2PI6A

Crystal structure of the sheep signalling glycoprotein (sps-40) complex with 2-methyl-2-4-pentanediol at 1.65a resolution reveals specific binding characteristics of sps-40
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYTFANISNNEIDTWEWNDVTLYDTLNTLKNRNPKLKTLLSVGGWNFGPERFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSFTLASSKTDVGAPVSGPGIPGRFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLAEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tryptophan as a three-way switch in regulating the function of the secretory signalling glycoprotein (SPS-40) from mammary glands: structure of SPS-40 complexed with 2-methylpentane-2,4-diol at 1.6 A resolution.
pubmed doi rcsb
molecule tags Signaling protein
molecule keywords Chitinase-3-like protein 1
total genus 128
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2007-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2pi6A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2pi6A01
5E6YA 4PTWA 4GO8A 4N42A 1CTNA 2VX7A 2J75A 4PSRA 3IANA 1MFUA 1WZLA 3VKKA 2X09A 3GNOA 2OSYA 1MWOA 3N04A 3WEZA 1JI2A 4PMOA 1VFOA 2XGBA 3UCQA 3BCDA 4JHOA 4UNIA 1VEMA 3MMUA 4IPLA 4W8BA 4UFKA 3N11A 1JFHA 3MUIA 4W89A 5EFFA 1XYFA 4AC1X 5FL1A 5D9OA 1V0NA 2CXGA 3AMCA 1UWQA 5JIWA 2WHMA 2QLYA 1DHKA 3DECA 3EDKA 4M1RA 1EDQA 4ATLA 2JE8A 3OGRA 1J0YA 1R87A 4AIEA 1I1XA 2WVSA 5LA2A 4D6HA 4AD5A 1L0PA 1J11A 2WMGA 1ISWA 4MDPA 1C8XA 2VTFA 2WZEA 2YL8A 3AIUA 3NDZA 1XCXA 2YL6A 4M80A 3T0AA 4GPNA 1EA9C 3VD7A 1V3KA 4BQ3A 2VC9A 2XJ7A 1MQPA 2GJXB 1OIFA 1W32A 3AIEA 1EXPA 5BCAA 4TUFA 4AZCB 1GOOA 3WD2A 3WD1A 1ODUA 2WC7A 1UD6A 1UR2A 1HVQA 1V0KA 3L4XA 2C8NA 5GNYA 2X2YA 1GONA 2E9BA 1M03A 2E40A 1JYVA 2ZXAA 1ISXA 4W7WA 3RDKA 3WDPP 3VX1A 4J3SA 2GVYA 1B30A 3WD4A 1KFWA 3N12A 2A3HA 1OGBA 4OOZA 4DUVA 4IM4A 4U3CA 2ZUMA 3FY1A 4XZWA 3SUVA 2E9LA 5BXSA 1UD3A 2D0FA 5A8OA 4TTGA 1PX8A 4OBRA 3WFLA 4P8XA 4D1JA 5CLWA 1VEPA 3VNYA 4PUDA 3IAPA 1UG6A 4H8UA 3AFBA 1J12A 2EPKX 2CCRA 1XCWA 1WKYA 2YIHA 4W7UA 1BF2A 1C90A 6CGTA 3VOCA 1CXLA 2O9TA 5JBDA 1JF5A 2Y2WA 4J3TA 3WUEA 3DYMA 1OINA 3T2PA 1MQQA 2X1IA 1WPCA 1OCQA 2A3AA 3TTSA 3HN3A 1TMQA 3WMCA 3AS0A 2UY2A 2ZX7A 2XGIA 1VBUA 2O9RA 3HMCA 1XH1A 1E0WA 3VVGA 2VZVA 4Q7NA 4PUEA 3DYPA 4C7DA 2DSUA 1LLOA 2J78A 3VINA 4AMCA 3AS3A 4OBSA 1LL7A 4TVCA 3AOFA 2EPLX 2DT1A 1J0IA 2BFGA 2W66A 2EO7A 3AIQA 4W88A 4BQ5A 1K6AA 2G4FA 4GI8A 4GZIA 4IUGA 5CPTA 3EMCA 3GBDA 1WE5A 2VZSA 3CMJA 1WCGA 4HA1A 3AIBA 4XX6A 1CLVA 3WSUA 3OG2A 1SR0A 1SMAA 2G41A 3WQWA 2CEQA 2D24A 2ZUWA 1YQ2A 1W9BM 2CNCA 3PZIA 3WQ8A 3GXIA 1EOMA 1G1YA 1TR1A 4DUXA 4UOZA 2VR5A 1OGGA 2WHJA 2XG9A 3CTTA 3DYOA 3CZ8A 1NOWA 2BS9A 2D3LA 2J47A 2XVPA 4S3KA 3SCOA 3U5YA 1HKMA 2ZWYA 4A3YA 3ARTA 3PZMA 4HOZA 5JIPA 1JL8A 5A95A 1XV8A 1M04A 3TOPA 2J7GA 3AS2A 3PBGA 2QF8A 3AQUA 4ACZA 2JF6A 2DSKA 3UETA 4HMEA 5CQ1A 2WW5A 4QCFA 2YLAA 2J7BA 4GQQA 1O6IA 5I2UA 1KCKA 1JYWA 4QP0A 4E2OA 4PTMA 4W8AA 3SCSA 1GVIA 1J0HA 1BPLB 2D1ZA 1PIFA 2JEQA 1OT1A 3SCWA 5A1AA 4ACYA 2G3NA 1I75A 3WEOA 4AY1A 2J62A 2QPSA 4CCDA 3VD4A 4TX8A 3IJ9A 1UUQA 1BG9A 2EPOA 2QV4A 2J7CA 3AIRA 4ZE4A 2ZXQA 3GNPA 1JAEA 3FHAA 3TTOA 3OGVA 3OIHA 1DTUA 4CD8A 2J74A 4JFUA 3ZT7A 2WK2A 3LMYA 3M46A 1GORA 2GJXA 1JDDA 4TVUA 3T0BA 1UQYA 2CHNA 3CUFA 4EE9A 2DIEA 3VGHA 1GQLA 4UFJA 4P7RA 3MSDA 1XYZA 1NP0A 2J25A 3VIOA 3BMWA 5BXRA 4MB5A 2DT3A 1NOUA 3TONA 4UQEA 3MUY1 3EBVA 3W28A 5I3DA 1TZ7A 2F2HA 4TOQA 4B16A 3G6LA 1C93A 1KGWA 5GNXA 4CU8A 4JCMA 1E9LA 2E8ZA 2OWCA 3I3DA 1H2JA 1KBKA 4JL1A 5A94A 1UR0A 2XFFA 1E43A 1QHPA 4E4PA 4JIEA 3AHVA 8A3HA 3VIMA 1ISVA 2F61A 2VT0A 3W4RA 1V02A 1HL8A 1W9DM 2VRQA 3WUGA 1OGSA 1WO2A 4JKKA 1QPKA 3OB8A 1ZBVA 4UQCA 1SYTA 4Z2GA 1VFUA 1NWSA 4PMZA 1X6LA 5ABFA 1WZMA 2Q8XA 3OLIA 5AYIA 1BVZA 4PCSA 3WEMA 4AZBA 4W8LA 2DSZA 1J18A 3B9AA 3ARVA 4HZ6A 3SUUA 3VIPA 2CERA 1J0ZA 1WDQA 2GDVA 1BVNP 4NF7A 2J7DA 1N82A 1QVBA 5ABFB 1PX3A 1TA3A 2BV9A 4GXPA 3WMSA 1K9DA 3DHPA 1FFQA 4DWSD 1J0KA 1E6XM 4MB4A 2GSJA 6A3HA 3ZQ9A 1W9XA 5IFTA 3O9NA 3UERA 2Y8KA 1B3ZA 1TE1A 3L4TA 2UY3A 4DWSA 4HP5A 1JXKA 1ZBWA 1G94A 1UWUA 3N1AA 3GH7A 1LL4A 3L4ZA 1CXEA 1QNRA 4BF7A 3PZOA 1HNYA 1EDTA 2FHBA 4AXNA 5M5DA 2PC8A 4CD6A 4HZ8A 4DUWA 4GI6A 1E6RA 1HVXA 1V6XA 1CZ1A 2VCBA 3VDCA 1E73M 1EQPA 1XC6A 1O7AA 2ZWZA 3AICA 3VD3A 3ZM8A 5IFPA 4AZIA 3K8KA 4UR9A 1BYCA 3SCVA 3POCA 4L4PA 3ZO9A 1JAKA 4URIA 4TTUA 5D9NA 1HL9A 5A6BD 1XSJA 2XYLA 1WNOA 1HKIA 1FHDA 4OIFA 1B1YA 2YDSA 2BHUA 3CH9A 2D22A 4B3KA 1BSIA 3CHEA 5CPQA 3M07A 4FLQA 4PMUA 5EB8A 2DPEA 4A3HA 1D3CA 2W91A 1JZ5A 2GJRA 1H41A 2QMKA 2WCSA 3BAXA 2WBGA 3KL0A 1Q6FA 1JZ2A 1TA3B 3AJ7A 3O2LA 2WVVB 3ZSTA 1J01A 1UWSA 2CITA 1PBGA 3S6TA 3ARSA 1ITCA 1UOKA 3K8MA 2YL9A 3MV01 5D4YA 2VZUA 3WN6A 2NW0A 4CCEA 5A6BA 1JI1A 3ALFA 1LJYA 1M53A 4UQBA 3U7VA 2YBTA 1OT2A 1DEDA 4PYSA 3CUHA 4GIAA 4KGLA 2D0HA 3MUAA 2OWWA 2V3GA 1R86A 3T2QA 2WYSA 3AYSA 5JUVA 4ZXLA 1UR8A 1KWKA 1W1YA 2DH3A 4FK9A 2XIIA 3VGEA 3AISA 5CG0A 5CSYA 3SCNA 1NOFA 1KBBA 2VZTA 4M82A 4J3XA 1E71M 2E4TA 1MW3A 5TD4A 1V0MA 2ZE0A 4MJ4A 1MYRA 5HOSA 2VCAA 1HP4A 4U5KA 3GH5A 2CPUA 4LXFA 5ABEA 3A4XA 5M3WA 5FD0A 4MNJA 2ZIDA 1JD9A 1WDSA 1VJSA 3FN9A 4QLJA 