2PJPA

Structure of the mrna-binding domain of elongation factor selb from e.coli in complex with secis rna
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
121
structure length
121
Chain Sequence
FSEEQQAIWQKAEPLFGDEPWWVRDLAKETGTDEQAMRLTLRQAAQQGIITAIVKDRYYRNDRIVEFANMIRDLDQECGSTCAADFRDRLGVGRKLAIQILEYFDRIGFTRRRGNDHLLRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SECIS RNA
publication title Structural insight into a molecular switch in tandem winged-helix motifs from elongation factor SelB.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Translation/rna
total genus 44
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2007-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09107 SelB-wing_3 Elongation factor SelB, winged helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2pjpA02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2pjpA01
3EYIA 2PQ8A 3CJNA 3WGIA 2XROA 1Z6TA 2RV8A 1Z6RA 4YIIA 5FGMA 4OIPF 3SQNA 1FC3A 1DPUA 1HXDA 4EV0A 3GX4X 2FBKA 4ENKA 1S8NA 1K7AA 2KIMA 3U1DA 2P6TA 1BJAA 2AXLA 2RN7A 3KZYA 2A61A 4E70A 4ZYGA 4A5MA 3ECHA 2P5KA 4ETSA 3REOA 1KYZA 4WX9A 5KK1A 3VOEA 4LG0A 4Q5SF 4HW0A 1B59A 4NB5A 3TDZC 2M8EA 1TQMA 2A69F 3W6KB 4UV8A 4P9FA 3WTVC 2MC3A 1U2WA 3WE3A 5DCMA 2YPRA 4I2OA 1SAXA 1MGTA 4H0EA 2JPBA 1H9GA 2X0LA 1BIBA 2VBYA 4OOIA 1GVJA 1MJBA 1USTA 3T1BA 1YQAA 5ICCA 5BPIA 2P6SA 3T5XA 3RTRA 4O3MA 3EYYA 2K02A 1J59A 4L9VA 1LDKB 1GHCA 3WTYC 2D1VA 4HF1A 4I0BA 2BYVE 5HOOA 2PMUA 2HTSA 2J5OA 2QQAA 3F22A 2UWMA 3KE2A 2XV4S 2KRFA 1B1BA 3M8FA 1R36A 3ZMSA 1HQCA 4HX7A 5HS7A 3BJAA 4CYDA 4RB0A 1V3FA 2A6EF 2E1NA 5K5RA 4BHCA 5D5VB 4A6DA 2PLYA 4UVCA 2BV6A 5HDNA 3BY6A 2ESNA 3FWEA 4IXAA 1OPCA 3RKYA 4HLXA 3TGNA 4HAMA 2CWEA 2W25A 2Z5UA 3N4MA 4CICA 5FLXK 1T6SA 2HTJA 4AIKA 2RC4A 3WODF 2DT5A 2FMLA 5LEJA 5ED4A 3JSPA 3ZN0A 2GWRA 3M1EA 2STWA 1ON1A 2NYXA 4RAYA 4ZYEA 4S04A 3SZPA 4LK0F 1BC8C 1K79A 4ZH4F 1BN5A 1LEAA 2GA2A 1YW7A 1U5TC 1IXCA 2X4HA 2ZNYA 2WV0A 3R4KA 3GVAA 3K0LA 3GYHX 2H6CA 5DYMA 5HDGA 1G4DA 3ROUA 5CVVA 1NHAA 3WTWC 1LDJA 4HDVA 2CW0F 3BJ6A 3BWGA 4G8XA 1I1GA 1HSTA 2F5DA 1ULYA 5EEGA 3TQNA 3OOPA 3F6VA 1USSA 1MZBA 2H6BA 4A0YA 1G3TA 2DK8A 2ELHA 4WXCA 1MKMA 2VBXA 4LK1F 3FMSA 3R60A 1Q1HA 4EQQA 2ACJA 5BMZA 2V1UA 4JBAA 1ZN2A 4GGGA 4KDPA 2PBIA 4G94A 1JE8A 1KA8A 1JHFA 4HLYA 3EDPA 3BROA 3F3XA 4ZYDA 3LA2A 2ESHA 1KU2A 2ZMEA 3MAJA 5L3DA 1O7FA 2QYOA 1VTNC 2F5FA 5D8KB 2R3SA 1YS6A 2K4BA 3N97A 3F6OA 2QM3A 2ZFWA 1OR7A 1EV7A 1SMTA 3RI4A 3GWZA 1BOAA 3CUQB 1XDUA 4ESBA 3WTTC 1YG2A 2QWWA 2DLLA 2LDUA 2DPDA 3F8MA 4AD9A 3IRRA 5JVTA 1ZRCA 2G7HA 2EB7A 5D4SA 1J75A 3V7SA 2M87A 2FRHA 1H0MA 4R79A 2ISYA 2MH2A 4R1HA 5E1XA 2KIFA 3BP8A 2B0LA 1GXPA 1TW2A 3HRSA 4BAYA 4EJVA 4HOBA 1UHMA 2RVCA 3JAMK 5A2QK 2CSOA 2FE3A 4HF0A 2D45A 1WRJA 5TRDA 3HUGA 3M8EA 1U5TA 3DXJF 4LLLA 3ZMTA 4I98B 2GQQA 4G7ZF 4KA4A 2EJRA 2JSCA 1ZYRF 5LEKA 4A0XA 2JPCA 4B8XA 1L3LA 3R6SA 4G6DA 1LVAA 5IT9K 3ZMDA 5K5OA 2P5VA 1YIOA 4KMFA 1F5TA 2A68F 1P6RA 1CF7B 1I5ZA 1ZHFA 3JAMZ 