2PI6A

Crystal structure of the sheep signalling glycoprotein (sps-40) complex with 2-methyl-2-4-pentanediol at 1.65a resolution reveals specific binding characteristics of sps-40
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
361
structure length
361
Chain Sequence
b'YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYTFANISNNEIDTWEWNDVTLYDTLNTLKNRNPKLKTLLSVGGWNFGPERFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSFTLASSKTDVGAPVSGPGIPGRFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLAEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase-3-like protein 1
publication title Tryptophan as a three-way switch in regulating the function of the secretory signalling glycoprotein (SPS-40) from mammary glands: structure of SPS-40 complexed with 2-methylpentane-2,4-diol at 1.6 A resolution.
pubmed doi rcsb
molecule tags Signaling protein
total genus 128
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2007-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2pi6A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2pi6A01
3WMBA 1E0VA 2JE8A 2WHJA 4HPHA 4CU6A 2X0HA 2WSPA 3FAWA 2A3AA 4JFVA 5IHSA 2E9BA 3ARQA 3TOPA 3ECQA 2BVYA 3U7VA 1BHGA 1B2YA 5E70A 1CYGA 5D8ZA 4GZJA 3SCRA 3SUVA 8A3HA 3VX1A 2CESA 2ZXDA 3QR3A 5FCZA 4KWUA 3LPPA 3SIMA 1LG1A 5A6LA 1B3XA 1TVNA 5ABHA 4HMCA 3VO0A 3AOFA 2Y8VA 5I78A 3NYDA 2XTKA 1LG2A 4OBRA 4PSPA 2DSKA 4PMYA 1XC6A 2XFYA 5IHRA 4GINA 1H1NA 3AS0A 1QI0A 4WKAA 4WLCA 1F4HA 1M04A 1QHPA 1HKKA 2WVSA 3OA5A 2ZUNA 2PBOA 4MNJA 1UR1A 2WHKA 1FHLA 3WUEA 5FKYA 5A6BA 4H8UA 2VTFA 3N15A 5BCAA 1GOWA 4AXNA 1KXHA 5A95A 2YL6A 3OZOA 1MXDA 1ISWA 1DWFM 5M03A 3WDJA 4JIEA 3AIQA 1JZ8A 5A6MA 1OT2A 1W3JA 4J3VA 3AMKA 4ZE5A 3CZJA 2C0HA 3ALGA 4V28A 1A47A 1JAEA 3MO4A 1CNVA 3TTSA 5AC5A 5CG0A 5JH8A 1V3MA 1E0XA 1KB3A 3K4AA 2XVGA 1G9HA 1JDDA 4R5EA 3VIGA 4CU8A 2WPGA 3MUZ1 1HVQA 2FHCA 3VDCA 4PMQA 3ZQ9A 3IJ8A 3W26A 4D6IA 4J3WA 2EJ1A 5EBAA 2VI0A 3AXXA 2G3NA 1M01A 1JI2A 3MANA 3AFBA 2JIWA 2GJXB 3CHDA 2QMKA 5LA1A 3N12A 4UOQA 5I5RA 4EE9A 3BLKA 2CYGA 1CGYA 1N82A 5JBFA 4Z2LA 3W4RA 3RJXA 2BVDA 4WF7A 2GFTA 3UETA 1DHKA 3RILA 1XHGA 3VINA 1CLVA 3T09A 4A3YA 2GJXA 4P7NA 3TONA 3BSHA 1XV8A 4CGTA 1GVIA 1QBAA 2OWCA 1H41A 3K4DA 1QW9A 3AIWA 1E73M 4M81A 4ZXLA 5CSYA 4JFTA 5CLWA 2X2YA 4JL1A 4M82A 1BGGA 2BHUA 5KZ6A 2GDUA 1UOKA 2E9LA 2WMKA 3GM8A 3RO8A 4EKJA 3PZVA 2FGLA 3AHXA 1B9ZA 1V6UA 3K8LA 2F8QA 3S2CA 1JZ2A 5A2BA 3NIYA 3NUKA 1UWSA 1HN1A 2NT0A 3ARZA 5BWFA 3CUHA 4TUFA 4ATDA 2FDMA 1K6AA 2YL5A 2Z1KA 1MQRA 1V08A 2YLLA 2WVUA 4JKMA 3W28A 3VM7A 4NRRA 1CGXA 1B31A 3O2LA 1LWHA 4RL3A 1E1FA 2XG9A 1BQCA 4W5UA 3FAXA 1KBBA 2E0PA 2ESCA 4J28A 4IPLA 1GQIA 3B9DA 4QCFA 1SR0A 3NSXA 2VR4A 4DM2A 1QPKA 3AS1A 1V0KA 1DWAM 2XM1A 3UESA 4Z2HA 1U2YA 2J8GA 1ECEA 3GXIA 1HKJA 1UUQA 2EPLX 3KL0A 1FP9A 3ARXA 3EBVA 4QCEA 4F79A 8CGTA 1J12A 1FH8A 1E5NA 1H09A 4JFSA 1PZ2A 3QHNA 3WD0A 1KGUA 2D22A 4BA0A 1VFOA 3WEOA 1W9XA 1R85A 1CDGA 1NOFA 2CPUA 2X1IA 4PMZA 4U3CA 1PIFA 3VGGA 1E6RA 1R8LA 3ZM8A 3PZUA 3ZJ8A 2VRQA 4AD5A 3GYCA 1WZKA 5C70A 2PB1A 2CBVA 1GOMA 5CPQA 5BRQA 3WUGA 1BVNP 1B3WA 4A3HA 4W87A 3VKKA 5I6SA 4PUDA 2X05A 4LYQA 3WN6A 2J62A 1J01A 4M1RA 3L4VA 1XH2A 5GNXA 1PZ3A 2PWGA 3WNMA 4PBGA 1R86A 3NCOA 5CGTA 1EGZA 1H5VA 1XH1A 2O9TA 5HPCA 1GVYA 4HMEA 2PBGA 3WNLA 5A8QA 3VGBA 4JHOA 2Y8KA 1QVBA 2WMIA 3CUGA 1KFWA 4B9YA 1OT1A 3MSDA 3VD5A 1ZB5A 1CECA 3WH9A 3PZIA 1DP0A 3L4WA 1AQ0A 3KZSA 3F5LA 2OSYA 4D72A 4PTWA 3NJ3A 4ACZB 2YIHA 2J7EA 3VX0A 1C8XA 1W1TA 3GNRA 4JKKA 4PRWA 2Z1SA 4DUWA 4E4PA 5IXEA 4MJ2A 1AQMA 4UTFA 1MW1A 5I77A 1YQ2A 3AXIA 3DHUA 3GNOA 2UY5A 1HJQA 5HBFA 2PWFA 1BYDA 2EPKX 1TFVA 4F9DA 2QLYA 1YHTA 2WMGA 3CUFA 1HVXA 2ZX9A 1OCQA 1UR0A 2C8NA 1E4LA 3N9KA 4W5ZA 4BQ3A 2FH8A 2OLHA 2YJQA 2RGLA 4OZOA 3GBDA 1UD8A 4GKLA 4GXPA 5HDRA 4H7VA 2EO7A 2CBUA 1HT6A 3DHPA 1H0GA 1V0LA 1PPIA 1IT0A 4TTUA 4P7QA 2BV9A 1E5JA 1UKSA 1GJWA 4AD1A 1J0JA 5EMYA 2CERA 3WQ8A 1PBGA 3AIVA 2NW0A 1RPKA 5DEZA 1BYBA 5D9OA 1LJYA 3CZKA 3UERA 4CVUA 2WAGA 1H11A 1UHVA 1QOXA 1GNXA 4MB1A 3PZOA 4CD4A 4J3TA 3AJ7A 4JFUA 1EA9C 4P8VA 2J7HA 2VR5A 3OZPA 1B1YA 1QNQA 3AIEA 4D1JA 4ZFMA 1LL4A 1E4NA 4NZCA 2CHOA 3AHZA 3A4XA 2W67A 2WVVA 4U3AA 1HL9A 4P7LA 1V6VA 2W63A 5AYBA 3WFLA 2IXVA 1JAKA 2CXGA 1JDAA 3AYSA 3W6LA 3SCVA 3NSNA 5IDIA 1A3HA 3SCWA 3BAWA 3MKKA 5ECUA 3VIMA 1JZ4A 3EMQA 4B16A 1LWJA 2VZVA 3WELA 4E2OA 4W8LA 4C7GA 4JL2A 3RMEA 4X9YA 3IAQA 3NDZA 3AISA 4B15A 2F61A 1OINA 4PN2A 2VCAA 4Z2JA 2EXOA 2ZUUA 2W92A 1VJSA 4DWSD 2FHFA 4JCMA 3KEHA 1HJUA 3OLGA 3F5KA 5E6YA 2AOSA 2GJRA 1NWRA 1TCMA 4ML4A 1B90A 1L0PA 3WDHA 1MW0A 3PTQA 2D23A 5HOSA 3ARWA 3AIRA 3PZMA 1E6XM 3TA9A 1VENA 2DGAA 4OIFA 2XWDA 4QDMA 1VBUA 4AIUA 5BXPA 3OLIA 1ZS2A 4E8DA 4AD3A 3WL1A 4D6EA 1E6SM 1BPLB 4KRUA 4DWSA 2XJ7A 2FHBA 2CNCA 1JZ3A 3GH5A 4HZ6A 4GZEA 3CUIA 2XUCA 1NARA 3OGRA 4A4AA 1BTCA 1ZBCA 1C3FA 1UWTA 3BCFA 3WF4A 1HXJA 3WD1A 1WZAA 3W27A 1XYFA 4W85A 3U5UA 5I3DA 1MYRA 4L4PA 2WLZA 2V3DA 1GJUA 3MS8A 5FIPA 3N04A 2PWEA 3AZSA 4LYPA 3WF2A 1W3HA 3OGSA 1GORA 2XSAA 3ZT5A 1V6XA 1WE5A 3PTKA 1ISXA 3RIKA 3U5YA 2V3GA 3UR7A 3KWXA 3UEQA 2RGMA 2O9OA 2G8ZA 2Y4SA 4Z2KA 1ODUA 3ZT7A 3VDAA 