2PI3O

The crystal structure of ospa mutant
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
246
structure length
246
Chain Sequence
NSVSVDLPGSMKVLVSKSSNADGKYDLIATVDALELSGTSDKNNGSGVLEGVKADASKVKLTISDDLGQTTLEVFKSDGSTLVSKFVTSKDKSSTFEKFNEKGEVSEKFITRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGEVSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTSSNTITVQQYDSNGTSLEGSAVEITKLDEIKNALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer surface protein A
publication title Aromatic cluster mutations produce focal modulations of beta-sheet structure.
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags Membrane protein
total genus 47
structure length 246
sequence length 246
ec nomenclature
pdb deposition date 2007-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.160 Mainly Beta Beta Barrel Lipocalin C1 set domains (antibody constant domain-like) 2pi3O01
3.90.930.1 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Outer Surface Protein A; domain 3 2pi3O02
2OL6O 2OY1O 5B10O 2FKGA 1FJ1E 3CKFA 5B3MO 3CKGA 2AF5A 2PI3O 5B11O 3AUMO 2OY8A 1OSPO 1P4PA 2OY7A 3EC5A 2I5VO 2I5ZO 2OYBO 2FKJA 2G8CO 2OL8O 2HKDA 2OY5O 2OL7A 5B2AO
chains in the Genus database with same CATH superfamily
1RXHA 1ZNLA 1I04A 3RE6A 1DV9A 5CHKA 4QYNA 2C4IA 2WUTA 3IG9A 1WBIA 4GRJA 1ALBA 1HQQA 3EC5A 4QZUA 3HOLA 4HPCA 3OBLA 3OD9A 5D4AA 1A57A 1UZ2X 2RA6A 4YCEA 3STNA 3VG3A 1MVGA 4R0BA 2R74A 2RTJA 5H9KA 4JHQA 2BHVA 1FTPA 5JVGE 4KT5A 3APXA 1TOWA 3FW5A 1A2DA 4ZH6A 3FEPA 4K19A 1SWUA 3IGEA 2Y3EA 1MDCA 2RTIB 1HQPA 3RDXA 1DF8A 5CE4A 2X8TA 1VYFA 3VG2A 4XMEA 1VWGB 1A18A 3FR5A 2QA4E 1S72E 1MUPA 2IFBA 3CC7E 2K23A 1SWNA 4A1YA 4Y0QA 4NNSA 1YP7A 2BSZA 1FELA 2QO6A 2OL7A 5GADG 1HMSA 2OVSA 1IIUA 3ELXA 5F1EA 4O3ZA 1O1VA 2OVDA 4U8UO 4NYQA 1YHQE 3CCEE 1NP1A 3APWA 3H3IA 2OF8A 2JU7A 3VHIA 4I9RA 1BLRA 4A1HA 1EIOA 1YIVA 1LELA 1OEEA 3BS2A 3CC2E 4YFQA 1EW3A 4MISA 4YMYA 4I3CA 5GAHG 4O3WA 4QAEA 2IZAA 3ZUOA 3VG5A 1JZUA 1X89A 1A3YA 1TOUA 1I9HA 1S7DA 1YWAA 1P4PA 1YWDA 4PJ2A 1R0UA 3B2IA 1SXUA 2RTLA 5HCEC 2JGSA 1X8QA 5B2AO 1KD1G 2BC3A 4M7MA 1JYDA 1KT4A 1RLBE 1SLGB 3D95A 1IKEA 1Y55X 1HN2A 4QGWA 5AQ6A 2ACPX 2EU7X 2RTCB 5H9NA 3I0AA 3VGWA 3SOTA 2HKDA 3F8AA 2RTHB 4YGHA 1GKAB 5EPQA 2GTLO 3EM0A 3OE3A 1W4TA 1YUPA 1VWBB 2POAA 3PH5A 1SWCA 4GKCA 3QQ2A 2ZJQE 1GGLA 5EDBA 2Q2MA 3PQSA 5AJBA 4O4SA 2UZ2A 2RCTA 3FR4A 1KOIA 2X4MA 4AZRA 1Q7YG 1TVQA 2BT9A 1LCWA 4GDAA 1LIEA 1JMZA 3UEUA 1CBIA 3CWKA 5EEEA 1N9YA 3P6EA 3HWGA 1YJ9E 3FA8A 5EDCA 2OTJE 2C1QA 3KFFA 1SRGA 1CJ5A 3UEVA 1GT3A 1WUBA 4DNEA 4OELA 1STRB 4LQZA 5FQ6E 1KFFA 3VG6A 3G4SE 3ZI8A 4U67E 4Y59A 4ORWA 5K06A 3STMX 3QKGA 2FHNX 3CMEE 1VQNE 2LBAA 3S5XA 3MM0A 1O8VA 4QZTA 3WYPA 1SWSA 2CBSA 1AVDA 1VWOB 1X71A 3WZOA 3NADA 2R56A 1E5PA 2LKKA 