2PI6A

Crystal structure of the sheep signalling glycoprotein (sps-40) complex with 2-methyl-2-4-pentanediol at 1.65a resolution reveals specific binding characteristics of sps-40
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYTFANISNNEIDTWEWNDVTLYDTLNTLKNRNPKLKTLLSVGGWNFGPERFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSFTLASSKTDVGAPVSGPGIPGRFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLAEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tryptophan as a three-way switch in regulating the function of the secretory signalling glycoprotein (SPS-40) from mammary glands: structure of SPS-40 complexed with 2-methylpentane-2,4-diol at 1.6 A resolution.
pubmed doi rcsb
molecule tags Signaling protein
molecule keywords Chitinase-3-like protein 1
total genus 128
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2007-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2pi6A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2pi6A01
3ARUA 3AI0A 1WDRA 4OZOA 1EO5A 4UOJA 3DC0A 1E3XA 1WDQA 4JFSA 4HTYA 2FGZA 2G3JA 3CZKA 6CGTA 2FDMA 2DGAA 1ZB5A 2VQUA 3VGGA 1QHOA 3AS3A 2IUZA 3BC9A 3II1A 2CIPA 3WD1A 4UZSA 1VBRA 1ODZA 3LMYA 4E8DA 4YPJA 5CSYA 3AZTA 1JNDA 1R86A 1K9FA 3UESA 3ZJ7A 3WUBA 3RMEA 3ZSSA 2YBTA 2WBKA 3VIMA 3WF0A 3MSDA 4PBGA 1RH9A 4PRWA 4W8BA 3SCQA 3VIJA 3WUGA 4WK9A 4J7RA 1XD0A 1KB3A 3N9KA 4AZ5A 3T08A 1MQPA 1E4LA 1HIZA 3MV11 2JF7A 3DYPA 5EBAA 4PMUA 1QHPA 3F5LA 2VC9A 2W61A 3NDZA 3KE0A 1ZBKA 1UD8A 4JFWA 2BXZA 4FLSA 3NCOA 5EFDA 1E6ZA 2GSJA 4F66A 3W24A 3DYMA 4HOZA 4OJYA 1HXJA 1AQ0A 1K9DA 4RE2A 2EPLX 4NRSA 3VMOA 3PTQA 4PEEA 2V3FA 4M8UA 2CKSA 3FAXA 3T2PA 3TTQA 4AEEA 2YL5A 4MB3A 5GNXA 1KWKA 2DSUA 4NI3A 4DUWA 5IHSA 3WUEA 1V6VA 3SCTA 4D71A 4FLRA 3ZSTA 1OT2A 2OWXA 3L4YA 1UZ4A 5BXTA 3W37A 3WF2A 5D9MA 1G1YA 3DHUA 1ZL1A 4U33A 5DO8A 1I1XA 1PX4A 2XFYA 2WHLA 5EMYA 4NF7A 3KZSA 5A2BA 2QPSA 1KXHA 2J7BA 1JZ4A 4YHGA 3F4VA 3QHNA 2OYLA 3OLDA 2JIEA 5D4YA 5F7UA 2IXVA 1EIBA 2VCBA 3WQWA 1XH0A 4F9DA 1EA9C 2F8QA 5HDRA 5I0DA 3NIYA 2ZIDA 3ARYA 3N15A 1BG4A 3NSMA 3VIPA 3VUPA 4HP5A 4PCSA 2WVSA 4BQ4A 1Q4NX 2E9LA 5CLTA 3T09A 4GINA 3TP4A 2O9RA 1CGTA 3WQ6A 3UETA 4N0RA 3OG2A 1UUQA 2J8FA 4MPKA 4J28A 2A3EA 1UA3A 2XHYA 3BLPX 2J4GA 4AXNA 1HJWA 4FMVA 4PCTA 3PZUA 2WXDM 4P7OA 2ZICA 5JBDA 3ZQ9A 1GHRA 1KXTA 3ARSA 3I3BA 1W1PA 1HF6A 3VGEA 2RGMA 3T0BA 5JBEA 1JZ6A 5LA0A 4KGJA 4DWSC 1XYZA 1Q6CA 4ATWA 3WUFA 5CG0A 3RM8A 5HNNA 2O9PA 3OGSA 2XM1A 4GKLA 2VCCA 2O92A 1QI0A 2VR5A 2E9MA 3K8LA 2VJXA 1H11A 2TAAA 3UR7A 4Z2JA 2ZUMA 3ZO9A 3BMVA 4M81A 3SUWA 1OWQA 4IPLA 3W4RA 1J9YA 4GI8A 1QW9A 1SFSA 8CGTA 1JDDA 3MUY1 3L4UA 4TOQA 4MNMA 3CHFA 3ARWA 1UD4A 2XIBA 3F5JA 4P7QA 2Z1SA 3N17A 1BFNA 1X6LA 1PZ2A 1IT0A 4UOZA 1VEMA 2DEPA 1QOXA 2JEQA 2OYKA 4W85A 2CHNA 4PYSA 1SMDA 1VFOA 2CBUA 2XIIA 4JCMA 3CPUA 2WM0A 1V3IA 2JFEX 3SCUA 2OYMA 1KBKA 3VD7A 1XCXA 1HT6A 2XVGA 5AYBA 3ALFA 1NP2A 1UR0A 4KWUA 1QNOA 1MW3A 1RD6A 2UY3A 2CITA 2WSKA 3AS0A 1UWTA 2CEQA 1E43A 1MW2A 4QDMA 1US2A 2WCAA 4CD7A 4M80A 3AIBA 2ZXDA 4MADA 5E09A 5GQBA 1WPCA 3GXDA 3OBAA 3WEOA 1UD5A 2XFFA 5ABGA 3GH5A 1GNXA 5A6AA 3VMPA 1OGSA 3RM4A 9CGTA 4Z2KA 1XSIA 3SCVA 1KXQA 4UFHA 2OSWA 1TCMA 3AICA 3VIOA 5D8ZA 1GOMA 4WKAA 3WEMA 3L2LA 3N1AA 1LL4A 2VTFA 3BSGA 1U2YA 4J3UA 1F4HA 1D3CA 1H3GA 1QNPA 1M01A 1JYNA 1H49A 3TA9A 4ZFMA 2ZX6A 2GDVA 4PTXA 4JAWA 3SURA 4B9YA 1BLIA 4AZCB 4EAMA 3ZM8A 1UD3A 1GONA 1VEOA 1GCYA 4AIUA 4P8VA 3OIHA 3AOFA 1UWIA 1VFFA 3TOPA 2G3MA 1PX8A 5E0FA 1JZ5A 4FLOA 1W1YA 2CXGA 2XWDA 5JIWA 1E9LA 3M07A 3OGRA 4XX6A 1CPUA 1GJWA 2F2HA 3WH5A 2Y5EA 1WNOA 1FH7A 3K8KA 3GXFA 3SUVA 2PWFA 2WMGA 3WNOA 2J7DA 4F9JA 3AHYA 4TTGA 2WMHA 1J01A 1FFQA 2XGBA 5BXPA 1Q6EA 5JH8A 3AQUA 1OSEA 4AD2A 2WCGA 5HXMA 4PTMA 3ARPA 5FKYA 3BAKA 1VB9A 3HU7A 4MNLA 2XFRA 1NP0A 4AZBA 4W7VA 1UWSA 4D1IA 4W5UA 2BVTA 2D3NA 3AMKA 2NT0A 3VIGA 1J18A 4XZBA 3IAPA 3AIQA 4BQ3A 3WQVA 4TVUA 1MW1A 4W8AA 1CXLA 3W81A 2Y8VA 3NSXA 1EHNA 3WMSA 3GH4A 2QMKA 1QBBA 3GXIA 2E8YA 1NWSA 4F79A 3OB8A 2X0HA 1SMAA 1UWQA 2QMJA 5A6JA 3CLWA 4DUVA 1EQCA 2YDQA 5JIPA 2YDRA 3OLGA 2WVVA 4MTVA 3D5HA 1Q6DA 2UY2A 2GK1A 1UHVA 1YQ2A 4MAZA 3PZNA 4TVDA 4CN4A 3MS8A 2CBIA 3PN8A 4V27A 4MAVA 5D9OA 4RE4A 5A8MA 5M5DA 2WWDA 4GQQA 4D6EA 3VGBA 4HMCA 1C93A 4UFJA 2XGIA 5ABHA 2G8ZA 4AEFA 3I3EA 1P6WA 1TE1A 3OA5A 3WH7A 1KQZA 1XD1A 4A3YA 7A3HA 3CUJA 3NDYA 5TD4A 1TA3A 1HN1A 2PBGA 4W5ZA 3B9EA 3BMWA 2WAGA 2ZXQA 2WVTA 4J3TA 2J47A 1E6PA 1O7AA 3GNOA 4XB3A 3FAWA 4ACZA 5CLWA 2ZX7A 4UQ9A 4MDOA 3BGAA 1CZ1A 1D7FA 1IV8A 1JAKA 1JDCA 3HMCA 3WD0A 1W9UA 4AC1X 2RGLA 3MMDA 4CN6A 1UYQA 4BA0A 3AXHA 5D9NA 2UY5A 1JYVA 1DWJM 1W1VA 5JUVA 1TVNA 3GBEA 3EDFA 1TR1A 5FD0A 3ZOAA 4AD3A 5IXEA 4ZE5A 4W7UA 3VTRA 1NARA 3EMCA 3GYCA 1UR4A 4HA4A 1C90A 1ZJBA 3DYOA 1H0IA 1BGAA 4W8LA 3E1F1 2V5CA 1PZ3A 3POHA 2O9OA 4DWSA 3WMCA 4HZ7A 1BGGA 3ARTA 1QI2A 4U2YA 1E5JA 4C7FA 1DWGM 3AIUA 4ZEPA 1J12A 2GFTA 1E72M 1XSKA 4W88A 2X09A 1E3ZA 3L4WA 2DT1A 2UY4A 1WZKA 1W2VA 4D6CA 3K1DA 2J74A 2WNWA 2VVSA 3T0DA 4LX4A 4MJ2A 3W0KA 1QVBA 2PWEA 1KQYA 2WKLA 4R5EA 1B2YA 2F61A 1HX0A 5HPCA 3A3HA 1BTCA 2WHKA 2VI0A 5I77A 1CTNA 3EMQA 2WHMA 5A8PA 3EDKA 1KFWA 