2WMKA 2XWEA 3VIJA 1JG9A 3SUWA 1NWRA 3DHUA 1UR9A 3AMGA 3LPGA 1LL6A 4W84A 3CIVA 1TVNA 7A3HA 4J3WA 3W37A 2DSWA 4CN1A 2XVNA 4HU0A 1G5AA 1V0LA 5HBFA 2VUYA 2Y8VA 5JBFA 2WMIB 1KXVA 4P8WA 1UKSA 3WL0A 1J0JA 3PZ9A 2EPMX 3TP4A 1A47A 4P7NA 4EAMA 1VAHA 3SEPA 1ZJBA 1W9PA 4B15A 1E6SM 3NDYA 5FOOA 4J3UA 3CUIA 1CDGA 1E6NA 1K9TA 2E3ZA 3VMNA 1F4HA 1RH9A 4E8DA 3JUGA 4CD5A 5A8NA 3D5HA 5ABGA 4HMDA 3AI0A 2WAGA 3THDA 4LX4A 1FP8A 2Y4SA 2WXDM 3IJ7A 2BVTA 1J9YA 2XVGA 4W87A 3BGAA 1W9UA 2V3FA 2WSPA 3N15A 4NRRA 4V2XA 1VJZA 2CBUA 3ARPA 1B9ZA 2PF0A 1HJUA 3WL1A 3A4AA 1E3XA 1E4LA 3F5KA 1MW2A 2ZX5A 1AMYA 2A3EA 3SIMA 4X0VA 3ARWA 1HX0A 1ISZA 1G9HA 5E0FA 2MANA 4CU6A 1KWGA 2E9MA 1V3HA 1F4AA 2FGLA 4BZYA 4R27A 3T09A 1PZ2A 2FHFA 3WDRA 4LYQA 3SCTA 2EPNA 2A3CA 4UZUA 1GOIA 4D72A 4AW7A 1UH3A 2WWCA 2O9OA 4ML4A 4GQRA 1PJ9A 2RGMA 2GUYA 4P7OA 5IHSA 4F9DA 1UQZA 1E15A 3RO8A 1XGZA 2EQDA 4MAVA 3FW6A 2BHYA 1UZ4A 1W3KA 3THCA 2ZX6A 3ZJ6A 3L4UA 4PMNA 4JFSA 4CD7A 4PBGA 1CYGA 2YA2A 1MVYA 3EYPA 1V3MA 3UG5A 2TAAA 1US2A 5HNNA 1HKKA 4J3VA 2J79A 4ZEPA 3FAWA 1AQ0A 3TTQA 1RPKA 2D23A 4IPNB 1VF8A 1UA7A 4HZ7A 1W3JA 2B31A 2HISA 4W7VA 4Z2KA 1U30A 4FLRA 4BA0A 1JYNA 2YOCA 4XV0A 1M7XA 3WMBA 4LYRA 1JNDA 2VX6A 2VR4A 4MDOA 1CPUA 4GZJA 1UR1A 1CGYA 3F5JA 3PZQA 1B0IA 3WH5A 4MADA 4H8HA 1AQHA 2ZX9A 2ZX8A 2VURA 1S46A 1VIWA 1BAGA 4ATWA 4AZHA 2XFYA 5HPOA 2W5FA 4ATDA 1FP9A 5A8QA 2C7FA 3WNLA 1GOMA 1CXKA 3RIKA 3BAIA 3CHFA 2ZOXA 3WKZA 3I3BA 3SCUA 3KE0A 3AMKA 3MU7A 1E1EA 1GZJA 1NARA 2WNWA 1VENA 3MANA 4OZOA 1UWTA 1V03A 4UTFA 1RP9A 1ZS2A 4UFIA 5D9PA 4F66A 1TUXA 2BNJA 4AD1A 1JF6A 3GNRA 5FKYA 1FHLA 4D6JA 3N13A 4D6DA 1H3GA 4Z2IA 1V6YA 4CGTA 1GOWA 4JL2A 4CN6A 1W9VA 2VZOA 1OM0A 4HA4A 1ODZA 3FNDA 1E0VA 3AHYA 3HU7A 3A3HA 2XWDA 4AZCA 1EQCA 1MW1A 2YJQA 4PMRA 3WQ4A 3WNOA 3W24A 1JNEA 3W27A 3W25A 4PCTA 3VUPA 2VL4A 3W38A 1UZ1A 2J8FA 4JFVA 3ZMRA 3BAKA 1PPIA 1GQIA 1LQ0A 3J7HA 2WMJA 1E1FA 4LYPA 3K4AA 5E0CA 3W6LA 3AHTA 3FAXA 2WMIA 4J28A 3LPPA 1C7SA 1HP5A 5A6AA 2DIJA 1C8QA 3RJXA 2E0PA 1EO7A 5HDRA 1UH4A 2WBKA 3PZNA 3GYCA 1CENA 2V3EA 1HJXA 3GH4A 3RM4A 3PZVA 4WLCA 4WSJA 4BQ4A 2PB1A 3F4VA 1HJQA 4H8VA 4MB3A 4P7LA 3WF2A 4NZCA 3CZJA 1CWYA 4QCEA 4KWUA 3U57A 3W82A 1TCMA 1E5NA 4CKQA 1MXGA 1XRVA 4X9YA 1UD2A 2YLLA 3AS1A 4UFLA 2GJPA 3K8LA 4KRTA 3SUSA 2NT0A 4AWEA 3SUTA 4PN2A 4PTVA 4ZENA 1ZBKA 3BAJA 5ABHA 3RMEA 4W86A 1EIBA 3BH4A 3POHA 5E09A 2WZIA 1K9EA 2FDMA 5EFDA 1GNXA 1PX4A 4HMCA 3QGVA 1CNVA 1KB3A 1QI4A 2FH6A 2BVYA 4GKLA 3M7SA 2NT1A 1QNQA 1Q4NX 1E5JA 2JEPA 4YHEA 1PZ3A 1K9FA 3WNPA 3LPFA 1JDCA 5C70A 4FLSA 4IISA 3VGBA 2O9PA 3PTKA 1R7AA 3ZR6A 5AC4A 4MB1A 3LPOA 1JD7A 1GUVA 4B3LA 3SCQA 3UEQA 5IXEA 2J8GA 1BG4A 1KGXA 2CBJA 5I78A 1M01A 3WDQA 1QNSA 4B9YA 1P6WA 2DSVA 2G8ZA 3AROA 2DEPA 2VRJA 2OLHA 3FXYA 3VMPA 2YKKA 3EDDA 4UQ9A 1VBRA 3AHXA 1ZL1A 1GHSA 1UD8A 3APGA 3NSNA 3VD9A 3MMDA 4MTVA 1GJUA 1KXTA 2DT2A 5BRPA 3WY1A 2A3BA 2CHOA 3MS8A 4AIOA 1C7TA 5F7UA 1D7FA 4B9ZA 1E72M 1Q6EA 4AZ7A 5E6ZA 1E6PA 1PEZA 3BLKA 1ZB5A 1XSKA 1TFVA 1G0CA 2BVDA 5LYRA 1JYXA 3ARXA 1WDPA 4JAWA 4PMVA 4PMXA 2YDQA 1B90A 4EKJA 3GXDA 2YBUA 3KZSA 3ZJ8A 3N9KA 5JBEA 4M29A 3UG4A 2PBGA 4WK9A 4AZGA 3VX0A 2Y5EA 3ECQA 4LGXA 2VX5A 4UOJA 3ZSSA 2V3DA 2XHYA 3UESA 5HPCA 3VIIA 1PAMA 4U2ZA 4QLKA 3T08A 2XFRA 3KL5A 4S3JA 3ZT5A 5DT7A 3WQVA 1UH2A 2G3MA 1FH7A 5I5RA 3QHNA 1H4PA 2DQXA 5HXMA 3K4DA 1V3JA 3G6MA 4AD3A 1BGGA 2ZUVA 3GZAA 3WF4A 3EMQA 3WNMA 4D6EA 1WP6A 5DEZA 4UOQA 3GXMA 2UY5A 3VILA 3B9EA 3VNZA 2X0HA 1E56A 2ZUNA 2VRKA 4CCCA 1OWQA 3PZTA 3BSHA 1H11A 4MJ2A 1QHOA 2YA1A 1UR4A 3CHDA 4H04A 4L4OA 1UKTA 5M03A 3VU2A 4CU7A 5I0DA 4M24A 1CGTA 5D8WA 2VI0A 4AZ5A 5CGMA 2V5DA 1OSEA 2VMFA 1C3FA 3NJ3A 4CVUA 4JKMA 1LWHA 5BWFA 3AZSA 2OSWA 1FA2A 2CBIA 5A2AA 1CIUA 1CXHA 1XD0A 2W61A 4DWSC 1GCYA 1B3WA 2VX4A 4C7GA 7TAAA 3L4YA 1SFSA 4HPHA 1VRXA 2YA0A 2J4GA 1CGWA 1EH9A 1OD8A 1LWJA 5BROA 2OSXA 2WCAA 3PZUA 1UA3A 1KGUA 2DT0A 1QHZA 3IJ8A 1HT6A 1ECEA 4P7QA 2VQTA 4M56A 3VGGA 3ARQA 4Z2JA 3WQ6A 1XH2A 2JFEX 3WH9A 5I79A 4W85A 3AXXA 3BMVA 3RCNA 1MXDA 3OGSA 5ECUA 5EBAA 3VD5A 5C8BB 5GNZA 2XVLA 1E0XA 2ZICA 5I77A 1W3HA 1E4MM 3CMGA 3GXFA 3OLDA 1X6NA 1Z32X 2X8RA 1NWUA 5BYWA 3ZIZA 4U2YA 4Z2HA 3VIGA 3UR7A 2VO5A 2JF7A 1H49A 4LQ1A 4N0RA 2D0GA 4MNMA 3KWXA 3RM8A 4TXEA 3ZOAA 4GINA 1R8LA 2WHKA 3A4WA 1BQCA 3CBWA 1EDGA 5A2BA 3WDHA 2WZHA 1NQ6A 1OD0A 4X0NA 1UHVA 1TG7A 2WPGA 3PHAA 3W26A 2FH8A 1JZ7A 2WVUA 1FOBA 3VDHA 4FF5A 1BTCA 4PEEA 4OKDA 2YDRA 2V38A 1H0GA 3O6AA 4DM1A 3W53A 1ESWA 3VDBA 2AMGA 2PWHA 1JFXA 3CHCA 2BXYA 3WQ5A 1JZ8A 3VM5A 3L4WA 3SCPA 4V27A 1DWGM 1UWIA 3CGTA 4H7VA 3PTQA 1DP0A 4OJYA 2DGAA 1R85A 3W6MA 3GBEA 2CKRA 1HIZA 1WZAA 2ESCA 1BLIA 2WC3A 3AMLA 5AC5A 1CXIA 3NUKA 3IK2A 1E40A 1HF6A 4ACZB 1QOXA 1E70M 4J7RA 4WKAA 2UY4A 1UKOA 4H2CA 5BRQA 4CVWA 2W92A 5BXPA 1JGIA 3HJEA 2BXZA 4H41A 4RE2A 1CGXA 3IAQA 3WF1A 3WNNA 2O92A 1GHRA 3U7BA 5CZKA 1W3LA 3M6DA 1OBAA 2GK1B 1VFMA 2Z1KA 4Q22A 4AZ6A 2VCCA 4TX6A 2W62A 3WD0A 2XPKA 1A3HA 3AIWA 3WD3A 3GDBA 3MO4A 4F79A 3EDEA 2G3JA 5IDIA 4MNLA 2IUZA 4OOUA 1G01A 1H5VA 2J7FA 4UFHA 5CXPA 1W1PA 2QMJA 2GK1A 2QHAA 3KEHA 5CPSA 1V6WA 2WKLA 3WUBA 1BYBA 1ITXA 2VVNA 1EO5A 2D20A 2XIBA 2IXVA 4FLOA 2J7HA 