FJ1 E;  2FKG A;  2OYB O;  5B2A O;  5B10 O;  3AUM O; 
#chains in the Genus database with same CATH topology
 3J7Z G;  1HY2 A;  2IZF B;  1MUP A;  4IMN A;  3ZW0 A;  3C76 X;  4KII A;  3NQK A;  1BLR A;  4I3D A;  1GT1 A;  3KFG A;  2C1Q A;  4JHQ A;  4O4U A;  1KL4 A;  3TGB A;  3ZQ3 A;  3PED A;  1SWL A;  1LKE A;  5AEO A;  2OFB A;  4DNE A;  1RXJ A;  1SWN A;  2ZJQ E;  4QGV A;  1LDO A;  4YFR A;  4KC8 A;  2MO5 A;  2R74 A;  1SLF B;  2I5Z O;  1E5P A;  1QFT A;  3CCE E;  2LBV A;  2EU7 X;  3FR4 A;  3MG5 A;  1JJ2 E;  1SRE A;  4MVK A;  4CPH B;  2X34 A;  2WQ9 A;  2GH7 A;  3RWX A;  1Y52 X;  2HLV A;  3VPJ E;  1PEE A;  3I17 A;  1RJL C;  2RQ0 A;  2L68 A;  4YH0 A;  2G78 A;  2GTL O;  2A3F X;  1JBH A;  4ES7 A;  4XMH A;  3PIO E;  4GGR A;  3HWF A;  1GX3 A;  2FRS A;  5LJE A;  4GNY A;  1A57 A;  4HPD A;  1Y9L A;  4YDB A;  4BQU A;  2CBS A;  1SY0 A;  5KIC A;  4ML7 B;  4XMG A;  4ORS A;  4GUZ A;  1OPB A;  2WUT A;  1KXO A;  1EPA A;  4CK4 A;  2JGS A;  1STS B;  2IZE B;  4A8Z A;  1HBQ A;  3K3L A;  4INN A;  3P6H A;  3F6Z B;  3P02 A;  2GC9 A;  5FQ6 E;  5HCE C;  4BX6 B;  1G7N A;  3FEK A;  1N0S A;  2A2G A;  5MLC H;  3G71 E;  4TQ2 A;  5H1S I;  5FQ7 E;  1SRH A;  1H91 A;  1VWF B;  1KD1 G;  2GJ5 A;  5LJD A;  3WJF A;  1A3Y A;  4Y0S A;  1KT7 A;  2A5B A;  1VQ9 E;  3BRN A;  2KTS A;  2UZ2 A;  2AF5 A;  5H9N A;  4FBR A;  4BX5 A;  2IFB A;  5CE4 A;  5GAH G;  4YVB A;  2RTC B;  1LNM A;  2WEX A;  4GET A;  2KT4 B;  4WFA E;  2OF8 A;  4PSQ A;  1B4M A;  1O8V A;  2IZB A;  2HZQ A;  3FYF A;  2MF6 A;  1E02 A;  4YMY A;  2CBR A;  2QA4 E;  1JJJ A;  3VE2 A;  1OBQ A;  1VQK E;  2QO5 A;  3HWE A;  2FWV A;  3B2H A;  4YKM A;  1SWB A;  5B2A O;  3I56 E;  2G5L A;  1VQ7 E;  4CDF A;  2LBA A;  5D8J A;  1PBY A;  1ICN A;  3B2L A;  1Q82 G;  1VPR A;  2IZA A;  3D96 A;  5L8N A;  3PEC A;  1SY3 A;  4GK9 A;  1JZU A;  1VWP B;  1Y9T A;  1EII A;  3D97 A;  4BJ8 A;  4I60 A;  1TVQ A;  3EBK A;  2PI3 O;  3CXC E;  2ACP X;  4IOA E;  4Y59 A;  4YGG A;  4NNS A;  1SXY A;  2QOS C;  1LIB A;  1RXK A;  3CR6 A;  5HWZ A;  4GJV A;  4ALO A;  2ALL X;  2CZU A;  3TGC