3AKMA 2F01A 4XMHA 2LBVA 1E00A 4A60A 3DTQA 4EXZA 4MEEA 3KZAA 1ICNA 4ZFXA 4ZCBA 4AZPA 1EALA 5IRAA 5AN9B 2A0AA 1VWAB 4WFVA 2G7BA 3PIPE 3O2YA 4GD9A 1ZNKA 3FDCA 3HK1A 4TKBA 3CCME 3S26A 4ORSA 3VPJE 1LDQA 3CCRE 5DM7E 4CPIA 1LKEA 5K67A 3DLLE 1I05A 4KIIA 1JJXA 3OJYC 3NX2A 2AKQA 4ES7A 4NW4A 2RTPB 3VG7A 4C5PA 5B11O 1DC9A 4ORUA 1QVGE 2MHDA 3G7XA 3CQNA 1MEPA 3NBXX 5LJBA 1SWPA 5GAGG 4CPHA 1PTSA 3CQRA 4Y0RA 1NQNA 4BCSA 1B0OA 1QFTA 1G74A 3TGBA 4TQ2A 2QO4A 2WQ9A 1KT6A 3MX7A 1JJUA 5LKEA 2ASNX 4XMGA 2A3FX 3U03A 3I17A 1VPRA 4XMDA 4ALBA 1SWOA 3ELZA 5KHPA 1SY3A 1CRBA 3Q6LA 2OY8A 4ML7B 1RSUB 1SREA 2ANSA 2RTKA 1LFOA 3WBGA 1M90G 4QGXA 1Y0GA 2OL6O 1NBXA 4D6BA 1KXOA 4Z2VA 3RBYA 3APVA 2RTNB 3OW2E 1X8OA 2AT6X 5B5FA 2CQLA 4QQ1A 2IZBA 1KT7A 3FR2A 5DG4A 2CZUA 1K73G 4Y5DA 4Z28A 1LCZA 4BJ8A 3JSQA 5JD2A 4LKPA 4FQBB 1T68X 1SWBA 2M4LA 3GAQA 2GTFX 1SY0A 5BYPA 4BX6B 2A2GA 3PDFA 4EDEA 5AJCA 1HBPA 3C78X 1EIIA 1UYOX 2L9CA 1Q81G 1O1UA 2RQ0A 3VE1A 2AT3X 3FMZA 4UU2A 3HWFA 3B2HA 3RWXA 3WXQA 4OMXA 3SAOA 4U3QA 1LF7A 3RDMA 2JU3A 5HWZA 1OEJA 4WF9E 3NP1A 1Y52X 2Q4NA 3IA8A 4N7CA 4CDFA 1HXLA 4IABA 1PBOA 2RN4A 2ZSCA 3WJEA 1AB0A 4Y0SA 1GX8A 2W2AA 1EI5A 1PBYA 2G78A 3PECA 4YDAA 4CSBA 1CBQA 3ZW0B 4HPBA 1YITE 1HXZA 5HZ8A 4KC7A 4OS0A 1BSOA 4GUZA 1OBUA 1VQ6E 3NQ9A 3N91A 5H9AA 4WCEE 5IRWA 3FIDA 1G85A 1U18A 4IB8A 1TW4A 3WYQA 2W2BA 1I78A 3AKNA 3HWEA 2F73A 1Y53X 2LB6A 3D96A 3WZNA 5LJCA 3TF6A 1ZRYA 2RTFB 3BU1A 1NQMA 3VHMA 1YJWE 3EBKA 4UU3A 4AZNA 3MBTA 3O19A 4IOAE 3P02A 4KC8A 5HBSA 3D97A 2N93A 4QYPA 1EPBA 3FW4A 4NLIA 1BWYA 3P6FA 1BSQA 4UY8G 4OEMA 2X8FA 4ZHFA 3KFIA 1KZXA 1DZKA 4BGFA 4AW8A 1VWIB 5HL7E 4MVKA 3PP6A 5EZ2A 1Y9LA 3SLOA 5BVSA 1U17A 5D48A 1YWBA 4Y0PA 4GH7A 1XKIA 4N7DA 5HAEA 3ZUIA 1ACDA 4OS8A 1GX3A 4ZHGA 4NYRA 4O49A 3UEXA 1ADLA 2Q2PA 4FBRA 2BS6A 1HBQA 1N0SA 1VQ7E 4Z27A 1MM9A 5IO6A 2NNDA 3TGCA 4IOCE 1RJLC 3X00A 3J7ZG 2CAMA 4YBPA 3BY0A 3CCUE 1G5WA 2FR3A 2AMMX 4O9SA 2MF6A 2OYBO 2AT0X 1EUOA 4U9CA 3SZJA 2QO5A 3LV4A 2OY1O 5B10O 2HNXA 2F09A 3HWDA 2X32A 4XMCA 3BX7A 2DM5A 3C77X 1SRHA 2RTMA 3MG5A 1VWDB 1MOYA 1K9MG 1S44A 2Q9SA 4U8UN 5CYBA 1UREA 2RTGB 3Q34A 2IZLB 3CD6E 3RDOA 3WJCA 3PH6A 3KFHA 1NC9A 1LPJA 4LKTA 3RDUA 3IFBA 1KQSE 5F7GA 4NP1A 1LUQA 2G8CO 1LCVA 1JMXA 4AYHA 1X8UA 4ODDA 4OKAA 2QMIA 3VHHA 2DJGA 4GGRA 1AELA 2FTBA 1SWFA 1K8AG 1I06A 3DSZA 1NGLA 1OPAA 5HA0A 4HWMA 3FLLA 2XSTA 3TGAA 4O3YA 4WFAE 3FENA 2WR6A 4JNJA 4O4OA 5LJEA 2QOSC 1SMPI 1RSTB 1SWJA 4GU8A 1QY2A 2QM9A 2ZAIA 3EW1A 2IZCB 3ZW1B 4YFPA 3E3CA 2KT4B 4AZQA 2GTLN 4BOEA 2L5PA 1DFVA 1NP4A 2K62A 3WJBA 1ICMA 1GKAA 1RL6A 3NQ3A 4QGVA 2OY5O 1BJ7A 4U46A 4DCBA 1VWFB 4MIRA 4HFOA 3JQOA 4EKVA 1X8NA 2FS6A 2RTAA 1FENA 4GZVA 2QEXE 1BM5A 1KQXA 5DPQA 2FKJA 4ZHDA 2KW1A 2JMBA 4ORRA 1YP6A 3RE5A 4HPAA 2L68A 4IMNA 4RUNA 1RXJA 2RCQA 2X8SA 