1FP1D 1HKTA 1XB4A 2RGVA 2PN6A 5F6FA 1ZH5A 3H3UA 4RAZA 5FB2A 2Q0OA 2YX4A 2QQBA 4RGRA 1ZG3A 4EJWA 3TOBA 2QUFA 3CUQA 1MJAA 4I0AA 3SFZA 4PZJA 1DPRA 4KT5C 2W57A 4UNOA 3GLXA 4OU0A 1MDMB 4L5JA 1D5VA 2Z99A 4ON0A 3GZ5A 4A6EA 2P8TA 4Q48A 4M73A 1TLHB 2XAHA 5IT9Z 1ZGAA 4LMYA 3DEUA 3LAJA 4KIFA 2BE5F 3NQOA 4WXDA 3E6MA 1S6LA 1FNNA 2STTA 1LEBA 3O3KA 4BQAA 2G7UA 2COMA 1CGPA 1XMKA 3I5UA 4HA8A 4QLCU 1FPQA 4Z2YA 1WWXA 2E7XA 5ICEA 3GF2A 2YR2A 1QBJA 1B9MA 3T8RA 2JT1A 4ZZDA 4UUVA 3J80K 5JR3A 3SHFA 2FEZA 2NRAC 5L3FA 3V4GA 1SFXA 4XBFA 4XLPF 3O6BB 1C0WA 1MD0A 5F64A 1IN5A 4JK1X 1KQ0A 3J7AO 1RUOA 2F5CA 4Y13A 1R23A 1SD5A 3I4PA 3TO6A 2LF8A 1IN4A 3VFZA 3ULQB 2M45A 2FBIA 1CF7A 1FP2A 4KIBA 4XRFA 2O03A 4BNCA 4A12A 1RIOH 4EJOA 3J80Z 1R5GA 1FLIA 2RNJA 1B9NA 4LLNA 2ZKZA 4HV6A 1FYKA 2IW5A 3GUDA 3J81Z 2ZCWA 5BOXA 1J7KA 2M1BA 1YLFA 2F5EA 4EGYA 4LB6B 2L3DA 3E6CC 3K2ZA 2Q2EA 4L9JA 3FZVA 3FXUA 4RB3C 3I0TA 2OD5A 2MH9A 4O6JA 2XKOA 3LA7A 1R58A 3I59B 1EH6A 2K7LA 4OIRF 3RKXA 2FA5A 2UZKA 1PDNC 3GEZA 1E2XA 1EH8A 3AAFA 2V79A 3KP3A 5D5XB 2FF4A 3JTGA 2BEOA 3COAC 2OA4A 3L09A 3KP4A 1ZLJA 5AIPA 1QO0D 1R7JA 1BBYA 2A3SA 1ZRFA 2QBYB 1U78A 2XUBA 4MQ9F 3OV8A 1H9TA 4O5VA 1TTYA 2P4WA 4EJUA 2IVMA 1SD6A 1AWCA 2WC2A 1XMAA 4KICA 1I6XA 5CLSA 3I64A 4I09A 1SFEA 3ERED 2HS5A 1ZLKA 3R0JA 5JHUA 1IXRC 1ZREA 2Y48A 3QPTA 3WTUC 2D2WA 1EH7A 2YU3A 3O2PE 4OMYA 2Z3YA 1J5YA 1O3SA 3DQVC 1OKRA 3U9GA 4HZFA 4KFCA 3I59A 4D0PA 2YSRA 1YW8A 2HR3A 2E1CA 1XGOA 4GYGA 1LNWA 4N0BA 1TW3A 1ZRDA 3KLNA 1P2FA 4KYWA 1R1VA 2QZ8A 2FU4A 3M7GA 3JSOA 2IA2A 4R8HA 3WU0A 3LA3A 2FNAA 1TNSA 1RUNA 4MEXF 2VXZA 4A2UA 2VOOA 3K1NA 3VODA 3KEOA 3V8LA 2Z9OA 1KU3A 5D6FA 4M6YA 2ADUA 2DBBA 1ZAOA 4OIOF 4WK8F 4KNYA 1QZYA 3JW4A 3BPXA 4HX4A 2VC1A 3K1MA 4G9YA 1TQIA 4PGGA 2XAJA 1BC7C 3KCCA 1QQIA 3BZ6A 3R61A 3KZZA 2JZYA 3WU1B 4B09A 1OYIA 1WSUA 3CLOA 2PI0A 2K27A 2PFBA 1KYWA 1XSVA 2ZNZA 5DD4A 5HLGA 1JHHA 2OBPA 3WTXC 4ESJA 3IKTA 2VC0A 1J0RA 2M5WA 2PMHA 3T8TA 3CTAA 1D3YA 1IW7F 1XCBA 2JRTA 3ELKA 4ENMA 1P92A 1RNLA 3KP5A 2QQ9A 1R22A 5CVIA 4G6QA 5ICFA 3MWMA 3LQRA 1KU9A 1W5SA 5FLXZ 5E20A 4IF4A 1I27A 5LHHA 3ZPLA 3WGGA 1Y0UA 5DV5A 4ASNA 3EQLF 1W4MA 5HLHA 3CDHA 2EFPA 4DQ2A 5J8FA 2DQLA 1ODDA 3I71A 3I53A 1UB9A 3WE2A 4IRIA 3GFLA 2MD5A 2FMYA 4WXHA 3CUQC 2XRNA 1YO5C 2P7CB 3QAHA 1FBSA 2VBZA 4AWXB 3MQ0A 3BOQA 3L7WA 3F8CA 1P4WA 3RIRA 4A0ZA 1FOKA 2LSOA 1FWZA 6PAXA 1ONVA 3RPUA 1XGSA 4A5NA 4HYEA 2TDXA 3GZ6A 3HOTA 4LLGF 3PQJA 5ILUA 3MZYA 1F9NA 1LJ9A 1TNTA 3HRUA 2IT0A 4LGWA 4Y17A 1OMIA 1SD7A 3FHZA 3I54A 3RYRA 2HKXA 3DP7A 1I1SA 3IWFA 4L9NA 3BPVA 5L3GA 3GW2A 3P9CA 3IHUA 2L01A 1YS7A 1W5TA 1BI3A 2HKOA 4IRGA 3IL2A 4P55A 2A5YB 5L3CA 4KIGA 4XLNF 2ZXJA 1FT9A 2H94A 4WCGA 2ISZA 3NRVA 5BQTA 2KKOA 3M9AA 2V9VA 5DDGA 3TOAA 3L9FA 2AS5F 2O6GE 3L00A 3K1PA 1S7OA 5ICGA 5LHIA 2VONA 1JXSA 1TBXA 2FSWA 3DF8A 4HQEA 3Q9VA 4UV9A 2VE9A 2V1XA 3F23A 3LWFA 1J2XA 1FX7A 4WF2A 3U2RA 1BM9A 1ZG1A 3WTSC 1W7PB 4ENNA 1IXSB 4U0YA 4Q4ZF 3EUHA 1K78B 3CO6C 2OAZA 4S05A 2VN2A 4RB2C 5A2QZ 2LNBA 1DUXC 