3ARYA 1B3XA 2WM0A 2PWFA 1MFVA 2WVTA 1EGZA 3E1F1 5IHRA 4CUCA 3PN8A 9CGTA 4NSBA 4WKHA 4AISA 3UR8A 5A6KA 3AMDA 4GZEA 1UD4A 4RE3A 2WLZA 4WSKA 1GPFA 4AIUA 3BAWA 3WF0A 4U33A 3RJYA 4D71A 1D2KA 2VNCA 4MPKA 1GJWA 5EMYA 1EHAA 5C71A 3CZGA 1H1NA 1W1TA 1W1VA 5A8MA 1V3IA 1GOKA 3EMZA 1BGAA 1CXFA 4QAWA 4D6CA 4D6GA 4HU8A 4Z2LA 1QNOA 1LF1A 3GM8A 1UKQA 3K1DA 2NSXA 3AXHA 3A47A 4AEFA 1HN1A 4YPJA 1UWRA 3OBAA 4HA3A 3MKKA 3ZR5A 3WNKA 2VOTA 1H0IA 1E6QM 5LA0A 4EANA 3OA5A 1GQJA 2WCGA 1Q6DA 2WMHA 1CECA 1LG2A 1DWHM 1PIGA 4ZE5A 2EJ1A 3NSMA 3WH6A 1HJWA 5M17A 3AIVA 1V08A 3FHQA 1W2VA 1ZBCA 2J77A 1EHNA 1JDAA 3K46A 2ZUTA 3RILA 4PMYA 3GTNA 1XD1A 1GW1A 3A6OA 5BXTA 3WENA 3SCRA 2PWEA 4JZ5A 3BXWA 1XHGA 5GQBA 2PI6A 3CZEA 4ZFMA 3MV11 3ARUA 1DWFM 5I24A 2BY3A 4AD2A 4K68A 4EK7A 4JFWA 2W67A 1FH9A 2F8QA 3D3AA 3BSGA 5A2CA 3DC0A 5CJ5A 5DF0A 3U5UA 4P8UA 1CLXA 3CZKA 1KR0A 2WVVA 4XUYA 1JIBA 1LG1A 1GVYA 3AXIA 1B31A 1FH8A 3ARRA 1AVAA 2FGZA 2XTKA 3B9DA 3N18A 1V02E 4JKLA 3PTMA 2BY0A 4XB3A 5CLTA 1TVPA 1IV8A 1CEOA 2JIWA 4WJXA 2RGLA 4GO9A 1B3VA 2DH2A 4F9JA 4R5EA 2D2OA 1FFRA 3NSXA 3W81A 2G3IA 1VFFA 2WMFA 2ZUSA 1DWIM 5JH8A 3KL3A 3VGDA 5I6SA 1SMDA 4KGJA 3VTRA 2OYLA 1BYAA 2GFTA 5A69A 3AZRA 2HVMA 4U5IA 2QPUA 5FL0A 4JHZA 1W91A 2WWDA 4YHGA 4GI9A 6TAAA 2WB5A 2CIPA 1E4NA 2X05A 3VMOA 2XM2A 4AEEA 5KZ6A 7CGTA 3F5LA 4QLLA 2E8YA 3VIKA 4KMQA 3CUJA 5A6JA 1E4IA 2WANA 4UZSA 4V28A 2WKGA 1JZ6A 4E8CA 2C0HA 1X1NA 5AY7A 4CN4A 4UQDA 3RPMA 4NI3A 4HPGA 3CO4A 4UCFA 4ZXOA 5D8ZA 1KXHA 3EDFA 3L4VA 1MQRA 4J27A 3BLPX 3SURA 4XZBA 1QI3A 1JXJA 5LA1A 3QOMA 1HJSA 2ZXBA 1KQYA 1W2PA 4JFTA 3MSGA 3T2OA 4BCEA 1VEOA 3L2MA 2ZXDA 4BS0A 1GOQA 1J10A 1B3YA 3OZPA 1U33A 1C91A 4RE4A 3WDIA 3OLGA 2ZUUA 1UD5A 3TA9A 4C7FA 1OIMA 3WELA 1QI0A 3CLWA 2AAAA 5A8PA 2WSKA 1US3A 5E9AA 4RL3A 3ALGA 2X0YA 4PMDA 2J7EA 5CGTA 3WFZA 4U31A 1C92A 1QBAA 1QI5A 8CGTA 5A6LA 3OLEA 3PZGA 1CBGA 3N17A 1Q6GA 2EXOA 2CBVA 3II1A 4W93A 1VB9A 4KH2A 3CUGA 2UWFA 2BHZA 3CZLA 4M81A 1KXQA 1IZJA 1KCLA 3W29A 2WC4A 5I23A 3ARZA 1HJVA 2V5CA 3VO0A 1KR1A 1NP2A 3ZJ7A 3AZTA 2JIEA 3T0DA 4PSPA 3VGFA 1V6VA 2W4XA 4W5ZA 5FCZA 3ZJKA 3W0KA 1QW9A 1NH6A 1I1WA 5DT5A 3B8SA 3WDJA 1Q6CA 2FHCA 1GQKA 5D9MA 2VQUA 4D6FA 1IT0A 1QBBA 1QW8A 1L8NA 1ISYA 2WHLA 1MW0A 2BY2A 1Y7VA 4HTYA 3BC9A 3WF3A 4D1IA 3RM9A 2XM1A 3VIFA 3WBEA 1BHGA 1UYQA 4DWSB 3OZOA 4Y7EA 2XSBA 4UFMA 2W63A 5A3HA 5GPRA 4KRUA 4HOXA 1R7OA 1JZ4A 3QOKA 4QDMA 3WH7A 4UQAA 5KEZA 1V6UA 3WBAA 3CPUA 1WDRA 3EDJA 2Z1SA 2D3NA 4A4AA 1QNPA 1WZKA 1XSIA 4F8XA 2VJXA 3MMWA 2GDUA 1KQZA 3WIJA 3AHZA 1BYDA 1IZKA 5CSUA 3UG3A 1NM9A 1U2YA 3QR3A 1V3LA 2XVKA 4QFUA 2OYMA 1C8YA 5DFAA 4MAZA 2YL5A 4P8VA 1DWJM 2BY1A 2EBNA 1XH0A 5E70A 4AYSA 4HOWA 4W5UA 1WAWA 1ZJAA 1QI2A 2DDXA 4PMQA 3WUFA 4PTXA 1AQMA 4U3AA 2PBOA 2JALA 2Y24A 5AYBA 2CESA 4AD4A 4MNKA 4PRWA 3WH8A 1UKPA 2EEXA 4JCLA 3I3EA 2WLYA 2OYKA 4BQ2A 1WB0A 1CGUA 4AD0A 1OB0A 4LPCA 1H09A 2XSAA 1HKJA 2CETA 1BFNA 3QHMA 5FIPA 4WKFA 4WF7A 3TTYA 2OWXA 2IXUA 1B2YA 4FMVA 1RP8A 3MUZ1 3NYDA 4M8UA 1E3ZA 2CKSA 1YHTA 1NWTA 2XUCA 3QHOA 4YN5A 3S2CA 3ZT6A 5A6MA 1JZ3A 5A6SA 4D6IA 4NRSA 3BAYA 1RD6A 1DWAM 3NCOA 4OUEA 4DM2A 3VM7A 3L2LA 2CYGA 1CGVA 3VPLA 1EOKA 2VVSA 2PWDA 3VIHA 3NIYA 3AYRA 1HXJA 2PWGA 3BCFA 5DO8A 4CD4A 5DMYA 3VDAA 2AOSA 1E55A 1E6ZA 4TVDA 4WIWA 1ZU8A
chains in the Genus database with same CATH superfamily
4GO8A 1WXYA 4PZVA 3MP4A 2RJGA 2O4MA 5H91A 2HK1A 2ZYFA 3BW3A 4XD6A 4DQWA 2X09A 2XH0A 2OSYA 4CEUC 2E68A 3WEZA 4TQTA 2ZADA 2YYUA 2PBCA 4JHOA 1LLZA 4UNIA 4LAMA 3MMUA 4RCXA 3PPGA 4M1BA 4UFKA 4W8BA 3W1MA 3MUIA 2BDQA 1TPB1 4Y9NA 3M0LA 4XO7A 3B0PA 2H6RA 5D9OA 1V0NA 3EKLA 4DAIA 4L1XA 4W9TA 1JPHA 1DHKA 3M0KA 2EG6A 4E4UA 3OGRA 1AH3A 1YDNA 1R87A 4AIEA 1I1XA 3PWIA 4GNVA 3STFA 1Q6RA 4AD5A 4MDPA 3UJFA 1C8XA 1UW9A 3PF3A 1OYBA 4WVXA 4G9PA 1EA9C 1IGWA 3EXTA 3EEGA 4JYSA 3HG3A 3L0GA 4QEEA 4M7SA 4NZ5A 1EJWC 2DIKA 3GU0A 1RQHA 3WD2A 2QXWA 2WC7A 3RG6A 3QQWA 3UZ5A 2EPHA 4JNZA 5HWMA 2JKAA 4HKPA 3T6CA 4GYPC 1TWWA 2E9BA 2E40A 4TX9A 1SW0A 4DJDD 4ZSUA 4AAJA 3RDKA 4J3SA 1FKJA 3LV6A 3MWAA 1B30A 1EQ3A 3EKZA 4DUVA 4IM4A 3SN1A 3FY1A 3NM3A 3SUVA 2E9LA 4N6EA 3B0VC 2R1LA 4TTGA 1PX8A 3WFLA 5CLWA 2BOGX 4PUDA 3IAPA 3ANYA 3SIZA 4ZOBA 3F2DA 3W23A 3G77A 2CCRA 1C9DA 1XCWA 2XFWA 4J1OA 1EIXA 4UMAA 2R1NA 3UA3A 3PRAA 1BF2A 1XFCA 6CGTA 4YYCA 4FNRA 2XH2A 4AF0A 1OINA 3T2PA 4DXVA 3HPSA 1Q7ZA 2UY2A 4Q8TA 3MSYA 2XGIA 1FHVA 1XH1A 4KKXA 4PUEA 2IQTA 3KXQA 3B0XA 2YGYA 4C7DA 4AMCA 4TVCA 2PDGA 1Q6UA 1VJIA 5IOBA 2W66A 3GDTA 5F4SA 2ATSA 1K6AA 1DQUA 1ME7A 4GI8A 3NZPA 5CPTA 3BSMA 3KRBA 1Q1CA 1WE5A 3UWUA 1WCGA 4Q4KA 1CLVA 4ERIA 3WSUA 4WGHA 4DBUA 3OG2A 2QAPA 3WQWA 1F61A 2D24A 2NQLA 4EXQA 4PODA 1PYFA 2CNCA 4LT9A 5D2VA 3SSZA 3L5MA 3GIPA 1EZWA 1TR9A 3GXIA 4V33A 4L61A 1G1YA 2OLAA 2REQA 3W7KA 3S9ZA 4UOZA 3NAVA 4YTUA 1AW1A 3O0FA 1NOWA 1KBJA 1EYEA 2ACUA 2J47A 4S3KA 3RUBL 3SCOA 3M0XA 2PSNA 1HKMA 2Y0FA 4E38A 1JUKA 1VYRA 3RX2A 2GQ8A 4A29A 4JPGA 1XV8A 4GC3A 5DRIA 3AS2A 3NL6A 5TF0A 2KAUC 1YXDA 2P3EA 2OO0A 3UETA 2BLEA 5H2ZA 3W86A 4WZHA 3FYYA 4DPQA 5F2MA 1O6IA 4QP0A 1F7BA 1Q8JA 4E2OA 4PTMA 4QISA 1GYLA 1PIFA 1DOSA 3BZJA 2ZRVA 1P0BA 5BMWA 2QJHA 1GT8A 2ON3A 4EWJA 1ONWA 