1DZMA 3CKFA 1OBQA 2IZHB 3EMMA 3NQKA 1P6PA 5HCDC 4CPFA 3P24A 2A8GA 3VG4A 4RUUA 4EFGA 3RDQA 1MX8A 4OMWA 4I3BA 5D8JA 5JVHE 3TZSA 1DZJA 2JW1A 2ALLX 5EEDA 4YKOA 1LIFA 4BX7B 2C1SA 1SA8A 1FE3A 3RKGA 1X8PA 1YI2E 3CMAE 2ZJPE 3G6EE 3WJFA 1UYNX 1KT3A 2LA7A 3PQUA 5LJHA 4BBOA 1YWCA 2NP1A 1GT1A 2JN3A 4Z2OA 2AL0X 5K68A 5HZ6A 2VFCA 2FT9A 3FIQA 4IMOA 2E4JA 4ZR2A 4TKJA 1BRPA 4NV7A 3SZHA 2HYSA 3P6DA 3FYFA 3LTWA 4GNWA 4ZHCA 4L1NA 1SRJA 2A13A 1ERBA 4FGIB 1ERXA 1VWLB 4WFBE 1SY2A 1BBPA 2FWVA 3V8UA 1W6FA 3UEWA 4U8UM 3U9PC 1VWHB 1AQBA 1SWAA 3B2JA 1Z24A 4GJSA 3CR6A 2OVAA 1SWQA 1G7NA 2OY7A 3VU1A 1IKJA 5L8NA 1MX7A 4Z6JA 1SWLA 1VWMB 2FS7A 4IAXA 1YJNE 2G5LA 4LZUA 4IB7A 4BQUA 1IFBA 2IZJA 5D45A 3CCJE 3CCVE 1RBPA 2QOMA 3APUA 1QQSA 4JGLA 3T6LA 2FHLA 4EQAC 1LDOA 5L3YA 1SLDB 5MLCH 3WVMA 4CDCA 4CDEA 4GE1A 3BX8A 3AUMO 2X34A 4DQ4A 1QABE 1LIDA 4MVIA 1VQOE 2HZQA 1HMRA 4INNA 4PSQA 1JJ2E 2IZEB 5B3MO 2OFRX 4BX6A 2RTBB 2WQAE 2GTLM 2FGSA 5HZ5A 2NNQA 3AEHA 1EXSA 2RTRB 2MM3A 3CBSA 3PPTA 5F6ZA 1LIBA 4IRWA 4MVLA 5L8OA 4ZJ0A 3C76X 2OFBA 3MVFA 2RTDB 2ACOA 4GGTA 2X56A 4ARHA 2GC9A 1E06A 5BVQA 4MVEA 3RZYA 2OVEA 5H8TA 4GNYA 5B27A 1SWEA 2Y32A 1VWNB 1HY2A 3P6HA 1HMTA 3STKA 2PI3O 1KL3A 2UYWA 2OTLE 1PEEA 1RAVA 2RTOB 5CSEA 2FLJA 3CCQE 1VQPE 3NX1A 1QVFE 2AH7X 4KH8A 3I56E 4JO6A 3ZW0A 1RXKA 1VYOA 5F58A 2ZJRE 3UAQA 2CZTA 5HA1A 2JU8A 5AEOA 5FQ8E 4IB6A 3ZQ3A 2FRSA 2A2UA 1MK5A 4GJVA 2IZDB 1QG5A 1SWHA 2WEWA 2G79A 4I60A 1VQLE 1STSB 4WHIA 5KICA 4LZVA 4A8ZA 4IO9E 3FA7A 5GAEG 3U0DA 4WFNE 2YG2A 1VWEB 3F9DA 1H91A 4ORXA 1KL5A 5HZ9A 1T0VA 1VQKE 2NNEA 1VYGA 4GK9A 2YMSA 4ON1A 4WFUA 4I95A 1EPAA 1SLEB 5HZQA 1AVGI 5BVTA 3ZWEA 2XKLA 3L4RA 1KZWA 1ML7A 2KD2A 2L67A 1VWRB 2I5ZO 3KVNA 1OEKA 4YFRA 1GXAA 2MWHA 3WZPA 3HTYA 1NJIG 1SWRA 2JOZA 4O4UA 4O4XA 1ZNGA 2HMBA 2IZGB 4Z2PA 2FR2A 1VWJB 1BEBA 5D47A 2MO5A 1QWDA 3G71E 1SWGA 2GH7A 2KTDA 1ZNHA 1STPA 2PY1A 1W5RA 2Y3FA 2Q39A 2OFMX 2CM9A 1SWKA 1VWCB 1BSYA 4ORYA 4YH0A 2Z4IA 4AZMA 5FFHA 2IZKA 1N9MA 1JJJA 1NDJA 5HCCC 1KC8G 1CBSA 4O3XB 4OS3A 1SXXA 4IAWA 5LKFA 3BSZE 3BDRA 4GGZA 1EQDA 1N4JA 1N8RG 5FAZA 3CXCE 2DJFA 4YCHA 3KFGA 5LJKA 3S5VA 4TKHA 2KTSA 3GE2A 1FJ1E 2A5CA 1TXLA 2AF5A 1M1KG 1KGLA 2WSJA 1Y9TA 2CBRA 1SWTA 2I5VO 3I55E 1PMPA 4NNTA 5HTDA 3WJGA 1K3BA 4CK4A 4CPEA 1KT5A 2HLVA 3WJDA 3D4RA 1OBPA 2HZRA 3HPEA 5KIDA 4EEJA 2AVIA 4YGZA 1SRFA 2BS5A 1XCAA 1JBHA 3EW2A 4AZOA 1SXWA 1W2BE 1GX9A 4YDBA 4CV7A 4I3DA 1T8VA 1VQME 1N7YA 3T2XA 3KQ0A 1GM6A 1L6MA 3RY1A 5DM6E 4CPHB 2O62A 2RD7C 4ALOA 4ID2A 1OSPO 1B8EA 3BLGA 4HPDA 3FELA 1LICA 3CMPA 4IB9A 5HTEA 2OL8O 3ZW1A 2IZFB 3T6FA 5B5GA 1VWQB 1LNMA 2FKGA 1D2UA 4COTA 1DF3A 1IJ8A 1SRIA 3CBCA 4M6SA 4L3RA 4TJZA 3SLJA 3F6ZB 1VQ9E 4NLJA 1FDQA 2P8GA 2CM4A 1VQ5E 4XMFA 5LJGA 2OFAA 4FBOA 3CCSE 5H9LA 1SWDA 4ZHHA 1U0XA 1VQ4E 1D3SA 2X55A 