1P4XA 1G3SA 1O57A 4RS8A 2OZ6A 3FF5A 1S7AA 2EV5A 2QVOA 3P9KA 2RQPA 3RPQA 3ZN1A 4CDGA 1YW9A 4JQFA 1FSHA 4I01A 2HQRA 1YTYA 2O8XA 2K4JA 1FBUA 1XDSA 4CO8A 5DEQA 4HBLA 4IVNA 4GYIA 4K2EA 2EWNA 3V8KA 1QPMA 3JTHA 3FM3A 5TJJA 3P7NA 1IZ1A 1MJ9A 3LAPA 4OMZA 1IF1A 1IN8A 1O7LA 4L5IA 5J6XA 3K69A 1AOYA 3LSTA 5ERIA 3WG9A 3Q5FA 3HHGA 4AIJA 2H09A 3IRQA 4CZZA 3KP2A 5J8CA 1W7PA 1R1TA 3MZHA 5HLIA 4EM2A 2IPQX 2EK5A 2G9WA 2P5LC 3DPTA 1HBXG 2CQKA 4UVBA 4CHUA 1LB2A 4I7HA 1ZGJA 3G3ZA 2C6YA 3HIFA 1T38A 3KP7A 2EV0A 3QU3A 2KJCA 4PCQA 3EETA 2UXXA 1MDMA 1HW1A 4KN4X 4U0VA 1XD7A 2DO7A 4LG0B 1T2KA 1W7PD 5JFRA 2EV6A 2XGXA 4M72A 2NNYA 1SFUA 3ABUA 4MTEA 3F72A 2DQRA 4EM0B 1T0FA 2EFQA 2EA4A 1Z1DA 1Z7UA 1FYLA 3E5QA 5LRSA 3LQQA 2VOPA 1OYWA 2CFXA 2GIVA 3BJOA 3QP6A 3FXRA 3WGHA 1HKSA 4M9ZA 3DPLC 3IC7A 1Z05A 1BI0A 4UHTA 1D8JA 3FX3A 5E18F 4G7HF 1JGSA 3C1DA 1QGPA 4P9UA 5LRRA 3C3WA 1FSEA 5DD8A 4LFUA 4XSZF 2KJBA 2CG4A 5CYVA 4YFKF 4NQWA 3HRTA 3HRMA 4M9SA 1PP7U 4RGSA 5D8LB 3ML6A 5IT3A 3DFGA 2XASA 1LQ1A 4EVIA 2ETHA 1G3YA 2NS0A 3VB2A 2MA3A 4KN7X 2K86A 1YYVA 2XIGA 1ZARA 1IRFA 1HW5A 4U88A 5E1WA 2ZO4A 1ZG5A 3C18A 4U0WA 4HX8A 4L18B 2RDPA 3HSRA 4RGXA 1Z9CA 4NHJA 1GXQA 3C7JA 2V6CA 4UVAA 1WQ2A 4WWCA 3KETA 5AIQA 2VT2A 2GA1A 2P7VB 2HQNA 2FNPA 1FBQA 1T98A 1S29A 3L2CA 2DI3A 3DV8A 5K5QA 3WTZA 2V1DA 1U8RA 2DFIA 2QBYA 4CXFA 4KUMA 1IN7A 2GAUA 4XSXF 3NEUA 3QRFF 3FXQA 2BBYA 2JTVA 4ZZLA 2XAGA 2HZTA 4RGUA 3HTUA 1XSXA 5BPDA 3IWZA 2GXBA 4IHTA 4OIQF 3VEPA 2WWYA 4ENJA 2PJPA 2VT3A 3FMRA 4MQVA 1V4RA 4L9TA 5KVRA 2HOEA 5ILSA 5BS6A 1WI9A 2IP2A 3E6DA 1SMYF 5H6RA 3F8NA 1XSDA 1R00A 2QENA 4CGZA 5FD5A 3ZP5A 3GFIA 4FX0A 5D5WB 2DAOA 2MBFA 2DPUA 1B6AA 3QPHA 2F2EA 3ISPA 3KEQA 4FX4A 4MEYF 1IRGA 3E3VA 2ZMEB 4EM1A 5E1ZB 1XGNA 2BGCA 1O3QA 3GFJA 3PQKA 3S2WA 1FYMA 2WTEA 4EJTA 3ZMVA 5D6EA 5LGTA 3RKWA 4G7OF 5DUIA 4YG2F 3RDIA 4P5OA 2DU9A 4HQMA 2L4MA 3K9TA 3FMQA 3V7CA 5JI6A 1KU7A 2UXNA 2NAZA 3ECOA 1XGMA 2LF7A 4BXUA 1FY7A 3LFKA 2W24A 2Y75A 1F1ZA 5E8GA 2HFHA 3ZMUA 2MLKA 2OU2A 2OZUA 2QLZA 4YFXF 1A04A 2XAFA 3G73A 1ON2A 5HDKA 4N9HA 3QOPA 5FFXA 4IJAA 1QZZA 2VE8A 2A07F 5H6QA 1R1UA 5LGUA 4BHBA 2A6HF 5H20A 2Y0MA 3TDUC 4FT8A 1F4KA 2YX7A 4PDKA 3V8JA 5HVQC 4BH9A 3GO5A 3HTSB 1YFHA 3KP6A 4DNCA 2IA0A 2HYGD 2FOKA 5LLQA 1U5TB 3W6JB 3H92A 4I02A 3D5LA 2M30A 4YFNF 2MLGA 5E17F 1IUYA 1KGSA 1G3WA 3E5UA 2RKHA 4Q47A 3F21A 1UHWA 3I58A 2EFOA 1BIAA 1DDNA 4N9IA 2IRFG 5F1RA 1KQ9A 4HF2A 4AIHA 5FD6A 3H3ZA 5D4RA 3HSEA 2VODA 5LHGA 4HV5A 3F8FA 1STZA 1HW2A 2W85A 1IN6A 1HSJA 5D5UB 3ZQ7A 3IKVA 2CO5A 4QWQA 1SD4A 3TO9A 5LGNA 1UCRA 4U7DA 4MTDA 4EMSA 4KMUX 3RYPA 4U7BA 2XVCA 1TQPA 1S3JA 1IAWA 2VBWA 2OQGA 3Q9SA 2PG4A 4L0ZB 3T0YA 4TV7A 3MEXA 4F7ZA 1RI7A 2E7WA 2HGCA 2DW4A 2R7DA 2XAQA 4BHPA 4OINF 4PGHA 2O61A 4ZYHA 2DTRA 4LJZF 2ZJ2A 1QNTA 1FZPB 3HYIA 4RB1A 4MNUA 2J5PA 2GXGA 4MGRA 4ESFA 2DK5A 3E5XA 3QU6A 3CUOA 2PEXA 2XKPA 4MHGA 5CJ9A 3KFWX 5CVJA 1RZ4A 3F8BA 2CGPA 1LDDA 4Y15A 1X3UA 2H27A 3HOSA 1R5HA 2W84A 4M9XA 4IHSA 2L02A 3TO7A 2LKPA 5ILVA 2FQ3A 4M6XA 5AONA 