2PIEA

Crystal structure of the fha domain of rnf8 in complex with its optimal phosphopeptide
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
132
structure length
132
Chain Sequence
GAHMAGGRSWCLRRVGMSAGWLLLEDGCEVTVGRGFGVTYQLVSKICPLMISRNHCVLKQNPEGQWTIMDNKSLNGVWLNRARLEPLRVYSIHQGDYIQLGVPLENKENAEYEYEVTEEDWETIYPCLSPKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNF8 Transduces the DNA-Damage Signal via Histone Ubiquitylation and Checkpoint Protein Assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase RNF8
total genus 32
structure length 132
sequence length 132
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00498 FHA FHA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.20 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 2pieA01
2FEZA 1MZKA 2JQIA 3HX1A 1FHRA 4H87A 1K2NA 2FF4A 5A8IA 4EJQA 2CSWA 1UHTA 1J4OA 1UJXA 3PO8A 5E50A 2KKLA 4D9VA 3KT9A 2JKDA 4A0EA 1J4QA 5DJOA 3UV0A 1G6GA 2XT9B 3POAA 1WV3A 3UOTA 3VA1A 3I0MA 1YJ5C 3VA4A 2A0TA 3UNNA 1FHQA 1GXCA 1K3JA 1LGQA 1WLNA 1K2MA 4QCJA 2PIEA 3HUFA 2EH0A 1J4LA 2KB3A 3UN0A 3UMZA 1LGPA 3I6WA 1G3GA 3UNMA 3I6UA 1DMZA 1K3QA 1J4PA 3VPYA 2KFUA 3FM8A 4G2SA 3OUNA 3MDBA 2BRFA 2JQJA 1QU5A 2AFFA 2JQLA 3I0NA 1K3NA 1YJMA 2KB4A 1J4KA 2LC1A 3ELSA 2W3OA 3ELVA 4JONA 3GQSA 3HUEA 4EGXA 1R21A 2G1LA 2JPEA
chains in the Genus database with same CATH superfamily
1MZKA 2Q5FA 2I2AA 2BONA 3DITA 5DHSA 1U0TA 2JGRA 5EJFA 4A4YA 2A0TA 1FHQA 1Y3HA 4JIWD 3HUFA 4R9PA 3V8NA 1KHXA 3AFOA 3UN0A 4KU0D 3VZCA 2I2FA 1Z0ZA 4L02A 2I2CA 4G2SA 1KHUA 2AFFA 5JEMA 1YJMA 2KB4A 1J4KA 4JONA 1K3NA 2I2DA 2JPEA 2FEZA 3GMJA 2JQIA 3HX1A 1K2NA 2FF4A 1SUWA 1QWTA 1J4OA 1YGSA 3V7UA 5JELA 2I29A 1Y3IA 2AN1A 5EJHA 3S40A 1J4QA 5DJOA 4A0EA 3T5PA 2XT9B 3POAA 3UOTA 1MR1A 1Z0SA 1GXCA 1LGQA 5DHQA 1ZOQA 4QCJA 2EH0A 3V8QA 3V8PA 1J4LA 2KB3A 3VZBA 1G3GA 3A77A 3UNMA 2I2BA 4JIVD 3VPYA 1U0RA 3FM8A 3MDBA 2BRFA 2JQJA 4HAOA 5JEJA 5DHTA 1DMZA 2W3OA 2G1LA 3PFNA 4H87A 4WERA 5A8IA 4EJQA 1UJXA 5DHPA 3KT9A 3UV0A 5JERA 3VA4A 3VA1A 2XXSA 2P1RA 1DEVA 1G88A 5JEKA 2PIEA 5EJIA 3UMZA 3V80A 1K3QA 3VZDA 1MJSA 2KFUA 1U7FA 1Z0UA 1QU5A 3I0NA 2I1WA 2LC1A 3GQSA 3HUEA 1R21A 5DHRA 5EJGA 4V24A 1FHRA 1DD1A 2CSWA 1UHTA 5E50A 4D9VA 3PO8A 2KKLA 4WRRA 5C4VA 2JKDA 2QV7A 1MK2A 1G6GA 1YT5A 3V7YA 5JEOA 1WV3A 2QVLA 3UNNA 3I0MA 1YJ5C 1K3JA 1U7VB 1WLNA 1K2MA 1U7VA 3DSHA 3V8MA 3V8RA 1U7FB 1LGPA 3I6WA 3I6UA 1J4PA 5DHUA 3OUNA 3V7WA 2JQLA 5BVIA 3ELSA 4DY6A 3ELVA 4EGXA 1J2FA