4B55A 4TNNA 1SXYA 3PEDA 2ZAGA 1CBRA 5FENA 1KQWA 4QRLA 2WPUA 3FEKA 3NPOA 3ZZVA 3RDSA 3VE2A 5JR8A 3K3LA 4KCAA 4DQ3A 1I4UA 4BX7A 1JQPA 3RY2A 5L8IA 2OZQA 3T1DA 3D9WA 1VQ8E 4YKMA 3HOEA 5F6BA 4FBVA 1IW2A 1B4MA 2A5BA 1Q86G 3CC4E 2LFOA 3FA9A 4BX5B 2Z4HA 5C0NA 2WWPA 2RTEB 3NR3A 3LHNA 5IO5A 4ZGFA 4QNIA 4IBAA 2AT5X 2GJ5A 4YVBA 5F2BA 1IFCA 1BRQA 3B2KA 2RTQB 2X46A 2IZIA 1DZPA 2VDFA 3WOVA 3WZQA 1VWKB 4ZGUA 2QCBA 2VFBA 3ZW2A 1KL4A 2W2FA 4YGGA 5IO7A 3SZIA 3PK2A 4NV8A 1QFVA 4GETA 1ZNDA 2MJIA 1E02A 2AT8X 1B56A 1K24A 3CCLE 5IRUA 1PM1X 4CDDA 1QY1A 1S2PA 2BLGA 1N43A 3B2LA 4ZH9A 4BX5A 1OPBA 1AVEA 1GT5A 3FA6A 4WBKA 4YBUA 2R73A 3EBWA 1QY0A 4I6SA 3PIOE 1GT4A 1VWPB 5IXGA 3O22A 5H1SI 2OF9A 3BRNA 3P6GA 5B29A 2WEXA 3SLTA 5FQ7E 3RSWA 5LJDA 1JYJA 3T2WA 4GDZA 3BU9A 4TLJA 1SY1A 1ZNEA 4I9SA 3CPWE 3CKGA 3S60A 1YIJE 4BVMA 1Q82G 1FEMA 4D6AA 1JV4A 1SLFB 3P6CA 3EYCA 2X45A 3CF5E 1E2TA 1JIWI 3JS1A
chains in the Genus database with same CATH topology
2OL6O 2OY1O 5B10O 2FKGA 1FJ1E 3CKFA 5B3MO 3CKGA 2AF5A 2PI3O 5B11O 3AUMO 2OY8A 3IG9A 1OSPO 1P4PA 3IGEA 2OY7A 3EC5A 2I5VO 2I5ZO 2OYBO 2FKJA 2G8CO 2OL8O 2HKDA 2OY5O 2OL7A 5B2AO 1RJLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OL6 O;  2OY1 O;  5B10 O;  2FKG A;  1FJ1 E;  3CKF A;  5B3M O;  3CKG A;  2AF5 A;  2PI3 O;  5B11 O;  3AUM O;  2OY8 A;  1OSP O;  1P4P A;  2OY7 A;  3EC5 A;  2I5V O;  2I5Z O;  2OYB O;  2FKJ A;  2G8C O;  2OL8 O;  2HKD A;  2OY5 O;  2OL7 A;  5B2A O; 
#chains in the Genus database with same CATH topology
 1RXH A;  1ZNL A;  1I04 A;  3RE6 A;  1DV9 A;  5CHK A;  4QYN A;  2C4I A;  2WUT A;  3IG9 A;  1WBI A;  4GRJ A;  1ALB A;  1HQQ A;  3EC5 A;  4QZU A;  3HOL A;  4HPC A;  3OBL A;  3OD9 A;  5D4A A;  1A57 A;  1UZ2 X;  2RA6 A;  4YCE A;  3STN A;  3VG3 A;  1MVG A;  4R0B A;  2R74 A;  2RTJ A;  5H9K A;  4JHQ A;  2BHV A;  1FTP A;  5JVG E;  4KT5 A;  3APX A;  1TOW A;  3FW5 A;  1A2D A;  4ZH6 A;  3FEP A;  4K19 A;  1SWU A;  3IGE A;  2Y3E A;  1MDC A;  2RTI B;  1HQP A;  3RDX A;  1DF8 A;  5CE4 A;  2X8T A;  1VYF A;  3VG2 A;  4XME A;  1VWG B;  1A18 A;  3FR5 A;  2QA4 E;  1S72 E;  1MUP A;  2IFB A;  3CC7 E;  2K23 A;  1SWN A;  4A1Y A;  4Y0Q A;  4NNS A;  1YP7 A;  2BSZ A;  1FEL A;  2QO6 A;  2OL7 A;  5GAD G;  1HMS A;  2OVS A;  1IIU A;  3ELX A;  5F1E A;  4O3Z A;  1O1V A;  2OVD A;  4U8U O;  4NYQ A;  1YHQ E;  3CCE E;  1NP1 A;  3APW A;  3H3I A;  2OF8 A;  2JU7 A;  3VHI A;  4I9R A;  1BLR A;  4A1H A;  1EIO A;  1YIV A;  1LEL A;  1OEE A;  3BS2 A;  3CC2 E;  4YFQ A;  1EW3 A;  4MIS A;  4YMY A;  4I3C A;  5GAH G;  4O3W A;  4QAE A;  2IZA A;  3ZUO A;  3VG5 A;  1JZU A;  1X89 A;  1A3Y A;  1TOU A;  1I9H A;  1S7D A;  1YWA A;  1P4P A;  1YWD A;  4PJ2 A;  1R0U A;  3B2I A;  1SXU A;  2RTL A;  5HCE C;  2JGS A;  1X8Q A;  5B2A O;  1KD1 G;  