4BYYA 3D0SA 1Z91A 3TKYA 1BI2A 1DP7P 5L3BA 4L0YB 1OYYA 5K1YA 5HS8A 1PUEE 1B4AA 3R0AA 3DKWA 3BDDA 4GCVA 4FHTA 3P9IA 3B73A 3PFIA 5HS9A 1G6NA 4YIFA 1T39A 2Z33A 2OQRA 3KLOA 3HSFA 2Q8KA 2GZWA 3E97A 4GXOA 3GXOA 3ABTA 2EFWA 1HKQA 4UXNA 5FFZA 5FO5A 5CVRA 3E6BA 1K6OA 2NNNA 3ZMZA 4M74A 1K78A 2CYYA 4IPAA 1D8KA 3J81K 5E8IA 2D1HA 4M71A 2HWVA 4LB5A 5EEHA 2O3FA 2FXAA 5LBQA 1KQ8A 3GFMA 2ZBKA 5CVUA 4IRHA 3HHHA 1REPC 2L4AA 3SXYA 2O0YA 3MCZA 1BI1A 2IJLA 2HEOA 3MFKA 4P96A 5DUKA 2HDCA 3B02A 1U6GA 5DCMB 1E17A 2IA1A 1J9IA 2FBHA 1WKMA 2EFNA 2XHKA 5L3EA 4LD5A 1PP8F 3QP5A 4AVPA 4HDUA 3V7RA 2R7FA 2L54A 3SZTA 2HYFA 2KIUA 1L0OC 3FM5A 4GO1A 1O3RA 1UFMA 1XN7A 2EA2A 1XCVA 3RJPA 1P4AA 4EGZA 1U3EM 5DCFA 3CO7C 1O3TA
chains in the Genus database with same CATH superfamily
2HVSA 1QPIA 2LRDA 2FQ4A 4DGWB 3EYIA 2E19A 2M0CA 2H8RA 2PQ8A 3CJNA 3WGIA 2XROA 1Z21A 1Z6TA 3Q0WA 2RV8A 1Z6RA 1NTCA 4YIIA 1MBEA 4D7MA 3G1MA 5FGMA 3CC4I 4OIPF 2B7EA 3IUOA 1FC3A 1PJRA 3ABLH 2DMQA 3SQNA 1DPUA 1HXDA 2EZKA 4EV0A 1PYVA 3GX4X 1YHQI 5FLVA 2FBKA 2NOGA 2E1OA 2VXDA 2XB0X 4ENKA 1S8NA 3CF5F 4QIWN 1K7AA 2KIMA 2EPFA 3U1DA 2LKXA 2P6TA 1BJAA 2AXLA 2RN7A 3KZYA 4CYCA 2XF6A 2AQFA 1K61A 2A61A 3FDYA 4E70A 3GTOJ 2ZSIB 2LP0A 4ZYGA 2KHMA 4A5MA 3ECHA 2P5KA 4ETSA 3REOA 1X4PA 1KYZA 1IUFA 4WX9A 2IGKA 5KK1A 3VOEA 1JKRC 4LG0A 4DYCA 4Q5SF 2JA2A 4IEJA 4HW0A 1B59A 3BR1A 5IP9J 1MIJA 5IPAA 4NB5A 2VQLA 4XRMA 3TDZC 1A35A 2PX9A 2M8EA 1TQMA 3WG7H 2A69F 1S7EA 2HXOA 3SZGA 3W6KB 4UV8A 5DS9A 4CCNA 4P9FA 3WTVC 2TCTA 2KRHA 2MC3A 3L2WA 4AIDA 2DT6A 1U2WA 2P0WA 3WE3A 2K5CA 3IH3A 5F04A 5DCMA 3H5NA 5DM7F 2YPRA 4I2OA 5IOZA 3CMYA 3I4NJ 3G1LA 1SAXA 1MGTA 5EJCA 2M34A 4XN0A 4H0EA 2JMWA 2O9LA 5EG0A 3DCFA 2XSJC 3SYTA 1NH3A 2JPBA 2Y2ZA 1H9GA 2X0LA 1FTTA 3EUKL 1BIBA 2VBYA 3BCAA 4OOIA 4V2GA 1GVJA 1MJBA 1USTA 2L2OA 3T1BA 1YQAA 5GP9A 3ASOH 5ICCA 5BPIA 2P6SA 2VQCA 4V2FA 3T5XA 4JX5A 3RTRA 4NBQA 4BS9A 4DBRA 4O3MA 3EYYA 2K02A 2M2EA 1J59A 5F0HA 2WV1A 4L9VA 1AKHA 2E71A 1LDKB 2DA2A 2GM4A 1GHCA 3WTYC 2D1VA 2BZTA 3PM1A 3TL4X 2W1OA 4HSTA 3K4BA 3BR3A 4CH7A 4I0BA 4HF1A 4A3IJ 2L0KA 2BYVE 4PFPA 5HOOA 2PMUA 1HCRA 2HTSA 2J5OA 2QQAA 3F22A 3CC7I 4U87A 2UWMA 3KE2A 2XV4S 1UG2A 4CCOA 5B5EC 1OFCX 2I10A 3H9JA 3OL4A 1I3AA 2KRFA 1MW7A 1B1BA 4A69C 4IKFA 2ZMEC 3M8FA 1R36A 3ZMSA 5C4XJ 1RETA 1HQCA 4HX7A 4Y33A 3BJAA 5HS7A 4RB0A 4CYDA 1V3FA 2A6EF 2VQHA 1MMDA 2E1NA 2I8DA 5K5RA 1A36A 4BHCA 4BEHB 5D5VB 3EPZA 2K40A 4A6DA 2PLYA 1LFBA 3CP2A 4UVCA 2DTZA 2BV6A 5HDNA 1OR7C 4UUSB 3BY6A 2F4IA 3WHCA 3CCEI 1B72B 2ESNA 5JLWA 1NG6A 3FWEA 3ERMA 4IXAA 1OPCA 3RKYA 2VLAA 1YJWI 4HLXA 3TGNA 4W1UA 4HAMA 2CWEA 2W25A 2Z5UA 4D1QA 3N4MA 4CICA 5FLXK 3JREA 1T6SA 3KYLA 2ME6A 2HTJA 5KCMA 4RDUA 3S1QJ 4AIKA 2AXTC 1WH7A 3IAS2 2RC4A 3WODF 2DT5A 4DBQA 3LSIA 1TZLA 2FMLA 5LEJA 2L7KA 5ED4A 3JSPA 3ZN0A 3K4LA 3LSHA 5H2FC 1VQOI 2R7UA 2GWRA 1JKPC 1VF9A 3M1EA 5HNHA 2NVXJ 2STWA 3UNGC 3H36A 2VKVA 1ON1A 2NYXA 4RAYA 4ZYEA 4XONA 4XL9A 1Z7LA 2WAQN 4S04A 3SZPA 4LK0F 1BC8C 1K79A 2G0EA 3A2KA 1TWAJ 4ZH4F 