A;  1YUP A;  3WJD A;  5AJB A;  2RTQ B;  1SWS A;  1VWH B;  2Q2P A;  4QAE A;  1SWF A;  1RBP A;  1X8O A;  2R73 A;  4ZGU A;  1VWB B;  4GZV A;  1CBS A;  1NQM A;  1N8R G;  2OVE A;  2W2F A;  4FBO A;  4O3X B;  3CCL E;  3SZJ A;  1FEL A;  2OY1 O;  2A8G A;  2VDF A;  1KT5 A;  1VQP E;  4NP1 A;  4ZHD A;  1K24 A;  1VWM B;  4L3R A;  3KFH A;  1VWD B;  1E2T A;  5KID A;  4ODD A;  4MIR A;  5BVS A;  1STR B;  5HA1 A;  2AL0 X;  2QO6 A;  4D6B A;  1G5W A;  1RAV A;  2Z4I A;  1IKJ A;  1S2P A;  3L4R A;  2RTA A;  1MX8 A;  2BHV A;  1K8A G;  4WF9 E;  2OVD A;  1IW2 A;  2AKQ A;  3PK2 A;  1VWG B;  2CM9 A;  1VWK B;  4GU8 A;  1K3B A;  5HCC C;  2RN4 A;  3HOL A;  3S5X A;  1DZJ A;  1BSQ A;  2K62 A;  3ELZ A;  2BT9 A;  4AZP A;  2M4L A;  1CBQ A;  1CJ5 A;  1WBI A;  1NJI G;  2FS6 A;  5B11 O;  2FKJ A;  4YGZ A;  1QWD A;  4IAX A;  1L6M A;  2L5P A;  3CC2 E;  5AN9 B;  3VHH A;  2I5V O;  1N43 A;  1Q86 G;  2RTG B;  1BRQ A;  1WUB A;  3RDM A;  5DG4 A;  5LJK A;  2FTB A;  2RTM A;  4CPH A;  5HTE A;  2KTD A;  3NQ9 A;  4R0B A;  4O9S A;  4BOE A;  1QY1 A;  3T6L A;  4CV7 A;  1HQQ A;  2MHD A;  1OPA A;  3SZH A;  1R0U A;  1ALB A;  1LIE A;  5CSE A;  3CQN A;  2BLG A;  2G7B A;  4DQ4 A;  3H3I A;  2RTN B;  4Z2V A;  4TNN A;  2HYS A;  1SLD B;  3BX8 A;  4IB8 A;  4WBK A;  1LCZ A;  3B2K A;  1X71 A;  4KC7 A;  4FGI B;  3WVM A;  2IZH B;  4JNJ A;  3N91 A;  1GGL A;  5CHK A;  1LFO A;  3ZI8 A;  4O49 A;  2R56 A;  3WJE A;  3ZUO A;  3C77 X;  3CMP A;  4BX6 A;  3IG9 A;  1VWJ B;  2F01 A;  3WXQ A;  4EFG A;  3FA6 A;  1LCV A;  4KCA A;  4OEL A;  5IRW A;  3CMA E;  3BS2 A;  3CCS E;  3NAD A;  3ZW1 B;  2A2U A;  5FFH A;  3STN A;  3CF5 E;  3U03 A;  4YDA A;  1A2D A;  3FDC A;  3BY0 A;  3PDF A;  1T0V A;  1HXL A;  2MJI A;  4ORW A;  2QO4 A;  4ZH6 A;  5GAD G;  2FT9 A;  4U8U O;  3T2W A;  5IO7 A;  5EED A;  1TW4 A;  4COT A;  5HZ8 A;  3IGE A;  1SMP I;  4WHI A;  2E4J A;  3B2I A;  3CQR A;  2DM5 A;  3CC7 E;  1Z24 A;  3SLO A;  2DJF A;  1OBP A;  5H9A A;  1RSU B;  3UEV A;  5LKF A;  3FEP A;  1Y55 X;  3VG4 A;  3D95 A;  3Q6L A;  5B5G A;  3DTQ A;  1YWA A;  2RTF B;  3RY1 