2A7NA 3W01A 2G3NA 1FDYA 1TZ9A 2OJPA 2J62A 4YLWA 3QTGA 4DJDC 1T99A 4TO8A 2P8CA 3R2GA 1IEVA 3VNJA 1J6PA 2EPOA 4KCTA 4C02B 2ZXQA 1ZP4A 2GGJA 2OGYA 3WJYA 4LVAA 3TTOA 3VNIA 4MUZA 3OIHA 4PTNA 4CD8A 3R0UA 3ZT7A 1A49A 1EZ2A 3M46A 1GORA 1RY0A 4DRNA 2CHNA 3MI2A 3CUFA 4XZLX 3MSDA 1XYZA 1D7JA 4MB5A 5B7YA 4UTWC 4ZQMA 1DORA 4UQEA 1EX1A 2DZPA 4F48A 3C0SA 3FVMA 1FWHC 1K03A 2E1WA 1TZ7A 3G6LA 3RLGA 1UR3M 4JCMA 1E9LA 2XDFA 2E8ZA 1V51A 3GKFA 1YTDA 3I3DA 4LV4A 4IOTA 1X1ZA 4TNSA 4E4PA 4JIEA 2XINA 3VCCA 3AHVA 3UGRA 4HYRA 3KZPA 1S1RA 1V02A 2YCLB 3AYTA 2NXGA 1HL8A 3W83A 4F40A 4XBSA 3CAVA 4ZB0A 1QPKA 1SYTA 3W7IA 2OEJA 4QG8A 1O1HA 3JW7A 4HNNA 5I7GA 3OLIA 3E5BA 3WEMA 3BCJA 2PWUA 3CH0A 3LBMA 3B9AA 4HZ6A 4TIMA 4MMWA 3VIPA 1OC7A 2FTYA 3ITGA 3N6JA 2NV9A 1QVBA 3R94A 3ZFHA 2PUZA 4DRSA 4GUGA 1TA3A 4RXFA 4IJBA 1FVPA 4HPJA 4IQJA 2XPAA 2GSJA 6A3HA 2P10A 3BVJA 2INFA 2OMAA 2Y8KA 3MC5A 3L4TA 1JXKA 1G94A 1LRQA 1R3VA 3IHZA 3N1AA 2VHLA 2HS6A 3W7RA 2ATMA 2KR7A 1TV5A 4LNYA 1EDTA 2PEVA 4H83A 4DZ2A 4OE7A 5M5DA 4ASTA 4CD6A 1E6RA 4L9XA 4O1DA 3GLCA 4BEUA 2YCJA 2ZRXA 3W2MA 1ZJHA 3OYXA 4D8LA 2V8ZA 3PNUA 4R88A 3FEQA 4QSHA 1HZYA 1XC6A 4IIHA 5HUPA 3XINA 2PP3A 1PTAA 2YCLA 2PRMA 3K8KA 1AJ0A 3KHJA 3BJTA 1FDZA 1JVNA 1BYCA 1SO3A 5C5YA 4L4PA 2BZNA 5AHMA 1EJTC 3R58A 1L6SA 5K4ZA 1JAKA 3MT1A 3TN3A 4LAYA 3S1GA 3BJFA 4LSBA 5A6BD 1XSJA 3W2LA 3PFRA 2PA6A 3QM3A 1WNOA 2DORA 5FAGA 5JQ9A 4OIFA 4QM1A 3CHEA 4AVOA 5CBIA 4KPLA 2EF9A 2GJRA 2WBGA 1JCLA 4I7VA 1PBGA 3S6TA 1QXLA 5H8MA 2OVLA 3PANA 1ITUA 2FMNA 3K8MA 1AMKA 3MV01 3B3DA 5TIMA 2X7VA 3WN6A 4CCEA 1LJYA 1S2TA 3C0JA 3LI0A 1PIIA 1ECQA 1M53A 2FPVA 3GNNA 3S0CA 4WY0A 2V3GA 3C8FA 5DMNA 4CQ9A 2WYSA 2N87A 4GZ7A 4FK9A 4N9BA 3B03A 3SCNA 1NOFA 1KBBA 4B5XA 2E4TA 3THAA 3WLRA 1MW3A 4N9DA 1V0MA 2ZE0A 5XINA 1MYRA 1W5QA 2P8BA 1EJRC 1L6YA 1THFD 5MKGB 1A5SA 1HP4A 1KRCC 3S1XA 4LXFA 5ABEA 1Y5VA 4YVXA 1KTNA 4DYEA 2Z2AA 1LTDA 4E2DA 2ZIDA 1EJVC 4HNVA 1VJSA 3NO3A 4QLJA 1BL4A 1O5KA 2WMKA 3GPKA 1XLMA 1JG9A 1NWRA 2IMRA 3AMGA 1E9YB 4JY8A 5AHEA 3DEQA 3DFNA 3P2VA 1G5AA 3HQPA 1R0MA 3FAPA 2D2GA 2R24A 1EKOA 2YX0A 4RW3A 1MUWA 5JBFA 1V77A 1KXVA 5F4WA 3V0UA 1J0JA 3PZ9A 4UNKA 1YNYA 1QMLA 3SQSA 4NNCA 5L9FA 2VEFA 5HR6A 1A47A 1ZJBA 3QXBA 3L5AA 3NURA 1BWKA 1P0EA 3NDYA 1ZTVA 1GVQA 1BWVA 3CUIA 3QF0A 4WHBA 1YADA 1K9TA 1RH9A 4HPNA 3GAYA 3QFEA 5ABGA 3NQGA 1O12A 3SN0A 4I9JA 4JTLA 4A21A 4H4IA 5LIWX 4BF9A 3EX4A 1DIDA 4A05A 4RX0A 3N15A 3EOUA 3ARPA 5HQLA 4MY8A 4C6EA 1SO6A 5CPOA 3A4AA 2PPOA 2WNZA 3F5KA 4Y9MA 5HANA 3SIMA 1Q6LA 4PR4A 4X0VA 4DX3A 3U3HA 1HX0A 2PD9A 2XIQA 3T40A 1WV2A 5E0FA 1V3HA 1F4AA 2FGLA 3NYZA 1SVDA 4O11A 1EJUC 3TROA 1BVWA 3GW0A 4JEJA 4LYQA 1F73A 1O4UA 3OVRA 1UH3A 3LRLA 2R1MA 3CEPA 4GQRA 1IEXA 4TV5A 1Z41A 2VFHA 3LG3A 3JZEA 2Z29A 1UBPC 5M2FX 1E0TA 2BHYA 3V75A 3Q37A 1MEIA 2B7PA 1JPDX 4CD7A 4PBGA 1CYGA 1MVYA 4PCNA 4H3DA 3S5YA 1XIHA 3DHDA 3TTQA 1QO5A 1EXBA 3V18A 1Q3NA 1VF8A 1W3JA 2B31A 4Z2KA 2E5DA 4NIRA 4GY1A 4FNUA 4BA0A 3KAFA 1X7IA 2WQPA 3KTXA 1TWSA 4AFYA 3PPHA 4EX4A 4IMCA 2X2GA 4GZJA 1UR1A 1N8WA 5HMDA 4L4MA 4W9OA 4G1KA 2FVKA 3W1PA 3CK5A 3WH5A 3HG4A 3YPIA 4O57A 1EP1A 2VP8A 3TTEA 5CCZA 1BAGA 1PKNA 5HPOA 1KM5A 1LRTA 2W5FA 1TSIA 2C7FA 3P67A 4YVPA 1ZQ5A 2HVOA 4BI7A 4MVAA 1X98A 4FAMA 3RIKA 3CHFA 2Z7GA 5LHEA 3FDKA 2OZ0A 4DUOA 5BU6A 1YW5A 3VOIA 1VHNA 1SFTA 2JGQA 1V03A 1I2OA 4UFIA 4F66A 2BNJA 1JF6A 3GNRA 5FKYA 4G7EB 2IQDA 3N13A 3GXPA 1IXOA 4Z2IA 1J4RA 4MY1A 1GOWA 2F23A 4JL2A 4CN6A 1U5JA 5HMFA 1NAL1 1EC9A 3QY7A 5H8PA 1SPQA 2QJJA 1TV7A 2XWDA 4DH0A 5K2ZA 4TW7A 1EQCA 3IK8A 5AHLA 2VDIA 3H22A 4PMRA 1WX0A 1BXNA 2XN1A 3W24A 2CZFA 5HMEA 1TRDA 3W25A 2VL4A 1UZ1A 4BI6A 3BG3A 3ZMRA 3BAKA 3J7HA 5REQA 1TUFA 4LYPA 3W6LA 1JQXA 1NQKA 3AHTA 1AFSA 2WMIA 1MEWA 5KZDA 2DIJA 4G50A 3HQNA 1EO7A 2OXNA 3I7QA 5HDRA 1EPXA 4EP8C 2PDCA 1F74A 1HJXA 1UWAA 3HGJA 3AWOA 2QZRA 1FY6A 2PMQA 2RJHA 4MB3A 3WF2A 4NZCA 4YVVA 4N19A 1DPMA 2XZ9A 2GQAA 2LKNA 4CKQA 1Q2SA 1TPUA 3SFWA 1UIOA 1Q8AA 4X9YA 3K4WA 2ZQTA 5REQB 4UFLA 4L5ZA 2J13A 3TJIA 3SUSA 7PTDA 1SO5A 1O1ZA 3SUTA 4PN2A 4F0RA 3BAJA 4UR7A 5ABHA 1TTJA 1KD0A 3SN4A 4W86A 3DG3A 2BODX 4F2TA 3BH4A 3POHA 2I5QA 2FDMA 1TMHA 3CYVA 3O0KA 3P82A 2DY3A 4K36A 1QI4A 2PC4A 4RDZA 1A7XA 3KOZA 1W5NA 1FKKA 1E5JA 4N02A 1F76A 3LPFA 4MZ1A 3HM7A 1ELSA 3L7RA 5DY2A 2DZUA 2O9PA 2PZNA 1EA0A 4MB1A 3LPOA 4B3LA 2VD9A 4QG9A 3SCQA 3VKJA 1FKIA 4AB4A 2QIIA 3DGBA 2PE4A 1KGXA 1OCJA 4JHMA 2ZZ4A 4WY0F 4JGDA 2ZQVA 2QCEA 1VBRA 1UD8A 3APGA 3NSNA 3UWZA 3WY1A 2C71A 4DJEA 1J5SA 4JX4A 5F7UA 1UZDA 4B9ZA 5DBTA 3EA2A 1YATA 1PEZA 3WLIA 1XPYA 3REQA 1UJPA 1EBHA 1RQBA 1XG3A 1ZB5A 1FKFA 3GVGA 5LYRA 1JYXA 2NZLA 1K4GA 4PMXA 3T44A 3W2UA 2GZXA 3EPMA 2QDDA 5D02A 1B90A 2GSEA 4O0QA 2YBUA 3PRDA 3R4IA 3TW7A 3BG9A 1UC4A 3QQ1A 1YTKA 3ZJ8A 3N9KA 4HU3A 1MI3A 1GTHA 2R91A 3IJDA 4S23A 2YXXA 1KFJA 2ETNA 2YYTA 2Y5EA 1YDYA 3COTA 4C65A 3ZSSA 3WBXA 5HPCA 3R25A 3VIIA 1SFLA 3O5KA 1WDWA 1WUFA 3KL5A 4S3JA 4HIBA 2EG7A 4GVGA 2G3MA 3L2IA 1IYXA 3QHNA 3GE7A 3IARA 2GDQA 3DFSA 4WOZA 3K4DA 1WKDA 2RURA 5C54A 3G6MA 4AD3A 2PCQA 3WF4A 1MUMA 3NNTA 5JH2A 4GVHA 4MLRA 1YKWA 2UY5A 3VILA 2R82A 3TOYA 2OZ8A 4LVBA 2VRKA 3DC8A 3IKDA 1OWQA 2MLYA 