2BY1A 2XPUA 1QU3A 1BN5A 1LEAA 2GA2A 3JRIA 1WH5A 1YW7A 1U5TC 5TGTA 1IXCA 1ENHA 2JRMA 2X4HA 2ZNYA 2WV0A 3R4KA 3GVAA 2DFFA 2K85A 3K0LA 3GYHX 2H6CA 5J3LA 5DYMA 4NNJA 5HDGA 5M5YJ 1G4DA 2L9RA 3ROUA 5CVVA 4IOAF 1NHAA 4IQ4A 3WTWC 1LDJA 3NAUA 4HDVA 2EBIA 2JA5J 2CW0F 3FXJA 3BJ6A 3BWGA 1X4OA 4G8XA 2MG4A 2CQQA 3FISA 4M3DA 3E1SA 5GTIC 2HYJA 1I1GA 1HSTA 2F5DA 1ULYA 5EEGA 2QA4I 3TQNA 4E7IA 3OOPA 2Y9YA 3F6VA 1USSA 3Q3SA 1MZBA 2H6BA 4A0YA 4ZYAA 4AC0A 4BEHA 1G3TA 4XLHA 2NVYJ 2DK8A 4PJJA 4C2TA 3IP4B 2ELHA 2R7WA 4WXCA 2LD5A 4IO9F 1VQ5I 1MKMA 3MN2A 2VBXA 4LK1F 3VPRA 4C3IJ 3AG4H 5JVGF 2EZIA 3FMSA 3R60A 3OYNA 2R7ZJ 1B72A 5GADJ 1Q1HA 2KFDA 3V42A 4BQOA 4EQQA 2XF5A 4HRIA 4A3LJ 2ACJA 3LFUA 2L9SA 5BMZA 2V1UA 3ZQFA 3HUGB 4JBAA 1ZN2A 4GGGA 2H8WA 3E7LA 4KDPA 1MBJA 3ZQCA 2JVGA 2DA6A 2PBIA 5FRMA 3BC8A 3HM5A 4G94A 1JE8A 4DOZA 1KA8A 1TWGJ 4FASD 3RKQA 3HJEA 1JHFA 2EH3A 4HLYA 3EDPA 3BROA 2XGCA 1WFXA 1VQ6I 3F3XA 4DYQA 4OWRB 4ZYDA 3LA2A 2ESHA 1KU2A 2ZMEA 2BVMA 3MAJA 2GOMA 5L3DA 1O7FA 2HDDA 2VB6A 1Y6IA 4J19A 2JUCA 4XLEA 4G6TB 2QYOA 1VTNC 2F5FA 2W7NA 1ZR4A 2DJIA 5D8KB 2R3SA 1YS6A 2K4BA 3QQAA 3N97A 3F6OA 2QM3A 1UG0A 2ZFWA 4GDFA 1OR7A 1ETXA 1EV7A 1SMTA 3OYBA 3QYFA 2X1DA 1MH3A 3FHNA 3RI4A 3GWZA 2R92J 1BOAA 1WJCA 5GTHC 3CUQB 1XDUA 4ESBA 3WTTC 2KL4A 1YG2A 2QWWA 2MGQA 4YELA 3ZXSA 2DLLA 2LDUA 2DPDA 3F8MA 2EINH 3OIQA 3A4CA 4AD9A 3IRRA 1WCMJ 2BOLA 5JVTA 1ZRCA 2G7HA 2EB7A 2OUMA 5J4VA 4XN3A 5D4SA 1J75A 3FXKA 3V7SA 1KONA 5K7ZA 3K6GA 2CFOA 1D0YA 2M87A 3W2VA 2FRHA 1H0MA 3FXLA 4R79A 2ISYA 2MH2A 2W48A 3GTGJ 1JUMA 4R1HA 5E1XA 3CCQI 3TP0A 3HB9A 3FBIB 2KIFA 1N75A 4BQQA 4RMNA 5JHFA 3BQZA 3BP8A 2B0LA 1GXPA 1TW2A 3HRSA 3PNTA 2CV0A 4BAYA 3PIOF 1HDPA 4EJVA 4HOBA 1UHMA 4XLFA 2RVCA 3JAMK 5A2QK 1TP4A 2CSOA 2FE3A 4HF0A 1VFCA 4IHXA 2QGUA 3BR6A 2D45A 2W82A 1WRJA 1XG1A 5TRDA 3HUGA 4D9JA 5FKOA 3M8EA 1U5TA 2DODA 4AVZA 1Y8RB 3DXJF 2CJJA 4LLLA 3ZMTA 3QOEA 4I98B 2GQQA 2ELJA 3H0GJ 4G7ZF 4KA4A 2EJRA 2JSCA 1ZYRF 1H8AC 2KMUA 2NS7A 5LEKA 3VYUB 3HPGA 1BW5A 2HOAA 4BL0B 4A0XA 1P7IA 2JPCA 2W4SA 2LG4A 1W1WE 2R0QC 4B8XA 1L3LA 3R6SA 4G6DA 4HNVA 1LVAA 2LYCA 4MO7A 2HU9A 3ZMDA 1MSFC 5IT9K 1E0EA 5K5OA 3H5RA 3S1MJ 2P5VA 1TWFJ 1YIOA 2HVRA 2QSFX 4KMFA 1WJAA 2LY2A 1F5TA 2BW3B 3GTMJ 3AFHA 2A68F 1P6RA 3OIOA 1CF7B 2L9VA 1I5ZA 4XKVA 4BY1J 1ZHFA 3JAMZ 1XMXA 4XRSA 2GXAA 1FP1D 1HKTA 1XB4A 2RGVA 1X58A 2JA6J 2EZHA 2NXNB 2PN6A 5F6FA 1QA6A 1ZH5A 1B8IB 1WJ5A 3H3UA 3H0DA 4RAZA 5FB2A 4RLFA 1Z67A 2Q0OA 2YX4A 2QQBA 4P1WA 4RGRA 1ZG3A 1BR1A 4EJWA 3TOBA 2QUFA 1W36C 3CUQA 1MJAA 4I0AA 2DN0A 3BR0A 4PZJA 3SFZA 1UHSA 1X1AA 5EZHA 1DPRA 4KT5C 2W57A 1HF0A 3OYFA 3GLXA 4OU0A 1MDMB 1JJ6C 4UNOA 1FIPA 4L5JA 4XORA 2JUGA 5IYDJ 3GTPJ 1D5VA 2Z99A 4ON0A 3GZ5A 4A6EA 4RM2A 2P8TA 4M73A 1TLHB 2XAHA 4Q48A 5IT9Z 1ZGAA 4LMYA 1TT0A 5EEAA 3DEUA 3VYSB 4ABZA 2ZFUA 2DOEA 3LAJA 2H1LA 1I3QJ 4KIFA 2V9PA 2BE5F 3NQOA 1VI0A 1K6YA 3EUAA 4WXDA 3JRAA 3E6MA 1S6LA 1X3WB 5C4JJ 1FNNA 2R7SA 4H4KC 2STTA 1LEBA 3O3KA 3ESWB 4BQAA 1DGWY 4IHYA 2G7UA 2COMA 3KIOA 4FE7A 