1NWUA 3BSHA 1OGBA 1C7SA 3VOCA 1RPKA 1TA3B 2ZWYA 1V3HA 1W9BM 1BSIA 1WDPA 1MWOA 1CGWA 3ZT6A 1PAMA 3WKZA 5CJ5A 3FN9A 2C8NA 1BF2A 3QOKA 3VPLA 2XUCA 1OIFA 1B9ZA 1UWRA 1GVYA 2GK1B 4GO8A 2XVLA 2J62A 4HMDA 3K4AA 2NSXA 1I75A 1BYAA 3K8MA 2WC7A 4OKDA 1ITXA 3IJ7A 4PMRA 4WJXA 1FP8A 3ECQA 2NT1A 5I24A 5A6SA 4P8XA 3AYRA 2WC4A 1U30A 1W3JA 4NSBA 1HJVA 2CCRA 3QHMA 4IPNB 2NW0A 4UTFA 2J7EA 1KR1A 2ZX5A 1ZJAA 4U31A 3WDRA 3O9NA 3WDJA 1V02E 1ISYA 2WVVB 2CETA 3LPPA 2D1ZA 4JHZA 2JIWA 4URIA 3CTTA 2Q8XA 1CGUA 4GIAA 4W86A 4CVWA 4NRRA 3AMDA 4AD4A 4JKLA 2DSKA 2DSWA 4LPCA 4GI6A 4ZXOA 1K6AA 3AMCA 3CHEA 1CLXA 4UFLA 2FHFA 2WPGA 1HKMA 3PZTA 4U3CA 1JF6A 1VFMA 4J3VA 3QHOA 4Z2GA 2VX7A 3CZLA 5ABFB 3PZMA 4CD5A 3T0AA 3PHAA 3WQ8A 1ODUA 3J7HA 1W1TA 1K9EA 2D2OA 4HA1A 1OM0A 2CHOA 3WDIA 3RILA 1UR1A 1HP4A 3MMWA 3SCSA 2WZHA 3WNKA 5A8QA 5A3HA 1M04A 2JF6A 1XH1A 4S3JA 4GI9A 1FFRA 3OGVA 3MU7A 1G94A 1I1WA 3L4ZA 3AIRA 2WMKA 3L4TA 1CWYA 5FIPA 4CD4A 1J0ZA 1NOUA 1H09A 3WD4A 1C3FA 3VGFA 3WEZA 1JDAA 1D2KA 1E6XM 2G3NA 4EKJA 3ZJ6A 2QLYA 1EO7A 2W4XA 1XGZA 2OSXA 3NYDA 1UQZA 1X6NA 5A6BD 4AZHA 4UOQA 5A6KA 6A3HA 5BYWA 1NH6A 3CUHA 1L8NA 5A6MA 1GOKA 1VRXA 4CU8A 4OIFA 2DDXA 1E6RA 1LWHA 3A6OA 3AISA 1LLOA 4OUEA 3WN6A 3I3DA 2Y8KA 3WBEA 1R7AA 3TTOA 5KEZA 1DEDA 3JUGA 3B9DA 4B16A 1V6YA 3WIJA 3CZGA 4XV0A 4B3LA 2BY2A 1WE5A 4D6JA 2VQTA 1H5VA 4MB4A 5CPQA 1VJZA 5E9AA 2GJPA 3RJYA 3W26A 4S3KA 5CPTA 1EHAA 1E0XA 1V6XA 1XC6A 1WDSA 1CXFA 4UR9A 3A4WA 4PMDA 4PMNA 1NWRA 1HNYA 2XSBA 1J0HA 3AHXA 1ZBCA 5CGTA 5C70A 4MNJA 1C8YA 3OLEA 3BAIA 5FL0A 2PWHA 2EBNA 2Y2WA 3BCFA 4TX6A 3ZR6A 1PPIA 4PMVA 2D23A 1ITCA 2E9BA 4Z2LA 3WL0A 1M53A 2YA2A 1E6NA 3N18A 6TAAA 3GNRA 3IJ8A 3SEPA 2W67A 1V0LA 3VD3A 3LPFA 1W9PA 2J7GA 1UOKA 1QBAA 1TG7A 3VNZA 3WNLA 3DECA 4A3HA 1JZ3A 2DH3A 4MB1A 4W87A 5M17A 4V2XA 3AHTA 4IISA 2XVKA 1EGZA 5CPSA 3RCNA 3PTMA 4FK9A 4JL2A 5LA2A 3SCOA 2JE8A 2GDUA 5DMYA 4F8XA 2WLYA 4CU7A 3EDEA 2D3LA 4C7GA 5A6LA 5A94A 3OZPA 4AW7A 3CZ8A 5IHRA 4CCDA 3CMGA 5A8NA 3CHCA 3IANA 2VZSA 1G01A 1ISZA 1MYRA 3WQ5A 5BROA 2D24A 1QHZA 2ZXAA 1HL8A 1NWTA 2MANA 5I78A 2FGLA 2ZOXA 4JFUA 5IDIA 4WIWA 4RL3A 3AYSA 3VKKA 1DWHM 2WSPA 1B3XA 2EJ1A 2CYGA 1CLVA 2YJQA 1E6QM 3G6MA 4UFMA 2C0HA 4UQEA 1G0CA 1X1NA 5AYIA 3U5UA 4DWSD 1NOWA 3EMZA 4TUFA 1OBAA 1V6UA 3BAYA 1UR9A 1FH9A 3FY1A 2WVUA 1CXHA 4C7DA 2WHJA 4J3XA 4UQDA 2XG9A 4AD1A 2XVNA 1JNEA 4CKQA 1HJSA 4WF7A 1TZ7A 1LWJA 2X2YA 4HOWA 1CBGA 3VILA 2OWWA 4QCEA 3WNNA 1KXVA 1XYFA 2XWEA 1HKKA 4KGLA 2HVMA 4WLCA 1RP9A 2EPOA 3MUIA 4AISA 4AZIA 2VL4A 3CZEA 1IZJA 3VIFA 4HZ6A 1FOBA 2PB1A 3AZRA 3EDJA 3W53A 2WMFA 2XTKA 4CGTA 1XCWA 3D3AA 2VMFA 1VBUA 4J3WA 3CIVA 1E0VA 1B3YA 2FH6A 1JF5A 2WANA 2D0HA 2VX5A 1JI1A 1UKTA 4U3AA 3PZIA 2ZX9A 4CU6A 4D6HA 3WD2A 1JXJA 1N82A 2XYLA 4HPGA 4UQCA 3ARZA 4QCFA 4R27A 2O9TA 2ZXBA 4UFKA 3QGVA 1DTUA 5HPOA 3MANA 4QLLA 3RPMA 3SUUA 4N42A 3A4AA 1E40A 1HJQA 4E2OA 1GQJA 1J0KA 2CPUA 5C8BB 3ARRA 1JYWA 5A95A 1V3LA 3VDHA 2J79A 3IJ9A 5DFAA 5I23A 3UG3A 4AIEA 4B15A 4BCEA 3PZQA 2VO5A 1CGYA 3W28A 3W27A 2VUYA 3DHPA 4GZEA 2GVYA 2A3AA 4LYRA 3ARXA 2W91A 1CYGA 1UQYA 1XH2A 4BQ5A 2WZEA 4OOZA 2V3GA 3AMLA 4AMCA 1BYDA 2X05A 1GOWA 3VD9A 3WL1A 3FW6A 1BAGA 1E56A 1HVXA 4KRUA 2YDSA 4D1JA 4PSPA 3RIKA 1HJXA 2W92A 3VM5A 3CHDA 4UQBA 3FHQA 2ZUWA 4GPNA 1WKYA 2D0FA 3SCRA 4P7NA 1BYBA 3N11A 5DT7A 1IZKA 3AMGA 3U7VA 1L0PA 2OLHA 3LPOA 1SR0A 3L2MA 5BRQA 2YBUA 4PMQA 3VIKA 1BHGA 1LJYA 5EFFA 1Q6GA 4H8UA 5ECUA 3BCDA 2IXUA 3ALGA 1EQPA 4V28A 3WY1A 1C7TA 4E8CA 3PZGA 3SCWA 2WKGA 4P7RA 3VD5A 1EDGA 3BAWA 3VINA 4JL1A 5FL1A 1LL6A 1FP9A 3CBWA 4JFVA 2VOTA 4HZ8A 1JG9A 1KGUA 2FH8A 1CXIA 1BYCA 1GW1A 5LA1A 3QOMA 4PMXA 1VAHA 3CO4A 1JFXA 4GZIA 1BQCA 1R85A 1V0KA 1PIFA 4LQ1A 2X8RA 1UH3A 1CENA 5A8OA 4P7LA 1US3A 4W7WA 5I2UA 2E3ZA 1V0NA 1LL7A 1W2PA 4AWEA 1JD7A 4CUCA 4ZE4A 5A6BA 1XRVA 1JAEA 3ARQA 3CUGA 3WF3A 5GPRA 2ZUSA 4U2ZA 4Q22A 1J10A 1CXKA 3MO4A 4RE3A 5LYRA 2B31A 1QPKA 4NZCA 1FH8A 2D20A 3WDQA 4BS0A 2CKRA 1XHGA 3M6DA 5DT5A 3NSNA 2BHZA 5BCAA 4M1RA 4Y7EA 3MKKA 3QR3A 4ATLA 5GNYA 1E1EA 2PF0A 1EH9A 1V0MA 1V3KA 1BPLB 2CESA 4DUXA 2PI6A 1WZLA 4P8UA 1GQIA 5GNZA 4OBRA 1H4PA 1W91A 4TXEA 3THCA 4JKMA 3BLKA 3UEQA 3UERA 1EOKA 4QP0A 3S6TA 2YL8A 2V38A 1GJUA 4Z2IA 4PMYA 1DP0A 3BXWA 4HU0A 1LG1A 1BG9A 4OBSA 7CGTA 1C92A 1J0JA 4AY1A 1UH4A 5E6YA 5BRPA 3RM9A 2WBGA 2G3IA 2VX4A 2VT0A 1B3WA 1JD9A 2GJXA 1B90A 4M82A 2VZUA 4QLJA 3CUFA 4BQ2A 1TFVA 1J11A 2GJXB 3IK2A 4W93A 4QAWA 2YIHA 4ZENA 1PBGA 1QI5A 1KCKA 1RP8A 1WZAA 2YLAA 4ACYA 1JZ8A 2WWCA 1OIMA 2DIJA 1WP6A 1WAWA 5D8WA 3N13A 5I79A 3AXXA 1JYXA 5DEZA 3ZT7A 1OD0A 2J7CA 3GDBA 3ZJKA 2Y4SA 2V3DA 3VM7A 3VGDA 1Q6FA 4JZ5A 3AIWA 1LQ0A 4WKHA 3W6LA 1C8QA 2PC8A 3SCNA 3AROA 5AY7A 2DT3A 1GOQA 3PZ9A 3TTSA 4QLKA 1YHTA 1DHKA 4LXFA 4L4OA 1PEZA 2WCSA 4ACZB 1NM9A 2VCAA 2YOCA 1SYTA 1E4MM 1E73M 4PN2A 4GZJA 4AIOA 2BHYA 2X0YA 3AHVA 5CGMA 1JIBA 3U57A 1E6SM 4CD6A 2XPKA 1MXGA 2AAAA 4Z2HA 1AQMA 1CDGA 1U33A 3UR8A 3VGHA 1KGWA 1EDTA 5ABEA 1UKSA 1E0WA 4KH2A 3VD4A 5FCZA 4P8WA 1LF1A 4KRTA 5I6SA 1MQQA 3T2QA 4PTVA 2GJRA 3WNMA 4Q7NA 3SUSA 4UQAA 2W66A 2D0GA 3NJ3A 2WYSA 4H2CA 1JI2A 3CMJA 1G5AA 4W84A 4ZXLA 3BH4A 4X9YA 1W9XA 3M46A 1B31A 2QPUA 