1IWBA 1SSGA 2YA1A 3CHDA 3HPFA 5M03A 4HK7A 3JS3A 4H6RA 3NDOA 1PB0A 3QLLA 4JKMA 3FKKA 1LWHA 3MDWA 4GLEA 3IVSA 2Y63A 4CNTA 1FA2A 2CBIA 4OHQA 4KETA 3H4XA 3KTSA 1LOLA 4LAOA 4HPHA 4XKMA 2YA0A 4B2DA 2J4GA 4DNHA 1EH9A 2C3ZA 1QU4A 3LHTA 5BROA 3QC0A 4GE8A 3PZUA 1UA3A 4QBXA 2OKOA 1XGEA 4O2TA 2DT0A 4ZO7A 1A80A 3QPZA 3WLPA 1R38A 1XH2A 5I79A 4W85A 1IXPA 3CHVA 1R9HA 1BXBA 5ECUA 1YMYA 5DRCA 3NO5A 4LVFA 2ZICA 1S3TC 3AO0A 5I06A 2OKTA 3IVUA 4KEUA 2NVCA 2X8RA 2OQYA 1K8ZA 4ZQPA 2F2DA 1QDSA 4I90A 1XBYA 3ZVIA 3VFCA 5LXXA 4U2YA 3VIGA 2HSAA 1H49A 2OR2A 4N0RA 3VKAA 4MNMA 3ZLHA 4NJKA 1SW3A 3NR0A 3P5ZA 1BQCA 3UQAA 3WDHA 2WZHA 3A23A 4B5UA 1JZ7A 2HRWA 3CIXA 2NWRA 4YTSA 3BG5A 4NXKA 3URAA 5HWNA 4HGXA 3UVIA 1MO0A 3O6AA 1TREA 3W53A 1KBLA 2B7NA 3CHCA 4JIHA 3LY0A 2VELA 3SCPA 4H8NA 3CV7A 4GX9A 4H7VA 4DY1A 1XJBA 4OJYA 2OX1A 1R85A 1T5AA 3SR7A 4MIMA 2I16A 1UIPA 3TMQA 1TCOC 4ACZB 4WKAA 4U86A 2UY4A 4IJRA 3RPDA 1LUCA 5BRQA 4CVWA 1CGXA 3TCZA 1PKLA 2PDBA 1GHRA 3U7BA 2E5BA 4WX2A 4QIBA 3M6DA 2NXHA 2WV8A 3GC5A 3VDGA 1RALA 4OQVA 2W62A 3WD0A 4QR6A 1AW5A 4HCHA 2B5UB 5GPGA 1QOQA 1VP5A 2B7QA 2G3JA 2IPGA 3WLTA 4CQ8A 4JQ2A 4OOUA 1G01A 4KS0A 3QSTA 3MI3A 2QHAA 3TJXA 1V6WA 1H7RA 2VVNA 4XZNX 2D20A 2NVAA 3ARYA 1B3XA 1ROTA 4KCUA 3I6CA 5IHRA 3V5OA 5CH9A 4NSBA 3LI1A 5A6KA 4LUJA 3UW6A 4DZ5A 3GR7A 1KFBA 1UD4A 4FXSA 4RE3A 2Y5SA 5AC7A 2X1SA 2C0AA 2PDHA 3EWZA 3WF0A 4DRJA 1D2KA 1GJWA 1EHAA 4LC6A 3CZGA 3BK0A 4TR9A 4YCPA 2HBVA 3EMZA 1GZ1A 1FWCC 4Y8FA 4DN1A 3M16A 3TLLA 1AQFA 1QNOA 1UKQA 1PYMA 1PTGA 1M6JA 4NXSA 2ZR6A 4BR1A 2GGHA 2QNEA 4B2DD 1HN1A 5CSRA 4YPJA 3GU9A 4HA3A 1TWZA 4OU1A 2CZ5A 3WNKA 1H0IA 1FWAC 4IPJA 5DCBA 3U2OA 3S8HA 3U2CA 1K8XA 3OA5A 4AU0A 1DE6A 3FKRA 2IW0A 1OX4B 1Q6DA 1CECA 1LG2A 1LT7A 2INEA 1O5QA 1PIGA 1AD1A 5FJIA 2X1UA 2ZVIA 3NSMA 3IGSA 2CZVA 3W1RA 5I3KA 1V08A 3KM8A 1ZBCA 4PRTA 2ZUTA 3BQ5A 3M64A 4UTKA 1EGMA 4WOQA 1F3EA 4NU7A 2KFWA 3LK6A 4BKNA 3PP7A 1XHGA 1TJ0A 2LJ4A 3MV11 3XIMA 3L67A 2RUSA 4JEQA 1XBVA 4AD2A 1JNTA 3RMJA 4Z17A 4EK7A 2W67A 3G24A 2F8QA 2XIJA 3RRXA 1T8QA 1XIJA 4UTJA 3U5UA 4P8UA 1VCGA 2ZFAA 2PRLA 1JIBA 1LG1A 4DO5A 1M41A 1EGVA 1GVYA 3QYQA 3IWPA 3AXIA 7TIMA 2QT3A 2V0TA 4JKLA 3PTMA 1GKQA 3FJNA 1IV8A 2RGLA 1L6GA 4EVZA 3KAGA 4R5EA 2D2OA 5I3IA 3ZR4A 1VFFA 5DQPA 3GNXA 1E0UA 5FI8A 1TX0A 4NUWA 3B8UA 2QQ6A 4KEVA 1SU5A 1W0MA 3UD6A 2QULA 4N9CA 4C1LA 1WBHA 4AEEA 3IRDA 3F5LA 4QLLA 1FRBA 5EA9A 3HA1A 3CL7A 3LTPA 2WANA 4UZSA 4V28A 4K1WA 4KWSA 4CN4A 5BOFA 4UQDA 2QF7A 3RPMA 3FOKA 1HL2A 4YWIA 3LDVA 1A3XA 3NEHA 5D8ZA 3ITYA 3L4VA 4H7CA 4JOMA 1JXJA 4PUKA 3D0CA 1KQYA 4G5DA 1W2PA 2ZC1A 5B7ZA 3KLLA 4MJMA 4RUBA 3W1QA 2ZXDA 1QAPA 3TN4A 2QCFA 1YW1A 3CV6A 1GVRA 3RYSA 4RE4A 2YFNA 4NAEB 2FZ9A 2ZUUA 1JPMA 3TA9A 3T7VA 4Q4QA 4L65A 3WELA 2X1TA 2Z27A 4MWAC 1FWWA 2WO5A 2X0YA 4PMDA 5CGTA 2GGGA 5E1QA 2V67A 2JZVA 1I2RA 3LHUA 4W93A 2Z1VA 4KH2A 4XIMA 4AC7C 1IXQA 5JXQA 3LYEA 4O14A 1IZJA 5CKSA 3W29A 1QUMA 1C9WA 4TW8A 4OUIA 2V5CA 2CZEA 3OBEA 4B5TA 1NP2A 1D9EA 3W1AA 1TO3A 3AZTA 1XS2A 5EY5A 4Y96A 3VGFA 2W4XA 2QJGA 3L9CA 4DVOA 1FXQA 1M5YA 1I1WA 4WR3A 3WDJA 2FHCA 2Z0IA 1ZGDA 2VQUA 1B3OA 2XIOA 3W73A 5HWJA 1QW8A 4ADUA 1B57A 3CAKA 1XLCA 1ZALA 4US6A 3NEVA 1U1UA 3QMSA 4Y9OA 3RM9A 1E9IA 3GAKA 1UYQA 4F0LA 3OZOA 3N25A 2UZ9A 2RHGA 3NQCA 3QOKA 4O53A 3PRBA 4S3BA 1V6UA 3WBAA 3CPUA 3EDJA 3KDNA 2D3NA 4LS2A 4GISA 3QW3A 3MDUA 5EYWA 4F8XA 3QV9A 3DFYA 1M5WA 1IZKA 5CSUA 3UG3A 1U2YA 2VGGA 2XVKA 3HV8A 5DFAA 2FQIA 3N2TA 4MAZA 3T81A 2EBNA 2GSHA 5BZAA 1TJ1A 1ZJAA 2DJLA 2V6AA 1FCVA 5PTDA 4ZB2A 4U3AA 2PBOA 2A5HA 2A2IA 1XG4A 1H60A 4AD4A 3LGDA 4HHHA 1UKPA 1TPC1 4JCLA 4MHBA 4G1NA 4KRZA 1H09A 2XSAA 2HEJA 4HA0A 1BFNA 1NEYA 1XISA 3QHMA 2PTZA 2GVEA 3QQ0A 1B4KA 1XR2A 5J8LA 4XQ6A 5FIPA 3R8RA 4WKFA 4L9YA 1RP8A 3MUZ1 2V63A 3BWWA 3VOHA 3QHOA 4YN5A 4ODRA 3EWXA 3EPOA 4Q4RA 4GNJA 3CWOX 3FA4A 3B8IA 4D6IA 2FZBA 1RD6A 4PA8A 4MLJA 3NCOA 4DRPA 4K2SA 3VM7A 5A5WA 4KERA 3L2LA 3IRSA 2OX4A 2VVSA 1G67A 3NIYA 3BCFA 1GZGA 3M0IA 4DF1A 3VCRA 4QJ3B 5DO8A 4IIFA 2ZR4A 4MWAA 5DO2A 3UI6A 1VHCA 5XIAA 4TVDA 3UF9A 3T4WA 1GVIA 2FKEA 1LROA 2XH4A 4PSRA 1MFUA 1WZLA 3VKKA 2D2JA 4C6MA 1IT7A 4PMOA 3I4KA 3MY9A 1YPXA 4ES4A 1VGAA 4NL1A 3U8GA 5AC6A 1Q6QA 4GUHA 5GVJA 4NJHA 1XYFA 3CL6A 2V5KA 3PBMA 1YIXA 2CXGA 1LRNA 1VD6A 4C1NB 3H2CA 4NT0A 4IMGA 2QUTA 3C2VA 1ZUAX 5LA2A 3B0UX 3O8AA 1OC6A 4JYDA 3ITCA 4GPNA 2NQ9A 2HE5A 2XJ7A 3OPSA 4LB3A 1FCBA 4O0KA 2Q3OA 1L2QA 5BCAA 2M1IA 5F1VA 3N4AA 4IX2A 3TYZA 3U4AA 1LUCB 4X2RA 3URQA 4FR6A 1UR2A 5CZTA 2Z2UA 3L4XA 5GNYA 1VR6A 1VBHA 2A0NA 2XP3A 2OOFA 3NG3A 1Y0EA 2GQ3A 3VX1A 2GVYA 1PE1A 3WD4A 1RLDA 2DQWA 4PCFA 4Z1BA 3A5VA 4XZWA 4GYPA 1UD3A 4OBRA 4P8XA 3TK7A 3VNYA 1RVKA 4H8UA 3EZ4A 4LUIA 4OFCA 1DIKA 1J12A 3CIWA 2EPKX 2E1DA 2P3ZA 2GVLA 3S2MA 3BICA 3EKGA 3ONBA 2O9TA 4DO7A 1JF5A 1PDZA 1TTIA 4NJJA 3WUEA 5C9RA 2F38A 3P8IA 1OCQA 2A3AA 3HN3A 1RBAA 1TMQA 3WMCA 4QE5A 3AS0A 1OX6A 2ZX7A 5HULA 4IICA 1VBUA 3SECA 4OGZA 3GC4A 4HSNA 4KWWA 3VVGA 4Q7NA 4DO6A 2DSUA 1LLOA 2J78A 1DVJA 2FDSA 1LL7A 3FCPA 3AOFA 1P0KA 1VYSX 3W7EA 2BFGA 3AIQA 4BQ5A 3S6OA 3DOPA 4FB7A 1F07A 4GZIA 1EWDA 2HPIA 3GBDA 3CMJA 4HA1A 2WZMA 3LHWA 4ZL1A 1QOPA 3W84A 3H2FA 