1CGPA 1QVTA 1XMKA 3I5UA 4HA8A 2KRCA 2Y9ZA 4QLCU 3PL8A 3HOXJ 1FPQA 2NOJB 4Z2YA 2R7QA 1X1BA 3BTLA 2FUG2 2WY8Q 1WWXA 2E7XA 2DMTA 5ICEA 3GF2A 2YR2A 4EEFG 1QBJA 1B9MA 3T8RA 2JT1A 4CCJA 1E3PA 4ZZDA 4UUVA 3J80K 5JR3A 1MNEA 4DZPA 3SHFA 2FEZA 2NRAC 5L3FA 3V4GA 1MBKA 1WGXA 1SVOA 1SFXA 4XBFA 4XLPF 3O6BB 3KYDB 1C0WA 1UJ8A 1MD0A 5F64A 1IN5A 4D7NA 1VQLI 3NWTA 3ONQA 4JK1X 1KQ0A 3J7AO 1RUOA 2F5CA 2ME0A 3LSMA 4W97A 3CZ6A 4IQJA 4Y13A 1R23A 1SD5A 3I4PA 4PFOA 4N4NB 2UUZA 2BW3A 3TO6A 1MBFA 2LF8A 2R4GA 1IN4A 3VFZA 3ULQB 2M45A 2FBIA 1CF7A 1FP2A 4RM3A 2GIZA 4KIBA 3BG9A 4NQWB 2KLOA 4XRFA 2O03A 3HG9A 4BNCA 4A12A 1RIOH 4EJOA 1BR2A 1B8IA 3VSLA 2K9MA 4DYRA 3OYAA 3J80Z 1R5GA 2LC2A 1FLIA 2RNJA 1B9NA 4N4OB 4IZZA 4LLNA 2PMZA 2DJNA 2ZKZA 4HV6A 2BY0A 1FYKA 2IW5A 1YJNI 3S14J 2I5UA 2V1NA 3GUDA 3J81Z 2ZCWA 2F4MB 5BOXA 1J7KA 2M1BA 3OL3A 1YLFA 1U0JA 3FBNB 2F5EA 5IYBJ 4EGYA 3ABMH 4LB6B 3SJMA 4Y7NJ 2L3DA 3E6CC 3K2ZA 3DLAA 2Q2EA 4L9JA 3FZVA 1K83J 1QHGA 3OY9A 3FXUA 4RB3C 2LH9A 3TP3A 3A01A 3I0TA 2OD5A 2MH9A 4O6JA 3SEQA 1OCRH 1BL0A 4UY8I 1SFKA 3RQIA 2XKOA 3BZCA 3LA7A 1LE8A 3HOWJ 1R58A 1GT0C 3LSKA 3I59B 1EH6A 4NC8A 1RC9A 2MFZA 1VQ4I 2K7LA 4OIRF 3RKXA 2FA5A 2UZKA 2BY2A 1G8XA 1PDNC 4DIQA 3GEZA 1E2XA 4X0GA 1EH8A 3QPLA 3OYMA 3AAFA 2V79A 3S17J 2ZB9A 3KP3A 2UV1A 1X1PA 5D5XB 2FF4A 3JTGA 2BEOA 3COAC 2OA4A 3L09A 3KP4A 3OYEA 2CV1A 1ZLJA 3F9KA 5AIPA 1QO0D 1R7JA 3OS0A 3TEDA 1ZTRA 1BBYA 2A3SA 1PUFB 4B3XA 2BY3A 1OQYA 1ZRFA 2QBYB 4B1RA 1JUPA 1K4TA 1U78A 2XUBA 2X1CA 2EILH 4A3BJ 4MQ9F 3VSKA 3OV8A 2OF7A 1IRZA 1H9TA 2BVLA 4O5VA 4AYBN 3MKWB 1I6HJ 1TTYA 3G4SI 2P4WA 4EJUA 3I56I 1RRJA 3QPSA 2IVMA 1BR4A 1SD6A 3MKLA 4M3EA 1AWCA 2WC2A 1XMAA 2E1MB 4KICA 1I6XA 5CLSA 3I64A 2Y0SA 2KP6A 4S0HB 2CUJA 2QKMB 2R7XA 3PUBA 1EKEA 4KJZA 1W36D 4I09A 1SFEA 3ERED 2HS5A 1WZ2A 1ZLKA 1ETQA 1AU7A 3R0JA 2WADA 5JHUA 1IXRC 1ZELA 2CU7A 3PIPF 1ZREA 2Y48A 1V55H 2ECBA 2E5ZA 3QPTA 4QTRA 3WTUC 1VNDA 2D2WA 2KDOA 3ZQGA 1EH7A 4E6KG 2YU3A 3HKZA 3HEFA 4QSHA 2WB1A 4OAYA 5C3EJ 5J1RA 1E3OC 3O2PE 4OMYA 4A3GJ 4BXXJ 3OR2C 4F55A 4BE2A 2V9KA 2Z3YA 5KAFC 1J5YA 1O3SA 3DQVC 1OKRA 3OYHA 3U9GA 4FQGA 1U9NA 3ZGKA 3S3OA 4HZFA 4B44A 2CQ7A 2F48A 3BZKA 4KFCA 2HOTA 2WA0A 4XRSG 3I59A 4D0PA 3CJTB 1XTAA 2YSRA 1P7JA 1YW8A 2HR3A 4Z6YA 2E1CA 1MNMC 1XGOA 4GYGA 1LNWA 4N0BA 1TW3A 1ZRDA 2H1KA 2VJ4A 3I55I 3KLNA 1P2FA 1ETYA 3LL7A 1R1VA 1OLTA 1Z0XA 4KYWA 2M3AA 2QZ8A 2FU4A 5EYRA 4B43A 5IOYA 3HC7A 3M7GA 4BJ6C 3JSOA 2IA2A 5F1JA 4R8HA 2X48A 3WU0A 4V19K 3LA3A 2FNAA 1TNSA 2R7TA 3FK6A 1RUNA 4MEXF 2VXZA 4A2UA 4D5FA 3K1NA 2VOOA 1F36A 5F0FA 1AHDP 1EA3A 3VODA 3KEOA 3V8LA 2KZGA 4M3GA 2Z9OA 1WPKA 1DP3A 1ORKA 1KU3A 3MD2A 2BXYA 1PUFA 5D6FA 2Z16A 4M6YA 1A31A 3A1YA 3PSIA 2GOXB 3FIWA 3N05A 2HNHA 2ADUA 3L2QA 2DXIA 2CW7A 4A3JJ 1GDTA 2IAIA 2DBBA 1ZAOA 3CJRB 3TW7A 1ETKA 2P81A 1SEUA 3K70D 2L7ZA 4OIOF 3QYBA 5GPCA 4WK8F 4KNYA 1QZYA 3JW4A 3BPXA 1MMSA 1QRYA 1X1DA 4HX4A 3B6CA 3KEYA 1S5LC 1QHHD 2VC1A 3RZDJ 3K1MA 4G9YA 2ID6A 2M7BA 3K4NA 3OSFA 3J7AY 1TQIA 3DEWA 4PGGA 2XAJA 