3T08A 1SMAA 1LF1A 2TAAA 4P8WA 1WAWA 1JZ7A 2D2OA 4D6GA 4MJ4A 2GVYA 2ZX7A 1JYXA 3GH7A 3DYMA 3WDIA 3W81A 5AYIA 2WBKA 4MB5A 1UR4A 3WQWA 3WBAA 3GZAA 3EMZA 3BAKA 4PMVA 1BG9A 2Y24A 3ZSSA 3B8SA 4UFHA 1GZJA 2YOCA 2ZUMA 1EOKA 2DT3A 4TXEA 4IUGA 1UQYA 4JHZA 2BHYA 5CPTA 2WVTA 4PMDA 1HJWA 2XPKA 4MDOA 4CCCA 2DT0A 2UWFA 2VZTA 1B3VA 1W9DM 4HP5A 4ACYA 2F2HA 3VIKA 2VO5A 2ZXQA 1JFXA 1W1VA 1I75A 4U5KA 1VAHA 3SUUA 2WHMA 1Q6CA 1H2JA 2BY1A 3GH4A 4P8XA 1B3ZA 4B3LA 2J47A 1XSJA 1E15A 4C7DA 1WNOA 4UOJA 3VTRA 4B9ZA 4BQ5A 1GOOA 5CPSA 4W7UA 2E40A 3A3HA 1CGWA 2JFEX 4W89A 4QAWA 1QNSA 3O9NA 4CKQA 3PZGA 1TR1A 1HNYA 2J4GA 4GIAA 3EDDA 4F8XA 2VT0A 3FY1A 3DC0A 2ZOXA 1W2VA 4J27A 3WD2A 2QF8A 3WFZA 4RE3A 1BSIA 4W7VA 1V3IA 1NQ6A 1GPFA 1UR9A 4WK9A 1FH7A 1UD5A 1WDRA 3GNPA 5DMYA 2BFGA 5JIPA 1FFQA 1M03A 1ITXA 5A8NA 1KXQA 1H3GA 2DH3A 2IUZA 2VRKA 2J7FA 1MFVA 3BAJA 4XZBA 3AS2A 2W5FA 2WHLA 3CBWA 3SUSA 5ABEA 3PHAA 2VX7A 4DUXA 1CXFA 2E9MA 4V2XA 4HU8A 3T2PA 4H41A 1OM0A 5A2AA 3SEPA 2V3FA 1MW2A 5E09A 1MWOA 3KL5A 3DYOA 3T0BA 4KH2A 1QW8A 3WH6A 1AMYA 1G94A 2UY4A 3VD7A 5HXMA 1WO2A 4XB3A 3TTOA 1C7TA 1G5AA 1Q4NX 2CCRA 1QI3A 1XSKA 2AAAA 4DWSC 1E72M 1JZ5A 2CHNA 2WMFA 3ARVA 3WH8A 4TTGA 2AMGA 1CXEA 3OGVA 2QV4A 3MMWA 1HKMA 7CGTA 3F5JA 1Z32X 5JIWA 1BG4A 3CMJA 1JYVA 3I3EA 1W9BM 1UD4A 3MV11 2YLAA 1H0IA 2DPEA 3SCQA 3VIIA 2CBIA 1WZMA 4UQBA 4FLQA 2CBJA 2O9RA 4HOWA 2EEXA 4CD8A 3L4TA 5D8WA 1JNEA 3WQ4A 1C93A 2J78A 1CGUA 4HZ7A 2YDSA 5LA2A 4HOZA 1PX3A 5M5DA 3MUY1 1AQHA 3BCDA 1UWIA 4F66A 1V3LA 5BROA 1HP4A 1E1EA 4XZWA 1JYWA 1TE1A 2XVLA 4AEEA 3BMWA 4CCDA 1G0CA 3MMUA 4Z2GA 4HOXA 5EB8A 2ZXAA 4KMQA 5FOOA 2G4FA 3AS3A 5GPRA 5I2UA 1XD0A 4MB3A 1O6IA 3VD9A 3VGHA 3B9AA 4H2CA 2YKKA 1KWKA 2G41A 3CO4A 3D5HA 3M7SA 4WKFA 4QLLA 1EH9A 3ZIZA 1E6NA 4U2ZA 1KQZA 2WB5A 3U57A 3PBGA 3VDBA 4ZEPA 1QNPA 1C92A 1JXKA 3FW6A 1TA3B 1LQ0A 4MNLA 4W84A 4UFLA 5AY7A 2BY0A 2VZUA 1DWIM 5GNZA 3HU7A 3W82A 5A3HA 4JKLA 3K8KA 1JNDA 4PSRA 5JUVA 2E8YA 1HJVA 3KL3A 4H8HA 5KEZA 1TA3A 4PYSA 3AMGA 3MU7A 3TTYA 1C7SA 1EDGA 2HVMA 3CZGA 4OKDA 2YA2A 5LA0A 5E0FA 3ZJ7A 3MSGA 3CZ8A 3VIJA 1XGZA 4YHGA 2ZE0A 1KR0A 1W91A 3CHEA 2D3NA 4AEFA 2EBNA 5DO8A 1C90A 4AZ5A 2V5CA 4WSKA 1M7XA 5A1AA 2VVSA 4MDPA 3WQ6A 1JIBA 4UZUA 2DSVA 3AHYA 2DIJA 4DM1A 2DIEA 1VEOA 4PCTA 4TX6A 1GOIA 1OGBA 3W25A 4XV0A 6TAAA 1CXIA 4S3KA 1OGGA 2J25A 2OYLA 5GQBA 2ZWZA 4WKHA 1CXKA 4TOQA 2BNJA 2XVNA 3AIBA 2GK1B 4MAZA 2WC4A 1FHDA 1RP8A 1KXVA 3CZLA 5FD0A 4AZIA 3L2LA 3TTQA 2CETA 2W62A 4AD4A 2DSZA 3WMSA 3VMNA 1E70M 4YHEA 3MUAA 4NRSA 3AHVA 2VRJA 4ACZA 1GW1A 4UCFA 3BH4A 4J3UA 3L4XA 3EMCA 5A8PA 2QMJA 4OBSA 1VBRA 3WH7A 3GBEA 3WEZA 3ZSTA 1KXTA 1BF2A 2ZX6A 4BF7A 2MANA 3N11A 1B3YA 1CGVA 3WUFA 3DECA 1EHAA 3VIFA 5A94A 3N1AA 1UH3A 2VQUA 5HNNA 1GCYA 3ZO9A 3WY1A 3JUGA 3WMCA 5I24A 4BZYA 4NI3A 3VGFA 2CIPA 3WH5A 1UR2A 3WF3A 1BYAA 4IPNB 4J7RA 1GONA 1CLXA 2YDRA 4GQQA 4TVUA 1JDCA 4YPJA 4CUCA 3QOMA 3VOCA 3AIUA 5E6ZA 3AHTA 2VCCA 3WNNA 1WB0A 1XCWA 3HN3A 3RM9A 1EOMA 2D24A 1CXLA 3AXHA 4W8BA 3GTNA 1R7AA 1GHRA 4MADA 4UFIA 4CVWA 1HX0A 2J7GA 3L2MA 3VPLA 2XFRA 1ZBVA 2W61A 1CENA 1G1YA 4K68A 4UQ9A 1MQQA 1KGWA 2X8RA 4Z2IA 4W86A 3GXMA 2EPOA 3II1A 4AZBA 1W9VA 4HTYA 2PWDA 2VUYA 3BXWA 4V27A 4LX4A 4OUEA 3VVGA 1J0ZA 2J8FA 1UD3A 3AROA 4J3XA 3M6DA 4B3KA 3E1F1 3VIPA 4JFWA 3D3AA 1W3LA 3RCNA 1VEPA 4W88A 1O7AA 5CXPA 2J7DA 1NWUA 1E6QM 3NDYA 1U33A 3UG5A 1B0IA 4D6HA 1WKYA 5C8BB 2OWWA 1K9EA 1IZKA 2J79A 4AD0A 3AQUA 1PJ9A 4AC1X 1UZ1A 1X1NA 2YA1A 1C8QA 1OD8A 1PX8A 2PC8A 1EO5A 2PI6A 3WDRA 4AMCA 3SCSA 2BXZA 4D6CA 2VZOA 1E40A 4NSBA 4HA4A 1V03A 1RD6A 1Q6FA 3LPOA 4LYRA 4S3JA 3WF1A 2ZX8A 1VFMA 2J77A 4BCEA 3SUWA 1XH0A 2BHZA 4GPNA 1V6YA 3FNDA 4ZE4A 2OYMA 1KGXA 1B30A 1UH4A 1JD7A 4ZXOA 3RM4A 2VX6A 1NWTA 2V5DA 3O6AA 1AVAA 4AZHA 5A6KA 4MTVA 2D20A 3BAIA 1Y7VA 2EPNA 3HMCA 4AIOA 3N18A 1OD0A 2W4XA 3L4ZA 5CZKA 4M56A 3A4AA 1W2PA 2DH2A 2QPUA 2DT1A 2WXDM 1E0WA 2FGZA 9CGTA 4U5IA 3WQ5A 4Q22A 3WBEA 3BMVA 1EQPA 2WKLA 3AYRA 3WUBA 1V0MA 2WYSA 1ODZA 4RE2A 1ITCA 1VIWA 3BAXA 1TG7A 4AWEA 5ABGA 2DDXA 1NOUA 2NT1A 5LYRA 2YA0A 4AZCB 3WKZA 3GDBA 2E4TA 3IAPA 3SCTA 1KCLA 1WDPA 1S46A 2E8ZA 3T2OA 4GI9A 2WLYA 4LXFA 2WBGA 1E6PA 4LPCA 3ARPA 4PTVA 4M80A 3BSGA 3OG2A 1PEZA 2FH6A 4OOUA 1LLOA 2VQTA 3VU2A 2VOTA 4N42A 1X6LA 1J10A 3PZQA 5CLTA 4TX8A 2XM2A 5GNYA 1LL7A 2WWDA 3GXFA 2WCAA 4FK9A 3VNYA 1SYTA 2VJXA 4WIWA 4RE4A 1KBKA 3VMPA 7TAAA 4YN5A 4U33A 3M07A 2JEQA 1RH9A 1NP0A 1JFHA 4P7OA 2VZSA 3TP4A 2DEPA 4D1IA 1BAGA 1JGIA 1JL8A 1X6NA 2BXYA 1KR1A 4X0VA 3WQVA 1QI5A 3CZEA 2CKSA 2VVNA 4GO9A 1UG6A 3UCQA 1HJSA 3UG4A 3WEMA 1E3XA 3A4WA 3CMGA 3T2QA 5A6BD 4U2YA 3ARRA 2G3JA 2ZXBA 7A3HA 3VGEA 1JI1A 3LPFA 2A3BA 1U30A 5E9AA 3WNKA 1VF8A 1LL6A 1US3A 2WW5A 3SCPA 1PIGA 3B9EA 4ATWA 2A3EA 3UR8A 4QLKA 1W1YA 4XUYA 1QHOA 1ISZA 1J0HA 1TZ7A 5IFTA 3WL0A 4GQRA 1OGSA 1UA7A 3VIHA 2GUYA 3VMOA 2XGIA 4WSJA 1FFRA 2WWCA 2WM0A 1QNRA 2YBUA 1BVZA 1CXHA 1MQPA 1QNOA 1UR8A 2GDVA 1R87A 1KWGA 4QP0A 4KGLA 5D9PA 4HZ8A 2ZWYA 3CIVA 3QHMA 4CU7A 3VILA 1J18A 4AD2A 4CN6A 5BXTA 2HISA 1WZLA 1RP9A 5FL0A 4OJYA 1UKPA 2X09A 3CTTA 5M3WA 1UYQA 1V6WA 5I23A 1US2A 3IK2A 2XVPA 4AIEA 1OB0A 1NP2A 3F4VA 5F7UA 1V3JA 3NSMA 2WC7A 2PWHA 3CGTA 