3TDBA 1FWIC 1TELA 1SMAA 3E0IA 2G41A 2CEQA 3IUHA 2D9FA 4AX6A 1YQ2A 3FYPA 3BURA 3LCFA 1XKYA 4G2DA 3WQ8A 1GGOA 4NNRA 1R3SA 1TR1A 4DUXA 2VR5A 2WHJA 3DYOA 3CZ8A 1JUBA 2XVPA 2ODOA 4G56A 2JGYA 3RGTA 5F4XA 3QSRA 2GQ9A 2ZWYA 4A3YA 3ARTA 5FSDC 1H1YA 3HFYA 3ZWTA 3TOPA 3V16A 3PBGA 2QF8A 5LIYX 4ACZA 2XPBA 4WDTA 1ZP3A 4QZVB 3LENA 3WCZA 2NVDA 2FAPA 3LCGA 3OJGA 4RZ5A 3H7RA 2G37A 1KCKA 2JBMA 1T11A 4L1WA 5FA5A 3E38A 1OX4A 1OFBA 1BPLB 3ABXA 3EOOA 1EB3A 4Q4PA 1OX5A 1PHWA 2QVHA 1OT1A 4KFPA 5CZSA 3OHIA 3RR1A 2DUXA 3OQEA 4ACYA 2D69A 2Y8UA 3PM6A 1EC8A 1I75A 5IDZA 4AY1A 4ZOEA 2QPSA 1BRLB 2W9MA 1C29A 4CCDA 3E96A 4TX8A 2HZGA 3I10A 1UUQA 2MF9A 1HQTA 3E3HA 1JAEA 1POJA 5HTGA 3FHAA 2VN1A 4YMZA 2J74A 1TIWA 4US5A 5FACA 1KKRA 1JDDA 4TVUA 1WDDA 1TYGA 2ZTKA 1R30A 4EE9A 1RV8A 3LXCA 1NOUA 1A5MC 3W28A 3UR5A 3V1PA 2I17A 2F2HA 4B16A 4GK8A 4K39A 1NDYA 3R5EA 5C2GA 2I1OA 2A4AA 1KBKA 3VOGA 4JL1A 5A94A 1UR0A 4WEVX 1G4TA 1PCKA 3P7YA 3VIMA 2E67A 1AUSL 1ISVA 1DIOA 1QO2A 4M5PA 3ODKA 3OVPA 2A21A 1W1B1 4JKKA 4Q7BA 3OB8A 4DYJA 1A5KC 4O0ZA 1X6LA 3VOFA 5BU9A 1WZMA 5ABFA 3GW3A 3O5FA 1XRTA 5G4WA 4PCSA 3JU2A 4HJFA 4C6QA 5G2IA 3ATYA 4PUJA 3ARVA 3SUUA 3KBVA 1J0ZA 4NF7A 3C8NA 1BKFA 4XVEA 3NM1A 1O66A 3B4UA 1ZSXA 1N82A 1ZNNA 2DU2A 5AZ0A 5EMKA 5ENLA 4UTIA 1UJQA 2KGJA 5AFDA 2BV9A 4GXPA 3WMSA 4MKNA 3QH2A 3DHPA 1T40A 2X41A 5AN7A 2C13A 3EX1A 2KX9A 2IF4A 5M1TA 1R46A 5IFTA 4KF1A 4M19A 3UERA 1B3ZA 1TE1A 3STEA 1Q6IA 2UY3A 4DWSA 4HP5A 2J6VA 2AMXA 4ZCWA 2A79A 4EPDC 2Z1WA 3TWAA 5D2XA 1HNYA 2FHBA 4RLIA 4AXNA 4WDXA 3DFPA 4DUWA 4MYAA 1CB2A 1HVXA 1V6XA 2J6XA 2VCBA 2HXTA 4OT7A 3R1ZA 1A3WA 4NZJA 4O18A 3VDCA 3PS7A 1E73M 4ECLA 4LEQA 4R3UA 1ZCOA 3CM4A 3E0VA 1IGSA 4GIRA 1QASA 1G7VA 2ZWZA 4KEMA 4JNYA 3AICA 4IQEA 1T96A 4UR9A 4XKYB 2KE0A 4O28A 1Z42A 3ZZ1A 1K70A 5EBUA 3C4UA 1Q4WA 4IIDA 3LHYA 3WBWA 4MFDA 1XIMA 3DI0A 3R0DA 3LOTA 5A6TC 3GHTA 4L64A 1HL9A 4LVGA 2R14A 2XYLA 1PV8A 4LUTA 1B1YA 4IF2A 3CH9A 1DXEA 3WQOA 3M07A 4PMUA 5EB8A 5I3GA 4A3HA 4AQLA 1H41A 2WCSA 2QGYA 1EEXA 1Q6FA 3TUUA 1TA3B 1D7KA 3AJ7A 3ZSTA 3OTRA 2CITA 3GFYA 3ARSA 3QV8A 5AECA 4CNPA 5FJTA 1UOKA 1XIDA 2YL9A 3W7GA 2VZUA 2F2KA 3FFSA 2HVNA 3KLKA 1XIGA 4F0SA 4MWAB 2C16A 4UQBA 3U7VA 3HFTA 1DEDA 4YL2A 1Q7QA 4GIAA 1QW7A 2SFPA 3W7HA 2D0HA 3MUAA 3SJNA 3GUGA 3S9YA 4Y6GA 3AYSA 1OZMA 2LPVA 1ZAJA 1UMYA 4Q8PA 1KWKA 3G0SA 3VGEA 2PPGA 4JX5A 4F3HA 5F1UA 3SY5A 4BHYA 2YFOA 2I9UA 3KBMA 4MF4A 5TD4A 3W71A 1S2CA 2BWGA 1P43A 1S39A 2GPTA 2DZSA 2QUNA 3ZWSA 3JXVA 2Y85A 3UT0A 2ZRZA 4U4MA 5I98A 3OBKA 2Y7GA 4FF7A 3E0LA 4O4WA 3BLIA 1FDJA 1RA0A 3FN9A 2XWEA 1OF8A 3TE9A 1XCFA 2C1IA 3LPGA 3PJUA 4TU1A 1NSJA 5DITA 1TRIA 4QRNA 4XZIA 4CN1A 3RCYA 2XVNA 3CT2A 3UZYA 5I3FA 2WMIB 1UKSA 5H1WA 1UP0A 1XLFA 3O5DA 2PDJA 6ENLA 3TP4A 4EAMA 1VAHA 5KTLA 2PDKA 4YNGA 3SEPA 5HT1A 1W9PA 3R7MA 1E6SM 5I07A 4IHCA 1W3NA 1EJXC 2LGOA 1CDGA 4L1GA 1K02A 1F4HA 4HN8A 2PTXA 5A8NA 1REQB 3G1SA 2Y4SA 4PH6A 4RZ6A 5DCEA 3IJ7A 1J9YA 3BGAA 2V5LA 1R9YA 5KMYA 3CAWA 4NRRA 4V2XA 1TV8A 1HJUA 4DT4A 4IT6A 1E3XA 2ZX5A 4DRMA 1PSCA 3G18A 3TZFA 3V5FA 2HXUA 2MANA 4CU6A 4AWSA 4S38A 3SM0A 1R2TA 1XIBA 3O6CA 3T09A 4DYKA 1NDZA 3GG7A 3SCTA 2A3CA 4UZUA 1GOIA 4V1XA 5AHFA 4D72A 2ISFA 4GVIA 2WWCA 2IS7A 3KCJA 2O9OA 1YEYA 2PLMA 1QPRA 2ZCGA 1M3UA 1KBIA 3KVMA 4GH1A 4FAPA 4L6OA 3NL2A 1F8IA 4F9DA 2O0TA 3K13A 4NYYA 4MGVA 3U9IA 3WQCA 2EQDA 4MAVA 1CB7B 1XICA 1KRAC 1CX9A 5HKGA 3UCDA 2CXEA 3T1GA 2GLKA 2ZX6A 3ZJ6A 3G1RA 3L4UA 4PMNA 1T6MA 3EYPA 5HNNA 4J3VA 1LBMA 2J79A 2GJLA 3LXAA 4B91A 5FF3A 1M7OA 2D23A 1DJWA 2VGFA 4NZFA 4JFIA 2FB2A 3UYCA 3I4EA 4HZ7A 3WK2A 4YCOA 2Y7EA 2NUXA 1N8FA 4FLRA 4ZO8A 1R3RA 2WQDA 4MOZA 1DJXA 1X8CA 1FTXA 2FGBA 3LN3A 3DU0A 1CPUA 4ITZA 4EPKA 7REQA 3MTWA 1CGYA 3H9RB 1TB3A 4XISA 5D37A 3NZRA 4XG1A 3OOBA 1FWEC 1B6CA 3V4BA 4LF1A 1UP2A 5J5RA 4HU4A 4DJEC 2VURA 4QDWA 1ZAIA 3TU9A 4BK9A 2XFYA 1E51A 1PKMA 1FP9A 1RXOB 5A8QA 2DUAA 3WNLA 2OU4A 3S2LA 3OZMA 3IJLA 4JIIX 3BAIA 2ZOXA 3I3BA 3M5YA 3AMKA 1E1EA 1GZJA 2WNWA 2PDNA 2HBXA 1VENA 2QIWA 2HJPA 4XAFA 4XZMX 4DJDA 3E74A 5D09A 1QWGA 1RP9A 4RNIA 4AD1A 4C5YA 4D6JA 4ICNA 1J4HA 4D6DA 1H3GA 1V6YA 5LNRA 3TYUA 3LM7A 3M6YA 1RK6A 3AHYA 3A3HA 3AUOA 3FGCA 1EEPA 1MW1A 2YJQA 3B0YA 4FHAA 3W1XA 3M0YA 3Q67A 3W07A 4JN8A 4ZODA 1JNEA 3M5ZA 3W27A 4UTWA 3W38A 1JDFA 2I57A 1PPIA 3T4CA 2WMJA 1E1FA 5E0CA 2YZ5A 1HP5A 4KQZA 2E0PA 1PWMA 4Z1AA 3GIYA 3KBNA 3TSBA 3RM4A 3PZVA 3BLOA 4RXGA 3F4VA 1HJQA 3HZ3A 4H8VA 3H12A 4X2PA 2P76A 3IUDA 5EMJA 4WJ8A 1V4YA 4P7LA 1XRFA 3PSVA 5ECVA 1KC7A 3FGCB 2H3BA 3RFWA 4NHVA 4QCEA 1XQKA 1TCMA 1VFSA 3ELFA 3N2OA 3UJ2A 4EF9A 1UD2A 4QNEA 1WBJA 3IGXA 5HR7A 4AWEA 2ZZ5A 4LV9A 6PTDA 4PTVA 3GHRA 2POZA 3RMEA 1V93A 4JX6A 3TQKA 1AG1O 4PEKA 1GPWA 4NKCA 4QGCA 1EIBA 3HGRA 1KV5A 5E09A 1BKHA 1A53A 4C6OA 1JRBA 1E1CB 4U10A 1GNXA 3VAVA 1CNVA 3QBUA 2XP5A 1IR1A 1KB3A 3O07A 4GUFA 3M7SA 1Q4NX 1PZ3A 1K9FA 3GVQA 3WNPA 2QEZA 1D3HA 2IQ0A 2PTWA 4Q4SA 4FLSA 3THUA 3HMJG 3S1VA 2BGNE 4WUIA 4B90A 4LAKA 5IXEA 1BG4A 2CBJA 1M01A 1QNSA 4B9YA 2Q71A 2CW6A 3WLQA 4OV9A 3AROA 2PURA 2CLEA 4FOJA 3VMPA 1FWRA 3EDDA 5BW6A 3B05A 3KW3A 4FZIA 3MMDA 1VBJA 2V5BA 5BRPA 1R47A 1TJRA 3T0TA 5AVNA 2PDWA 2CHOA 1LZOA 2NX3A 