A;  4UY8 G;  5HTD A;  4AZQ A;  1GT5 A;  2G8C O;  1OEK A;  1HXZ A;  3BLG A;  4FQB B;  4AZO A;  2VFB A;  4NLJ A;  1YI2 E;  1I05 A;  3OD9 A;  5LJH A;  3CBC A;  1Q7Y G;  3JS1 A;  4LKP A;  2RTK A;  4MIS A;  3GE2 A;  1HMT A;  4B55 A;  2KW1 A;  3EMM A;  3CCQ E;  4U67 E;  1KQX A;  4AZR A;  3LHN A;  2Y32 A;  1LIF A;  2IZC B;  1PM1 X;  2OVA A;  5BVT A;  5F6B A;  3RE5 A;  2X8T A;  2HNX A;  4IB9 A;  4CPF A;  1KL5 A;  1O1V A;  3HWD A;  1CBR A;  1YIT E;  3P6C A;  5D47 A;  2RA6 A;  1N9Y A;  2JU8 A;  1FTP A;  2OZQ A;  2OL7 A;  1NC9 A;  1EIO A;  1ACD A;  2RTJ A;  3AKM A;  1AVD A;  3WZN A;  1NP4 A;  4UU3 A;  5H9L A;  3PPT A;  4LZV A;  4YFP A;  4ZFX A;  3CCV E;  1AVG I;  3I0A A;  3AEH A;  4O3Y A;  3T1D A;  1EQD A;  2CZT A;  4ORY A;  1ZNG A;  4ZH9 A;  1W6F A;  3SLT A;  1X89 A;  1VQO E;  1Y53 X;  2Y3E A;  1ZRY A;  4N7C A;  4I95 A;  1VWQ B;  3FR5 A;  3APU A;  3PQU A;  3P6F A;  1VYF A;  2RTI B;  4NV8 A;  3Q34 A;  5FEN A;  1VQL E;  1MK5 A;  5LJC A;  1JV4 A;  3ZW0 B;  4Z6J A;  3RDS A;  2NND A;  1SWQ A;  3AUM O;  3NP1 A;  4I3B A;  1G85 A;  1KQW A;  4MVE A;  2HKD A;  1URE A;  3P24 A;  3CCR E;  1IKE A;  1YWD A;  1SXW A;  5LJG A;  1RLB E;  2JN3 A;  1ZNL A;  4OMW A;  3NBX X;  2QCB A;  3FA9 A;  1SRG A;  5HL7 E;  1SLG B;  1M90 G;  1GT3 A;  5L8I A;  3T2X A;  3P6D A;  4KT5 A;  2JW1 A;  5IRU A;  3WJG A;  1X8U A;  1SRF A;  4BCS A;  4EDE A;  1S72 E;  5D4A A;  5F6Z A;  3APV A;  1ADL A;  3G4S E;  3NX2 A;  1OSP O;  2RTE B;  2OL8 O;  2F09 A;  1KZW A;  3VHI A;  2RCT A;  4Z28 A;  1ZNE A;  4YGH A;  4OS3 A;  4WCE E;  1NBX A;  4EXZ A;  3E3C A;  3WJB A;  3WZQ A;  4GH7 A;  2CAM A;  1QQS A;  5D48 A;  1JJX A;  3STK A;  2C1S A;  2WPU A;  1YWC A;  3BX7 A;  5EDB A;  3TZS A;  1DF3 A;  3OW2 E;  4BGF A;  4ZR2 A;  4QNI A;  1VWC B;  3BU1 A;  1ERB A;  2OYB O;  2POA A;  5HZ6 A;  4CSB A;  3HPE A;  2N93 A;  1SWU A;  3VG5 A;  3FLL A;  1N9M A;  3S26 A;  1NP1 A;  3EC5 A;  1IJ8 A;  2X45 A;  2Z4H A;  2C4I A;  5L3Y A;  3SLJ A;  3EW2 A;  4Y0R A;  3OJY C;  2JU7 A;  5F58 A;  4DCB A;  3F8A A;  5DM7 E;  2GTL M;  2AT6 X;  