2BC3 A;  4M7M A;  1JYD A;  1KT4 A;  1RLB E;  1SLG B;  3D95 A;  1IKE A;  1Y55 X;  1HN2 A;  4QGW A;  5AQ6 A;  2ACP X;  2EU7 X;  2RTC B;  5H9N A;  3I0A A;  3VGW A;  3SOT A;  2HKD A;  3F8A A;  2RTH B;  4YGH A;  1GKA B;  5EPQ A;  2GTL O;  3EM0 A;  3OE3 A;  1W4T A;  1YUP A;  1VWB B;  2POA A;  3PH5 A;  1SWC A;  4GKC A;  3QQ2 A;  2ZJQ E;  1GGL A;  5EDB A;  2Q2M A;  3PQS A;  5AJB A;  4O4S A;  2UZ2 A;  2RCT A;  3FR4 A;  1KOI A;  2X4M A;  4AZR A;  1Q7Y G;  1TVQ A;  2BT9 A;  1LCW A;  4GDA A;  1LIE A;  1JMZ A;  3UEU A;  1CBI A;  3CWK A;  5EEE A;  1N9Y A;  3P6E A;  3HWG A;  1YJ9 E;  3FA8 A;  5EDC A;  2OTJ E;  2C1Q A;  3KFF A;  1SRG A;  1CJ5 A;  3UEV A;  1GT3 A;  1WUB A;  4DNE A;  4OEL A;  1STR B;  4LQZ A;  5FQ6 E;  1KFF A;  3VG6 A;  3G4S E;  3ZI8 A;  4U67 E;  4Y59 A;  4ORW A;  5K06 A;  3STM X;  3QKG A;  2FHN X;  3CME E;  1VQN E;  2LBA A;  3S5X A;  3MM0 A;  1O8V A;  4QZT A;  3WYP A;  1SWS A;  2CBS A;  1AVD A;  1VWO B;  1X71 A;  3WZO A;  3NAD A;  2R56 A;  1E5P A;  2LKK A;  3AKM A;  2F01 A;  4XMH A;  2LBV A;  1E00 A;  4A60 A;  3DTQ A;  4EXZ A;  4MEE A;  3KZA A;  1ICN A;  4ZFX A;  4ZCB A;  4AZP A;  1EAL A;  5IRA A;  5AN9 B;  2A0A A;  1VWA B;  4WFV A;  2G7B A;  3PIP E;  3O2Y A;  4GD9 A;  1ZNK A;  3FDC A;  3HK1 A;  4TKB A;  3CCM E;  3S26 A;  4ORS A;  3VPJ E;  1LDQ A;  3CCR E;  5DM7 E;  4CPI A;  1LKE A;  5K67 A;  3DLL E;  1I05 A;  4KII A;  1JJX A;  3OJY C;  3NX2 A;  2AKQ A;  4ES7 A;  4NW4 A;  2RTP B;  3VG7 A;  4C5P A;  5B11 O;  1DC9 A;  4ORU A;  1QVG E;  2MHD A;  3G7X A;  3CQN A;  1MEP A;  3NBX X;  5LJB A;  1SWP A;  5GAG G;  4CPH A;  1PTS A;  3CQR A;  4Y0R A;  1NQN A;  4BCS A;  1B0O A;  1QFT A;  1G74 A;  3TGB A;  4TQ2 A;  2QO4 A;  2WQ9 A;  1KT6 A;  3MX7 A;  1JJU A;  5LKE A;  2ASN X;  4XMG A;  2A3F X;  3U03 A;  3I17 A;  1VPR A;  4XMD A;  4ALB A;  1SWO A;  3ELZ A;  5KHP A;  1SY3 A;  1CRB A;  3Q6L A;  2OY8 A;  4ML7 B;  1RSU B;  1SRE A;  2ANS A;  2RTK A;  1LFO A;  3WBG A;  1M90 G;  4QGX A;  1Y0G A;  2OL6 O;  1NBX A;  4D6B A;  1KXO A;  4Z2V A;  3RBY A;  3APV A;  2RTN B;  3OW2 E;  1X8O A;  2AT6 X;  5B5F A;  2CQL A;  4QQ1 A;  2IZB A;  1KT7 A;  3FR2 A;  5DG4 A;  2CZU A;  1K73 G;  4Y5D A;  4Z28 A;  1LCZ A;  4BJ8 A;  3JSQ A;  5JD2 A;  4LKP A;  4FQB B;  1T68 X;  1SWB A;  2M4L A;  3GAQ A;  2GTF X;  1SY0 A;  5BYP A;  4BX6 B;  2A2G A;  3PDF A;  4EDE A;  5AJC A;  1HBP A;  3C78 X;  1EII A;  1UYO X;  2L9C A;  1Q81 G;  1O1U A;  2RQ0 A;  3VE1 A;  2AT3 X;  3FMZ A;  4UU2 A;  3HWF A;  3B2H A;  3RWX A;  3WXQ A;  4OMX A;  3SAO A;  4U3Q A;  1LF7 A;  3RDM A;  2JU3 A;  5HWZ A;  1OEJ A;  4WF9 E;  3NP1 A;  1Y52 X;  2Q4N A;  3IA8 A;  4N7C A;  4CDF A;  1HXL A;  4IAB A;  1PBO A;  2RN4 A;  2ZSC A;  3WJE A;  1AB0 A;  4Y0S A;  1GX8 A;  2W2A A;  1EI5 A;  1PBY A;  