3M46A 3ARSA 3IANA 1Q6GA 5DT5A 1EDQA 1IV8A 2XWEA 4XX6A 2BY2A 1NOWA 1GOKA 3ZOAA 3WDQA 4HA1A 1OBAA 5DF0A 3ZJKA 3KE0A 2D0FA 5CQ1A 1E71M 1I1WA 2JF6A 2VL4A 3SCNA 3BGAA 2WK2A 3G6MA 3CLWA 2WCSA 1DWJM 1BYCA 2BS9A 4MB4A 1VJZA 1ZJAA 3EYPA 3WNPA 1VFUA 1UA3A 4UOZA 2WSKA 1GQKA 1XYZA 4LGXA 1NH6A 4GI8A 1E4MM 4J3SA 1HKIA 4ZENA 4H8VA 4UFKA 1QBBA 4UFJA 4PMUA 4CN1A 4GI6A 1H49A 3SCOA 4FLSA 3WF0A 2DQXA 1W9PA 3W6MA 4HA3A 1CEOA 2ZIDA 5BXRA 3PN8A 4PEEA 1JZ6A 2QPSA 3RM8A 3FN9A 2G3IA 3VUPA 3AICA 1TMQA 4D71A 1QI2A 1BFNA 1MXGA 1HJXA 3L4UA 3VM5A 3ARUA 2PF0A 4Y7EA 4BQ2A 4CCEA 3QOKA 1OIMA 3FXYA 3IJ7A 2CKRA 2WMJA 1JXJA 5A8OA 1ISVA 2DT2A 1EDTA 1EXPA 1J0YA 1E43A 1D7FA 5HPOA 4MAVA 4HMDA 1M53A 3GXDA 5EFDA 5FL1A 5ABFB 2IXUA 3K46A 1UKQA 1ESWA 4M29A 4PMXA 5A8MA 5C71A 1VRXA 1E9LA 3J7HA 1UD6A 1DWHM 5A6SA 1DTUA 3L4YA 3CH9A 3ZR5A 1I1XA 3BC9A 3IJ9A 4QLJA 1BLIA 4W93A 1CGTA 2VC9A 1L8NA 3VGDA 1NWSA 1P6WA 3RPMA 4HU0A 3ZT6A 2JEPA 5BRPA 2W91A 1R7OA 5ABFA 2YL9A 4PTXA 5DT7A 2EQDA 2EPMX 2A3CA 3AMCA 1XCXA 1H4PA 5EFFA 2J75A 2VX5A 1EQCA 4CN4A 1V02A 2Y2WA 3W29A 1SFSA 3CHCA 1Q6DA 3RJYA 1UWUA 3ZJ6A 1WDSA 2D0HA 3EDEA 4HPGA 4R27A 2VCBA 1V3HA 4L4OA 2WZHA 4JAWA 4PMNA 4UQCA 1J0KA 2B31A 1K9TA 1UD2A 1J0IA 2O9PA 4GZIA 3WD4A 5I0DA 2WC3A 3G6LA 6CGTA 3OLEA 3DYPA 2XYLA 1EIBA 5D9MA 2XVKA 1GQJA 1K9DA 3VDHA 2WMIB 4TVCA 1TUXA 2NSXA 1FOBA 5DFAA 1PX4A 5IFPA 5TD4A 3ZR6A 3AZTA 1GUVA 5JBDA 1XSIA 1GHSA 3CHFA 2ZUWA 3THCA 3I3DA 1MFUA 2DSUA 3ARYA 2W66A 4X0NA 5M17A 1MVYA 1C91A 1HIZA 3CPUA 4EAMA 1V02E 2G3MA 4AZ6A 2ZUVA 2XHYA 4AZ7A 1HF6A 1KCKA 2J7BA 2ZICA 1UKOA 4LQ1A 1MW3A 1GOQA 2UY2A 1W32A 2JIEA 4DUVA 4CD6A 2WNWA 4CD7A 3EDJA 1V3KA 2GK1A 2O92A 5CSUA 5D4YA 4MNKA 1XRVA 4EANA 1E6ZA 2DSWA 3VIOA 3THDA 4MNMA 4UQEA 1PAMA 1W3KA 5A6AA 1K9FA 2WANA 4UQAA 5A2CA 3WENA 3PZNA 5E0CA 1VEMA 3BLPX 4P7RA 3W24A 2JF7A 1UQZA 3AMDA 3UG3A 4M24A 1JF5A 1WDQA 3VNZA 1UWQA 6A3HA 4OOZA 3WNOA 1FA2A 5BXSA 3EDFA 3MMDA 4UNIA 2WZEA 4D6JA 2OYKA 3WSUA 3PZ9A 4D6DA 4TVDA 4AY1A 2WZIA 1VFFA 2YL8A 1W1PA 2V3EA 4N0RA 4FLRA 1TVPA 4AZGA 4Q7NA 3AMLA 2XGBA 2XIIA 1E55A 4E8CA 5AC4A 3FHAA 1FP8A 1UZ4A 2VMFA 1JYNA 3OLDA 5A6JA 2Q8XA 3MV01 4AYSA 2GJPA 2D0GA 1WP6A 1OWQA 1VB9A 2VNCA 2CEQA 1D3CA 1UWRA 1ZL1A 1IZJA 1D2KA 4URIA 2ZX5A 2WVVB 2WMHA 4W8AA 1W9UA 3QGVA 3T0DA 1GQLA 4UFMA 4AW7A 3N17A 4ATLA 3U7BA 4F9JA 1EHNA 1OSEA 1JD9A 2J7CA 3POHA 3WDPP 2XSBA 2WCGA 1FH9A 1E3ZA 4D6FA 4U31A 3RDKA 2XFFA 1XD1A 1CPUA 4NF7A 2VX4A 1UKTA 4P8UA 3N13A 3I3BA 4KRTA 5CJ5A 5BYWA 4KGJA 2C7FA 4GO8A 3AI0A 1OIFA 4C7FA 1HP5A 4UR9A 4EK7A 1ZU8A 2BVTA 2ZUTA 2JALA 1ZBWA 2UY3A 3AZRA 4M8UA 3VD3A 2GSJA 3VD4A 3SURA 4W7WA 3LPGA 1DEDA 1ZBKA 2OSWA 3QHOA 2XIBA 2ZUSA 3WD3A 1E4IA 4DWSB 1CTNA 3OIHA 2BY3A 1KQYA 3W53A 4BS0A 3S6TA 2OSXA 2OWXA 1CBGA 4PTMA 3BAYA 1JG9A 2CITA 1HL8A 5I79A 2X0YA 2QHAA 4MPKA 4PCSA 1CZ1A 4H04A 3W38A 1SMDA 4UZSA 3K1DA 1J11A 3PZTA 4CD5A 5JBEA 2YBTA 1J9YA 4QFUA 4AISA 1BGAA 3SUTA 1F4AA 4UQDA 2J74A 3A47A 1DWGM 1E56A 2Y5EA 3OB8A 3CUJA 3A6OA 3W0KA 3POCA 3ALFA 4PUEA 3LMYA 2A3HA 4WJXA 2VURA 1QHZA 3OBAA 1ISYA 1WPCA 3FHQA 1C8YA 5CGMA 2D3LA 2YDQA 2V38A 5A69A 1UH2A 4BQ4A 3MUIA 4JCLA 3SCUA 1ZJBA 3WIJA 3ZMRA 5D9NA 3K8MA 4JZ5A 1CIUA 4IM4A 1QI4A 1Q6EA 4FLOA 3HJEA 4AZCA 1G01A 1JF6A 1V0NA 2WKGA 3ARTA 4PMOA 4PMRA 3PTMA 3W37A 3APGA 1NM9A 1CWYA 2E3ZA 4FF5A 1WCGA 3T0AA 2D1ZA 3EDKA 4FMVA 4IISA 1EO7A
chains in the Genus database with same CATH superfamily
1E0VA 4HPHA 3W71A 3PA7A 4LCRA 4LCQA 2FQIA 2VN1A 1W56A 2PCQA 3KOZA 3H22A 4O1AA 1HKVA 3U7VA 4S3CA 1BHGA 3IIPA 1CYGA 1BEUA 5D8ZA 3P5YA 1DORA 4GZJA 4O4VA 2DUZA 2CESA 2ZXDA 3QR3A 2DG9A 4I7VA 4L6OA 4KWUA 5AZ1A 2Y8UA 4F2TA 3SIMA 4A8LA 4DBEA 1B3XA 5TQLA 2PRMA 5ABHA 3VO0A 2NX9A 4K8EA 3NYDA 2A2IA 1YEYA 5HMSA 1LLWA 3NRKA 2DSKA 2GWGA 2Q71A 4PMYA 4C6KA 5XINA 1XC6A 3WCZA 2IF4A 2XFYA 3EKZA 2C19A 6REQA 3L9CA 3AS0A 1AG1O 3TLQA 4WLCA 2OGYA 3PANA 1A3WA 4QAIA 3WLMA 4NHVA 1YIXA 1SSDA 2ZRWA 3C86A 3WUEA 1YADA 5T26A 5FKYA 3CB8A 4H8UA 3PUDA 1JQVA 3N15A 3ITGA 5A95A 3B8IA 3C2FA 2NUWA 3OZOA 1MXDA 1ISWA 3EEZA 3BV7A 4WOZA 3AIQA 3PVFA 1OT2A 1W3JA 3AMKA 4ZE5A 2C0HA 2CW6A 3IUHA 5DXXA 2XN0A 4C6BA 3EPMA 3OU8A 4FF7A 4G2DA 1CNVA 3SO7A 5AC5A 3ITVA 1V3MA 1U5VA 3OTRA 4JD4A 3VIGA 4R5EA 4CU8A 2VEIA 3IEBA 1CLKA 3RYSA 1HVQA 2P4VA 2FHCA 3ZQ9A 3IJ8A 3MWAA 1BTMA 4WSHA 4PGLA 3UPMA 3EY6A 3AXXA 3LDVA 4UTTC 3TWBA 3AFBA 4XG1A 4HU3A 3CAVA 2GJXB 4LJ3A 3W7LA 3CHDA 2C1IA 5LA1A 4UOQA 1W5MA 5AC8A 5I5RA 1LQAA 3LMZA 1S2WA 2CYGA 1LM1A 3NA8A 1V8EA 4ZPTR 4H6KA 2GFTA 3UETA 3UZWA 1DHKA 4O1FA 3VKBA 1CLVA 4A3YA 3TONA 3L65A 1XV8A 1H41A 3WK2A 1XLGA 5CLWA 2X2YA 4UIOA 4M82A 1IT8A 4LVFA 2YB4A 1ICSA 1A4MA 3IKDA 4L1GA 4MKVA 1FY6A 3KAOA 4ZCWA 1DXEA 3AHXA 5C2GA 2WJEA 2HE8A 2BG5A 1HL2A 3LCLA 1J79A 2F8QA 4CNOA 5AFDA 1W1IE 5AYXA 1K02A 5A2BA 3UGRA 3NPXA 3FK4A 4ZFCA 1Q2RA 2ZA1A 4ATDA 2FDMA 2YL5A 3LS9A 2V9DA 5CBJA 3PG9A 1OX4B 2WVUA 5HJYA 4LAZA 1LWHA 1E1FA 2XG9A 1IT7A 3T6CA 3WLNA 2E0PA 3O63A 3IK8A 1A7XA 2ETNA 4QCFA 5HK4A 5H8MA 4IG2B 2VR4A 4DM2A 3W75A 2DQWA 5HNUA 2XM1A 2RDUA 1U2YA 1ECEA 3GXIA 2ZA2A 2VELA 4F79A 3R79A 1J12A 1FH8A 2QPXA 1H09A 1V6TA 4JFSA 3S5SA 1XRFA 3WD0A 4NNBA 1POKA 2ISVA 1NOFA 2GUUA 3PB2A 3W2MA 