1CIUA 4PUDA 1LG2A 4U5KA 2EEXA 1KGXA 1GZJA 3G6LA 3KL5A 2ZX8A 3POCA 4WSJA 2VZOA 5BXSA 1JXKA 1E4NA 3HJEA 1G9HA 2DIEA 3ARVA 3FHAA 1QNSA 1A47A 5I3DA 4TTUA 2E8ZA 4EE9A 2HISA 4MB5A 4FF5A 1GPFA 5M3WA 1CECA 2W63A 3F5KA 3WNPA 2EQDA 3MUAA 4QFUA 1EOMA 2PBOA 4HU8A 2D22A 4PMOA 2WMJA 1K9TA 1MFUA 2J7HA 1UR2A 2OWCA 2FHBA 3ZMRA 1HL9A 4MNKA 4E4PA 1XSJA 3W6MA 4D6IA 4H04A 3EYPA 3K4DA 4MDPA 5CQ1A 4A4AA 1WB0A 4AZGA 2VNCA 3MMUA 3M7SA 3VU2A 1VENA 1UWUA 1WZMA 8A3HA 4J27A 3ZT5A 1CXEA 2WMIB 2XM2A 1ZBVA 1EXPA 3A4XA 3OZOA 3WSUA 1E4IA 3MUZ1 3CZJA 2ZUVA 2BFGA 4PSRA 1QNRA 5A2AA 4KMQA 4IUGA 3WQ4A 4H41A 1E15A 4GXPA 4XZWA 3PBGA 2YLLA 1MXDA 2CNCA 1OINA 3AHZA 1FHDA 5BXRA 4DM1A 1GQLA 3O2LA 1B3ZA 2W62A 2FHCA 5I5RA 3U7BA 4H7VA 1UZ1A 2GUYA 1GOIA 1PIGA 5AC4A 1WO2A 3WH9A 4X0NA 1CGVA 5FOOA 2E4TA 5DF0A 1OCQA 2JEPA 1HP5A 3U5YA 1UKOA 3GNPA 2BVYA 1O6IA 2EXOA 1ISVA 1AVAA 1GUVA 2PWDA 3MV01 1J0IA 2Z1KA 3KL3A 1KBBA 4LYQA 1DWAM 5BWFA 4LGXA 1FA2A 3VX0A 3WDPP 5A2CA 3TONA 4PTWA 4D72A 4JCLA 1AQHA 1W3LA 4UCFA 4MJ4A 2DPEA 3KWXA 3GM8A 2WLZA 1Y7VA 1H41A 2XVPA 2YL9A 4AD5A 3KEHA 4UFIA 3O6AA 3VDCA 2DT0A 1JZ7A 5E0CA 1OGGA 1E5NA 3SIMA 3L4XA 2UWFA 4JIEA 2CBJA 1HKJA 3A47A 1JGIA 3WENA 3VDAA 3AIEA 4BZYA 1DWIM 4HPHA 1OT1A 3MSGA 4ML4A 1C91A 2VURA 5CXPA 2EO7A 3WF1A 1ZU8A 3AXIA 4CN1A 4U5IA 3VVGA 3AFBA 3OLIA 5ABFA 1VIWA 2WMIA 2W5FA 5KZ6A 2WB5A 1E70M 3GH7A 4YHEA 2VR4A 3BAXA 2AOSA 3RDKA 3WD3A 2E0PA 4B9ZA 1FHLA 1BVZA 1UD6A 1CEOA 1MVYA 1NQ6A 4D6GA 1UA7A 4DWSB 3W38A 4IM4A 4H8HA 2J75A 2YKKA 5IFPA 1R8LA 4UNIA 3SCPA 3N12A 2A3CA 1ECEA 2JALA 3VIIA 2J77A 2VVNA 2BY3A 4WKFA 1KR0A 1GHSA 1TVPA 5A1AA 5IFTA 1HKIA 1ESWA 3KL0A 1QNQA 4JHOA 1TMQA 5AC5A 5EB8A 2PWGA 3B9AA 1MW0A 1V3MA 4HMEA 1WCGA 4CCEA 3WH6A 2YA1A 1KWGA 3WF4A 4M24A 2DSZA 1B30A 1VEPA 5HBFA 1VFUA 4JKKA 4EANA 1JL8A 1B1YA 1PX3A 1B3VA 4EK7A 1XV8A 3UG5A 3CH9A 2VZTA 1VJSA 1JZ2A 1F4AA 5CZKA 1C8XA 2X1IA 4CCCA 3WFZA 2VX6A 5M03A 3WMBA 2DH2A 4PMZA 3W29A 1E1FA 4H8VA 4AYSA 1VF8A 3T2OA 2BY0A 3PZOA 2J8GA 1HJUA 2ZE0A 3HN3A 1W3HA 3UCQA 3WELA 3BAJA 3WH8A 3ZJ8A 1H0GA 7TAAA 1B0IA 2OSYA 5HOSA 1QW8A 1MQRA 2EPKX 2ZWZA 1AMYA 1GOOA 2YL6A 4GQRA 3WDHA 1CNVA 1UKQA 4AZ6A 2V5DA 2XSAA 1W3KA 1QI4A 3VMNA 3WBAA 2WW5A 1GQKA 4AZ7A 3WFLA 2AMGA 3W82A 2J7FA 2WC3A 1E55A 4X0VA 2QHAA 2E40A 4M29A 1W9VA 4XUYA 2DSVA 3W25A 3ZR5A 2G4FA 1V03A 4W89A 3FNDA 1QI3A 3AS1A 3VIHA 4CD8A 1GVIA 4L4PA 4CVUA 2VRJA 2BNJA 1H1NA 3AZSA 1TUXA 1A3HA 4BF7A 3RO8A 5D9PA 1JFHA 4AD0A 1GORA 3AIVA 3VO0A 2Y24A 1UKPA 1E71M 4HA3A 1OB0A 3PZVA 3CGTA 4D6DA 4GO9A 3SUTA 4J3SA 1ZBWA 2BVDA 5E70A 4JFTA 1M7XA 2A3HA 1Z32X 2WZIA 3S2CA 2QV4A 1S46A 3VNYA 5JBFA 3RJXA 1UH2A 2CBVA 2BXYA 1EDQA 2C7FA 2J25A 1UD2A 2V3EA 5E6ZA 2ESCA 2EPMX 2ZUUA 4B3KA 5CSUA 3AS2A 3TTYA 2A3BA 3AJ7A 2ZUTA 3GTNA 1W9DM 5A69A 1R7OA 3CUIA 4D6FA 2BHUA 4TX8A 1H2JA 3LPGA 3THDA 1CGXA 3EDDA 4FLQA 1V6WA 3PTKA 2J78A 3NUKA 4K68A 1PJ9A 4WSKA 3L4VA 1ISXA 1HVQA 3APGA 1V02A 3GZAA 2DT2A 2WK2A 4LYPA 2BV9A 2BS9A 1V08A 3N04A 4PUEA 1UR8A 4OOUA 4ATDA 2QF8A 3GBDA 1MFVA 3K46A 2VRQA 3FXYA 3ZIZA 1OD8A 2G41A 4HOXA 3VX1A 2VRKA 3B8SA 2ZUNA 3GXMA 1R87A 3UG4A 2VZVA 1BVNP 3EBVA 2EPNA 1NOFA 2BY1A 1UG6A 1KCLA 1ISWA 1V3JA 1DWFM 4AZCA 4YN5A 2YA0A 1J0YA 4UZUA 3VDBA 2CERA 1M03A 1W32A 5C71A 4M56A 2DQXA 2XJ7A 1ZS2A 3IAQA 4TVCA 4DM2A
chains in the Genus database with same CATH superfamily
4OZOA 1WDRA 4UOJA 1OADA 1M9HA 1WDQA 3TYEA 4JFSA 3N2BA 3KCOA 2PRHA 3P93A 2DGAA 4UTHA 1OC7A 1ZB5A 1LBFA 5DANA 1NMWA 2IUZA 3WD1A 4LUSB 2J6VA 4YPJA 5CSYA 2DUXA 4MJMA 1R86A 1K9FA 3RMEA 3FJ6A 2GSHA 1ONWA 3WF0A 4NAEB 3MSDA 1RH9A 4W8BA 5EY5A 5TAOA 3SCQA 3WUGA 3UQAA 5BNKA 2XIOA 4KFPA 1K4GA 4AZ5A 1TCOC 1TV8A 3WLTA 2JF7A 4DZHA 2AL2A 3I68A 1JCJA 1QHPA 3F5LA 3N4EA 3OBEA 1UJQA 4GC3A 2ISFA 1CT5A 3NI6A 3NCOA 1PINA 3VNDA 3WLLA 1E6ZA 2GSJA 3W24A 4L9XA 1I8JA 4OJYA 4OQVA 4TO8A 4FI4A 4GUHA 4JIIX 1K9DA 3ITGA 3NQ7A 2EPLX 2ZA1A 4PEEA 4M8UA 2CKSA 3FAXA 1RA5A 3APTA 4O16A 5FJOA 4IHCA 3A9BA 4PUJA 5GNXA 3W83A 1SO3A 3DGRA 1KWKA 4DUWA 3O6CA 3WUEA 4I6VA 2X16A 6REQA 3VE9A 2GL5A 3WBXA 2ZA3A 3QZ6A 1CLKA 2GQ3A 2PDXA 3ZSTA 2WJFA 1OT2A 4TX9A 1MRAA 5BXTA 4HZMA 1XBVA 3O0FA 3WF2A 4LRSA 4EXAA 2YZ5A 1W5NA 4B2DD 4U33A 4RUBA 4XD6A 3VYLA 3F4VA 3QHNA 2OYLA 1ELSA 5JU6A 4QX4A 5F7UA 1EIBA 2VCBA 4QR6A 7XIMA 2QUVA 3VCRA 3UR5A 2ZIDA 3NSMA 4NYYA 2WVSA 3L0NA 3R58A 1S39A 4H2HA 1P7TA 2JQXA 1C29A 2HS6A 4QAIA 3DIPA 3UETA 2J8FA 4GQGA 3UNTA 4EP8C 3GR8A 4Z0JA 1LDCA 3OQ8A 3W7RA 1HJWA 4PCTA 1QW7A 1O60A 4WR3A 5SWUA 3UWYA 2B81A 2XIJA 2DZXA 4BEQA 2P0IA 3GTHA 2PTDA 5EKYA 1GVQA 1W1PA 1N2VA 3KTCA 4NILA 4JX6A 4GUGA 3PA7A 1W3TA 2QYGA 4FO4A 3S1XA 4KGJA 1EJTC 2O9PA 3PPFA 3T55A 3MCNA 2E9MA 5FEZA 4Z2JA 5CKSA 4M81A 5REQB 2FKPA 1ZZMA 1OWQA 4IPLA 4IMAA 2CZVA 4US5D 1J9YA 1QW9A 3CWHA 4HHMA 1OK4A 3CK5A 1JDDA 3PBVA 1SO4A 4MNMA 2VEPA 3ICJA 4O28A 1QMLA 3F5JA 3EB3A 4KETA 4P7QA 3GIQA 4F0HA 1SJAA 1S38A 2DEPA 2JEQA 3G1VA 3LN3A 3RPDA 4S3FA 3MY9A 4PYSA 1U1HA 2CBUA 1T6MA 2DVXA 2V5JA 4CNUA 2CLOA 1H7RA 2EPHA 1F5ZA 3ALFA 3BQ6A 3CMFA 1QNOA 3STCA 1MW3A 1RD6A 3AS0A 1UWTA 2CEQA 4DELA 1LWIA 4QDMA 4O54A 4YCOA 3TC5A 3HG5A 3TW7A 3AIBA 4XAGA 5FF3A 1ADOA 1WPCA 3OBAA 5LXEA 3OHMB 4REQB 3DN5A 