2G78 A;  3PEC A;  4YDA A;  4CSB A;  1CBQ A;  3ZW0 B;  4HPB A;  1YIT E;  1HXZ A;  5HZ8 A;  4KC7 A;  4OS0 A;  1BSO A;  4GUZ A;  1OBU A;  1VQ6 E;  3NQ9 A;  3N91 A;  5H9A A;  4WCE E;  5IRW A;  3FID A;  1G85 A;  1U18 A;  4IB8 A;  1TW4 A;  3WYQ A;  2W2B A;  1I78 A;  3AKN A;  3HWE A;  2F73 A;  1Y53 X;  2LB6 A;  3D96 A;  3WZN A;  5LJC A;  3TF6 A;  1ZRY A;  2RTF B;  3BU1 A;  1NQM A;  3VHM A;  1YJW E;  3EBK A;  4UU3 A;  4AZN A;  3MBT A;  3O19 A;  4IOA E;  3P02 A;  4KC8 A;  5HBS A;  3D97 A;  2N93 A;  4QYP A;  1EPB A;  3FW4 A;  4NLI A;  1BWY A;  3P6F A;  1BSQ A;  4UY8 G;  4OEM A;  2X8F A;  4ZHF A;  3KFI A;  1KZX A;  1DZK A;  4BGF A;  4AW8 A;  1VWI B;  5HL7 E;  4MVK A;  3PP6 A;  5EZ2 A;  1Y9L A;  3SLO A;  5BVS A;  1U17 A;  5D48 A;  1YWB A;  4Y0P A;  4GH7 A;  1XKI A;  4N7D A;  5HAE A;  3ZUI A;  1ACD A;  4OS8 A;  1GX3 A;  4ZHG A;  4NYR A;  4O49 A;  3UEX A;  1ADL A;  2Q2P A;  4FBR A;  2BS6 A;  1HBQ A;  1N0S A;  1VQ7 E;  4Z27 A;  1MM9 A;  5IO6 A;  2NND A;  3TGC A;  4IOC E;  1RJL C;  3X00 A;  3J7Z G;  2CAM A;  4YBP A;  3BY0 A;  3CCU E;  1G5W A;  2FR3 A;  2AMM X;  4O9S A;  2MF6 A;  2OYB O;  2AT0 X;  1EUO A;  4U9C A;  3SZJ A;  2QO5 A;  3LV4 A;  2OY1 O;  5B10 O;  2HNX A;  2F09 A;  3HWD A;  2X32 A;  4XMC A;  3BX7 A;  2DM5 A;  3C77 X;  1SRH A;  2RTM A;  3MG5 A;  1VWD B;  1MOY A;  1K9M G;  1S44 A;  2Q9S A;  4U8U N;  5CYB A;  1URE A;  2RTG B;  3Q34 A;  2IZL B;  3CD6 E;  3RDO A;  3WJC A;  3PH6 A;  3KFH A;  1NC9 A;  1LPJ A;  4LKT A;  3RDU A;  3IFB A;  1KQS E;  5F7G A;  4NP1 A;  1LUQ A;  2G8C O;  1LCV A;  1JMX A;  4AYH A;  1X8U A;  4ODD A;  4OKA A;  2QMI A;  3VHH A;  2DJG A;  4GGR A;  1AEL A;  2FTB A;  1SWF A;  1K8A G;  1I06 A;  3DSZ A;  1NGL A;  1OPA A;  5HA0 A;  4HWM A;  3FLL A;  2XST A;  3TGA A;  4O3Y A;  4WFA E;  3FEN A;  2WR6 A;  4JNJ A;  4O4O A;  5LJE A;  2QOS C;  1SMP I;  1RST B;  1SWJ A;  4GU8 A;  1QY2 A;  2QM9 A;  2ZAI A;  3EW1 A;  2IZC B;  3ZW1 B;  4YFP A;  3E3C A;  2KT4 B;  4AZQ A;  2GTL N;  4BOE A;  2L5P A;  1DFV A;  1NP4 A;  2K62 A;  3WJB A;  1ICM A;  1GKA A;  1RL6 A;  3NQ3 A;  4QGV A;  2OY5 O;  1BJ7 A;  4U46 A;  4DCB A;  1VWF B;  4MIR A;  4HFO A;  3JQO A;  4EKV A;  1X8N A;  2FS6 A;  2RTA A;  1FEN A;  4GZV A;  2QEX E;  1BM5 A;  1KQX A;  5DPQ A;  2FKJ A;  4ZHD A;  2KW1 A;  2JMB A;  4ORR A;  1YP6 A;  3RE5 A;  4HPA A;  2L68 A;  4IMN A;  4RUN A;  1RXJ A;  2RCQ A;  2X8S A;  1DZM A;  3CKF A;  1OBQ A;  2IZH B;  3EMM A;  3NQK A;  1P6P A;  5HCD C;  4CPF A;  3P24 A;  2A8G A;  3VG4 A;  4RUU A;  4EFG A;  3RDQ A;  1MX8 A;  4OMW A;  4I3B A;  5D8J A;  5JVH E;  3TZS A;  1DZJ A;  2JW1 A;  2ALL X;  5EED A;  4YKO A;  1LIF A;  4BX7 B;  2C1S A;  1SA8 A;  1FE3 A;  3RKG A;  1X8P A;  1YI2 E;  3CMA E;  2ZJP E;  3G6E E;  3WJF A;  1UYN X;  1KT3 