2DDAA 1BC7C 3KCCA 1QQIA 3BZ6A 3G71I 3R61A 3KZZA 2E2IJ 2JZYA 1WJFA 3WU1B 4A93J 2XSDC 2LVSA 3PUFA 1N25A 4B09A 1OYIA 1WSUA 4ZTFA 3A03A 4F92B 1M1EB 3CLOA 2PI0A 4IHVA 3WHBA 2K27A 2PFBA 1KYWA 1XSVA 2CQXA 2ZNZA 1TC3C 3W2WA 3AG2H 1W0UA 1VQ8I 5DD4A 3IAM2 5HLGA 1JHHA 2OBPA 1OCTC 3WTXC 4ESJA 1BJZA 3OYDA 3ZCOA 3SEZA 3IKTA 2VC0A 2DYRH 2OV7A 1J0RA 1SVLA 1GUUA 2M5WA 2PMHA 1DU6A 3T8TA 3CTAA 1D3YA 3C2GA 1CQTA 1IW7F 1G59A 3LMMA 1XCBA 2JRTA 3ELKA 2QQ8A 4PJMA 3BG6A 3F0CA 3FKIJ 3CMEI 4ENMA 1MNDA 1P92A 1RNLA 3KP5A 2QQ9A 1R22A 5CVIA 4A3CJ 2FJ1A 4G6QA 5ICFA 2LBFB 3MWMA 3LQRA 1KU9A 1W5SA 5FLXZ 2R7RA 3H5AA 1WJEA 5E20A 4IF4A 1I27A 3DTIA 3BG7A 5LHHA 2WBMA 5FLMJ 3DWLE 5K7HA 3ZPLA 3WGGA 4B48A 3TMOA 3L2UA 1Y0UA 2XC7A 4RAFA 1YE9A 1XS9A 5DV5A 5J47A 1NK2P 1TWCJ 1D1BA 4ASNA 1G2HA 3FXOA 2L9NA 2O5RA 4C3JJ 2VQGA 4PJ0C 1QVUA 3EUHC 3EQLF 3CJQB 5DM6F 1W4MA 5HLHA 2V26A 3CDHA 2OTJI 2EFPA 4DQ2A 5J8FA 2XF7A 1SFOJ 5J4YA 3CDIA 1N77A 2E2JJ 2DQLA 3L2RA 3VWBA 3HOYJ 1ODDA 3I71A 2DOFA 3I53A 2RQQA 4UUSA 1UB9A 1AA7A 1XPXA 3WE2A 4IRIA 3GFLA 2MD5A 2FMYA 2R93J 1ACIA 1SVMA 4WXHA 3G1OA 1P9QC 3CUQC 4I99C 1Q1VA 2XRNA 1YO5C 3OIPA 3JRHA 2EIMH 2P7CB 3KYCB 3QAHA 1FBSA 2VBZA 4AWXB 3MQ0A 3BOQA 3L7WA 3F8CA 1P4WA 4M3BA 3RIRA 4A0ZA 3CP8A 1IO2A 1X2MA 1FOKA 4CCKA 3LOCA 5HODA 4FETA 2O8KA 2OTLI 1WJDA 2KQRA 2LLKA 4LITA 4EATA 2LSOA 2X1EA 1FWZA 1ERDA 4FISA 4F91B 3BR5A 1Z3YA 6PAXA 1IV6A 1ONVA 3RPUA 3AG3H 2HXIA 1XGSA 4E7JA 4A5NA 4HYEA 2TDXA 3GZ6A 3HOTA 4C3HJ 4LLGF 3PQJA 5ILUA 3MZYA 1F9NA 2E60A 2K3FA 1LJ9A 1TNTA 3HRUA 2IT0A 3ZQQA 3DU6A 4LGWA 4Y17A 4YIRX 1OMIA 4ZDOA 2VPRA 1SD7A 1YJ9I 1R49A 3FHZA 5EGOB 1A6IA 3I54A 1R6RA 2LBFA 3RYRA 2HKXA 3DP7A 1I1SA 4E7ZA 2ZJPF 3IWFA 4L9NA 1RKWA 3BPVA 3GW2A 5L3GA 3J7YJ 3DEEA 2XPWA 3P9CA 1T33A 3DKYA 3HDDA 5FKNA 3LNQA 3IHUA 2L01A 5E3LA 3PNVA 1YS7A 4HNTA 1W5TA 2DOAA 4BY7J 1H89C 3DKXA 4F93B 3CMMA 3IV5A 5IP6A 1BI3A 2HKOA 2E5NA 2RAEA 4IRGA 2M7AA 3H9GA 3RPUD 3IL2A 2E35A 4P55A 3D5SC 2A5YB 4BJ5C 1R4NB 5L3CA 3RSNA 3MMYB 4KIGA 4XLNF 2ZXJA 1FT9A 1E3HA 2H94A 4WCGA 1DU0A 3J7ZI 2ISZA 3NRVA 2A5WA 3A0HC 2HI3A 5BQTA 3OYGA 2KKOA 3M9AA 2V9VA 5DDGA 3TOAA 3PFYA 2LFBA 5GAEJ 3L9FA 4XKBA 2AS5F 3NWSA 1R9TJ 2JQ7A 2O6GE 1ITYA 3L00A 1RR8C 1SAUA 5GAHJ 3K10A 1FTZA 5CKTA 3K1PA 1APLC 1S7OA 5ICGA 5LHIA 2VONA 3CCUI 2QSGX 1JT6A 1JXSA 1TBXA 3S1NJ 3DF8A 2FSWA 2XAUA 3HXLA 3KX2A 4HQEA 2VJIA 3Q9VA 4UV9A 2AO9A 1X19A 1X2NA 1TT5B 2VE9A 3LSPA 3VYTB 2V1XA 3ZR8X 3F23A 3LWFA 1D5YA 3RZOJ 1J2XA 3MZ8A 3BLYA 2FOWA 4HG2A 1FX7A 1MMAA 1ETVA 4UB6C 4WF2A 3U2RA 2CRGA 1BM9A 1ZG1A 3WTSC 4I6ZA 4OAZA 1T0FC 1W7PB 1F43A 4ENNA 1IXSB 2LTPA 4U0YA 4Q4ZF 2KPMA 2HPIA 4BKXA 3EUHA 4MFEA 4XMYA 1K78B 3CO6C 1ZKGA 4BDYA 2OAZA 4XM3A 2Z1DA 2L7MP 4S05A 2E36A 1D1AA 3GMEA 2X6XA 2VN2A 4RB2C 5A2QZ 2LNBA 2Z2SB 1DUXC 2FX0A 1P4XA 1ZGWA 4BQNA 1G3SA 4HPQA 1O57A 4XKCA 4RS8A 2CUFA 2OZ6A 1MBGA 3FF5A 4BDZA 4MLOA 3QYEA 4A3DJ 1S7AA 2EV5A 2QVOA 3Q0VA 3P9KA 3IH2A 2RQPA 3RPQA 3ZN1A 4CDGA 4II3A 1YW9A 4JQFA 3L1PA 4GRIA 5EZGA 3QWLA 1OCZH 2XPVA 3H9QA 1FSHA 