1VWR B;  2LKK A;  3RDQ A;  4C5P A;  1UZ2 X;  1B8E A;  5EDC A;  4QYP A;  4QGW A;  2A5C A;  2YMS A;  2MWH A;  2ZAG A;  1VQN E;  4HPA A;  1UYO X;  2X4M A;  1ZNK A;  1QG5 A;  3HK1 A;  1BSO A;  4BX5 B;  2OFA A;  1BBP A;  2RTL A;  1YP6 A;  3LV4 A;  1ZND A;  5HZ5 A;  5HA0 A;  5IO6 A;  1SWR A;  3CD6 E;  2G79 A;  1SXU A;  1D2U A;  1TOU A;  4RUU A;  4D6A A;  4M7M A;  3VG6 A;  2A0A A;  3RZY A;  1LIC A;  1BJ7 A;  4IAW A;  1YIJ E;  3ZZV A;  1A18 A;  1LEL A;  1GKA A;  2Y3F A;  1BWY A;  5H8T A;  1MM9 A;  4HPC A;  4LQZ A;  5LKE A;  3OE3 A;  3EBW A;  3LTW A;  1CBI A;  1SWC A;  3G7X A;  4U3Q A;  3STM X;  1U18 A;  3I55 E;  3WZO A;  1HMS A;  4O3W A;  2P8G A;  5C0N A;  4LZU A;  4ZHG A;  3ZW1 A;  2AVI A;  3VG7 A;  4TKJ A;  3FW4 A;  1XKI A;  3MX7 A;  1HBP A;  3FEN A;  2NP1 A;  1LF7 A;  4I9S A;  2BS6 A;  2ANS A;  3WBG A;  2IZI A;  3C78 X;  3P6G A;  1O1U A;  1FJ1 E;  2ZSC A;  1OEE A;  5DPQ A;  4XMC A;  4Z2O A;  1BM5 A;  2RTD B;  2OFM X;  4L1N A;  4DQ3 A;  4QGX A;  2FR3 A;  2L9C A;  4TKH A;  1HMR A;  4OKA A;  3ELX A;  3VG3 A;  2OL6 O;  2XST A;  1SWT A;  4BX7 B;  1I04 A;  3V8U A;  1YP7 A;  3U0D A;  1KQS E;  3SAO A;  4OEM A;  3UEW A;  3VG2 A;  2ZJP E;  1MVG A;  4EKV A;  4GRJ A;  2X8F A;  5IXG A;  2IZJ A;  3O19 A;  5B10 O;  2Q4N A;  5EZ2 A;  3GAQ A;  3CC4 E;  5GAG G;  3NR3 A;  1AVE A;  3WYQ A;  3DSZ A;  4O4X A;  4GGT A;  4BBO A;  4Z2P A;  1DF8 A;  2IZK A;  2XKL A;  1P6P A;  1HQP A;  3FID A;  2A13 A;  2OTJ E;  5FQ8 E;  1STP A;  4QZU A;  3MBT A;  4WFU A;  5IO5 A;  1JYD A;  1AB0 A;  4YFQ A;  1XCA A;  1M1K G;  1TXL A;  3D4R A;  3CCU E;  1DC9 A;  3NX1 A;  1PTS A;  3T6F A;  3KQ0 A;  4K19 A;  1K9M G;  4GD9 A;  5K06 A;  2X32 A;  2ZJR E;  5CYB A;  4PJ2 A;  1VQ4 E;  4YBU A;  3CME E;  4Y5D A;  5B27 A;  4IBA A;  3HOE A;  4GJS A;  1VQ6 E;  2Q9S A;  3WJC A;  1ML7 A;  4YCE A;  5K68 A;  1SWK A;  2W2B A;  1Q81 G;  2OF9 A;  1QY2 A;  4QQ1 A;  5BYP A;  4IAB A;  2BSZ A;  1JQP A;  3OBL A;  5F2B A;  1GX8 A;  3X00 A;  2CQL A;  4JGL A;  1UYN X;  1SXX A;  2VFC A;  2NNE A;  3O2Y A;  1KL3 A;  3RKG A;  2RTP