2XFFA 3BJFA 3HOJA 1LLWA 3UXDA 1JCLA 1KFEA 3VMPA 2DVUA 1WXZA 3KZPA 2XH2A 1FUYA 5A8GA 1KXQA 2OSWA 4IGNA 2PF8A 3VIOA 5D8ZA 1GOMA 1IIGA 1AUSL 1U2YA 1Q65A 1F4HA 1L6GA 3RR4A 1WQ5A 3TV8A 1VGAA 3GTXA 1M01A 1KBIA 2ACQA 3LBMA 2DFAA 1EC7A 3IK8A 2GDVA 4GYPC 1UW9A 3IHZA 4PTXA 3V0TA 5CH9A 4A8IA 4JAWA 3SURA 3W2LA 2OCZA 1GCYA 4AVOA 4P8VA 3CO8A 2FLIA 3O7UA 1UWIA 1TYGA 5CZJA 1FX6A 1PX8A 5E0FA 1FKSA 1JZ5A 5D2XA 1MRQA 3F4NA 3FA3A 1RR2A 2OLAA 1F61A 4AG0A 3OGRA 4UTWC 4L56A 1CPUA 3PBWA 2F2HA 1KFCA 3KAOA 3VOFA 3WH5A 1EYEA 2HJPA 3GXFA 4JFLA 3SUVA 3G0XA 1W3IA 3URAA 3WNOA 1GRJA 3AHYA 2CLHA 3AWNA 2LKNA 3BICA 3HJZA 4QS5A 2JK2A 4Q6XA 3AUJA 3W7OA 3WK2A 5DCBA 5G2WA 5HXMA 5JH2A 3RGTA 4PTMA 5FKYA 1VB9A 2H3DA 5LIXX 4P2VA 3NM1A 3KHJA 4Q7IA 3MT1A 3CM4A 3S8HA 4W5UA 2ZQ0A 5JMUA 1Z3NA 1VQTA 3VIGA 3QMRA 3TC3A 4M6PA 6XIAA 8XIAA 3AIQA 2W6RA 1JRBA 4BQ3A 4LUSA 4CNSA 4C1LA 4W8AA 1XCFA 1UIPA 4G50A 5HINA 3R43A 4PE8A 2CLLA 3BJTA 1Z8AA 2B4GA 3M0HA 3KAIA 3TJIA 3GXIA 3N2MA 1F9CA 1NSJA 4JTDA 3KLLA 3IEBA 1REQA 3M0IA 1DORA 1Q45A 4F79A 2BBFA 5A6JA 3TZFA 4NZ1A 4RW3A 2I56A 3UCCA 4XK2A 5JIPA 1PKYA 2YDRA 1IF2A 1THFD 3VZXA 1Q6DA 2XP3A 2GK1A 2J88A 3DCPA 2PGWA 3DX5A 3LI0A 4MAZA 3UYCA 3AYVA 3WLHA 5K4ZA 2F4EA 3MS8A 3PN8A 2LLEA 2P3EA 1Q85A 4GQQA 4D6EA 4GA8A 3WQCA 1C93A 1JQVA 3O5EA 4REQA 2HPMA 5L9FA 1P6WA 1TE1A 1IR1A 3R12A 3NDYA 1PV8A 3E0FA 3EXRA 1TO3A 1L8PA 3L21A 2ZXQA 4O0KA 4QE1A 2QCDB 3GNOA 2A3LA 2BOFX 1CZ1A 1D7FA 3M6YA 2F38A 3Q4DA 4HD5A 3REQB 2ATSA 1EPVA 1ZY9A 3QTGA 2RGLA 4KS0A 3FA4A 2UY5A 5B8IC 1DWJM 3FXGA 8RUCA 1W1VA 1ZP4A 1RPXA 3LLDA 1DJYA 4W7UA 3VTRA 1NARA 3DBPA 3C0QA 3GYCA 4IIDA 3AO0A 4D9PA 5I3HA 1ZJBA 3GU9A 1XINA 4XG1A 3E1F1 4IP7A 4LC6A 4NY2A 3W2JA 1S5NA 3WMCA 3U0HA 1RVGA 4HZ7A 1BGGA 3ARTA 1E5JA 1O4UA 3CC1A 3A5FA 3AIUA 3PY2A 1J12A 2GFTA 2OKOA 3L4WA 2DT1A 4G7FA 4LSBA 4U10A 2WNWA 3UGVA 3EA1A 2PD9A 1QVBA 1TV4A 1KQYA 4Q8TA 2YCKX 3HGSA 4JD4A 9RUBA 1IT8A 3A3HA 3LHYA 1BTCA 3UWWA 1OEPA 1U79A 2FZMA 1TTJA 1KFWA 1FWHC 1C7SA 1IEXA 3KCLA 3N6QA 5H1WA 5D09A 1EP1A 4GJIA 4TW7A 2PTWA 1BSIA 4FAPA 1C9WA 1UBSA 4PRTA 1CGWA 2OB3A 4XUGA 2H8XA 3WKZA 1AFSA 4ERAA 3LERA 5BU6A 1WUEA 3KTXA 1RBLA 5HNRA 1T99A 3W1RA 3VPLA 2VEFA 4S3BA 4JIQA 2GK1B 4Q8UA 1P43A 4QG9A 1ADDA 3BZGA 2BXVA 1I75A 1BYAA 3K8MA 4O10A 5LHFA 1KLYA 4EPKA 4WJXA 4FX7A 1HUVA 2VXNA 3ECQA 3LM3A 1T7LA 1RQEA 5I24A 5A6SA 4KRZA 1U30A 1ALDA 4JTQA 4N4PA 1A5BA 2HSAA 3QHMA 2HXTA 1FKBA 4U31A 1F73A 1ZJAA 3QY6A 3WDJA 1ISYA 2B7NA 2WVVB 2Z1VA 2D1ZA 4FOKA 4JHZA 4CQ8A 1M5WA 2DG9A 4E2DA 5CG7A 4YMZA 2NQHA 3GIYA 4Q4RA 4O1CA 1ICPA 5C2CA 3CHEA 3F4WA 4ROQA 1CLXA 1TPC1 4OBTA 4KIEA 1YPFA 4NL1A 2NZLA 1JCHB 3PZMA 3ANUA 3WQ8A 4S2BA 2D2OA 2PURA 2FZNA 4M1BA 5K4XA 4XD4A 1OM0A 3Q37A 4IG2B 1W6TA 5A8QA 3A23A 1YMYA 3BVJA 2R14A 3P60A 4S3JA 1U22A 4GI9A 1FFRA 2V2CA 3MU7A 1I1WA 3AIRA 1RAKA 5FIPA 1P0BA 3NO5A 3MVIA 5I3FA 3L12A 3UZXA 1J0ZA 1KM4A 3OVGA 4IWWA 1H09A 3WD4A 2PLCA 3L66A 3TR2A 1BTMA 2G3NA 2QLYA 4Q8NA 3WQGA 2W4XA 1NELA 5BWAA 2I7GA 1Z42A 3WQPA 4JTHA 2C71A 5BYWA 1YEYA 3TN4A 1GOKA 1DOSA 4CU8A 3H53A 3EA3A 1LWHA 4A3RA 3S9YA 3GHTA 5CAKA 1R7AA 3GG0A 3JUGA 3B9DA 1XWYA 3WIJA 2R1LA 2YX0A 3E0LA 1WE5A 4D6JA 4ORMA 1F07A 1R2RA 2VQTA 4Q8MA 2PDMA 4MB4A 2GJPA 2ZFAA 3RJYA 3W26A 4S3KA 4V15A 1V6XA 4UIOA 1GVFA 4QZVB 3PNZA 4GVIA 1NWRA 1J0HA 1Q63A 3HO8A 1A7XA 3OLEA 2DZUA 5T9CE 4Q3MA 3BCFA 4N7QA 1JPIA 5AYYA 7REQB 1S1RA 1ZJHA 4GH3A 4ZQNA 4ICMA 4PMVA 3QR0A 4PUUA 4HBEA 1M53A 3CV6A 1AW5A 4KF1A 1BEUA 2FYMA 6TAAA 4O0ZA 4ROPA 4HNUA 1OFQA 4CEXC 3SEPA 3VCCA 3LPFA 1W9PA 1F76A 3DGBA 3VNZA 1GG1A 2WV8A 4C6JA 3UA4A 2E77A 4GYPA 3AHTA 3RCNA 3KDOA 1A5AA 3UP8A 4JL2A 3SCOA 1YNQA 3M43A 4IJRA 2QEZA 5DMYA 2R1NA 4CU7A 2D3LA 3EWXA 1LOQA 4AW7A 4M7TA 3CMGA 3LG3A 4L65A 5A8NA 2NQZA 2VZSA 3OG3A 5DMNA 4DJDD 3H4WA 2ZXAA 4RNHA 1HL8A 3SQLA 2MANA 2QXWA 1R3TA 3CQJA 3K30A 1G4PA 5C7HA 2EJ1A 1G4TA 1VFHA 1JDEA 2YJQA 2PWVA 3GS6A 2NXIA 1X1NA 4DWSD 2Z00A 1NOWA 3P5YA 1A5KC 3H2AA 1UR9A 3HZ3A 3PANA 3C52A 2A0NA 5HMSA 4J3XA 2XG9A 2XVNA 3HGOA 2P8BA 1HJSA 2PD5A 2VENA 2X2YA 1OQFA 1RY0A 3AYTA 4PFMA 1HKVA 4QCEA 3WNNA 1R9ZA 1XYFA 2XWEA 3MW7A 3SSZA 5FJPA 4KGLA 1SPQA 4WLCA 1O5QA 2EPOA 1V5XA 3P74A 4OU1A 1N8WA 3VIFA 4FNRA 2XTKA 4OVXA 2VMFA 5CJNA 3CIVA 1B3YA 2OG9A 3DUGA 1JF5A 3M0VA 2DZWA 2WANA 3W84A 3VZYA 4N6EA 1JI1A 2GOKA 1Y0OA 2A85A 4CU6A 2ZX9A 3IUIA 1JXJA 3USBA 3ARZA 4OT7A 2ZXBA 4UFKA 3QGVA 1DTUA 2I14A 5FF2A 3GTIA 2QCEA 3QSRA 3GNNA 1S5MA 2AQWA 1XICA 4O15A 1HJQA 4E2OA 2V2HA 2P53A 3TC6A 3SIZA 4AWSA 1P5BA 1XPGA 5DFAA 2QCMA 3G18A 4PUMA 3PAJA 5HWJA 4HPXA 2QV5A 4BCEA 4L4LA 3PZQA 2EG7A 1HFBA 2VO5A 4B5WA 2VUYA 3UT0A 2Y70A 4IJBA 2QUMA 3B05A 3K5XA 3NZRA 2GVYA 1W0MA 4YXGA 3ARXA 1RQHA 2IKHA 1XH2A 1ZAHA 4POCA 4HJWA 5AHNA 2PTZA 6PTDA 4AMCA 3AMLA 4GGHA 1GOWA 2ZC8A 5B80A 1BAGA 4DZAA 4IG2A 4N9EA 3VM5A 4ODMA 4UQBA 1MUCA 4YTRA 1KFBA 3NQAA 3PUGA 4GPNA 2D0FA 1N1AA 4ODNA 1EQ3A 5DT7A 5AKQA 1TV5A 1SR0A 1Q7QA 4GYJA 1E1CA 4LVFA 2YBUA 4PMQA 3VIKA 3CQ0A 4NZFA 3SBFA 4IPJA 1EQPA 2Y7EA 4E8CA 3PZGA 5I03A 3VD5A 3QC3A 4G2PA 1EDGA 3WLJA 4MUZA 2G97A 1R3SA 3MHGA 4DBSA 3RRXA 1FHUA 1LL6A 3MC5A 5F2MA 5J8LA 2V63A 5D03A 2OELA 3CBWA 4QJ3B 2I5IA 4KKXA 4D8ZA 4GZIA 2B0MA 1BQCA 3UY8A 1V0KA 1HKWA 1PIFA 1O1ZA 4FIRA 4P7LA 5I2UA 4W7WA 3O63A 4AWEA 4TU1A 1XRVA 2QAPA 4S3DA 4WUIA 3TROA 1ZQ5A 3ARQA 2ZUSA 4US6A 1TZZA 4ZR8A 1SVDA 3MPGA 1J10A 3MO4A 4RE3A 2B31A 1EJSC 4PUWA 3LI1A 3R10A 1DJNA 4NZCA 4FR6A 3WDQA 4B5NA 4NJGA 2X42A 3V5FA 2MF9A 1XHGA 1PYFA 3NSNA 4Y7EA 3VKAA 3TCZA 3UZZA 4XKMA 3QR3A 5GNYA 3BW3A 2PF0A 1G67A 1O68A 3A24A 3EX4A 2PI6A 3W7QA 1ZLPA 3GHUA 5GNZA 3DFYA 1TJPA 4FIQA 4JKMA 3UEQA 3GKFA 5HMDA 4QP0A 2V38A 4JTJA 2YCEA 3W88A 4EPBC 4QE5A 4U28A 3NGFA 1FDZA 3KOXA 4OBSA 1C92A 1UH4A 2C19A 5BRPA 4J5NA 3RM9A 3FEMA 4LW7A 2VX4A 3MA8A 4QEHA 1B90A 4ZBCA 2VZUA 4QJ5B 4BQ2A 2Y85A 3QFWA 5F2GA 1RCOB 2EKCA 3ZLGA 3NZQA 1J11A 3W75A 4DF2A 4W93A 1H51A 3ORWA 4F2BA 4QAWA 3IWPA 3MVTA 4HNOA 3LK6A 1WZAA 1JZ8A 2ZZ7A 2WWCA 1I9CB 1SZRA 4IPIA 3S2JA 3T44A 2F6KA 3H2CA 5D8WA 4CQBA 4BF8A 3FSUA 1QPOA 3S5SA 3AALA 3SDOA 3ZT7A 4N19A 4IMDA 5AOUA 1I2PA 3PWGA 1S5WA 1UMLA 2P1FA 2V3DA 4O17A 4Y8EA 5D2VA 4JZ5A 4NAEA 4WKHA 2PC8A 3SCNA 2NUYA 5AY7A 3R94A 2DT3A 3PZ9A 3TTSA 3TN6A 1F74A 5HR6A 4A8LA 3TDBA 1PEZA 2WCSA 3H26A 2QJGA 3IIPA 5A5WA 1POKA 1E73M 1XDJA 3STPA 3WJYA 4GZJA 4DT4A 3FCPA 2BHYA 2X0YA 3VK5A 3GY1A 4JTLA 3RF9A 3U57A 4CD6A 2O4MA 1POJA 4LF2A 3UVAA 5FSDC 2EJAA 4ZQOA 3BWWA 3RYSA 3KW3A 3S5ZA 1U33A 2QGYA 3MP3A 3R0UA 2WKJA 1MO0A 4HNVA 2NXHA 4Q4SA 5I6SA 2GJRA 3SUSA 4LU0A 1Q6HA 3T05A 4C1KA 4AF0A 2W66A 3NJ3A 1HQTA 3H21A 4W84A 3PPGA 3BH4A 1QASA 3IK4A 4DN1A 4XZHA 1B31A 2QZRA 1M7JA 2PLJA 5IBXA 1UJPA 3DXIA 1GZJA 3M47A 2ZX8A 3DI0A 1DTNA 2DZPA 4WSJA 1JXKA 1E4NA 2CU0A 4JX5A 1G9HA 1H7NA 3TWBA 3FHAA 1A47A 5I3DA 4TTUA 4A29A 2PDIA 1AW2A 2HISA 2VYOA 2P5NA 3EWDA 3LOTA 1CECA 2WJEA 3UJ2A 2FVLA 3CLMA 3S2NA 4KWWA 3DDMA 2YXGA 4QFUA 3LXBA 5K9DA 2WQDA 1V6TA 3INPA 4XBJA 2O0TA 4G56A 1RHCA 4IIEA 5LGZA 3TYBA 3WQEA 4MNKA 4DRIA 3EYPA 1AJ2A 1NFPA 3QEZA 1TWSA 3KAGA 1WB0A 3VU2A 2N87A 2CC0A 2HEJA 1G69A 4J27A 3ZT5A 2WMIB 4AY8A 3RLHA 4Y9NA 4GBUA 3A4XA 3WSUA 1R3QA 3MUZ1 4V33A 4C60A 4PSRA 1QNRA 3PF3A 5IDZA 1K3UA 4RV3A 3AHZA 3ANVA 5BXRA 4DM1A 3IJQA 3XIMA 5I5RA 2QS8A 3U7BA 1UZ1A 1OHLA 2GUYA 1TTIA 2PU1A 3C2YA 1WO2A 3EOSA 3SGZA 1OCQA 2JEPA 4WSHA 1HP5A 4JYSA 1UKOA 4IFOA 3U5YA 2PGRA 1AVAA 3ZVHB 2PWDA 4IQJA 2ZRXA 1KFKA 1KC7A 1PTDA 4LYQA 3QKZA 4E4FA 2IPWA 1FDYA 4K7VA 3GVRA 3BG5A 3NTPA 2ZTKA 1REQB 4JCLA 1AQHA 1O94A 1W3LA 3W7PA 4UCFA 1Y5VA 4GD0A 2DPEA 3COTA 3GHRA 2PBCA 5G4HC 2AQOA 3GM8A 3CB3A 3NQGA 2OODA 1Y7VA 2XVPA 5DELA 3IVSA 2YL9A 4UFIA 3VDCA 2DT0A 1E5NA 3GX9A 4HCLA 2CBJA 1QDSA 1B9BA 1AODA 1H7OA 3NNTA 4LJ3A 3OODA 3GSMA 1U83A 1DWIM 2Z27A 5C54A 1LQAA 3CAQA 2EO7A 1F3EA 3WF1A 2Y8UA 2PTYA 4DQWA 4UTTC 5D30A 1VIWA 2WMIA 3LCGA 4JNYA 3GH7A 4DYJA 3PNUA 4O52A 4IPXA 4PH6A 3L0GA 4HSNA 1A5CA 4B92A 3JU2A 1SJDA 2ACSA 4AFYA 3E0VA 1XLGA 3LHTA 1UD6A 4UMAA 1MVYA 3TIMA 3S9IA 3W38A 3AC0A 4I7VA 3N12A 2A3CA 2RAGA 3VIIA 3TQ0A 3TEVA 3PBMA 4RDYA 4C6BA 4WKFA 3O15A 3Q2DA 1TVPA 5A1AA 2PCEA 1NDWA 1QNQA 4ZOCA 1YBQA 1YATA 1WCGA 4CCEA 1X7IA 4B4FA 4M24A 2GGGA 4GISA 3DKLA 1YTEA 3EOUA 4J35A 3TSBA 1B30A 5HQLA 2HROA 3V35A 4ZPTR 3NQVA 1VFUA 4KEZA 3E5BA 4JKKA 1XRSA 4S3CA 1W1ZA 3QQ0A 1B3VA 1XV8A 4HK5A 3UG5A 2VZTA 1JZ2A 1F4AA 3O5LA 3E6EA 4NX0A 1C8XA 4CCCA 3WFZA 1RQBA 3NQFA 2DH2A 1WAUA 3LU2A 4H8VA 4CNTA 2QW5A 1JCYA 1S5TA 3PZOA 1GVRA 1UP3A 3WH8A 1H0GA 2OSYA 5D02A 2VD8A 5DXYA 1GOOA 3PB0A 4I8DA 4GQRA 2DV0A 4AZ6A 2V5DA 2XSAA 3VMNA 3WBAA 1GQKA 1LYXA 1MEIA 1PB0A 4LS0A 1L2UA 4RZ5A 4X0VA 2QHAA 4GX9A 1W9VA 1FWAC 3UWEA 2G4JA 3W7CA 3E3HA 4M6QA 2XSXA 3WBWA 4DJDC 1V03A 1UR3M 4XIAA 3GUGA 3E0WA 3VIHA 2MNTA 4L4PA 3AZSA 3RCYA 1TUXA 3BOLA 1XIHA 2MLXA 1T8XA 3FKKA 1WDDA 3CGNA 3VKCA 3UXLA 2Y24A 1E71M 1V7AA 3EAUA 3H6OA 4EXQA 1QO2A 2OJPA 4G2DA 2NSOA 3M0MA 5KMYA 1QXLA 5E70A 3LCIA 1M7XA 2WZIA 1Z32X 3BG3A 5JBFA 1XIIA 1UH2A 2BXYA 3ABRA 1RCXB 3M1ZA 3NURA 3R89A 3THAA 2RUSA 3KS6A 1K8ZA 3AJXA 2BSLA 2A3BA 4BWLC 1KM2A 1PKLA 4JN7A 5E93A 5HJXA 1H2JA 1XX1A 3LPGA 3MCOA 1CGXA 4FLQA 1IHIA 3V1PA 1X97A 3QY7A 3W86A 1CB7B 4QIUA 3APGA 1V02A 2PN0A 4JTFA 4AY7A 2BS9A 2NVCA 3N04A 4ATDA 3BL3A 3K46A 2VRQA 1CCWB 4LC8A 4W9OA 4MG4A 3KXQA 4F0MA 1U5VA 3B8SA 3ZXWA 2PP3A 2VZVA 1BVNP 2G3FA 3EBVA 5CC7A 2EPNA 4PUKA 4YTSA 1ISWA 4IGMA 2WOQA 3WH0A 3O5OA 3EX2A 2PODA 2Q3OA 4LUTB 4O1EA 1T96A 1M03A 1QPNA 5CEWA 3PWAA 1O5XA 2DQXA 2XJ7A 4MWAD 3IAQA 4TVCA 2Z2AA 1AJZA 3AI0A 3DC0A 3OA3A 3MP4A 4YTTA 3GNXA 4RXGA 6CGTA 2FDMA 2V68A 1W5MA 2C0AA 1QHOA 3AS3A 1Q3NA 1VBRA 1IX5A 1R2SA 3VKJA 1VP5A 3WUBA 2FFIA 4B91A 2Q8LA 1L6WA 1YE6A 2YBTA 3OU8A 1ZAIA 1KCZA 5D2WA 2PDJA 5MKGA 4FX6M 2NV2A 3UGRA 1ONRA 2NWRA 3A4JA 1E4LA 2E6FA 4PMUA 3RHGA 5KTLA 3TNOA 1S2AA 4WY0B 2VC9A 2W61A 3NDZA 4JFWA 5K3VA 2BXZA 2PDYA 5FF7A 1Z7AA 4FNTA 5EFDA 3DFTA 4GFSA 1EC8A 4F66A 2A21A 2FZ9A 3ERPA 3DYMA 3PSWA 1EZWA 1TTPA 3M5VA 1XI3A 4RE2A 2OEKA 3PTQA 2PPNA 1WXYA 1AH3A 2V3FA 4H9ZA 4WVXA 1GKQA 3WBYA 5I3GA 3TTQA 4AEEA 3TYCA 4CEUC 1N55A 4HT3A 1YIXA 5REQA 4H3DA 4R33A 3GDRA 1ZK6A 4WGHA 2DSUA 5I3JA 4BY3A 5IHSA 3KBJA 1RLDA 3IVUA 1QR7A 3EPNA 3SM0A 2GSEA 4D71A 4MY9A 1XL9A 4ZMGA 2OWXA 1D3GA 3EX6A 3W37A 3VFLA 2ZRYA 2QQ6A 3LCXA 4XISA 4YYFA 1ZL1A 4TMBA 5AFDA 4JBRA 2QPSA 1KXHA 1SZEA 4Y8FA 4YHGA 2C1HA 