1BTMA 1D7FA 1E72M 3LRKA 1K6WA 3NI6A 1Q6EA 4AZ7A 3MMTA 5G5IA 3BV4A 1AW2A 2BVDA 3G0XA 3TH6A 3ARXA 2R94A 2YDQA 1W1IE 4D8AA 1DJHA 4EKJA 5LZLA 5BNKA 3W7NA 3KZSA 1TJPA 3UG4A 3LB0A 3H21A 1KM2A 4WK9A 2DG4A 4UWMA 4LGXA 4UOJA 3UESA 4FP1A 1PAMA 2YB4A 1TX2A 4IQDA 3NTPA 1QCWA 4LUTB 5DT7A 4IPXA 1TVLA 1MRAA 2VGIA 1LBFA 1VCVA 3ITOA 1O60A 5AZ1A 5HK4A 2O56A 2ACRA 3V7PA 3EMQA 1WP6A 2VUNA 3LUTA 1VIZA 1MDLA 3BGJA 3B9EA 3S3GA 4DRKA 1E56A 3TYCA 4A8LA 4GRSA 3RCMA 3C61A 4K8GA 5D32A 3PZTA 3RU6A 4CCCA 2OELA 4MJ2A 5LGZA 1UR4A 4Q4OA 5TQLA 1F5ZA 3T8QA 1KLZA 3PR9A 1CGTA 5LNWA 4DBDA 2VI0A 3EX3A 3KABA 2VMFA 4K7VA 4CVUA 1E44A 3EWUA 1C8VA 4AVNA 1U5VA 3A9IA 4LJ3A 4B4HA 2OFJA 4ODOA 3O5GA 2HK0A 4C7GA 2PODA 1KM1A 3L4YA 5LSMA 5HNUA 3LZ3A 2H3DA 3LS9A 2I7GA 1AD4A 3SW6A 1QHZA 4WD0A 3IJ8A 3DKJA 1FCQA 1SJAA 3VGGA 4Z2JA 1SO4A 3SQLA 3FYOA 1ZZMA 3WLKX 2VKZG 2VC6A 1DJQA 3O1NA 2PGRA 3OGSA 5AOUA 5AYYA 1IEQA 3VD5A 2G95A 3PR2A 3G8RA 3UFYA 2XVLA 3SRKA 5I77A 5GJPA 4K7YA 3GXFA 1EYMA 1IWPA 3OLDA 3S5OA 1UMLA 3ENLA 2Z6IA 1RVGA 1L2UA 4XIAA 4ODMA 2J9XA 4LVDA 1H63A 1NWUA 3BTNA 2YDAA 3KRUA 5HATA 2VO5A 3CMFA 1SR9A 1K4HA 4IP4A 5AHNA 1FWSA 1QK2A 3ZS4A 4GINA 3IKGA 2CZDA 3GFXA 4NZ4A 4UNLA 1M7JA 1R8LA 1UC5A 3ITXA 3A4WA 1RBOB 3CBWA 1EDGA 5A2BA 1UROA 1NQ6A 1UHVA 5TNVA 2FH8A 1RY8A 1Y0OA 1BTCA 3NQ2A 4PEEA 4OKDA 3KFTA 2YDRA 2V38A 1H0GA 3GU1A 1LYXA 3MI6A 2XN2A 3P61A 2BASA 4UTLA 4UTMA 1VYPX 2PWHA 4MSPA 3W1UA 3EIPA 2ZZ1A 3L4WA 4BJHA 1NF7A 4GMEA 1S5VA 1UWIA 4IGHA 1DP0A 2DGAA 1ZY9A 4DEFA 3WLJA 3L21A 1HIZA 2J8TA 1WZAA 1KCXA 2KI3A 3AMLA 2Z2BA 3F4NA 2RH9A 3NUKA 3IK2A 1HF6A 2A1YA 3W72A 4A2RA 1O94A 1QOXA 3M5VA 1UKOA 3PUOA 4H2CA 4E0CA 3USBA 2BXZA 1MXSA 3IAQA 1VLWA 2FPYA 3WNNA 1DJYA 1G4SA 1OBAA 2GK1B 4JQ1A 1N1AA 3B8DA 3W74A 4Q22A 3HB9A 1W8SA 2VCCA 4TX6A 3GDBA 3WD3A 4JNMA 4F79A 3EDEA 2IUZA 4PC8A 1J2WA 1H5VA 1XLGA 2PDIA 4EXBA 2XSXA 3KAOA 4HYVA 4PGLA 3UVAA 1BYBA 2X0SA 3WLOA 3KP1A 2BG5A 2IXVA 4NAFB 1OYCA 4X3ZA 1MFVA 2WVTA 3P81A 3E1F1 2RDTA 4R0XA 1TCDA 3WH0A 4AISA 3KUMA 3UWEA 1S38A 4R34A 2VWSA 3SB0A 1FKXA 3NL5A 1X6UA 1GG0A 1GPFA 3PTDA 3BLEA 1H1NA 1JNSA 3T78A 1W1VA 3F03K 5A8MA 3U2ZA 1V3IA 4YIWA 1WQ5A 5FJPA 1BGAA 4GIYA 1I0DA 4H19A 4QAWA 1H1ZA 3GFZA 3THQA 3UPBA 3GM8A 2DZBA 2NUYA 3N2MA 3BO9A 4Q4MA 4MYXA 3NQEA 3UF8A 1PCWA 4CNNA 4AEFA 5CZJA 4RKAA 4A6GA 3M0HA 2F6XA 5I02A 3VYLA 1B54A 3OBAA 5C6MA 4Z1CA 2C18A 2ABBA 5LA0A 4EANA 1X97A 3C6CA 3SDOA 1S2AA 2WCGA 4ZPWR 1DWHM 3L5LA 1K3UA 4WQ6A 2ZZ7A 4ZE5A 2EJ1A 3WH6A 4G7FA 3AIVA 1BF6A 3SFKA 3MHUA 1W2VA 3UCCA 1EF3A 4INFA 5HJXA 1EHNA 1UUOA 3RILA 3TX9A 1VLIA 4CQCA 1PWLA 3A6OA 1KKOA 3WENA 2OGJA 3TAKA 3QVQA 3BXWA 1HFBA 3LCHA 7ENLA 5IBXA 1OG6A 1IE7C 2PI6A 4KT2A 3CZEA 3MSRA 4ZFMA 3ARUA 1DWFM 5I24A 1TIMA 2EHHA 4JFWA 4GH3A 1POKA 1SJBA 4KWVA 9XIMA 3W75A 2PDYA 4R7WA 3DC0A 5A2CA 5CJ5A 1JVWA 5DF0A 1W37A 4O19A 4O50A 1HTIA 4IQ2A 2QCDB 3H2EA 4MPQA 1KR0A 2WVVA 3TLQA 3CU2A 1QPQA 4Q8UA 3G3MA 1B31A 3BE7A 1P5QA 1TWDA 2VFFA 3M0MA 3QGAC 1KT1A 2HQAA 4HBKA 2GWGA 1MRQA 4AY8A 1G4EA 1CEOA 5DMLA 3GUWA 4LAZA 2QJNA 4F9JA 4IFOA 2G3IA 4R7OA 2WMFA 2ZUSA 3ABSA 1DWIM 3PG8A 1FKHA 2ALRA 3NQAA 1BYAA 2GFTA 3AZRA 3LZ5A 2ZZ2A 5TBOA 3TFCA 1W91A 2RDWA 2VOMA 4YHGA 4GI9A 3LMZA 3DAQA 1XDJA 3WQGA 4QS6A 3TDFA 2XM2A 5KZ6A 3H2NA 2UZ5A 2QUUA 3B04A 3M1ZA 5TAOA 1MZHA 3W87A 5G4HC 1M68A 4RPQA 2EKCA 2OOGA 3F4DA 4U85A 1X1NA 4I5UA 5BWAA 2AL1A 3CO4A 3HGOA 3P62A 3M0ZA 3EDFA 5XIMA 5DBUA 4IGNA 3CUZA 3SURA 3O5PA 1GVOA 1TWIA 3HPAA 5LA1A 4UXDA 1GEQA 3T2OA 3TW9A 2F6KA 2GVJA 3A5FA 1W5PA 5E9XA 5DCDA 4C5ZA 4XK2A 4A2SA 4RW5A 1Q5MA 1VFHA 1QPNA 2QCNA 4QT3A 1LCOA 2ZA1A 3DBPA 1D7IA 3EXRA 1IQ8A 3OLGA 5AYXA 1UD5A 1PVNA 1L6FA 3SRHA 4BEQA 3SBFA 3DDMA 3CLWA 5A8PA 5FF2A 3C5QA 4K6AA 3WFZA 1C92A 1QI5A 8CGTA 3Q94A 4PBFA 3OLEA 3PZGA 3N17A 5LIUX 3TJ4A 2CBVA 1VB9A 5C2XA 4GNKB 4PB3A 4EPEC 1UB3A 1WOBA 2BHZA 3P60A 2PRHA 3P14A 3CZLA 4M81A 1KXQA 4RV3A 3KADA 3C2EA 3MCMA 3ARZA 3FLUA 4A35A 4B5NA 5FF7A 3NZQA 1K7FA 3AU6A 3QKZA 1AJZA 3U6WA 4NQ1A 4Y8EA 3K2GA 1V6VA 1CCWB 4W5ZA 1QW9A 1NH6A 5DT5A 4UDMA 5D9MA 4ADSA 1QFEA 3M44A 4D6FA 1ZHAA 3IIOA 2F21A 3H2OA 3W02A 3GB6A 1MW0A 2BY2A 1OF6A 1Y7VA 2VFDA 3OU8A 2ZKMX 3QN3A 1KLYA 1VQTA 4PUNA 2PCEA 4HTYA 4D1IA 2VENA 3GTYX 3CEUA 1BHGA 3TZNA 5AC8A 4KRUA 4YTRA 1NDVA 3WH7A 2PU0A 1UPPA 1DIEA 3OEXA 4A4AA 2I9EA 4FNTA 2QR6A 4O4VA 5HWBA 4E2VA 1R2SA 2GDUA 3AHZA 4WRHA 3IEBA 1FWDC 4HBOA 2WKJA 3VCNA 3GR4A 5KETA 2WJEA 2GVGA 2WSQA 4UB9A 3QR3A 4RDWA 4FS9A 1C8YA 2RDXA 2NQ5A 1ALDA 1XH0A 4AYSA 2FIQA 4R85A 1QZ2A 3L23A 2UV8G 2Y6ZA 3OYZA 3N2BA 3SRFA 3WUFA 4PTXA 1MMFA 4DF0A 1X96A 1HKWA 3LGEA 4MNKA 5J6EA 3WH8A 3HPZA 2WLYA 2OYKA 3LTSA 1OB0A 4WCJA 1W56A 2CETA 1I8JA 1Z44A 4A8RA 1HKVA 3CPGA 2WOQA 4WGXA 2HNEA 1SM9A 4LS0A 2OWXA 2IXUA 3QR0A 2CKSA 1YHTA 1KFKA 4ALDA 2YR1A 3S2CA 3ZT6A 4NAEA 1UPMB 3A13A 4TX0A 3WQEA 3O5RA 5A6SA 1I4NA 4NRSA 1HO1A 3BMXA 3KOYA 4ZQCA 4AVFA 2AGKA 4GJIA 4IQCA 5B8IC 3VZYA 4B5WA 4OUEA 5G1YA 3OOQA 4GXWA 3UQNA 4DM2A 1XYAA 1LQAA 1Y65A 3IK4A 3H54A 4ERAA 4XUGA 1EOKA 1Q13A 2PV3A 1NDWA 1HXJA 3MJMA 3S2NA 3NVTA 3CWNA 1L8PA 2OQHA 1E55A 5G1MA 1E6ZA 2GL5A 1JULA 4PTWA 5E6YA 3UXDA 3GDLA 1F05A 4L80A 1MNZA 1AZ1A 4G8TA 4N9EA 