A;  2LA7 A;  3PQU A;  5LJH A;  4BBO A;  1YWC A;  2NP1 A;  1GT1 A;  2JN3 A;  4Z2O A;  2AL0 X;  5K68 A;  5HZ6 A;  2VFC A;  2FT9 A;  3FIQ A;  4IMO A;  2E4J A;  4ZR2 A;  4TKJ A;  1BRP A;  4NV7 A;  3SZH A;  2HYS A;  3P6D A;  3FYF A;  3LTW A;  4GNW A;  4ZHC A;  4L1N A;  1SRJ A;  2A13 A;  1ERB A;  4FGI B;  1ERX A;  1VWL B;  4WFB E;  1SY2 A;  1BBP A;  2FWV A;  3V8U A;  1W6F A;  3UEW A;  4U8U M;  3U9P C;  1VWH B;  1AQB A;  1SWA A;  3B2J A;  1Z24 A;  4GJS A;  3CR6 A;  2OVA A;  1SWQ A;  1G7N A;  2OY7 A;  3VU1 A;  1IKJ A;  5L8N A;  1MX7 A;  4Z6J A;  1SWL A;  1VWM B;  2FS7 A;  4IAX A;  1YJN E;  2G5L A;  4LZU A;  4IB7 A;  4BQU A;  1IFB A;  2IZJ A;  5D45 A;  3CCJ E;  3CCV E;  1RBP A;  2QOM A;  3APU A;  1QQS A;  4JGL A;  3T6L A;  2FHL A;  4EQA C;  1LDO A;  5L3Y A;  1SLD B;  5MLC H;  3WVM A;  4CDC A;  4CDE A;  4GE1 A;  3BX8 A;  3AUM O;  2X34 A;  4DQ4 A;  1QAB E;  1LID A;  4MVI A;  1VQO E;  2HZQ A;  1HMR A;  4INN A;  4PSQ A;  1JJ2 E;  2IZE B;  5B3M O;  2OFR X;  4BX6 A;  2RTB B;  2WQA E;  2GTL M;  2FGS A;  5HZ5 A;  2NNQ A;  3AEH A;  1EXS A;  2RTR B;  2MM3 A;  3CBS A;  3PPT A;  5F6Z A;  1LIB A;  4IRW A;  4MVL A;  5L8O A;  4ZJ0 A;  3C76 X;  2OFB A;  3MVF A;  2RTD B;  2ACO A;  4GGT A;  2X56 A;  4ARH A;  2GC9 A;  1E06 A;  5BVQ A;  4MVE A;  3RZY A;  2OVE A;  5H8T A;  4GNY A;  5B27 A;  1SWE A;  2Y32 A;  1VWN B;  1HY2 A;  3P6H A;  1HMT A;  3STK A;  2PI3 O;  1KL3 A;  2UYW A;  2OTL E;  1PEE A;  1RAV A;  2RTO B;  5CSE A;  2FLJ A;  3CCQ E;  1VQP E;  3NX1 A;  1QVF E;  2AH7 X;  4KH8 A;  3I56 E;  4JO6 A;  3ZW0 A;  1RXK A;  1VYO A;  5F58 A;  2ZJR E;  3UAQ A;  2CZT A;  5HA1 A;  2JU8 A;  5AEO A;  5FQ8 E;  4IB6 A;  3ZQ3 A;  2FRS A;  2A2U A;  1MK5 A;  4GJV A;  2IZD B;  1QG5 A;  1SWH A;  2WEW A;  2G79 A;  4I60 A;  1VQL E;  1STS B;  4WHI A;  5KIC A;  4LZV A;  4A8Z A;  4IO9 E;  3FA7 A;  5GAE G;  3U0D A;  4WFN E;  2YG2 A;  1VWE B;  3F9D A;  1H91 A;  4ORX A;  1KL5 A;  5HZ9 A;  1T0V A;  1VQK E;  2NNE A;  1VYG A;  4GK9 A;  2YMS A;  4ON1 A;  4WFU A;  4I95 A;  1EPA A;  1SLE B;  5HZQ A;  1AVG I;  5BVT A;  3ZWE A;  2XKL A;  3L4R A;  1KZW A;  1ML7 A;  2KD2 A;  2L67 A;  1VWR B;  2I5Z O;  3KVN A;  1OEK A;  4YFR A;  1GXA A;  2MWH A;  3WZP A;  3HTY A;  1NJI G;  1SWR A;  2JOZ A;  4O4U A;  4O4X A;  1ZNG A;  2HMB A;  2IZG B;  4Z2P A;  2FR2 A;  1VWJ B;  1BEB A;  5D47 A;  2MO5 A;  1QWD A;  3G71 E;  1SWG A;  2GH7 A;  2KTD A;  1ZNH A;  1STP A;  2PY1 A;  1W5R A;  2Y3F A;  2Q39 A;  2OFM X;  2CM9 A;  1SWK A;  1VWC B;  1BSY A;  4ORY A;  4YH0 A;  2Z4I A;  4AZM A;  5FFH A;  2IZK A;  1N9M A;  1JJJ A;  1NDJ A;  5HCC C;  1KC8 G;  1CBS A;  4O3X B;  4OS3 A;  1SXX A;  4IAW A;  5LKF A;  3BSZ E;  3BDR A;  4GGZ A;  1EQD A;  1N4J A;  1N8R G;  5FAZ A;  3CXC E;  2DJF A;  4YCH A;  