4EPKA 3QVQA 3LERA 3T44A 3SRKA 3O7UA 4ODKA 4X61A 3ZVHA 4HU4A 4AD5A 1KV8A 2OFJA 2I5QA 3HQNA 1OC6A 1J6PA 5CPQA 1EKOA 1B3WA 4GWEA 3USBA 3O05A 4H6EA 1J01A 2UZ9A 3SB0A 3L4VA 2ZQ0A 3KAFA 1T0OA 2PDPA 1PZ3A 1BXCA 2PPGA 3QTGA 1R86A 3NCOA 1B57A 1O5RA 3XIMA 1VFHA 5CGQA 1GG0A 5HPCA 1GVYA 1RQEA 4C5ZA 5CEWA 2NUXA 5LNWA 5CPMA 4JHOA 3KCEA 2OKTA 1SGJA 2QCMA 1OT1A 4HN8A 1ZB5A 1CECA 4UTIA 1KM6A 1DP0A 3NZGA 2DZTA 3KZ7A 4LWWA 3O5EA 2GVLA 4GIEA 2J7EA 4MUZA 4JKKA 1RBLA 2Z1SA 1TPWA 4E4PA 3CLMA 4MJ2A 1R47A 4UTFA 1MW1A 2OT1A 1OY0A 3G8RA 1YQ2A 5JU6A 1PKLA 1XLDA 4ASTA 3GNOA 2JQXA 2UY5A 2FTYA 4N9BA 3M0VA 1SW7A 1TFVA 1EUAA 4F9DA 2QLYA 3H24A 1S2VA 1DHPA 2FMNA 3T8QA 5HT1A 1OCQA 3RU6A 4W5ZA 2OX4A 2FH8A 4OZOA 4X22A 4GKLA 1UD8A 4LB4A 1P0NA 3HV9A 2OZTA 2JBMA 4KCWA 4H7VA 1HQTA 3I68A 2CBUA 1ZAIA 1H0GA 1V0LA 1PPIA 3WYZA 3GDKA 2BV9A 4FA3A 4YVXA 5DRCA 4GNVA 1K03A 4OE7A 1PBGA 3AIVA 1RPKA 2BXVA 1PDYA 1UBPC 2PDIA 3HIJA 4TW6A 1FWWA 1JPMA 3CZKA 1KFKA 2PU0A 3BO9A 1U79A 4A35A 4XO7A 3PZOA 3QQWA 3EGJA 1KA9F 1J6OA 3CIXA 2HNEA 4P8VA 1V77A 2CZVA 4N9DA 2ZR5A 1QNQA 3AIEA 4Q8MA 3UQAA 1F40A 1N2VA 2HVNA 3A4XA 4NU7A 3VI2A 3BG3A 4O28A 1V6VA 4YTUA 1VRDA 4O19A 1QMLA 3GFXA 1TIWA 3OODA 2FTPA 2Y63A 4E2OA 4C7GA 2CWNA 5HQEA 3ONBA 4X9YA 3RXZA 4B15A 4DJFA 4PN2A 1XYAA 4Z2JA 2EXOA 2VCAA 4Q8NA 4O2TA 3S1GA 1VJSA 4DWSD 4AWUA 2JKPA 1O5XA 4IQCA 4JTKA 4NAFA 2Y89A 3LTYA 3KEHA 3VUSA 3OLGA 4GY7A 2CLPA 2OKOA 4FOKA 2AOSA 3M0JA 4GRSA 5EMJA 4QE4A 1NWRA 2YB1A 2W9MA 2C91A 3A9IA 4JX6A 2D23A 5HOSA 3TW7A 4Y9NA 3JW7A 3MZ2A 3AIRA 3FDKA 1E6XM 3TA9A 1NFGA 4AIUA 1AL8A 4DJDA 1J4RA 1A53A 3VKAA 4E8DA 3WLOA 2NV2A 3WL1A 1E6SM 4R34A 4KRUA 3KOXA 5REQB 2FHBA 4GABA 3G1FA 1LORA 1T8XA 3W7CA 1PIIA 4Q3MA 4B3ZA 3MHFA 3OGRA 4ERIA 1DJZA 3QPZA 1OABA 1C3FA 4XO6A 1XISA 1ECQA 4F40A 1MDRA 4NAEB 1P5QA 3WD1A 1KLZA 4QG8A 3M0IA 1XYFA 1AH0A 3B3DA 3RN6A 5DCDA 2HCVA 2X1RA 2P8CA 2V3DA 1GJUA 3MS8A 4ONVA 4HARA 3N04A 3PRBA 1ADDA 3WF2A 1W3HA 4PTDA 1A0CA 1FBAA 1WE5A 1EPVA 3GHTA 3RIKA 3BLLA 1FKFA 3OG3A 4RZBA 1WOAA 3UEQA 2RGMA 2Y4SA 1LUCA 4AYGA 1TCDA 3FYYA 1RJQA 1VJIA 2VKZG 4D6GA 2XIJA 4N19A 2ACQA 1JYXA 4MWAD 4NYUA 2PV2A 4PBEA 3PBMA 1SZRA 3JR2A 4BF9A 2WBKA 5K9CA 1VFSA 1HXVA 3GZAA 1W17A 3EMZA 2GGJA 3WFAA 3B8SA 4UFHA 3IV8A 4RNIA 2YOCA 4MLRA 3P5ZA 1QO2A 2GGEA 5H8UA 3VZZA 5CPNA 4YIWA 1UQYA 2BHYA 3VAWA 1HJWA 2XPKA 4UTKA 3NM3A 4GH1A 2DT0A 2VZTA 4ZO9A 1FKLA 1B3VA 3RLHA 4MMWA 4G6CA 3SAZA 4IOTA 3STPA 1W1VA 4XTDA 4WY0F 1F05A 5EMLA 2V8ZA 2F6UA 1FDZA 3SUUA 4NXKA 4CNUA 1TJ1A 2E67A 3AXMA 4HCHA 1RA5A 3LHWA 1SO3A 3LHTA 1YXCA 1WKEA 4FX7A 1ENUA 3LI1A 4I7UA 4O12A 5I3KA 4BQ5A 1P0EA 3E2RA 1GOOA 3NQDA 1DYSA 4IPIA 2JFEX 4W89A 3UJRA 4AHPA 4X2PA 4NJIA 3H12A 2DVXA 3PZGA 4S3EA 1TR1A 1TWZA 1DJYA 1J93A 1HNYA 2J4GA 4GIAA 3TYDA 3EDDA 4J27A 3DC0A 4UNKA 3CGNA 3TN5A 3A5FA 3QRHA 4O0KA 4O4WA 5FAJA 1Z7AA 1RBOB 5F2MA 4QJ3B 3CT2A 3N2TA 3NQCA 1GPFA 5F2GA 1UD5A 1WOBA 1FH7A 3HG5A 3A3XA 3W7HA 2QCFA 3P81A 1F3WA 1Q1CA 3OQEA 1VCVA 3KAHA 5JIPA 3FS2A 3BZGA 1KXQA 2DH3A 3FKRA 1TKKA 3KLKA 2IUZA 2VRKA 3MI3A 3BAJA 3V1PA 1EJRC 1PZ1A 4HU8A 4V2XA 3T2PA 4B5SA 4W9QA 1OM0A 4H41A 5A2AA 5JVLA 2V3FA 3M5VA 2PRHA 1MWOA 3KZPA 3G24A 4O18A 2QS8A 4UR8A 4F0KA 4LCSA 1T99A 3WH6A 2XP8A 1ZUAX 3NR0A 1NVMA 3VD7A 7REQA 1WO2A 2CCRA 1YE6A 4NZ1A 4PBFA 1XLMA 2AAAA 3VNIA 1XIFA 1BWKA 4X63A 1OK6A 3WH8A 2O0TA 1CXEA 3TSDA 3OGVA 3S2NA 4A3QA 1A50A 3E0LA 2QV4A 4Q6JA 3MMWA 3F5JA 1A5CA 1BG4A 4AF0B 3P67A 4JDYA 4DX3A 3CMJA 2YLAA 1H0IA 2DPEA 1I60A 3HM7A 1XQKA 3VIIA 1OX6A 3N29A 4I9TA 3USZA 3L68A 2CBJA 1ELSA 1P1XA 4HOWA 4CD8A 2HV5A 1ZY9A 2J78A 5LA2A 1XC4A 4H4IA 4ODLA 5BROA 4QZVB 3QY8A 5J6EA 2I1OA 2E5DA 5FJIA 4WXYA 3MMUA 3B9OA 4BF5A 1QASA 1A80A 2ZXAA 1W5OA 2FZNA 3UZZA 3ATZA 3WQDA 4KMQA 5FOOA 3CEPA 1F2JA 1SJCA 2QJMA 1TR9A 1W5NA 3S0CA 5GPRA 2R82A 1XD0A 2ALRA 5I2UA 4QTGA 2QDGA 3CO4A 3D5HA 4KW2A 4WKFA 5EMKA 3HZ3A 3ZIZA 1E6NA 5LZLA 1X6UA 1ZGDA 4U2ZA 5FEXA 4GYPC 2WB5A 3U57A 3PBGA 4DBSA 3GDLA 3B0PA 5KZMA 2PRLA 2ZDRA 4OWGA 3N2BA 1QNVA 2A85A 3P2VA 1LQ0A 3U48A 5BU6A 4UFLA 3KXQA 1FWEC 2VZUA 4GNJA 1RCQA 1DWIM 3V7PA 4IPXA 3PAOA 3W82A 3EAUA 1FHVA 4CQCA 5A3HA 4GX9A 3SGGA 2F21A 1NMWA 1HUVA 4O10A 3RGTA 1MUCA 3W2LA 1I8JA 2Y85A 1UUOA 3KAGA 3TTYA 1Q45A 3AMGA 1C9WA 4QRNA 4QIUA 4EWJA 2YA2A 5E0FA 3MSGA 2PTZA 3VIJA 2J13A 3MW7A 3UF9A 2X7VA 4IQJA 3S46A 4M6VA 2DJXA 3CHEA 1L1PA 3QF0A 4AEFA 1XGEA 2G4JA 2PD5A 2I5IA 2I7GA 1TWWA 4GFSA 5A1AA 1YDOA 3DESA 4UZUA 4YS1A 4HVXA 2DIJA 2Z28A 3MKVA 1GOIA 3JS3A 1OGBA 6TAAA 1CXKA 3R0DA 2BNJA 4L9ZA 4DIPA 2GK1B 4C6JA 1UOZA 3BK0A 3LQGA 4AZIA 2XP4A 3TTQA 3IS4A 3T9PA 1ZRQA 3C0JA 1QFEA 4OV9A 3C2YA 4O1CA 1HO4A 4YHEA 3MUAA 4NRSA 2VRJA 1DIKA 2XP5A 4UCFA 3EX1A 4K2SA 4U86A 4E3TA 3OVQA 1SJDA 3W1XA 3O5KA 2A1YA 1W26A 4GVHA 3GBEA 3WEZA 3N2MA 1TIMA 3VA8A 1N55A 1BF2A 4BF7A 3FEMA 2MANA 4V1XA 3PJXA 3C3UA 3DECA 1Y8BA 3KBWA 2KO7A 5HNNA 1GCYA 3JUGA 4E4FA 4BZYA 4NI3A 4TIMA 3TEVA 1OYAA 1BYAA 2OEKA 1GONA 2YDRA 3CAQA 3EX2A 1NQKA 4XZIA 3TCEA 1XPYA 4U84A 3QOMA 2Z2UA 3AIUA 3K13A 4JIPA 3RO6A 2FYMA 4RR4A 1MRQA 2VCCA 5U4NA 3KHJA 3WNNA 1R46A 3S6OA 4L56A 4DO5A 3G18A 3RM9A 1EOMA 3LQLA 2FJKA 2DZBA 2F7FA 5HNRA 1S38A 2ON3A 4AMAA 1TRDA 4A22A 4CVWA 