2Y1HA 3E96A 1FWIC 3MB9A 4GQ0A 3N14A 4OECA 4NQ1A 3T07A 3QZEA 1NDZA 1XJBA 4GJJA 1XLAA 5HDRA 3BV4A 5EMLA 3ARYA 3ITOA 4RV8A 4HJFA 4HP5A 4MWAC 4F3HA 4BQ4A 3QSTA 4GINA 3TP4A 4ZB5A 2E68A 3C5QA 5LNRA 4ZTXA 3WQ6A 4K8EA 5B7YA 3OG2A 3QC0A 5I98A 4MPKA 2A3EA 2QVHA 4ITZA 4HN8A 4IGSA 5ECVA 1UA3A 5EYWA 1I4NA 1D7KA 4AXNA 2J4GA 1Z69A 2VC5A 1GHRA 2QDHA 2FTPA 4ZZ9A 2C14A 1KXTA 2YZRA 2BWGA 1IWAA 4S38A 1Q2RA 2DJXA 4LFYA 4Z42C 3H9RB 1EEXA 2UZ9A 4Y2WA 3H7UA 4FNSA 4LY8A 4C6MA 3AXKA 3LLFA 5LA0A 3TYZA 1EBHA 1X1OA 1Q6CA 4ATWA 3TOYA 4YL2A 4GKLA 2VCCA 4KERA 5EL1A 1OX6A 3O5RA 1EP2A 3K8LA 4QNWA 1H11A 1G4EA 2TAAA 2Z28A 4H1ZA 3ZO9A 4PFHA 2EGZA 2KAUC 1W31A 1VCVA 1M7OA 1SFSA 8CGTA 4AWTA 3MUY1 1HG3A 1EYWA 2REQA 2QCCA 5F2IA 3EEGA 3ZWTA 1V51A 4H00A 2Z1SA 4E0CA 2XZ9A 1X6LA 1PZ2A 3V3WA 2REQB 2VKZG 1IT0A 1QOXA 1WKFA 2R91A 2OYKA 4Y9MA 4W85A 2CHNA 1Y8BA 1SMDA 1EWEA 2WM0A 1V3IA 4LAZA 4J4OA 2PA6A 2FMOA 1WBJA 5AYBA 4KWUA 4Q4QA 2OR2A 1TPEA 2CITA 3P14A 1E43A 1MW2A 1O5RA 3GFXA 2QR6A 5E09A 4UMBA 3PUEA 1H50A 2HBVA 3CPRA 3E74A 5ABGA 1FCBA 3GH5A 1OGSA 2PPOA 1XSIA 1TX2A 3SCVA 2VDHA 2GDQA 5TBOA 4HBOA 1UROA 5KZDA 1TCMA 3AICA 1MXSA 4WKAA 3WEMA 1WOBA 1SFLA 3L2LA 3N1AA 2VTFA 1PDZA 4A05A 4J3UA 2XH7A 3NEVA 4ZB0A 2UV8G 3IVTA 3HA1A 4LCRA 1H3GA 2ATMA 3EPOA 3FGCA 4NJKA 4F0SA 1FTXA 3VC6A 4ZFMA 4ML9A 4W9QA 3M0KA 4C6CA 3ITXA 3STFA 3YPIA 1GVEA 2PDBA 1AMKA 3M0ZA 4AZCB 4EAMA 1UD3A 1GONA 1JPDX 2ZC1A 4HPJA 1FKLA 3MYPA 4DJEA 5ABTA 1VFFA 3FFSA 4OUIA 5FAJA 2XWDA 2VFGA 4QIBA 3O5MA 1E9LA 2XIMA 5AHIA 3BPWA 1DJHA 1GJWA 3G8EA 4MKSA 5AHMA 3CAVA 3K8KA 1W8SA 4Q8PA 3GKAA 1SFTA 2WMGA 4LEQA 4F9JA 2HNHA 5CCZA 1H62A 5FEPA 4TTGA 3S83A 2E1DA 1Q6EA 2ZZ2A 5JH8A 1YPXA 3T4WA 2AGKA 1VHCA 3T6CA 1OSEA 2WCGA 3A13A 3BAKA 2GLKA 3MBFA 4JDBA 3P81A 3HU7A 4MNLA 2XFRA 1NP0A 2GQ8A 1GJPA 4GYKA 3BW4A 4D1IA 1ZP3A 3BCJA 3M0YA 1C9DA 1OCNA 1TWZA 2A6LA 2NT0A 2QCLA 1J18A 2Q8ZA 3IAPA 2PWUA 5HKGA 3WQVA 4S2CA 1OG6A 1T41A 1MW1A 3W81A 2Y8VA 4WRHA 3ZVIA 4BI5A 5G2IA 1DHPA 1MEWA 5TF0A 3GC5A 4DO6A 3W1NA 1RLCL 1NWSA 3BGJA 4E6MA 1K8YA 4HGXA 1IGSA 2WJZA 2YDQA 1GYLA 1TMLA 4NAFB 3URNA 5DCEA 1VFLA 1SJBA 4MTVA 1UIOA 2UZ5A 4GFIA 1OX4A 1UHVA 4OWGA 3PZNA 1D3HA 3G1SA 1TPH1 1US0A 4CN4A 2HNEA 1O95A 3V36A 4V27A 4MAVA 4NXSA 5A8MA 1OYCA 3Q94A 3VGBA 3CB8A 3IRDA 2G8ZA 4AEFA 4HYVA 3JS3A 3OA5A 3GC4A 3WH7A 3UA3A 5HA7A 2BVWA 1HN1A 2PBGA 3BMWA 2WAGA 3ZWSA 3EY6A 3PP7A 4J3TA 4I5XA 2J47A 2PV1A 2OEJA 2BGQA 4BFAA 3S1VA 3SGUA 1XXXA 4E2BA 3JYJA 3FAWA 4ACZA 5CLWA 1XIDA 1K70A 2AKMA 4BKNA 1PL9A 4LNYA 4JY8A 1IV8A 1Q66A 1JAKA 1JDCA 3HMCA 4A3QA 3B4UA 3KDNA 1VPYA 4L61A 2CLMA 3NGJA 1YDVA 4NNAA 3I65A 1TVNA 1KRMA 3EDFA 3LHUA 5FD0A 1JCNA 3KVLA 4H19A 4NUWA 4DJDA 4ZE5A 1SW3A 1XLBA 4DPQA 1NQKA 4NZ3A 3VZZA 1C90A 2RKXA 1P0NA 4QTGA 3L5AA 1OC5A 2PCQA 1H0IA 1BGAA 4W8LA 1XLHA 4L3NA 2E7FA 2ZCGA 1PZ3A 3POHA 1YLVA 1RA0A 3N34A 4DWSA 4IP4A 4R0XA 1QI2A 4U2YA 4DJEC 3M4HA 4C7FA 3NFUA 2L5HA 1XSKA 4W88A 2UY4A 1WZKA 1W2VA 4D6CA 3EPMA 3RU8X 3W00A 2ITKA 2VVSA 3T0DA 1SZNA 3W0KA 1E51A 3TSDA 4U84A 4X63A 4R5EA 5B7ZA 2JZVA 3TFXA 4GZ7A 1V8EA 5DRIA 4LY4A 1CTNA 2Z2BA 5H2ZA 3EMQA 3SGGA 3E38A 1YNYA 1SO5A 3BGGA 3FDKA 5A8PA 3EDKA 4L6OA 3HPXA 1NWUA 3UQIA 2OKTA 3REQA 4RKAA 5EMMA 1R30A 3E2RA 2R82A 4C6DA 2AMXA 3HIJA 4JFKA 3TZNA 2DW6A 1I0DA 4HNLA 4UB9A 1SSGA 3CV2A 5KSWA 4QSHA 1QRQA 1FKRA 2HWGA 2OFNA 4S39A 2H9AA 3GK0A 3WLIA 2VR2A 3FN9A 5AZ1A 1XG4A 3G1HA 2AQVA 4QQUA 1M7PA 4ZQPA 2PRMA 4FNUA 4NVTA 1OIFA 3N25A 4IL2A 1OX4B 3H4GA 3EXSA 3T40A 2J62A 3K4AA 2FQIA 2A6NA 5FF4A 2WC7A 1OG0A 1L1PA 4IQLA 3IJ7A 4UUIA 3LD5A 3AYRA 4ZL1A 2WC4A 1W3JA 1AD4A 4PRRA 3DC8A 3GD6A 1SO6A 2Z6JA 4NSBA 2CCRA 3D47A 3VA8A 4IPNB 3V5OA 3NO1A 5HMEA 2ZX5A 3MMTA 1OCBA 3WDRA 3HF3A 3KUMA 2YSWA 2CETA 3W7DA 1VYRA 4URIA 1B6CA 1CGUA 3ITYA 4CVWA 3F2CA 3AMDA 4A22A 4JKLA 2GGJA 3MHFA 4LUJA 1K6AA 1VYSX 1KLZA 3RMJA 3F03K 4Z1CA 1HKMA 1JF6A 1UP2A 1VFMA 2F6UA 1IEWA 3B0PA 3PULA 3BLOA 4QNEA 4EWJA 3T0AA 3PHAA 3J7HA 3WK1A 3TXZA 3G5EA 1HP4A 3SCSA 1Q5MA 3KFTA 2WM1A 4K37A 3WCZA 2H8ZA 4EAYA 3W7LA 4IIBA 1FBAA 3UPBA 2JF6A 3IV3A 1XH1A 3NTYA 5AVHA 1B4KA 3L4ZA 1JNTA 3L4TA 4CD4A 1OZQA 3NOEA 1TPDA 4I9JA 3VGFA 3WEZA 3PFMA 2E6AA 3GLCA 2Z4GA 3C3UA 1R3YA 3OOQA 1E6XM 2PDKA 4DO4A 1IEQA 3C61A 3UI6A 3M5XA 1SZFA 1UQZA 2PPGA 5A6BD 4AZHA 4K38A 4J4KA 4J1OA 6A3HA 2RDUA 1HTIA 2QULA 3CUHA 1L8NA 5A6MA 3MSRA 5I3IA 1NY1A 2PC4A 1TWIA 1XLCA 4OIFA 2XGZA 4S23A 1E6RA 4NZ5A 1ZCNA 3WN6A 3I3DA 2ZQTA 1V6YA 3CZGA 1DL3A 1LORA 1U1JA 4XV0A 4B3LA 5EMUA 1H5VA 3TUUA 2G0WA 4DY1A 3A9IA 1EHAA 1E0XA 4DRMA 1CXFA 4GXMA 2VHLA 3MDUA 4FF7A 4ORIA 4PMNA 1L9WA 2XSBA 4XZLX 3ZYZA 4M6VA 4DZ2A 5CGTA 1W26A 4KEMA 3TLQA 2GOUA 4A2RA 3BAIA 2PWHA 2EBNA 2Y2WA 3D46A 3ZR6A 4CQAA 3PRDA 3GVWA 3OO2A 1VBGA 2D23A 1EFZA 1ITCA 2ABAA 1MUWA 4W9TA 2GQ9A 2A7RA 3N18A 3EKLA 3TJXA 3GNRA 1XIGA 2DVTA 4YIWA 1V0LA 3A21A 2J7GA 1TPVA 4JHMA 3DECA 3T0CA 1NMVA 3CPGA 1NFBA 4W87A 4O57A 2Y89A 4V2XA 3QGAC 4KFNA 1EUNA 5CPSA 5AB3A 3EWWA 5J6EA 3QH2A 5LA2A 3CL8A 3CH0A 1NFGA 2GDUA 1Q4WA 1XKYA 3EDEA 4CQDA 5A6LA 3B8WA 5A94A 1EYMA 5IHRA 4I6KA 2O7SA 3IANA 2FDSA 1AH4A 2RDTA 3WQ5A 3S46A 2X0SA 3I7SA 4Z1YA 2D24A 2VDGA 3SRKA 4U4MA 5G1TA 3C0LA 4MLJA 