chains in the Genus database with same CATH topology
1MZKA 2BONA 3DITA 2JGRA 4A4YA 2A0TA 1FHQA 4JIWD 3HUFA 4R9PA 1KHXA 3UN0A 4KU0D 3VZCA 4L02A 4G2SA 1KHUA 2AFFA 5JEMA 1YJMA 2KB4A 1J4KA 4JONA 1K3NA 2JPEA 2FEZA 3GMJA 2JQIA 3HX1A 1K2NA 2FF4A 1QWTA 1J4OA 1YGSA 5JELA 3S40A 4A0EA 1J4QA 5DJOA 3T5PA 2XT9B 3POAA 3UOTA 1MR1A 1GXCA 1LGQA 1ZOQA 4QCJA 2EH0A 1J4LA 2KB3A 3VZBA 1G3GA 3A77A 3UNMA 4JIVD 3VPYA 3FM8A 3MDBA 2BRFA 2JQJA 5JEJA 1DMZA 2W3OA 2G1LA 4H87A 4WERA 5A8IA 4EJQA 1UJXA 3KT9A 3UV0A 5JERA 3VA4A 3VA1A 2XXSA 2P1RA 1DEVA 1G88A 5JEKA 2PIEA 3UMZA 1K3QA 3VZDA 1MJSA 2KFUA 1U7FA 1QU5A 3I0NA 2LC1A 3GQSA 3HUEA 1R21A 4V24A 1FHRA 1DD1A 2CSWA 1UHTA 5E50A 4D9VA 3PO8A 2KKLA 4WRRA 5C4VA 2JKDA 2QV7A 1MK2A 1G6GA 5JEOA 1WV3A 2QVLA 3UNNA 3I0MA 1YJ5C 1K3JA 1U7VB 1WLNA 1K2MA 1U7VA 3DSHA 1U7FB 1LGPA 3I6WA 3I6UA 1J4PA 3OUNA 2JQLA 5BVIA 3ELSA 3ELVA 4EGXA 1J2FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FEZ A;  1MZK A;  2JQI A;  3HX1 A;  1FHR A;  4H87 A;  1K2N A;  2FF4 A;  5A8I A;  4EJQ A;  2CSW A;  1UHT A;  1J4O A;  1UJX A;  3PO8 A;  5E50 A;  2KKL A;  4D9V A;  3KT9 A;  2JKD A;  4A0E A;  1J4Q A;  5DJO A;  3UV0 A;  1G6G A;  2XT9 B;  3POA A;  1WV3 A;  3UOT A;  3VA1 A;  3I0M A;  1YJ5 C;  3VA4 A;  2A0T A;  3UNN A;  1FHQ A;  1GXC A;  1K3J A;  1LGQ A;  1WLN A;  1K2M A;  4QCJ A;  2PIE A;  3HUF A;  2EH0 A;  1J4L A;  2KB3 A;  3UN0 A;  3UMZ A;  1LGP A;  3I6W A;  1G3G A;  3UNM A;  3I6U A;  1DMZ A;  1K3Q A;  1J4P A;  3VPY A;  2KFU A;  3FM8 A;  4G2S A;  3OUN A;  3MDB A;  2BRF A;  2JQJ A;  1QU5 A;  2AFF A;  2JQL A;  3I0N A;  1K3N A;  1YJM A;  2KB4 A;  1J4K A;  2LC1 A;  3ELS A;  2W3O A;  3ELV A;  4JON A;  3GQS A;  3HUE A;  4EGX A;  1R21 A;  2G1L A;  2JPE A; 
#chains in the Genus database with same CATH topology
 1MZK A;  2Q5F A;  2I2A A;  2BON A;  3DIT A;  5DHS A;  1U0T A;  2JGR A;  5EJF A;  4A4Y A;  2A0T A;  1FHQ A;  1Y3H A;  4JIW D;  3HUF A;  4R9P A;  3V8N A;  1KHX A;  3AFO A;  3UN0 A;  4KU0 D;  3VZC A;  2I2F A;  1Z0Z A;  4L02 A;  2I2C A;  4G2S A;  1KHU A;  2AFF A;  5JEM A;  1YJM A;  2KB4 A;  1J4K A;  4JON A;  1K3N A;  2I2D A;  2JPE A;  2FEZ A;  3GMJ A;  2JQI A;  3HX1 A;  1K2N A;  2FF4 A;  1SUW A;  1QWT A;  1J4O A;  1YGS A;  3V7U A;  5JEL A;  2I29 A;  1Y3I A;  2AN1 A;  5EJH A;  3S40 A;  1J4Q A;  5DJO A;  4A0E A;  3T5P A;  2XT9 B;  3POA A;  3UOT