2J75A 3REQB 3GNOA 1IT8A 1JI2A 1H61A 1VFOA 5C55A 2XGBA 3CV1A 5T8GA 1VEMA 4KCVA 2XIMA 4LH8A 4JBRA 3N11A 1JFHA 1F6KA 1AL7A 4W89A 1ZENA 3CJPA 4AC1X 5G2HA 1UWQA 2ZRWA 3LGGA 4NYUA 4ROPA 3SZ8A 2JKPA 4GUJA 4ATLA 1FKBA 2FFCA 2JE8A 5DXYA 3A21A 1J0YA 1FKRA 2WVSA 1L0PA 1J11A 2WMGA 1ISWA 3SQMA 4NNBA 2WZEA 2YL8A 3AIUA 5D2TA 1XCXA 3NDZA 4M80A 3P5YA 3VD7A 1V3KA 1LORA 3GR8A 4HJWA 5CPLA 2VC9A 1MQPA 1P1XA 2CLFA 4AX7A 3QZ6A 4GC4A 2R8WA 4RE0A 4TUFA 2G3FA 6ALDA 5AB3A 1FJDA 2Z25A 4XTDA 2Y7DA 1J5TA 3WD1A 1OCNA 5DIVA 1HVQA 2BB0A 1IEIA 1V0KA 2C8NA 2IPWA 1BKSA 1OY0A 4ORIA 1GONA 4I6KA 4IP5A 3WJXA 1QNVA 1BRLA 4GFSA 4FX7A 4UTUA 1ISXA 5KZMA 4JFJA 4W7WA 3ITVA 2ICSA 3WMLA 4KCWA 3CT7A 5JMUA 2QPXA 1KFWA 4LOCA 4CNOA 3G1VA 1OGBA 4Q8QA 1NTHA 5BXSA 5A8OA 4D1JA 1VEPA 1UG6A 1DXIA 4DZHA 4CQBA 3P8JA 2V5JA 1VH7A 4XAKA 2YIHA 4HNOA 3IIXA 3LHVA 3EEZA 4W7UA 3GO2A 3C86A 1P7TA 5LXEA 3O5IA 2E6DA 1XLLA 3EOEA 1CXLA 3UR2A 2Y2WA 3OA3A 4J3TA 3TMLA 3WZ0E 4C1NA 1MQQA 2PU1A 4GVFA 3NPVA 3NQ7A 1IXNA 1JCTA 2Q8ZA 4PUWA 3S83A 2O9RA 3PBWA 5GJNA 2VZVA 5I03A 3H70A 4QG6A 3AS3A 4OBSA 3UPWA 3RHGA 2EPLX 2DT1A 1XKJA 3O06A 2HCVA 3CQIA 4PUUA 1T7LA 3EX2A 4FX8A 2G4FA 3NZGA 5FSEC 3EMCA 3JRKA 3ID7A 3DIPA 2VZSA 3QMTA 3AIBA 4RNJA 2P0IA 3RLVA 4XX6A 2OZ3A 3OVQA 4HMNA 2ZRYA 3H4WA 2H8ZA 1U1HA 1XLBA 2M08A 3FVDA 3PZIA 1FWFC 1WAUA 4GQGA 4FALA 3VC6A 2DJXA 1EOMA 1HO4A 4ZA0A 3AJXA 1KO0A 4R9OA 1OGGA 3CTTA 4IIGA 3P93A 1YPFA 2BS9A 1R3YA 2ZRUA 3U5YA 1H62A 3T07A 3R6IA 4HOZA 2PTDA 3GNDA 1RA5A 3KACA 1GG1A 3IJQA 3T0CA 3AQUA 2DSKA 3G1DA 3TA6A 4XBJA 4HMEA 4IGMA 5CQ1A 3W6YA 2WW5A 3H8AA 2YLAA 1OABA 4GI4A 3E0FA 2J7BA 4GQQA 3KCOA 4W8AA 3SCSA 5T9CE 3R89A 5G2WA 2D1ZA 4DRIA 1XW8A 2JEQA 1FWJC 4WY0B 3T8LA 1V5XA 3SCWA 1KRMA 1D7HA 2TSYA 5A1AA 3NPWA 2FVLA 4RR4A 2OEMA 3WEOA 1JCMP 3GTFA 2E25A 2FJUB 3VD4A 5CSSA 5JU6A 3FV9A 4ZQNA 5K3VA 1H51A 1BG9A 4A8IA 2J7CA 2FJKA 2G0WA 3AIRA 1U1JA 1QPFA 3GNPA 3KRSA 3BJSA 4JY9A 4JFUA 1LOQA 1XYBA 2WK2A 1EL3A 2GJXA 2OTDA 3LV5A 4UFJA 1NP0A 2QUVA 4GUIA 1EYWA 3TONA 1ZCCA 2A7PA 3L12A 3MUY1 4M6UA 1FKGA 3JZUA 2PDLA 5I3DA 1NIUA 2E6AA 1C93A 4ZPVR 4GJ1A 5GNXA 4Q8NA 4O17A 3D6NA 2OLSA 4IZGA 4FIRA 2OWCA 1H2JA 3U48A 4E8GA 1E43A 4O12A 2RAGA 4L56A 4GGQA 1IIGA 4EAYA 2KO7A 4XSMA 4B4FA 1AH0A 2F61A 2VT0A 4I5XA 1SGJA 3LTYA 4JDBA 3NWRA 1W9DM 4LBSA 2VRQA 3WUGA 1CLKA 1OGSA 3EWBX 4BWLC 3KX6A 3I68A 4ZGYA 1FCUA 1UBSA 1X7FA 3R10A 3UZXA 4AZBA 3STCA 4W8LA 4O15A 1J18A 4JTGA 2IPFA 3F1QA 1BVNP 1Q65A 4ILSA 4E3TA 2GWNA 2J7DA 4FR1A 5FEZA 2A7RA 1ICPA 4S2BA 5ABFB 2CFFA 4XZHA 4NNAA 4DROA 1FWGC 4ICMA 2ZQUA 2P50A 3AXKA 3CQHA 4GGHA 4XTIA 4JTDA 3ICJA 1FFQA 1RR2A 3KCEA 2FFIA 1E6XM 1MSSA 4HTBA 4LWWA 1XLKA 4MZYA 1WXJA 3D47A 3RLHA 4UIOA 5LIXX 4S3AA 1UWUA 1LL4A 3VZZA 1QNRA 1I2QA 3PZOA 3PWAA 1JDEA 1XF0A 1ITQA 3R43A 4HK6A 3LRMA 1TKKA 2YW4A 1CZ1A 4QEHA 3RAOA 1U22A 3S1WA 3U0HA 4PBEA 4XAPA 4QE1A 1EQPA 3RPTA 1SSDA 3HO8A 1Y5XA 3GIQA 4YTQA 3BDKA 1GKRA 3W00A 3VD3A 1OFDA 3ZM8A 3ABOA 4AZIA 4JD4A 2NWSA 3POCA 1OEPA 4HD5A 4LUSA 3R0KA 2EAWA 4URIA 4TTUA 4O52A 1S5MA 1HKIA 3C0QA 4J9JA 2YDSA 3NOEA 2BHUA 2WPBA 4LYKA 2D22A 3EPNA 5CPQA 4FLQA 4YXGA 2Z00A 2AAMA 4GY0A 4QJ5B 2DPEA 2O4QA 3HQ1A 1P6CA 1QJWA 1QPLA 2W91A 3I65A 1JZ2A 3O2LA 2WVVB 2IKIA 1LOSA 2CLKA 3KAHA 3SY1A 2NW0A 3PUEA 5A6BA 5MF5A 3TYAA 3VE9A 4R53A 2E7FA 3G1FA 1GJPA 1P0DA 4FOUA 2YBTA 1JUEA 1K8CA 4PYSA 3CUHA 4KGLA 1R86A 3T2QA 3N73A 3H7UA 4ZXLA 4FPSA 1W1YA 2XIIA 2ACSA 3HURA 3MA8A 3GG0A 3NQMA 5CG0A 5CC7A 4M0XA 1V8EA 3BLDA 2V30A 2ZZ6A 3A4JA 3KOXA 5HW7A 4ZQOA 3KOFA 2MLXA 4FA3A 1XQLA 4BWLA 3MO7A 3GWQA 7REQB 4JTRA 4U5KA 4MZ8A 1REQA 2CPUA 5C7HA 2RFGA 3BGGA 3A4XA 3S5ZA 1UOZA 5M3WA 1B9BA 3FXGA 3Q58A 1JD9A 1WDSA 3KZ7A 5FEWA 1P1MA 2AQWA 4U28A 3PVFA 1GEHA 3VIJA 4QE4A 4N7QA 3DHUA 1DKWA 2TYSA 3CIVA 1QWKA 4XO6A 7A3HA 3D46A 4NZ3A 1P0NA 3R8HA 3W37A 1ML1A 2DSWA 3O5MA 2YCIX 4HU0A 2B4GA 3CS2A 3CPRA 2Y8VA 3GXNA 1BWLA 4P8WA 3QPYA 3S6DA 3WL0A 3R12A 1YXYA 1XWYA 2EPMX 3L65A 1N8IA 1NSGA 2YW3A 4MSSA 2XP7A 1IF2A 3QY6A 4K1GA 6REQB 5D2WA 3NFUA 4HNTA 1XIFA 1ENUA 2C19A 2PGWA 3W7OA 4XVDA 3WJZA 3TN6A 1Y5WA 3JUGA 4PUMA 4JQ4A 3EAUA 2O7SA 1JCXA 2WAGA 1FP8A 3NQVA 5CGQA 4I8YA 4W87A 1W9UA 1NMWA 2BVWA 2QDEA 1VJZA 4MY9A 2PF0A 2ISSA 2MUCA 3MPGA 1HG3A 4D9PA 2ISVA 2QCCA 1MW2A 1AMYA 5EMMA 3ARWA 3UG8A 5K4XA 3ABQA 3QR1A 4NX5A 2J24A 2E9MA 3QRHA 3TCEA 2VEGA 4DIPA 3WK1A 4R27A 4BZYA 1PZ2A 3HG5A 2FHFA 4PFMA 4X60A 2EPNA 3O5JA 1PZ1A 3HBLA 4L4LA 2ZTJA 2NX1A 1YPIA 1UQZA 3TC6A 3UPMA 4PFHA 1E15A 4I8DA 1XGZA 3AXMA 3ES7A 4ZFCA 1YNPA 3THCA 4J35A 4TMBA 4UMCA 3LEPA 1V3MA 3UG5A 1US2A 3NL3A 2KZHA 1FWNA 3FAWA 1OQFA 1AQ0A 3R8GA 3CXOA 4EF8A 1RPKA 1K77A 3W1TA 3SRDA 3O6DA 1WOAA 2HISA 4W7VA 3QKEA 1TE6A 3G2GA 1JYNA 3NQFA 4XV0A 1M7XA 4EIVA 4LYRA 1U83A 5AVHA 4H00A 5HJYA 2VX6A 2DZWA 3A3XA 3CNYA 3LCIA 1V6TA 2L2SA 4GOAA 2G97A 1O5RA 4S2CA 1ONXA 2QDHA 2FTPA 1AL8A 4H9VA 3F5JA 3PZQA 1YX1A 4HNUA 4N2YA 4MADA 4DBEA 1FHUA 1AQHA 2ZX9A 2REQB 5I09A 1S46A 1VIWA 4ATWA 1EP2A 4AZHA 4JFKA 1Q6HA 4ATDA 4HCDA 4DHGA 1GOMA 2P4VA 3UNDA 2DG3A 3A12A 3EY6A 2BGQA 4Q6JA 3WKZA 3SCUA 3KE0A 3MU7A 2C79A 2HNHA 4K8EA 1DV7A 3JR2A 3PBVA 3MANA 1UWTA 4UTFA 1ZS2A 2P1FA 2OT0A 1XYCA 1TUXA