1P6CA 1AL8A 4H9YA 1RUSA 3W7IA 3NQMA 4B5UA 4JFUA 5IDIA 5BRBA 2C15A 2BG5A 1JQXA 2R9RA 1JGMA 1BKFA 2I17A 1E6QM 4UFMA 3EXTA 3N2XA 3DAQA 3M16A 2RHGA 1M41A 3IJDA 1OBAA 1V6UA 3BAYA 3N3TA 3QKEA 3RGCA 3FY1A 1EXBA 1K02A 1VBJA 3QFEA 4UQDA 4AD1A 4CKQA 5C0QA 4GWEA 1LWJA 3NEHA 4HOWA 2H6RA 2CFFA 2OWWA 3LLXA 3VKBA 4U85A 4H6RA 1HKKA 1JCXA 2VDIA 2F84A 5H6HA 3GZ3A 3MUIA 4LCSA 3CZEA 1IZJA 4QT3A 3DU0A 3EDJA 4NZ4A 4PC8A 4I9TA 4WJEA 4LYKA 2O4QA 3C8NA 1Q6QA 2YYUA 2FH6A 5JVLA 3N29A 1TVLA 3OEXA 4C6PA 1UKTA 4BF5A 4GRSA 4QQ3A 3PZIA 1DPMA 3LGDA 3OZYA 2GJLA 3WD2A 1N82A 4UQCA 4QCFA 4R27A 3S2LA 1DIKA 3BLIA 4JFMA 3MANA 5C5YA 1TV7A 4IF2A 2IF4A 2QPXA 1TQXA 2J66A 3PUDA 3SUUA 3A4AA 1JNSA 5A6TC 3AU6A 1J0KA 3O3RA 1GYNA 1R9YA 3EB2A 3E5PA 1JYWA 5A95A 1E0TA 5JQ9A 5J5RA 3H55A 3IJ9A 4X2RA 4TNSA 4AIEA 3L0KA 4B15A 1R0MA 4PCFA 2XDFA 5C2XA 4ZPWR 4IX0A 3SSJA 3W28A 4X3ZA 6ALDA 3DHPA 3IUHA 2V8ZA 3I10A 4ZO9A 1FWBC 2W91A 5AC6A 5DITA 1UQYA 1YBQB 1CX9A 4BQ5A 5KZEA 3SRFA 3VD9A 1HO4A 3S0CA 3GDLA 4M0XA 5KITA 4KRUA 4AIBA 4D1JA 1GZ1A 4XZNX 1IEIA 4IQEA 1FJDA 2WZTA 4BR1A 1XLMA 3CHDA 3QRHA 5D32A 4YVXA 4BI6A 3ME3A 4EIVA 2E5CA 3TYUA 4H9TA 3SCRA 4B5SA 4XBKA 5IOBA 4YCPA 1HGWA 2ALDA 1PXGA 3AMGA 3NXFA 2OLHA 3LPOA 3QYSA 7ODCA 3NQ6A 5MHBA 5BRQA 2J9ZA 3LZ5A 1WYIA 4H8UA 1EB3A 3BCDA 3ALGA 1AH0A 1C7TA 4IPPA 4OV9A 1YW5A 3TMQA 3BAWA 2MLZA 3VINA 4X2PA 3BUVA 5FL1A 1ZTVA 5G4EA 4HZ8A 1JG9A 4JEJA 2G95A 1JEZA 1GW1A 2HDJA 4NKCA 2NVDA 4WHBA 3A22A 1R85A 3RLVA 3VKDA 1T40A 4OV4A 4LQ1A 1FXPA 2X8RA 2NWSA 1PYMA 1ZSXA 4AC7C 3B8IA 1V0NA 4C6OA 1P1MA 1BWKA 1LUCB 1XIEA 4CUCA 4GJ1A 5DCDA 4O4VA 4PGLA 4LUIA 3WF3A 1JPHA 1XDMA 4LAUA 1MNZA 3PRBA 2B7PA 5LYRA 3L23A 3ZLFA 1FH8A 3RFAA 1A5NC 4GUJA 4JN6A 3M6DA 5DT5A 1J6YA 4I3GA 1IXNA 2VC6A 3MKKA 3G1AA 1IWBA 4K1GA 2QCNA 1S2WA 2CESA 4OBRA 1H4PA 3I7RA 1FWEC 5C6MA 3IJLA 2IPGA 3UERA 1EOKA 3LGGA 3OW1A 5GJPA 2QJMA 5MF5A 4Z2IA 3PB2A 3BXWA 3TN5A 3PG9A 1UC4A 4MM1A 1J0JA 3KWSA 4H6QA 4ZOAA 5DBTA 2G3IA 2VT0A 1B3WA 3QW4B 1JD9A 3PUOA 4I9MA 1JJKA 4M82A 2HRWA 3CUFA 3W73A 4OFCA 4LAWA 3R8RA 2GJXB 3V1HA 4ZENA 1FVPA 2P88A 1KCKA 3KAHA 3GAKA 1HGYA 4OTKA 4RDVA 4ACYA 3MO7A 4XAYA 5LNVA 1VBHA 1WP6A 1TV3A 3GDKA 4G7EA 3CQIA 4CNNA 4PEKA 2P0OA 1OD0A 4XKYB 2VP8A 2TSYA 3GDBA 2R1KA 5FACA 4YTQA 2V5BA 1L6YA 3VM7A 3W6LA 3L5MA 4MGVA 1C8QA 2PS2A 3N19B 1GOQA 2ZVRA 4QLKA 4JICA 1GVSA 1F6YA 4L4OA 2ZQUA 3M41A 1EX5A 2VD9A 3LSCA 3EWZA 1A3WA 1VH7A 4GCAA 4WY0F 3TQPA 3KVKA 2AAAA 4Z2HA 3W87A 1DJXA 3E49A 5K9XA 3PJUA 4WD0A 1M68A 3UR8A 3EB4A 2XH0A 3VGHA 1UKSA 4KH2A 3VD4A 3GPKA 4P8WA 1LF1A 3ELFA 3USZA 3JZUA 2PEVA 3R0DA 4ZXLA 2D0GA 3EIPA 2X30A 2ZZ3A 3TFCA 3R0KA 3M46A 4KCWA 3KADA 3R79A 4JTAA 3TNBA 1X38A 1LCOA 1QT1A 4PUDA 1KGXA 2X1UA 3QY8A 1JUBA 4I7UA 2Z25A 1PKMA 3W3OA 3AAMA 1SU5A 2O55A 1K7XA 1E1CB 1I45A 3HJEA 3ARVA 2ZQVA 1FRBA 1GYMA 3C6CA 4N6FA 4EE9A 1G6CA 1IGWA 2GVLA 4C1NB 3P84A 1P0KA 3RAOA 3W22A 3TQKA 3CAKA 2EQDA 1ME8A 2FVKA 2YDAA 2D69A 4RPQA 4R7JA 3B8TA 3UBPC 7PTDA 2I1OA 3W23A 3WYZA 3DHDA 1HL9A 3UWZA 4D6IA 4H04A 1ZENA 3LTSA 3PG8A 4MDPA 5T26A 2VNCA 3CQHA 1UWUA 5C9RA 1WZMA 3BE7A 4RNFA 3IIVA 1CXEA 1EIXA 4IQCA 1ZBVA 1RY8A 1E4IA 1BWVA 4NT0A 3W7HA 4O11A 2Z7KA 1A80A 4O14A 4IUGA 2ZQSA 2LPVA 5LIYX 1KD0A 1R9XA 2IQDA 4DRPA 1VLIA 3OPSA 1GQLA 3A3WA 1X8FA 3MI2A 3MKVA 4H7VA 1PHWA 4GCXA 3C2VA 1GOIA 3SADA 4MWAA 3LUOA 1GKRA 3C4UA 4X0NA 4EPEC 4UXDA 3URQA 1QTWA 3DFOA 3LHWA 3UPWA 3GNPA 4C02B 1O6IA 2EXOA 3GW3A 1GUVA 4LALA 4Z1BA 4NIRA 3MV01 4DI9A 1KBBA 4LGXA 5CC5A 2CWNA 1PCWA 4PTWA 3UU0A 3U4FA 1WKDA 1DE6A 5IM51 2A7PA 5CPNA 1TE6A 4GI4A 4MJ4A 1W3NA 2OFJA 4ZVJA 4HVXA 5FEXA 2FJKA 4C5ZA 3KOWA 3LXCA 2CLFA 4XTDA 4NJHA 3NWRA 4ICNA 3KEHA 1W1A1 4IXHA 4G6CA 2INZA 1SR9A 3CT7A 3LCHA 3SIMA 4C6KA 4LF1A 2UWFA 3WMLA 3AIEA 3FV9A 3FA5A 4Q32A 2PDHA 3LQLA 4DB7A 5DBUA 4BK9A 2DIKA 1XYBA 3GWQA 4U5IA 2XP9A 4HSHA 1FWDC 3DFPA 5ABFA 4L1GA 4RLIA 5KZ6A 2CLPA 3FVDA 1E70M 4I7WA 2VR4A 4RPPA 5AZ0A 4Z17A 3RN6A 1P4CA 3W72A 4QDPA 3R4IA 3RDKA 4UNKA 3CL7A 1HW6A 4B5XA 4B9ZA 2XPAA 4D6GA 2BTMA 1UA7A 2J75A 3OVQA 3QLLA 1TWDA 2J77A 4LEFA 5GJNA 1ADSA 4HTBA 4XO7A 1GHSA 4ZPVR 4JHOA 1TMQA 5EB8A 1YTDA 3K4WA 2OPJA 3PFRA 1UZHA 2ZKMX 3WH6A 1LRQA 1TPB1 4G8TA 3WF4A 3WQFA 1TB3A 2DSZA 1B4EA 1V7YA 3PR9A 1VEPA 5HBFA 5EA9A 5HW8A 1GT8A 4JTGA 3GFYA 1MMFA 5HK4A 3KP0A 2A79A 2XPBA 2X1IA 3IACA 3T8LA 5LIUX 4ODKA 3W7EA 3W29A 3QMSA 4AYSA 5LNUA 2Y78A 2BY0A 3C2EA 3VCNA 1W17A 3B8VA 1HJUA 2ZRUA 3HN3A 3UCQA 3QPYA 4GVHA 4R34A 2WSRA 7TAAA 3OTRA 1JRCA 1TKKA 3W1QA 3M0XA 1QW8A 5EMKA 2EPKX 4FX8A 2GGIA 1AMYA 1X7FA 2YL6A 5CBBA 1CNVA 2FIQA 3U3HA 1GWJA 3NR0A 3WFLA 2KGJA 2EKGA 4QE4A 1F3XA 1E55A 1H60A 4RE0A 2E40A 1Y5WA 3JXVA 5D38A 4XUYA 1NEYA 3ZR5A 3AS1A 4CD8A 3DFQA 2VRJA 2Z1BA 1H1NA 3LZ3A 1A3HA 3RO8A 4K8GA 1BD0A 3S1WA 5D9PA 4JQ2A 1GORA 3LCWA 4C6EA 4FXFA 3AIVA 3EOLA 1VS1A 1OB0A 4D6DA 4HSOA 1AW1A 4JTKA 4XTIA 4HPNA 4ES4A 4AX7A 1JULA 2QV4A 3JYMA 2KE0A 1EDQA 2NXGA 2CZ5A 1UD2A 5E6ZA 2HCVA 4JTEA 2FGBA 1OFEA 5LSMA 1Q8JA 3F4CA 2ISWA 3ID7A 1LRNA 1EF3A 3AJ7A 4GE8A 4XZMX 2VFEA 3H70A 4FP1A 5A69A 1XLDA 3CUIA 3QVQA 4TX8A 2NV9A 3P2VA 1OFBA 4O1BA 3THDA 3OIXA 2QT3A 4F4RA 2I16A 1V6WA 1EPXA 6ENLA 4K68A 1PJ9A 5LZLA 