3W83A 2PWVA 4S3FA 2J7GA 1ZBVA 4I5RA 1YXDA 1G4TA 3R4IA 1ZJIA 1Q66A 2X8RA 3GXPA 4Z2IA 4W86A 3WK0A 3RFWA 4AZBA 4Q7BA 4HTYA 4IJCA 2PWDA 4L80A 4RCXA 3BXWA 1OC5A 2D73A 4LX4A 1BRLB 3AAMA 3N14A 1XUUA 4LT9A 3TAOA 5FESA 2DW6A 3F1QA 4Z42C 2Z26A 3R10A 2XH4A 1EF2A 5G1TA 1O7AA 4S39A 3NDYA 1U33A 4D6HA 1WKYA 4K1GA 2OB3A 2PLKA 2FAPA 3U8GA 1SSGA 1PJ9A 1X1NA 4DEFA 3T0CA 3SGZA 2PC8A 2PI6A 2O4MA 4B5UA 4F0RA 4G56A 2BXZA 1QCWA 3QY7A 5CC7A 2VC7A 1E40A 4PZVA 2HROA 3B0UX 4S3JA 4KCUA 2RSEA 2QUMA 4ES4A 1QO5A 2ZX8A 4H7ZA 4BCEA 3SUWA 3PB0A 3FNDA 3IWPA 1XIHA 4XAFA 1PYFA 1B30A 1TCOC 1UH4A 3RFAA 4ZXOA 3W7RA 3C2OA 2AL2B 4Y96A 3O6AA 2REQB 2FZ9A 1Q6OA 1AK5A 2Z7GA 3QTPA 4BWLA 4MTVA 2D20A 1Y7VA 4FALA 5KETA 2RH9A 5D2VA 1OD0A 4RXFA 4C1NB 1JUBA 2DT1A 2B81A 3EKGA 4Q22A 1G4EA 2PGFA 1ITQA 3WBEA 3BMVA 1EQPA 2WKLA 2E25A 2QJHA 3RPDA 1FKRA 2VR2A 4HNOA 8TIMA 4UBPC 1ITCA 1GVQA 4R85A 1VIWA 1PBKA 3BAXA 3JU2A 5ABGA 1NOUA 2G5WA 4KIRA 2E4TA 3IAPA 2L5HA 3U6WA 2ODOA 4GI9A 2WLYA 3TQ0A 2WBGA 3O06A 5LIYX 1U1UA 3OP2A 1U5JA 2WKJA 1KRMA 3W74A 1ZQ5A 2WZMA 3BSGA 3OG2A 4FOJA 4HTBA 4WHBA 1PEZA 1W1ZA 1NFBA 3BOLA 4OOUA 2INEA 2VOTA 1QXLA 2GOUA 4N9CA 1NSGA 1FWJC 2CU0A 5GNYA 3GC5A 3NL5A 5LKYA 2OQYA 3TC6A 2GLKA 1PUDA 2Z1BA 1QJWA 2RUSA 4PE8A 1O5KA 4O53A 4EPEC 3OBKA 3QKEA 4U33A 1LCOA 3UWVA 3LGEA 1RH9A 4P7OA 1JFHA 4DZHA 3TP4A 2DEPA 4D1IA 1A4LA 1RBAA 3EWBX 2BXYA 1KR1A 4X0VA 3QW4B 7XIMA 1N8WA 4FNPA 3UCQA 3QGAC 4TW7A 3T2QA 4Z1DA 4LSBA 6REQB 2N87A 1TV5A 4U2YA 3W07A 3F2BA 2ZXBA 7A3HA 3DENA 3V0TA 1E44A 3C2EA 1XBXA 3W7DA 3NQGA 4DRMA 1SO6A 3NQ2A 2ZDSA 2R1KA 1US3A 2WW5A 4NILA 1VFLA 1KO0A 4ATWA 2HPMA 3UR8A 1EZ2A 2QCLA 2YCLA 2ZA3A 3GR7A 4AU0A 3SQLA 2Y7FA 4YTTA 4GG9A 5IFTA 3B03A 4GQRA 1OGSA 3CUZA 1UA7A 2XU2A 3NI6A 2GUYA 3S9YA 4IXXA 3Q45A 4ODNA 4ZPWR 4FX6M 1UMLA 4C6EA 2WM0A 4FR1A 3HPSA 2R1PA 5D04C 3FIGA 1PB0A 1ME7A 1UP3A 2GQ8A 3TTEA 1J18A 3DBNA 5HW8A 4CN6A 1RP9A 3R13A 1S5WA 3CTTA 5M3WA 1UYQA 3IJLA 4IPJA 3IK2A 4XD5A 2W6RA 1NP2A 1OG0A 5K9XA 2HK0A 3VCCA 3O5FA 3TDBA 5F2LA 1UPPA 3SECA 3C4UA 2HS8A 3GIPA 4PCFA 3M46A 1Q6GA 5D32A 3DKJA 2XWEA 2NWSA 1MZHA 1EFZA 4Y9OA 5HQLA 3KX6A 3LHUA 1VCFA 3KE0A 2D0FA 5CQ1A 3H2FA 2WNNA 3PNZA 2HXTA 1Q5MA 2VL4A 3SCNA 2OGJA 4QSHA 4G1NA 4RW3A 2WK2A 3G6MA 3P0WA 2VC6A 1ZJAA 1Z89A 3AUOA 2OCZA 3L23A 5C9XA 3HQOA 4AWSA 3BMBA 1LOQA 1NH6A 2NSOA 4J3SA 4ZENA 2IPWA 4PMUA 3LU2A 4CN1A 3IVTA 4GI6A 3SCOA 3PPGA 5T9CE 4DO6A 3P82A 2ACSA 5F4WA 5C2XA 1Q8JA 5E9XA 3RM8A 2HJPA 2INFA 3VUPA 3LCXA 3AICA 1QI2A 2BTMA 1BFNA 1MXGA 2LKNA 5J04A 5KINA 3W2KA 2PF0A 4AY7A 5CC6A 4I8DA 3PM6A 4O13A 1KM1A 1K8CA 3QOKA 1TWDA 1OIMA 5XIMA 1AW2A 3FXYA 3EEGA 1V7AA 3GR8A 1JXJA 4NXSA 1EDTA 4KEVA 3G3MA 3S2JA 4HGXA 1S3HA 4MAVA 3C0LA 2R8WA 3TX9A 4HMDA 5EFDA 7TIMA 2Z27A 3VNKA 3K46A 1UKQA 4M29A 2PC4A 1VRXA 4O11A 2W27A 1I2OA 3UPWA 1E9LA 3UNTA 4LUJA 1DWHM 2FDSA 3L4YA 3CH9A 5I07A 3LTPA 3GUWA 3IJ9A 3TW9A 2NQ9A 4I9JA 1LBFA 2PV1A 2EG7A 2JEPA 3ZVHB 4XD4A 3VNDA 5ABFA 2NVCA 3F4DA 2ZVIA 5DT7A 2OO0A 1HTIA 1TB3A 3AMCA 1XCXA 3PWAA 5M1TA 2VX5A 1EQCA 3KVLA 3W7EA 3W29A 4H9YA 1PXGA 2R24A 1UWUA 3ZJ6A 1P0BA 1WDSA 2PP3A 1NDYA 4HPGA 3URBA 5LIXX 4R27A 4L4OA 2NQ5A 4JAWA 3SBFA 2Z2AA 5FSEC 2GQ3A 3OO2A 1UD2A 2O9PA 2RFGA 1JPKA 4JQ1A 3UJ2A 2W3ZA 4A2RA 2WC3A 1PV8A 3PR9A 2QVHA 3DYPA 4IICA 1JVWA 2XYLA 1EIBA 3N2OA 5D9MA 5HWCA 2XVKA 3VDHA 1GRJA 3DH7A 2YZRA 3WQFA 1W3IA 3GSMA 4G7FA 4OV4A 4A2SA 2YYUA 5TD4A 2EG6A 1BKFA 4X2RA 3AZTA 2PGRA 2O56A 1KKOA 4IZGA 1XSIA 5E5CA 3M5YA 3ARYA 4JN6A 4FXJA 1HIZA 2G3MA 2Q09A 3OHIA 1I45A 3VE7A 2GVGA 4UDMA 3UWEA 1VPQA 1YDVA 4O14A 4Y2WA 3VC6A 4CD6A 3GAKA 4N2YA 1FKJA 4CD7A 4LFYA 4F48A 4LUTA 3N19B 3BANA 2PE4A 2O92A 1XRVA 3MVIA 1VBHA 1W3KA 4A3RA 2GL5A 1PWLA 5I3GA 4GE8A 3HURA 4GIYA 4UQAA 3WENA 3PZNA 3I7QA 4EXQA 5F4SA 3OZMA 4P7RA 3VFCA 1F8IA 1UQZA 3MSRA 2J27A 3DFHA 1JF5A 3VNZA 4MJZA 5LIUX 1EJ7L 6A3HA 2V2CA 4CQ8A 4OOZA 3E6EA 1FA2A 1IQ8A 4QHRA 5BXSA 3EDFA 1PO9A 3DX5A 3BCJA 4D6JA 2OYKA 2NVDA 4HA0A 4KEUA 3TA6A 4GC3A 2G95A 2WZIA 3UWUA 3BLFA 2GGHA 2V3EA 3O07A 4IX2A 4AZGA 1H7XA 1N1AA 4Q7NA 3QMTA 4DXKA 2XGBA 4L65A 2Z29A 2KAUC 3HFTA 3QMRA 2Q8XA 3MV01 4XZHA 4AYSA 3B04A 3RUBL 1WP6A 1AJZA 3VCNA 3WLJA 2CEQA 2OZ8A 1D2KA 3FLUA 3BPWA 1QW7A 3KLLA 1QPQA 4F0SA 3N3MA 4UFMA 5F4XA 4AW7A 2ZR6A 3NQMA 1BKSA 1I0DA 4F9JA 4IMCA 3MP3A 1FD9A 2J7CA 5D09A 3QQ0A 4Q33A 1FCVA 1FH9A 1Q6RA 5DELA 4D6FA 1DJXA 1DV7A 3LBMA 4NJJA 4CQDA 4NAFB 3P7YA 5BYWA 3DZ1A 3BOXA 1TQJA 1KM2A 1T41A 3LCIA 3S2LA 1HP5A 3W7OA 4EK7A 1T96A 1ZU8A 4Q4MA 3U4FA 3T05A 2BSLA 2UY3A 3ANYA 1XYLA 3CV1A 2PTDA 3VD3A 2GSJA 3SURA 1E0UA 3TN6A 3INPA 4O17A 1DEDA 2OSWA 3O0FA 1ROUA 4A8IA 1H7RA 3EZ4A 4JQ4A 2A7PA 4ZMGA 3W53A 4BS0A 3S6TA 1P48A 1VFTA 4LC6A 1IZCA 2OSXA 1TPVA 4PTMA 1NF0A 4HK7A 2CITA 1HL8A 1YPXA 2X0YA 4QR6A 4JTLA 1DBTA 1YPFA 3W85A 1J6YA 1DL3A 3A5VA 1NFPA 3W7NA 1GVRA 5HAOA 3EB4A 3PZTA 2YBTA 1FCQA 3QZAA 1PS9A 2A5HA 4L4LA 2J74A 4MZYA 1DWGM 2Y5EA 3OB8A 3CUJA 5A6TC 3LM3A 3DOPA 1R3VA 4PUEA 3LMYA 3E12A 2WSQA 3SRHA 2WSYA 5CGMA 1LUCB 5A69A 1ZLPA 5HJLA 4BQ4A 2X41A 3ITLA 1M5YA 4JCLA 3SCUA 5D05A 5EGRA 4ZB2A 1RAKA 3K8MA 4FXRA 3KCLA 1YW1A 4IM4A 1NDWA 3HJEA 2ZE3A 1JF6A 2RUDA 5BRBA 1IR1A 3PTMA 3W37A 4MPQA 4FF5A 