A;  1MR1 A;  1Z0S A;  1GXC A;  1LGQ A;  5DHQ A;  1ZOQ A;  4QCJ A;  2EH0 A;  3V8Q A;  3V8P A;  1J4L A;  2KB3 A;  3VZB A;  1G3G A;  3A77 A;  3UNM A;  2I2B A;  4JIV D;  3VPY A;  1U0R A;  3FM8 A;  3MDB A;  2BRF A;  2JQJ A;  4HAO A;  5JEJ A;  5DHT A;  1DMZ A;  2W3O A;  2G1L A;  3PFN A;  4H87 A;  4WER A;  5A8I A;  4EJQ A;  1UJX A;  5DHP A;  3KT9 A;  3UV0 A;  5JER A;  3VA4 A;  3VA1 A;  2XXS A;  2P1R A;  1DEV A;  1G88 A;  5JEK A;  2PIE A;  5EJI A;  3UMZ A;  3V80 A;  1K3Q A;  3VZD A;  1MJS A;  2KFU A;  1U7F A;  1Z0U A;  1QU5 A;  3I0N A;  2I1W A;  2LC1 A;  3GQS A;  3HUE A;  1R21 A;  5DHR A;  5EJG A;  4V24 A;  1FHR A;  1DD1 A;  2CSW A;  1UHT A;  5E50 A;  4D9V A;  3PO8 A;  2KKL A;  4WRR A;  5C4V A;  2JKD A;  2QV7 A;  1MK2 A;  1G6G A;  1YT5 A;  3V7Y A;  5JEO A;  1WV3 A;  2QVL A;  3UNN A;  3I0M A;  1YJ5 C;  1K3J A;  1U7V B;  1WLN A;  1K2M A;  1U7V A;  3DSH A;  3V8M A;  3V8R A;  1U7F B;  1LGP A;  3I6W A;  3I6U A;  1J4P A;  5DHU A;  3OUN A;  3V7W A;  2JQL A;  5BVI A;  3ELS A;  4DY6 A;  3ELV A;  4EGX A;  1J2F A; 
#chains in the Genus database with same CATH homology
 1MZK A;  2BON A;  3DIT A;  2JGR A;  4A4Y A;  2A0T A;  1FHQ A;  4JIW D;  3HUF A;  4R9P A;  1KHX A;  3UN0 A;  4KU0 D;  3VZC A;  4L02 A;  4G2S A;  1KHU A;  2AFF A;  5JEM A;  1YJM A;  2KB4 A;  1J4K A;  4JON A;  1K3N A;  2JPE A;  2FEZ A;  3GMJ A;  2JQI A;  3HX1 A;  1K2N A;  2FF4 A;  1QWT A;  1J4O A;  1YGS A;  5JEL A;  3S40 A;  4A0E A;  1J4Q A;  5DJO A;  3T5P A;  2XT9 B;  3POA A;  3UOT A;  1MR1 A;  1GXC A;  1LGQ A;  1ZOQ A;  4QCJ A;  2EH0 A;  1J4L A;  2KB3 A;  3VZB A;  1G3G A;  3A77 A;  3UNM A;  4JIV D;  3VPY A;  3FM8 A;  3MDB A;  2BRF A;  2JQJ A;  5JEJ A;  1DMZ A;  2W3O A;  2G1L A;  4H87 A;  4WER A;  5A8I A;  4EJQ A;  1UJX A;  3KT9 A;  3UV0 A;  5JER A;  3VA4 A;  3VA1 A;  2XXS A;  2P1R A;  1DEV A;  1G88 A;  5JEK A;  2PIE A;  3UMZ A;  1K3Q A;  3VZD A;  1MJS A;  2KFU A;  1U7F A;  1QU5 A;  3I0N A;  2LC1 A;  3GQS A;  3HUE A;  1R21 A;  4V24 A;  1FHR A;  1DD1 A;  2CSW A;  1UHT A;  5E50 A;  4D9V A;  3PO8 A;  2KKL A;  4WRR A;  5C4V A;  2JKD A;  2QV7 A;  1MK2 A;  1G6G A;  5JEO A;  1WV3 A;  2QVL A;  3UNN A;  3I0M A;  1YJ5 C;  1K3J A;  1U7V B;  1WLN A;  1K2M A;  1U7V A;  3DSH A;  1U7F B;  1LGP A;  3I6W A;  3I6U A;  1J4P A;  3OUN A;  2JQL A;  5BVI A;  3ELS A;  3ELV A;  4EGX A;  1J2F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...