3UPMA 2AKZA 4A2SA 3GZAA 1VYPX 2WK2A 1W37A 4LYPA 1DJQA 5DY3A 4GGQA 1V08A 4O1AA 1MFVA 3FXYA 3ZIZA 3FK4A 8TIMA 3QZAA 4H6KA 2POTA 4DRKA 4N4QA 2VRKA 2ZUNA 1R87A 2CZFA 3MWAA 1NOFA 1Q6LA 3SB0A 1O12A 3PS7A 2BY1A 1UG6A 4B90A 1QFEA 1X1ZA 4H01A 4AVNA 1V3JA 2EG6A 5XIAA 3EWBX 1O66A 1PDYA 1NVMA 1J0YA 3A12A 4UZUA 3W7MA 1FKHA 2OU4A 4UR8A 5C71A 1EC9A 4MFDA 3PC0A 4WDTA 4YWIA 3ARUA 4H83A 4D8LA 5BMXA 3OBKA 2WPBA 1E3XA 4C90A 4LS2A 2FGZA 3CZKA 4DNHA 4TV5A 3URBA 1GG0A 2IPFA 3II1A 3VC5A 1ODZA 3LMYA 3AZTA 3UESA 1F3WA 2FZDA 4C6NA 1V4YA 1FKIA 2WBKA 3HV9A 4QROA 4O8RA 4DRSA 1FY6A 1QPLA 5H91A 4UBPC 4PBGA 4PRWA 2WSYA 4NYUA 4FPSA 3UWQA 4WK9A 4XBSA 2E6DA 1KB3A 4QG6A 4ECLA 4NZJA 5K2ZA 3T08A 5AECA 3MV11 3IS4A 3DYPA 1FKXA 2YB1A 3HURA 3O5KA 3S6DA 3QF0A 3KCEA 3IRSA 5LKYA 1ZBKA 1UD8A 4FLSA 1XYLA 3CWOX 4ZO8A 1RBAA 1Q6UA 3CUXA 4S3GA 4HOZA 2E28A 5AYXA 3LTYA 4JXCA 2OZ0A 4DRNA 4NRSA 2RUCA 1XW8A 2A1YA 4XSLA 3V7PA 2OTDA 4NXKA 3T2PA 2NVAA 1DJIA 4LBRA 2AL1A 3ABQA 3UI4A 1O1HA 1NJJA 4MB3A 3W7KA 5H8MA 1DQUA 1OFPA 2FTYA 4IOTA 3LQGA 1PSCA 2B7QA 4NI3A 2D2GA 1V6VA 3STGA 3SCTA 4FLRA 3L4YA 1XKJA 1UZ4A 2V30A 5D9MA 4GACA 3MWCA 3DHUA 3SFWA 5DO8A 1PX4A 4M3PA 2WHLA 4NF7A 3PJXA 3C3NA 3KZSA 4QT2A 1I2RA 3OLDA 5D4YA 5BXJA 4R85A 1ZNNA 2ZYFA 3QMTA 1XH0A 4DO7A 4ZOEA 1EA9C 2TODA 2F8QA 3NIYA 2X7WA 3N15A 4F40A 1BWLA 1GW9A 1BG4A 3VIPA 1KNWA 3A64A 4ZSUA 3TDFA 4PCSA 3THQA 3S5OA 3T09A 4LAYA 5F4SA 1CGTA 3IV8A 4N0RA 4GIEA 4J28A 3U2OA 2HQAA 2RJGA 2OEMA 3NPVA 3NQCA 3QPEA 1KO0A 4LAKA 3BLPX 1PKNA 3PZUA 1PHQA 2WXDM 2LJ4A 4P7OA 2ZICA 5JBDA 5FESA 3E9AA 1QPFA 2E1WA 3ARSA 3I3BA 1VHNA 1GPWA 1V79A 4IIFA 3V0UA 3B3DA 4HU3A 2HE8A 3VGEA 4WXYA 4CQCA 3WLRA 2ISDA 2PDNA 3KAFA 3T0BA 5JBEA 3P0WA 1HL2A 3HPAA 1H7PA 1XYMA 1XYZA 5CG0A 3RM8A 3G3MA 5HNNA 1L2QA 3OGSA 2XM1A 1SJCA 1QI0A 2D2JA 1PO9A 2VR5A 2VJXA 3UR7A 2ZUMA 3AXMA 3B9NA 5T91A 1QPRA 4KEVA 4NP7A 3CHFA 1BVWA 1OABA 1QK2A 1XFBA 3L9CA 3ARWA 2PRLA 1UD4A 2VCDA 2XIBA 3NQEA 3IGUA 1A4LA 1Q7MA 3WK3A 5FAGA 3UQBA 2VWSA 1VEMA 3ONBA 1R5YA 3WG6A 4JIPA 4I9AA 3B4YA 4GC4A 4HNNA 2XIIA 1XLKA 4H7ZA 4JCMA 3UG8A 4MYXA 2J9YA 2DUAA 2R6OA 1KBKA 3VD7A 1XCXA 1HT6A 2XVGA 5CJMA 1NP2A 1UR0A 4AQLA 1QZ2A 5HW6A 3P5ZA 3U6WA 2R1MA 1G7VA 1TCDA 5CPMA 3LDVA 2UY3A 5DO2A 2WSKA 1VLWA 5M1TA 4WDWA 2P76A 1WKEA 4HN4A 4XWUA 1US2A 2NX9A 2OZ3A 3H2NA 4BF9A 2VFFA 2ZXDA 1KTNA 1YDNA 4MADA 4NHVA 3GXDA 1DXFA 1BSLA 2Q09A 3WEOA 1UD5A 4QDWA 4C5YA 4E38A 5A6AA 3RM4A 2PUZA 9CGTA 1U1UA 2VGFA 4UFHA 4PB3A 3BG9A 5LIWX 3OOBA 3LNPA 4HQVA 3BSGA 3U48A 1NIUA 4IL0A 3LMZA 1D3CA 5EPDA 3UNDA 1U5HA 2ZDSA 1MSSA 3NYZA 2ZX6A 3KRSA 3DZ1A 3I4EA 2I5GA 4PCPA 2Y7DA 4IQDA 3ZM8A 2JGQA 2GPTA 1A5LC 4IJCA 4NJIA 1VCFA 3OIHA 4GYFA 4Z0SA 3AOFA 1K7FA 3EX3A 2G3MA 3V16A 3UY7A 3W1PA 5G1MA 3M5YA 4GABA 1KT1A 4HBKA 1AJ0A 3ZR4A 5JIWA 3H2MA 4DBDA 3M07A 2GGHA 3F1QA 1AA1B 1RALA 3I4KA 3VE7A 2F21A 3CV7A 2PWFA 3SQSA 3I7QA 1ML1A 4IFKB 2C3ZA 2OZ8A 1FFQA 1UOZA 2XGBA 5BXPA 3H12A 3AQUA 5GJMA 2WQPA 3O1NA 4AD2A 4CNOA 4LANA 4HK6A 3ARPA 3T7VA 1QPQA 4HKPA 3ATYA 4NX5A 3V4BA 4W7VA 1TR9A 1UWSA 4JEQA 4PB4A 5FJJA 1TPWA 4PR4A 2BVTA 4JDYA 3AMKA 1EEPA 4XZBA 3ZFHA 3SRDA 3B0UX 2E25A 2ALRA 3FJ4A 1P7TB 4BHYA 4TVUA 1TELA 2OZTA 1CXLA 2PV3A 1ZALA 4FS9A 4E2VA 1P6BA 4UTUA 1DV7A 2I9EA 1EHNA 1KKOA 3C86A 2PV2A 4F48A 3C0SA 1QBBA 4HIBA 3L65A 2E8YA 3ODKA 1PBKA 3OB8A 2X0HA 3U2CA 5CZSA 1SMAA 1UWQA 2QMJA 3CLWA 1QUMA 1NF0A 3EKGA 1EQCA 2DZBA 3G0SA 2Z6IA 3CTLA 1UASA 3OLGA 3W01A 3D5HA 2UY2A 1PUDA 4AB4A 1YQ2A 6XIMA 4NI8A 2CBIA 3P80A 2WNQA 4RE4A 1PS9A 2WWDA 4HMCA 4LUTA 4J2MA 2XGIA 4I90A 5ABHA 3I3EA 3S2MA 3E02A 1IT7A 3NVDA 1KQZA 7A3HA 5TD4A 1TA3A 3UQNA 1DE5A 4W5ZA 5HULA 1WA3A 4ENLA 2WVTA 2XH4A 3BLFA 1F7BA 3GNDA 4KQZA 4M51A 2YXXA 1J79A 2ZX7A 2QVNA 4DZ5A 3MI3A 5CAHA 1P48A 4MDOA 4Q4PA 5C55A 5FI8A 4YTUA 4AHOA 5HATA 3WLSA 3GC2A 1XIBA 4QISA 4PTDA 2FFCA 5HT1A 3TKFA 1W9UA 4AC1X 4CN6A 4PBFA 3MI6A 4BA0A 3SN4A 3AXHA 3R13A 5D9NA 4O18A 1JYVA 3OZMA 3O6DA 4O1DA 2Z29A 1ECQA 6TIMA 2E5BA 3ABSA 3APYA 4AD3A 2VELA 4JOMA 5IXEA 3B0VC 2AWGA 5TNVA 1D7IA 2A5HA 4JQ1A 1UR4A 2ZTJA 3BV7A 1LLZA 4K36A 4UTWA 3DYOA 4JNZA 4X60A 1TUFA 4ZFCA 2V5CA 2O9OA 4N02A 3TK7A 3W1TA 3U9IA 2ONEA 1OVDA 1XDLA 2XP5A 1DWGM 1XUZA 4BJHA 4ZEPA 2GJNA 5FSEC 1H7WA 3VNKA 4KPLA 3GXNA 4HHPA 3K1DA 5AYZA 4ZO6A 2FB3A 2J74A 2RFGA 2VFIA 4DROA 4MJ2A 2PWEA 4JS3A 1XS2A 4K8HA 2X1TA 3UYIA 4K2SA 1B2YA 2F61A 4EXBA 3MJYA 1OFDA 4TIMA 5HPCA 1F8AB 3O5JA 3ABOA 5I77A 2WHMA 3W70A 3LCLA 2PP0A 3OVRA 1P0EA 1KKRA 3BSHA 5BOEA 3VOCA 2GWGA 1RPKA 4UTIA 3RK8A 3W71A 1TA3B 2ZWYA 1W9BM 1ZHAA 2PDGA 4LUYA 4MGGA 1RXOB 1WDPA 1MWOA 4JTUA 2YYTA 1TJ2A 2AAMA 3B8UA 3KVMA 2CW6A 1XBXA 2DJLA 3KX6A 5HUAA 4RR4A 2W27A 4H4IA 3DFHA 1KA9F 1BF2A 3QOKA 3GTYX 3CIXA 5I09A 2XUCA 1UWRA 4DUOA 1GVYA 1U5JA 4F0LA 4DWDA 2Q6ZA 1M1BA 4K39A 2NSXA 3NL5A 2DP3A 4OKDA 3WLOA 4DO5A 5EU9A 2JKAA 3L2IA 4LVBA 2NT1A 4P8XA 1EJRC 1KCXA 4UTFA 2J7EA 4XD5A 3HFYA 2MUCA 1M5YA 4MOZA 3P6LA 2A4AA 3CTTA 2Q8XA 4W86A 3ATZA 2Y6ZA 4NRRA 2HPIA 4LPCA 4GI6A 5G1YA 1A50A 1H5YA 4ZXOA 2JKPA 3AMCA 1TTQA 3K2GA 4UFLA 2FHFA 2NX3A 4U3CA 1XLIA 4DRHA 4DJED 4Q4MA 2ANUA 3QHOA 3G8RA 3V0SA 4EF8A 4Z2GA 2VX7A 3DENA 5ABFB 3CWNA 3JRKA 1IEVA