2Q8ZA 3T0AA 4E2VA 2DJLA 4RW5A 4S38A 1EO7A 2JE8A 4PA8A 1H7WA 4CU6A 4OUIA 5FF4A 4DJEA 2QULA 3FAWA 4GYFA 2A3AA 4JFVA 1IWPA 1M7JA 3CV2A 5IHSA 1IE7C 3TOPA 1SO4A 5CPOA 2BVYA 4RK8A 5L9FA 5DY3A 3GE7A 4HHPA 2ZRYA 4P2VA 3ZWTA 3FVDA 8A3HA 3VX1A 4JY9A 2GQAA 2IPGA 4IIGA 4UTJA 3IIVA 1D3GA 3EWYA 3LPPA 2J9ZA 4NUWA 3S5ZA 5I78A 1FKTA 2P76A 3LXCA 2XTKA 5HWJA 3UJEA 1LG2A 4WY0A 2NQHA 2VWTA 5IHRA 4TQTA 1H1NA 4ZO6A 4WKAA 4YWIA 2ZVRA 1F4HA 2PDWA 4RX0A 2ZUNA 3TYBA 4XSMA 3QMSA 3NGFA 3SY5A 2WHKA 1FHLA 5F2IA 4B5XA 4HHLA 5H6HA 2TRSA 4PB5A 5LGZA 3NQFA 1GOWA 3MPGA 3WLSA 1KXHA 4FIRA 3IJIA 3GDRA 1DWFM 4IL2A 3WDJA 3HQPA 3LLXA 1MXSA 4FX8A 5BMWA 3K30A 3XISA 5I98A 4PUJA 4ICCX 2Y6ZA 5HATA 3F4NA 4DRPA 4AC7C 1FWHC 5EBUA 4PMJA 3L0GA 4E4UA 5JH8A 3K4AA 2CLEA 4B91A 1EC9A 2WPGA 1NEYA 3VDCA 4PMQA 4D6IA 3TW6A 3B9NA 4CQAA 1NY1A 2A6NA 3LI0A 2VI0A 4WJ8A 2XPBA 1M01A 4GQ0A 7REQB 3ZWSA 3C56A 3RMJA 3CGMA 3EPOA 3WG6A 1WUFA 4JQ3A 3UWWA 1N82A 4Z2LA 4H7CA 8XIMA 4Q8QA 1A5BA 3NVDA 3RILA 3V16A 5CAHA 2PN0A 1XHGA 2XIOA 2NQJA 4F3HA 2GJXA 4IT6A 3BSHA 2OWCA 3K4DA 1F8AB 4AVOA 2INZA 1QW9A 3W1QA 1E73M 1Z8AA 4WCJA 3U4AA 4ZXLA 1KTNA 2ZRXA 1WKFA 5HWNA 1PE1A 3CQJA 2BHUA 2GDUA 1AZ2A 1UOKA 3CQ0A 1ZSXA 2WMKA 2XSXA 3HTWA 5LXXA 4EKJA 3M0HA 3PZVA 1D7JA 2FGLA 1B9ZA 2EULA 3ZVIA 1V6UA 5FA5A 1VHNA 1JZ2A 1CI1A 2E1DA 1UWSA 2NT0A 4Z17A 3ARZA 3JYMA 1YDNA 4B2DA 3MUCA 4L72B 2Z1KA 2GPTA 2XZ9A 2YLLA 3BLOA 1HW6A 2OJPA 1FHUA 3VM7A 5AOUA 2P10A 4E6MA 3O2LA 4RL3A 3OVRA 3IKGA 3N4EA 3FAXA 2BWGA 4R9XA 4J28A 1GQIA 3B9DA 3TC3A 3FSUA 1SR0A 1XG3A 1XYCA 3PBYA 2C18A 4KEMA 1KRCC 1FKDA 3Q37A 1HKJA 1UUQA 2ZADA 4C6LA 4GH3A 3KL0A 4OECA 3BJFA 3ARXA 3EBVA 4QCEA 3W1TA 1QATA 1ML1A 4XAPA 1PZ2A 3CASA 4FI4A 4XWUA 3WLIA 3V0SA 5B80A 3W84A 3WEOA 1MNZA 1CDGA 4IH3A 2RJHA 5FJPA 4U3CA 1PIFA 1XLHA 4NY2A 2VRQA 3O5DA 2P0IA 1WZKA 4B4FA 3B97A 2Q02A 3M41A 3U2ZA 3IUIA 5BRQA 3WUGA 3PAJA 2C0AA 4PUDA 2X05A 4LYQA 2QNEA 5DQPA 3WN6A 5I3IA 4XUGA 3U3HA 1SJBA 2P8BA 4GGBA 2ZQVA 3H4WA 4BR1A 3TDFA 1ADOA 2RHGA 3B8DA 2WJDA 4HPJA 1EGZA 1H5VA 5IDZA 1WUEA 4PL1A 2PBGA 3D0CA 3UP8A 3WNLA 1G4PA 1FVPA 3CPRA 2WMIA 3BW2A 1KFWA 2QYGA 3MSDA 4Z1CA 1UR3M 1AQ0A 1M68A 1FWBC 4MGGA 4GUFA 1GWJA 3O6YX 1C8XA 1W1TA 3C3NA 3OOBA 4PRWA 3E5BA 5IXEA 2FTWA 3B0YA 3CIWA 5I77A 1FWFC 1O68A 3W1AA 4L9XA 3IARA 2FKPA 3O3RA 1UZDA 5HBFA 3VOHA 4KS0A 2CLLA 4ROQA 3STGA 4BJHA 2ZX9A 1EJUC 2DORA 3BE7A 4J1OA 3CL7A 3MI2A 4BQ3A 3W7JA 2RGLA 3GBDA 2FKEA 2FZ8A 1FCBA 2EO7A 4ZOBA 2QUUA 4P7QA 1W1B1 4JPGA 1K77A 4DBDA 3UZJA 4AD1A 5EMYA 3DC8A 1J5TA 3HOJA 3SQSA 1PTAA 3FCPA 1R38A 4K37A 1BYBA 4W4QA 5D9OA 1JNSA 3UERA 4Q4PA 2PLJA 4A8RA 2EG8A 3GDMA 1TWIA 2AKZA 2MNTA 4O0QA 1YNQA 4CD4A 2Y1HA 3AJ7A 2WJZA 3NEHA 4LVAA 2J7HA 4X3ZA 4V1YA 9XIAA 2RUQA 1NTHA 2DVUA 4B5NA 3Q58A 4NZCA 3WK3A 4DN1A 3CNYA 2WVVA 1L6YA 2YCIX 5H2ZA 3HG2A 5AYBA 3MBDA 3IHZA 4LVBA 2CXGA 2I17A 1DJHA 3SJNA 1A3HA 1FJDA 1XWYA 2YGYA 4RDVA 1JZ4A 4F0LA 4W8LA 1ZCNA 1AZ1A 5HR6A 2ZYFA 3NDZA 3AISA 2F61A 4I6KA 3NOEA 2QV5A 2ZUUA 4AB4A 4MM1A 1D6OA 2LLEA 3S2MA 1O12A 4RDYA 4GJIA 1IXPA 3UXIA 2GJRA 4QS6A 4UTTA 5T91A 1TCMA 1B90A 1L0PA 1EEXA 3WDHA 1KC7A 1MW0A 1EGMA 3UD6A 3ARWA 3H53A 2P88A 4QDMA 4LS1A 5BXPA 3OLIA 1ZS2A 1VS1A 1EPXA 4NZJA 4AD3A 4J40A 2PAJA 4ZB5A 5FI8A 4UMAA 5D75A 4REQA 1RCOB 1H7PA 1KCZA 5ABTA 4A3UA 1K1DA 4ZQRA 3CUIA 4DVOA 4ZTYA 2ASHA 1UC5A 3B7XA 4YYFA 4KKXA 4RV8A 3RRXA 1W5PA 2Q5AA 1BTCA 3W7IA 3WF4A 1OFBA 1S5NA 3W2NA 3W27A 4K8HA 3TZFA 3LGGA 5I3DA 2WLZA 4Q4SA 5CZSA 4EP8C 5FIPA 1EX5A 4EVZA 4POCA 3AZSA 4PCPA 1V6XA 3M6YA 4TU1A 4JTGA 4ML9A 3U5YA 2V3GA 4NZFA 2QDDA 3W1RA 3IIOA 3QZ6A 4A21A 4ITZA 2O9OA 2G8ZA 6XIMA 1A0DA 3ZT7A 1EYEA 1SMAA 2F84A 1XLAA 2ZZ7A 1XDMA 3KOFA 2GVYA 3GH7A 4HNNA 4DXXA 3N4FA 4KR0B 3QYQA 4IGMA 5HULA 2J8TA 1EC8A 3CXOA 3AYVA 3WBAA 3BAKA 3B8WA 1LROA 2Y24A 3TWAA 1GZJA 2V2DA 2E77A 3WMLA 1XLIA 2DT3A 4HBEA 4IUGA 3M0YA 4N02A 4JTUA 2ISFA 4PMDA 3NQAA 2UWFA 1OHLA 1F6YA 2MPHA 1KW1A 4LAYA 4HP5A 4ACYA 3A22A 2E6DA 2Z1XA 3VABA 2ZXQA 4MYXA 1NDVA 4Q4OA 3S42A 1S2UA 1XUZA 3KADA 4KIEA 4DY1A 4RNJA 1XIGA 1H2JA 5FEWA 4A8NA 4ADSA 3IGSA 4B3LA 2PP0A 2J47A 1THFD 2YCLB 3IV3A 4J2MA 2OLAA 4UOJA 4B9ZA 1MRAA 2A0NA 1XRSA 4W7UA 1RJRA 4HNLA 3WQGA 4B5TA 4XKMA 1QNSA 1BF6A 4KQZA 2V67A 1M5WA 1XRTA 4U4MA 4F8XA 3IJQA 2VT0A 2ZOXA 4XD3A 2QF8A 3E0WA 2WQPA 2VEPA 3TSBA 3ERPA 3N34A 3WQPA 2HDJA 3UU0A 3WFZA 5XIAA 4W7VA 4XAGA 1NQ6A 4WK9A 1WDRA 1X97A 3GNPA 4DJFC 4MKSA 5DMYA 2DZSA 5J5DA 2BFGA 1AD4A 3TXZA 5I09A 3WQCA 1UBSA 4IPPA 2XH2A 2X30A 2J7FA 5TAOA 3AS2A 3UWZA 2WHLA 2Y5JA 3PHAA 2VX7A 1XDJA 2I9EA 4JEQA 2PDQA 2E9MA 4DXVA 3SEPA 3UWYA 2BODX 3D3FA 1P0KA 2QCCA 4MSPA 2BGSA 1OCNA 3DYOA 3T0BA 2V30A 4KH2A 3GG1A 2UY4A 4DJDC 3LHYA 4M7SA 3PWGA 4IT1A 1C7TA 4DI8A 1G5AA 4GVIA 1QI3A 4JQ2A 1K4HA 3PULA 1GGOA 3ARVA 2YFOA 4G1KA 2AMGA 2FLIA 1X8FA 4FO4A 7CGTA 2PURA 1KNWA 3UFYA 3MZNA 4WDUA 3NL6A 5D2XA 2Y61A 1TPB1 4J4OA 3XINA 3MV11 3WLRA 4F2BA 5AYZA 2CBIA 4H8NA 4FLQA 6PTDA 3F03K 2UV8G 1GEQA 2C15A 2NUYA 4GUIA 2GDQA 3L4TA 1JNEA 2YDSA 5RUBA 1US0A 5M5DA 3MUY1 1TX2A 1RPXA 4RPPA 1RCXB 2GGIA 2YXGA 1IXQA 5IBXA 4K3ZA 4F66A 3NPVA 1HP4A 4XZWA 3A3WA 3EXRA 5AHFA 3T40A 2YDAA 2EPHA 5G2WA 1S5TA 3PC0A 4EWND 4KCVA 