3KFG A;  5LJK A;  3S5V A;  4TKH A;  2KTS A;  3GE2 A;  1FJ1 E;  2A5C A;  1TXL A;  2AF5 A;  1M1K G;  1KGL A;  2WSJ A;  1Y9T A;  2CBR A;  1SWT A;  2I5V O;  3I55 E;  1PMP A;  4NNT A;  5HTD A;  3WJG A;  1K3B A;  4CK4 A;  4CPE A;  1KT5 A;  2HLV A;  3WJD A;  3D4R A;  1OBP A;  2HZR A;  3HPE A;  5KID A;  4EEJ A;  2AVI A;  4YGZ A;  1SRF A;  2BS5 A;  1XCA A;  1JBH A;  3EW2 A;  4AZO A;  1SXW A;  1W2B E;  1GX9 A;  4YDB A;  4CV7 A;  4I3D A;  1T8V A;  1VQM E;  1N7Y A;  3T2X A;  3KQ0 A;  1GM6 A;  1L6M A;  3RY1 A;  5DM6 E;  4CPH B;  2O62 A;  2RD7 C;  4ALO A;  4ID2 A;  1OSP O;  1B8E A;  3BLG A;  4HPD A;  3FEL A;  1LIC A;  3CMP A;  4IB9 A;  5HTE A;  2OL8 O;  3ZW1 A;  2IZF B;  3T6F A;  5B5G A;  1VWQ B;  1LNM A;  2FKG A;  1D2U A;  4COT A;  1DF3 A;  1IJ8 A;  1SRI A;  3CBC A;  4M6S A;  4L3R A;  4TJZ A;  3SLJ A;  3F6Z B;  1VQ9 E;  4NLJ A;  1FDQ A;  2P8G A;  2CM4 A;  1VQ5 E;  4XMF A;  5LJG A;  2OFA A;  4FBO A;  3CCS E;  5H9L A;  1SWD A;  4ZHH A;  1U0X A;  1VQ4 E;  1D3S A;  2X55 A;  4B55 A;  4TNN A;  1SXY A;  3PED A;  2ZAG A;  1CBR A;  5FEN A;  1KQW A;  4QRL A;  2WPU A;  3FEK A;  3NPO A;  3ZZV A;  3RDS A;  3VE2 A;  5JR8 A;  3K3L A;  4KCA A;  4DQ3 A;  1I4U A;  4BX7 A;  1JQP A;  3RY2 A;  5L8I A;  2OZQ A;  3T1D A;  3D9W A;  1VQ8 E;  4YKM A;  3HOE A;  5F6B A;  4FBV A;  1IW2 A;  1B4M A;  2A5B A;  1Q86 G;  3CC4 E;  2LFO A;  3FA9 A;  4BX5 B;  2Z4H A;  5C0N A;  2WWP A;  2RTE B;  3NR3 A;  3LHN A;  5IO5 A;  4ZGF A;  4QNI A;  4IBA A;  2AT5 X;  2GJ5 A;  4YVB A;  5F2B A;  1IFC A;  1BRQ A;  3B2K A;  2RTQ B;  2X46 A;  2IZI A;  1DZP A;  2VDF A;  3WOV A;  3WZQ A;  1VWK B;  4ZGU A;  2QCB A;  2VFB A;  3ZW2 A;  1KL4 A;  2W2F A;  4YGG A;  5IO7 A;  3SZI A;  3PK2 A;  4NV8 A;  1QFV A;  4GET A;  1ZND A;  2MJI A;  1E02 A;  2AT8 X;  1B56 A;  1K24 A;  3CCL E;  5IRU A;  1PM1 X;  4CDD A;  1QY1 A;  1S2P A;  2BLG A;  1N43 A;  3B2L A;  4ZH9 A;  4BX5 A;  1OPB A;  1AVE A;  1GT5 A;  3FA6 A;  4WBK A;  4YBU A;  2R73 A;  3EBW A;  1QY0 A;  4I6S A;  3PIO E;  1GT4 A;  1VWP B;  5IXG A;  3O22 A;  5H1S I;  2OF9 A;  3BRN A;  3P6G A;  5B29 A;  2WEX A;  3SLT A;  5FQ7 E;  3RSW A;  5LJD A;  1JYJ A;  3T2W A;  4GDZ A;  3BU9 A;  4TLJ A;  1SY1 A;  1ZNE A;  4I9S A;  3CPW E;  3CKG A;  3S60 A;  1YIJ E;  4BVM A;  1Q82 G;  1FEM A;  4D6A A;  1JV4 A;  1SLF B;  3P6C A;  3EYC A;  2X45 A;  3CF5 E;  1E2T A;  1JIW I;  3JS1 A; 
#chains in the Genus database with same CATH homology
 2OL6 O;  2OY1 O;  5B10 O;  2FKG A;  1FJ1 E;  3CKF A;  5B3M O;  3CKG A;  2AF5 A;  2PI3 O;  5B11 O;  3AUM O;  2OY8 A;  3IG9 A;  1OSP O;  1P4P A;  3IGE A;  2OY7 A;  3EC5 A;  2I5V O;  2I5Z O;  2OYB O;  2FKJ A;  2G8C O;  2OL8 O;  2HKD A;  2OY5 O;  2OL7 A;  5B2A O;  1RJL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...