B;  2AH7 X;  1PBO A;  4IMO A;  1VWN B;  3FEL A;  3IA8 A;  3CCJ E;  5HCD C;  1VYO A;  4N7D A;  5B3M O;  4CDC A;  4BVM A;  2K23 A;  2GTF X;  2LA7 A;  2AMM X;  2IZL B;  5FAZ A;  2KD2 A;  1RXH A;  3APX A;  4NLI A;  4MVL A;  1SWP A;  5JR8 A;  1OBU A;  2DJG A;  3FMZ A;  1DZP A;  4O4S A;  3PP6 A;  1YHQ E;  1SA8 A;  2MM3 A;  3IFB A;  5B29 A;  2QOM A;  1ICM A;  4ID2 A;  5EEE A;  3DLL E;  1FDQ A;  3FA7 A;  4XMF A;  1FEN A;  5H9K A;  1EXS A;  1P4P A;  1SWA A;  1G74 A;  2O62 A;  2FS7 A;  4Y0Q A;  1QVF E;  1W5R A;  3EM0 A;  4NYR A;  1X8P A;  2AT8 X;  3KZA A;  5HZ9 A;  3UEX A;  3EW1 A;  4GKC A;  1I78 A;  1IFC A;  2FHL A;  1KZX A;  2Q2M A;  1LPJ A;  4OS8 A;  4NW4 A;  1RST B;  3PH6 A;  3FR2 A;  1MOY A;  1VYG A;  2NNQ A;  1VWE B;  3B2J A;  1S44 A;  4WFN E;  1YJN E;  1YIV A;  3AKN A;  5AJC A;  4QYN A;  1KT4 A;  2RTB B;  2FR2 A;  1VQ5 E;  2OY7 A;  4GDA A;  3TGA A;  4NYQ A;  5LJB A;  1EW3 A;  1DV9 A;  1VQ8 E;  1SWO A;  2CM4 A;  3KFF A;  1DFV A;  4ZHC A;  5KHP A;  1SWJ A;  2IZD B;  1QY0 A;  3PH5 A;  1QFV A;  2ACO A;  2UYW A;  4M6S A;  2LB6 A;  4A60 A;  1DZK A;  2OVS A;  4Z27 A;  1SY1 A;  3VHM A;  4TKB A;  1B0O A;  1FE3 A;  1VWI B;  4UU2 A;  3RSW A;  4OS0 A;  3VGW A;  2HZR A;  5HBS A;  1VWA B;  3F9D A;  3PQS A;  2JU3 A;  3CCM E;  1CRB A;  3CPW E;  4A1Y A;  1FEM A;  4CPI A;  3P6E A;  3HWG A;  4U9C A;  2RCQ A;  5L8O A;  3WZP A;  2F73 A;  3NPO A;  1ZNH A;  2QEX E;  4RUN A;  2FGS A;  3RBY A;  2HMB A;  4ON1 A;  3O22 A;  1Y0G A;  1U17 A;  4IOC E;  3WYP A;  1JIW I;  1I9H A;  4IO9 E;  3JQO A;  4ORU A;  3FA8 A;  1SWH A;  3U9P C;  4A1H A;  2OFR X;  4U8U M;  1JJU A;  2BC3 A;  2OY8 A;  1X8Q A;  2ASN X;  4MEE A;  2FHN X;  1MDC A;  1KT3 A;  3KFI A;  3S60 A;  2RTH B;  4CPE A;  3SOT A;  2AT0 X;  3BU9 A;  3UEU A;  3MVF A;  2JOZ A;  2LFO A;  2WWP A;  3VE1 A;  1DZM A;  3BDR A;  4HFO A;  1GM6 A;  4ZJ0 A;  4U8U N;  1MEP A;  2W2A A;  4LKT A;  5JVH E;  1NDJ A;  3QQ2 A;  4CDE A;  4CDD A;  4XMD A;  2FLJ A;  2WR6 A;  2QM9 A;  4NNT A;  4BX7 A;  3WOV A;  3PIP E;  1JMX A;  1S7D A;  1SWD A;  1QAB E;  1LDQ A;  4IB7 A;  2IZG B;  4NV7 A;  2OTL E;  4ORX A;  2QMI A;  1YJ9 E;  4Y0P A;  1VQM E;  3RE6 A;  2GTL N;  1B56 A;  4YBP A;  3ZUI A;  3CKG A;  4ALB A;  1LUQ A;  1T8V A;  1I06 A;  2JMB A;  4ORR A;  1KFF A;  5BVQ A;  4ZHF A;  4GE1 A;  1KGL A;  2YG2 A;  4I3C A;  1KOI A;  1OEJ A;  4IB6 A;  4TLJ A;  4ZHH A;  1TOW A;  1SLE B;  4O3Z A;  3UAQ A;  1MX7 A;  1AEL A;  1ERX A;  2X46 A;  1EPB A;  5JVG E;  1VWO B;  1KC8 G;  1SRJ A;  5HAE A;  1YWB A;  4AYH A;  1SWG A;  3APW A;  4ZGF A;  3HTY A;  4GNW A;  1BRP A;  5AQ6 A;  1JMZ A;  2WEW A;  4ARH A;  5IRA A;  3ZWE A;  3SZI A;  2RTO B;  1IFB A;  1E00 A;  1JYJ A;  3G6E E;  4EEJ A;  1X8N A;  2AT3 X;  4HPB A;  3FIQ A;  4AZM A;  1SWE A;  1PMP A;  3VU1 A;  1N7Y A;  5B5F A;  2PY1 A;  2X56 A;  3D9W A;  4GDZ A;  4YCH A;  1GXA A;  4WFB E;  4ZCB A;  3FW5 A;  4TJZ A;  4U46 A;  3TF6 A;  3QKG A;  4O4O A;  2AT5 X;  3CKF A;  5DM6 E;  4EQA C;  4JO6 A;  1EI5 A;  1YJW E;  4YKO A;  4HWM A;  5D45 A;  3NQ3 A;  3RY2 A;  1IIU A;  1T68 X;  5EPQ A;  1RL6 A;  3S5V A;  1W2B E;  1AQB A;  2FKG A;  4GGZ A;  4QZT A;  5K67 A;  1K73 G;  4AW8 A;  1LID A;  3MM0 A;  2OY5 O;  2L67 A;  4QRL A;  3RDX A;  2X55 A;  1NQN A;  4FBV A;  2BS5 A;  1LCW A;  1D3S A;  1I4U A;  5F7G A;  1VWL B;  1KT6 A;  2WQA E;  2RTR B;  4IRW A;  1U0X A;  2Q39 A;  2X8S A;  5F1E A;  5JD2 A;  4WFV A;  1SY2 A;  3EYC A;  3RDU A;  1GT4 A;  3ZW2 A;  1GKA B;  1EAL A;  4AZN A;  4I9R A;  3CBS A;  3JSQ A;  3BSZ E;  4KH8 A;  1W4T A;  2ZAI A;  1SRI A;  1E06 A;  1NGL A;  3RDO A;  3CWK A;  1BSY A;  1EUO A;  4MVI A;  4I6S A;  1BEB A;  1HN2 A;  3KVN A;  5HZQ A;  4XME A;  1N4J A;  4OMX A;  2WSJ A;  1QVG E;  1GX9 A;  5GAE G;  2RD7 C; 
#chains in the Genus database with same CATH homology
 2I5V O;  2I5Z O;  3CKG A;  2AF5 A;  1OSP O;  3IG9 A;  2OL8 O;  1P4P A;  3CKF A;  2HKD A;  3IGE A;  2PI3 O;  2OY5 O;  2OY7 A;  2OY8 A;  5B11 O;  3EC5 A;  5B3M O;  2OY1 O;  2G8C O;  2FKJ A;  2OL6 O;  2OL7 A;  1FJ1 E;  2FKG A;  2OYB O;  1RJL C;  5B2A O;  5B10 O;  3AUM O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...