1GJPA 5EMMA 2PODA 1F76A 2EHHA 3E9AA 3N6QA 1TRIA 3VD9A 1W5QA 1RLCL 5H8PA 2QT3A 3RCMA 4QLLA 1EH9A 1QUMA 1TX0A 4BI5A 1DQWA 2PU1A 3IIZA 3DGRA 4S1FA 4W84A 3L0KA 4UTLA 2VWSA 4ZQMA 2BY0A 4JYDA 5C2CA 3C8NA 3O15A 3HU7A 4L6HA 4PSRA 2DUAA 1HJVA 1RLDA 3CYJA 4PYSA 3MDWA 1MO0A 4AQLA 2D9FA 4Q8TA 3ZJ7A 3L5LA 3CZ8A 1XGZA 1KLYA 3W86A 3PG8A 1G67A 5A8GA 1KR0A 3TU9A 3QKZA 2HXUA 3RR4A 4LNCA 4LAXA 1TQXA 4GKTA 2V5CA 1M7XA 2IKGA 3NQEA 4MDPA 3TXVA 2PDUA 2DSVA 1K7FA 4XISA 4DM1A 3PFMA 1XBZA 2YCKX 1O60A 4JTSA 4TX6A 1B4EA 3W25A 3EWDA 1CXIA 4S3KA 3ABQA 4H9ZA 2ZWZA 4WKHA 4LUTB 4TOQA 4O15A 4OBTA 2XVNA 3TJIA 2G50A 1FXPA 4TMBA 3CZLA 1L6WA 3L2LA 2CETA 2W62A 1Y0OA 5FSDC 2Y62A 4XAYA 1GYLA 4MKNA 3KVJA 4GVFA 4ACZA 1ADSA 3NTYA 2B0MA 3EMCA 2RQSA 2VUNA 2QMJA 6ENLA 4ADUA 1VBRA 2P3ZA 3H7VA 4XZ9A 1I2PA 3U2OA 3ZSTA 4LF2A 1KFBA 3I7SA 3S4TA 3N11A 4IT4A 4DHGA 3N2XA 1F3TA 1EHAA 3VIFA 4UTWA 1WKDA 3ZO9A 3WY1A 3WMCA 2O7QA 3WH5A 3TC7A 3WF3A 4J7RA 2Z6IA 2Y7DA 4GQQA 3VFLA 4TVUA 4Q4KA 4YPJA 3H2MA 3JXVA 2QCNA 3V36A 1UUMA 5E6ZA 3AHTA 3R0KA 4AUBA 1WB0A 3UPBA 3GD6A 4DNMA 3ID7A 1FX6A 3LRMA 4OT7A 1IXOA 3GTNA 2VFDA 2Y88A 1PHWA 4MADA 3DFQA 2A21A 3L2MA 2XFRA 2CLIA 2W61A 1P5BA 4UQ9A 1KGWA 4EAYA 5HNTA 5EKYA 4ZZ9A 2EKCA 3BJTA 1Z48A 3AWNA 1BL4A 3V75A 1EJXC 2PMQA 3VVGA 2F6XA 1J0ZA 2J8FA 4GVGA 3KAIA 4J3XA 3M6DA 2QW5A 2I5GA 2ZR4A 1UC4A 3KFTA 4TX9A 4W88A 5KSWA 1E6QM 3T07A 1B0IA 1Z6KA 1H61A 2OWWA 3BQ5A 2V5BA 1IZKA 3LCWA 2EF9A 4AD0A 1XPGA 3LYEA 4AC1X 1UZ1A 1JCXA 3QLDA 1PX8A 3G1DA 1EO5A 4TV6A 4AVFA 4AMCA 3T81A 4HA4A 1CW2A 1YE4A 5EL1A 4LYRA 5MF5A 1MNSA 2POZA 3AYTA 3WJXA 2BHZA 5T9BG 1XINA 3QR1A 4ZE4A 3F4CA 2BGNE 1PL9A 2R1LA 1A5SA 1JD7A 3H6OA 1NWTA 3OPSA 1AVAA 3B40A 2F9RA 4D8ZA 4GXMA 3N18A 2W4XA 3L4ZA 5CZKA 5HINA 3G1RA 3HPAA 1KFJA 2QPUA 3MY9A 1EYWA 4US5D 4U5IA 4L64A 5TF0A 3CU2A 2V5KA 5G4EA 4GXWA 4BY3A 3P8IA 3NFUA 3WUBA 3OVGA 2WYSA 4C1NA 4RE2A 1FAPA 4ECLA 5H1WA 2MLXA 2C1GA 1DIEA 1KFEA 1GW9A 3LV6A 3JVAA 2YA0A 4JY8A 3WKZA 3O5OA 4I3GA 3SCTA 5CJMA 5BU9A 2E8ZA 3T2OA 4DO4A 2H90A 4LXFA 1LDCA 2RDXA 3G1YA 4K7YA 4BK9A 2VGFA 1TV8A 1E6PA 1P1MA 2NQLA 2G0WA 4MF4A 4PTVA 1EWDA 2Y7EA 4HQVA 1P4CA 3F2CA 1NMVA 2FH6A 2NX3A 2VQTA 3VU2A 1OYCA 4FN2A 1X6LA 4TX8A 3UZXA 1LT8A 1LL7A 4DRIA 1E0TA 2QJGA 1V79A 2PDBA 4DROA 4NJGA 1Q4WA 2WCAA 3H8AA 4U28A 2C14A 1SYTA 4HT3A 4L7ZA 1KBKA 4YN5A 3M07A 4DH0A 3KWSA 8RUCA 3W88A 1BAGA 3RGCA 4YVVA 3GG8A 3UQIA 3KTXA 4LUSA 3WQVA 3EKLA 1UG6A 3QEZA 4WY0B 1XBVA 4LU0A 3NVTA 1H63A 5A6BD 1QK2A 4EPDC 3L21A 1NU5A 4ZPVR 3ARRA 2CC0A 1KT1A 2C13A 2YCJA 1B54A 1DXIA 3PUGA 4JNZA 3QPYA 2GVEA 1U30A 2F6KA 3WNKA 1VF8A 3R58A 3KACA 1LZOA 3ZLHA 1PIGA 1VHCA 1A5LC 4PRRA 2YW4A 2A3EA 1K7EA 1ROTA 3C5QA 5FF3A 1ISZA 1M6JA 3I7RA 2H8ZA 3WL0A 1O66A 2PZNA 4J4NA 1FFRA 4HSOA 1LLZA 1BVZA 1XXXA 1MQPA 1PZ0A 1R87A 1KWGA 3TMQA 4KGLA 5D9PA 2OT0A 1UMYA 3CIVA 2BB0A 2QXWA 3BICA 4AD2A 1EP3A 4R33A 5BXTA 1KRAC 1WZLA 1GVEA 2E6FA 1W8SA 2X2GA 1US2A 2IKHA 4LUIA 1EIXA 3DFOA 2D69A 2AAMA 1V3JA 4XAKA 3NSMA 1L8PA 3UXKA 2FIQA 2J6VA 3CGTA 3VOIA 2OX1A 4FB7A 3ARSA 4DUOA 4Z1YA 1LBMA 4NNAA 1OFAA 3TROA 1IV8A 1Q13A 4RDZA 3GVGA 1GOKA 3MSYA 1XYBA 5DF0A 4RDWA 3WLHA 3CMFA 3UA4A 3ZJKA 3ITTA 1I1WA 1PTDA 2JF6A 4BWLC 2OZ3A 1XDLA 1BYCA 4MB4A 3W70A 1HKWA 2V68A 3WNPA 1VFUA 4AAJA 2QZRA 4Y6GA 1GQKA 2JGQA 4ERGA 3WH0A 1I2QA 1E4MM 2VYOA 4H8VA 3AJXA 1E1CA 4WUIA 4FLSA 3WF0A 2DQXA 2M1IA 1MMFA 2DG3A 3W6MA 3W7GA 4XVEA 3FSTA 4CCZA 4HA3A 5BXRA 3U0HA 3S1XA 3FYPA 3NQ8A 1JZ6A 2HK1A 1FKXA 4OVXA 5L6UA 2G3IA 2DY3A 1JPHA 1C9DA 2Q3RA 1HJXA 3L4UA 2XISA 1EA0A 3VOJA 1KBIA 3VOGA 4AHOA 2WMJA 1EB3A 1EXPA 1E43A 3MVTA 3SR7A 1VYRA 1M53A 1K4GA 3GXDA 5FL1A 4C6MA 3AC0A 3RU8X 2JZVA 5C71A 3ME3A 3BOFA 3EOEA 4ZSUA 7ODCA 3ZR5A 4PTNA 1BLIA 1ZNNA 3RG6A 4B5VA 1NWSA 1TV4A 4WDXA 4KEZA 4MFDA 5K4ZA 2A3CA 2QUTA 4LBUA 2CFFA 2J75A 3GTHA 2ATMA 1GKPA 3KCOA 2PWUA 2MNRA 3CHCA 3RCYA 2QQ6A 2D0HA 1JVNA 3EDEA 1BXBA 4PMNA 1J0KA 2ZZ1A 4GZIA 1GKQA 2HRWA 3UZ5A 4QEEA 3PRAA 4IGNA 1A5MC 4GJJA 2WMIB 5CBBA 3B4YA 3BVJA 1UP2A 2FVMA 4IFOA 3WJSA 3MP5A 4HSNA 3TNOA 1DXFA 3P8JA 5BWAA 5J5RA 5JBDA 1GHSA 2XN1A 3P61A 3I3DA 3W1LA 4HB7A 4IMDA 1N7KA 3LOTA 1C91A 3TZNA 4AZ6A 3WLTA 2XHYA 1XX1A 4AZ7A 1XJBA 2NVAA 2CLMA 3LGDA 2J7BA 3TIMA 4FAPA 3TV8A 1WV2A 2UY2A 3W3OA 1W32A 2JIEA 4DUVA 1IHIA 1LYXA 4QITA 3FA4A 4FS9A 3EDJA 1ME8A 2Z00A 1V3KA 2ISWA 3E0VA 1YYAA 5CSUA 5D4YA 4MNKA 2WO5A 1E6ZA 2ACUA 1PAMA 3R1ZA 4GQGA 4RZ6A 1VR6A 3P74A 2J9XA 3EOOA 5E0CA 4RKAA 2JF7A 3AMDA 1WBJA 3UG3A 4M24A 4YXGA 3N9SA 4GOAA 4RJEA 1DQUA 5GJNA 3OQ8A 3MJYA 2NX1A 3PS7A 1F73A 2IMRA 4LBRA 3E96A 3LHZA 4UNIA 1XQLA 1T40A 3NL2A 4D6DA 4TVDA 3ZYZA 2QGYA 3T42A 3GNNA 1AODA 2YL8A 2NV1A 4DF0A 4FLRA 4KWWA 3QPEA 3AMLA 4J5NA 1VH7A 1E55A 4YMZA 4E8CA 3FA5A 5AC4A 3A13A 2VMFA 4Q7IA 2CWXA 3GFZA 2Q3OA 1F6PA 1OF8A 2VNCA 4RUBA 1D3CA 4URIA 2WVVB 2WMHA 3KBJA 4W8AA 3WLQA 4L3NA 4H1ZA 1TREA 3W22A 2Z24A 1TPEA 3BGGA 4ATLA 1TV3A 3AXKA 1H50A 1PTGA 3POHA 3D47A 1ONWA 3QYSA 2JKAA 2XFFA 2YZ5A 1XD1A 2RUCA 2VX4A 4AWTA 1UIOA 4LAWA 2PDLA 3EA3A 3L7RA 1O5QA 1D3HA 3I3BA 4KRTA 1OG6A 1YKWA 1W1A1 2C7FA 3TKFA 2FMOA 4C7FA 3I65A 3NPWA 5IM51 4UR9A 2PDMA 3SN0A 2BVTA 3RK8A 3LD5A 5G1MA 1YDYA 4YU1A 3TYUA 3VD4A 3M5ZA 4M5PA 4ZQOA 2PTWA 3RLGA 1TYGA 2DU2A 2ZUSA 3WD3A 3MBFA 1DTNA 4LAMA 4LOCA 3KVKA 1CTNA 2PF8A 4REQB 1YW5A 4LY8A 4LYKA 1UZHA 4GGHA 2PTYA 3BAYA 4JIHA 4WXZA 1T11A 2LJ4A 3ITXA 3P0XA 4PCSA 1QR7A 1K70A 3W38A 1SMDA 4ENLA 3PJWA 2VHLA 4CD5A 5JBEA 1WDWA 1BGAA 4HBOA 4DAIA 4UQDA 5KMYA 2ZZ6A 4QXIA 4GBDA 4XK2A 4Y8FA 3RRAA 3POCA 1LRQA 2A3HA 1T6MA 4WJXA 1QHZA 3ANVA 4DELA 1ISYA 1WPCA 4Y8EA 2D3LA 2V38A 4A05A 4GA8A 4ILSA 2PDHA 2HWGA 1U22A 1DPMA 1U1HA 4HNVA 3WIJA 3NYZA 1H51A 1SZNA 5D9NA 2PDCA 2DZXA 2XINA 3V1HA 1SVDA 3Q4DA 1EP1A 4JFMA 1V0NA 2WKGA 4YNGA 4PMRA 1I9CB 1UWAA 3APGA 1NM9A 5BZAA 2QDHA 2VXNA 4D2JA 4R7OA 4O8RA 3CAKA 4O50A 5TIMA 1G7VA 3G22A 2YFNA 2VP8A 2CLOA 2X0HA 2WSPA 4W9PA 3QLLA 2PDGA 3PPFA 4Q8UA 1YLVA 2H6RA 2GOKA 3ECQA 4DPPA 1B2YA 3KABA 4DB7A 2CXEA 4MY1A 3K1GA 2ZCGA 2F2KA 3HMJG 2PBCA 4HYRA 1I0BA 1TMLA 1LG1A 1TUFA 3TQKA 1TVNA 3SSZA 4PUWA 1A5AA 2PTXA 2Y8VA 3AOFA 5FF7A 3AO0A 4DF1A 5LHFA 3H70A 2R1NA 2V82A 3E5PA 3G3DA 4PSPA 2XPAA 1EZWA 1JR1A 4GINA 4R88A 3BMXA 5AKQA 5E1QA 1QI0A 5C54A 3S8HA 3PNUA 4FNSA 1QHPA 1GOXA 3OA5A 4C02B 4MNJA 1UR1A 3PUEA 3V0UA 2WOQA 3HG3A 5HKGA 4CLMA 5A6BA 3LENA 2I56A 1JPIA 2VTFA 3TJLA 1R0MA 5BCAA 4AXNA 4N4QA 4H83A 1KD0A 4DYJA 3CPGA 3C8FA 3FVMA 5A6MA 3GVQA 2FFCA 2J9YA 1NAL1 5C6MA 4O54A 4V28A 4GMEA 3IVUA 1A47A 4KFPA 3P14A 1YNPA 3TTSA 5CG0A 1E0XA 1KB3A 2XVGA 3KTSA 3A4JA 1F7BA 3LSBA 4DRJA 1G9HA 2VCDA 1JDDA 3RX2A 3S1VA 3UZYA 3FX4A 4ODOA 3MYPA 5KZDA 3GAYA 2LGOA 3W26A 3PPHA 3TYEA 2EJ1A 5EBAA 3KBMA 1A3XA 2G3NA 1JI2A 1XF0A 2PLMA 1EXBA 2H3DA 2JIWA 1OFPA 1DQXA 3SN4A 2QMKA 3EA2A 4HHMA 1KFLA 4HN4A 1JPDX 2IW0A 4Z0JA 3BLKA 1I6NA 1GVFA 4FXFA 2Z25A 3WBYA 1CGYA 3W4RA 3LLFA 3KOYA 3RJXA 1XLCA 1XKYA 3URNA 4IIDA 3VINA 2NWRA 3B0VC 1LOSA 4CGTA 1GVIA 2WNZA 1OFOA 2ZFAA 2DVTA 5CSYA 4JFTA 1QAPA 3T1GA 2NLIA 1X39A 1H1ZA 1JULA 4GIRA 4PFHA 1BGGA 2F4EA 5KZ6A 2D2GA 2OR2A 2OTDA 3GM8A 1MZRA 4QDPA 1XLBA 3B8UA 4W9OA 2M08A 2EJAA 2YX0A 3OZYA 1RK6A 3S2CA 4K38A 2FZMA 3T4CA 3NIYA 5DY2A 3V4BA 2Z0IA 4MY8A 2PPOA 4TUFA 3LZ5A 2X16A 2PDFA 3W1UA 1IXNA 1O94A 4PULA 5CKSA 1GZGA 3GQYA 3SM0A 1V08A 4S23A 4QQUA 5I02A 1IGWA 3HGOA 1B31A 5BNKA 2ISDA 4LVGA 2VFFA 2VFIA 2RJGA 3PBVA 3UJFA 1KBBA 2B7OA 3LLDA 4IPLA 4IF2A 4W9TA 1QPKA 4DJEC 1M3UA 3GXTA 3ABSA 3UESA 4M19A 5AHLA 3TAKA 1QPRA 5I03A 1BWVA 4IQDA 4GY1A 3CS2A 4DZ2A 4KBXA 1E5NA 3QHNA 3N3TA 2AGTA 3ITOA 1KGUA 1XICA 2D22A 4BA0A 3S5YA 1W9XA 2CPUA 2X1IA 2YW3A 3GC4A 4PMZA 3P60A 3WJYA 1RA0A 2QF7A 1R8LA 3NXLA 4KWSA 3ZM8A 3NGJA 3PZUA 4CQ9A 3BW4A 4HZMA 5C70A 2CBVA 4DWDA 1OADA 1GOMA 2V0TA 1C8VA 4AY8A 4W87A 3VKKA 2V5JA 4A6GA 5I6SA 5GJPA 2J62A 5LIWX 4M1RA 4UXDA 1TE6A 5GNXA 4M6UA 2PPPA 1MEWA 3GUGA 3R43A 3WNMA 4YLWA 4PBGA 1UROA 3E02A 2KGJA 2OQLA 5CGTA 5I06A 1JJKA 2CZFA 4H9MA 4Z08A 4ZSTA 4HMEA 3TCSA 3MCNA 2MLZA 3U9IA 2Y8KA 1QVBA 3R6IA 3CUGA 3E2VA 4HNUA 4B9YA 4I6VA 2V6AA 1OJXA 3PZIA 3QJAA 2PA6A 4GX8A 3KZSA 5HUAA 4D72A 4PTWA 1EBHA 3NJ3A 5HW6A 4J9JA 4JN8A 4ACZB 4I90A 2PS2A 4NT0A 1EC7A 3O5IA 4NKCA 3GNRA 4R0XA 3CH0A 4US6A 4BEQA 2GZXA 4DUWA 3ITCA 2IKJA 3I6RA 3C0QA 3MDYB 4JEJA 3DHUA 4FAMA 2IPFA 1BYDA 2EPKX 1ZP4A 3CUFA 4DRSA 3I6TA 1HVXA 1B3OA 2P0OA 3JZUA 3MJMA 3UVIA 1UR0A 4GCAA 3UJSA 1E4LA 3TC5A 3KRBA 3ATYA 2J88A 1G69A 3EX4A 4XBKA 3DCPA 5F1VA 4GXPA 1M1BA 4DYKA 3H4XA 1HT6A 4NVTA 1IT0A 4TTUA 2C6QA 4QSFA 4S2CA 1UKSA 2AKMA 2FFIA 1GJWA 3MCOA 2CERA 3WQ8A 1YPIA 2NW0A 3V5CA 1JDEA 2R9RA 5DEZA 2Z7KA 1PWMA 4XKYA 2VDHA 1RR2A 4OQVA 2WAGA 1H11A 3QV9A 1QOXA 1GNXA 1LBLA 4LC8A 3LV5A 4JFUA 4BI6A 1EA9C 3C61A 1JNTA 4DJFD 3RHGA 3OZPA 4H9TA 4RPQA 4XSLA 2FJUB 3WBWA 4ZFMA 5ENLA 1E4NA 5FJRA 1H7OA 2UBPC 1J96A 4U3AA 1HL9A 3M0LA 1EJTC 3DXIA 5HWBA 4P7LA 5I3HA 2W63A 4MY9A 2SFPA 3WFLA 5I7GA 2HBXA 5HANA 1EF3A 3NSNA 5IDIA 1EL3A 2QUNA 3BAWA 3MKKA 3HGSA 5ECUA 3VIMA 1FKBA 3M0XA 3EMQA 4B16A 1P7TA 3R25A 3S5NA 4DJDD 5IOBA 1OINA 2DW7A 2ZQSA 2ZZ5A 2W92A 2FPTA 4L1WA 5AHIA 3G0UA 1HJUA 3F5KA 4Y9AA 5E6YA 1F9CA 3M44A 4BEUA 4L6DA 3EB2A 3N25A 4ML4A 3PF3A 1HGYA 5E0KA 4ODMA 4JIIX 1Q85A 3COTA 1SUXA 1PCWA 1FWSA 4UTMA 1N8FA 3KDNA 3WO8A 4D6EA 4J3ZA 5B7YA 1BPLB 3DFTA 4DWSA 2XJ7A 3MP4A 2EAWA 2CNCA 1JZ3A 2NZLA 3GH5A 4GZEA 3P62A 4NJKA 5D02A 5GJMA 1QWKA 1R5YA 4DBUA 3NZPA 3NQ6A 5BOFA 1ZBCA 1ME9A 1V5XA 3WLLA 1HXJA 3RAOA 1YBQB 2XN2A 4TO8A 2E09A 1XCFA 3W23A 1WZAA 4W85A 3KRSA 1MYRA 4L4PA 3ZS4A 1WXZA 1FQ0A 3IUDA 4LYPA 4FNQA 3TQPA 1AJ0A 3OGSA 1GORA 2XSAA 3ZT5A 5KITA 5SWUA 3W6YA 3NO1A 2Y0FA 1ICQA 3I4KA 3UR7A 3APYA 3KWXA 4LVDA 2ZRUA 3DN5A 1QZ2A 3MHUA 3MC5A 2JGYA 4ZL1A 5LGXA 1LF1A 4P8WA 1WAWA 5BXJA 1JZ7A 3LUOA 2D2OA 4IP7A 4R53A 3S1WA 1RZMA 1S3TC 3W81A 5AYIA 4QG9A 1OF6A 4MB5A 1EJSC 3SY1A 4RZ5A 4I9AA 3GTYX 3ZSSA 3LHVA 4QG6A 2ZUMA 5AVNA 4JFIA 1YNYA 4LUSB 4YL2A 5HMEA 5DMNA 2WVTA 1OFRA 3KS6A 4MDOA 1FCUA 4CCCA 3IIXA 2PCEA 3UYIA 4S2BA 1POJA 1RVGA 4LV9A 1UASA 4CQBA 3E38A 3KRZA 1JFXA 3IRDA 2X1UA 4MWAA 3DGBA 2BASA 2HQAA 4E2BA 4WOQA 1C9HA 1SQ7A 2NXHA 4MGVA 5F1UA 1Q6CA 4HMNA 3GH4A 5K2ZA 1Q65A 1XSJA 1E15A 1OZQA 4DF2A 3RX4A 1WNOA 3VTRA 1TPFA 1WXYA 5CPSA 2E40A 1CGWA 3GHUA 1L2UA 4WGHA 3HPXA 1R9YA 1SFTA 4Q32A 4IIEA 3DKLA 3O5QA 2FZBA 3O9NA 4L5ZA 4H6RA 3WD2A 2RAGA 1B5TA 3AWOA 2E5BA 1Y5WA 4MWAE 1BSIA 1LP6A