2DA7A 4I01A 4PSXA 3HBLA 1Y0NA 2HQRA 4QPQA 2F5VA 3HL2A 1YTYA 2O8XA 5E79C 2K4JA 3PSFA 1FBUA 2DFHA 4CA0A 1XDSA 4CO8A 5DEQA 4HBLA 4IVNA 4GYIA 1JT0A 4K2EA 2EWNA 2CS3A 3V8KA 1QPMA 4CCLA 5K7FA 3JTHA 3FM3A 4HSRA 2HOSA 2Q1ZB 3GTKJ 5TJJA 4BBRJ 5FROA 4B4CA 1NK3P 3RCOA 3P7NA 1IZ1A 1MJ9A 3LAPA 4OMZA 4KT6A 2PJRB 1IF1A 1IN8A 1O7LA 2B9SA 4L5IA 2XB5A 5J6XA 3K69A 1AOYA 2KDZA 3AL0B 1LVKA 3SDGA 1T95A 1Z77A 1ZK8A 2CQNA 3X2QH 1Y1WJ 3LSTA 5ERIA 3WG9A 5GAGJ 3Q5FA 3HHGA 4AIJA 2LREA 5B1BH 3SFIA 2H09A 2E2HJ 3IRQA 4PSWA 4CZZA 3KP2A 5J8CA 2ZXWH 4X1EA 2OCCH 1W7PA 1R1TA 2A6TA 4IOCF 3MZHA 4C30A 5HLIA 4M6VA 3W2AA 1UELB 4EM2A 1X3ZB 2M0MA 2IPQX 1VQ9I 2ZXIA 1FOWA 4CSWA 3K70C 2EK5A 2G9WA 1IGNA 2P5LC 3JRGA 3DPTA 1HBXG 3A02A 3MVPA 2CQKA 4UVBA 4FTHA 4CHUA 2GBYA 1LB2A 4I7HA 4PJLA 1ZGJA 2Y0SN 3G3ZA 2C6YA 3FXMA 3HIFA 4DW6A 3ZOBA 3KP7A 4XLCA 1T38A 1HLVA 2EV0A 1GV2A 2ZC2A 3QU3A 4PJNA 2KJCA 4PCQA 3EETA 1FJLA 2UXXA 3CDLA 1MDMA 1HW1A 4KN4X 4U0VA 1XD7A 2DO7A 2EIKH 4LG0B 5C44J 1T2KA 1YX3A 2AQEA 2WY7Q 1W7PD 4JP0A 5JFRA 5JLXA 2EV6A 2XGXA 4M72A 2NNYA 1SFUA 3HKZN 3ABUA 2WB1N 3BR2A 4MTEA 1O4XA 2QSHX 3F72A 2DQRA 2LR8A 2DDBA 4EM0B 1T0FA 2EFQA 2EA4A 1Z1DA 1Z7UA 2VI6A 1FYLA 3O8HA 3E5QA 2E1MC 4BXFA 5LRSA 1JI8A 3LQQA 2VOPA 5IYCJ 2IGOA 1OYWA 2CFXA 2GIVA 3BJOA 4BJTA 5FJ8J 4ZDPA 1V5GA 1YRNB 3QP6A 1VQMI 1SC7A 3FXRA 2VKHA 3WGHA 1HKSA 2DYSH 3DPLC 4M9ZA 1ZQ3P 2PJRA 3IC7A 1Z05A 2AHQA 5TISC 1BI0A 4UHTA 2KISA 1D8JA 3FX3A 1LFPA 1I39A 4JYKA 1ETWA 1IC8A 4BACA 4AM3A 4XNFA 1S9HA 3ZQIA 3S1RJ 2VUMJ 3CF2A 5E18F 4G7HF 3C2BA 4KITB 1JGSA 3C1DA 1QGPA 4P9UA 5LRRA 3C3WA 4ZJZA 1FSEA 5DD8A 2QEXI 3PJRA 5IY5H 3A0BC 2HVQA 4LFUA 4F3QA 4A3FJ 4M3FA 4XSZF 2X6OA 9ANTA 2KJBA 2CG4A 5M5WJ 4UUTA 5CYVA 1IG7A 4Y52J 1VQ7I 4J00A 5FKMA 4YFKF 1N78A 3CCMI 1GV5A 4NQWA 1YITI 3HRTA 3CMAI 1BA5A 3HRMA 1VQNI 4M9SA 1PP7U 4RGSA 5D8LB 3ML6A 4XR6A 5IT3A 3DFGA 2XASA 2ZSHB 3CLQA 1LQ1A 4EVIA 2CW8A 2ETHA 1JJ8C 1G3YA 2NS0A 3VB2A 2MC4A 2WAEA 2MA3A 4RLQA 4KN7X 2K86A 1YYVA 1R5ID 2DA4A 3I9V2 2XIGA 1ZARA 1VZ0A 1IRFA 3DPUA 2X51A 4IHWA 1HW5A 1NG7A 1WVRA 4U88A 1WJBA 2A05A 2V4JC 5E1WA 2ZO4A 4MFDA 3S93A 5M5XJ 2IGMA 1ZG5A 3C18A 1YI2I 3K2AA 4U0WA 4HX8A 4L18B 2RDPA 3HSRA 4RGXA 2M4GA 1V5FA 1Z9CA 3CCRI 4NHJA 1GXQA 3C7JA 2VPLA 2V6CA 1MMNA 2EIJH 4UVAA 3TBIA 1WQ2A 3BT9A 4WWCA 3KETA 4ZTJA 5AIQA 2VT2A 2QF7A 1JUSA 4GFBA 1D0ZA 2GA1A 2P7VB 1BOBA 1WI3A 3JRFA 2L5QA 2OJED 2HQNA 2FNPA 3DBHB 2F6CA 2NVTJ 2IXSA 1YRNA 1JTXA 1GLNA 1FBQA 3CC2I 1T98A 1S29A 3CCSI 5HNFA 3G2BA 3DU5A 1IDZA 2YUSA 3L2CA 2D5VA 1IRXA 2DI3A 2LY1A 3DV8A 4XOPA 3H3VK 3Q0UA 3P5JA 1RESA 1XX5A 5K5QA 3MKYB 3LSGA 3S3MA 2YU9J 5FKKA 1LKXA 3WTZA 4PUSA 2V1DA 2F4OB 1XC5A 1HC8A 3BCBA 1VQPI 4RA2A 1Y56A 1BW6A 4E4HA 4XLAA 1U8RA 3VDXA 2DFIA 1FMWA 2K3PA 1Z3XA 4CXFA 4JX6A 4KUMA 1IN7A 2GAUA 3NARA 3OYJA 2QBYA 3FKJA 1OCCH 4XSXF 3NEUA 3QRFF 3OYIA 3FXQA 2BBYA 2JTVA 2KT0A 2CH0A 4ZZLA 2XAGA 5B1AH 2HZTA 2MW8A 3HTUA 1XSXA 4RGUA 5BPDA 3U1KA 2L7FP 3IWZA 2EQRA 1QZEA 2GXBA 4IHTA 4OIQF 2JA8J 4LIUA 3KZIC 4AYBA 2R5ZB 3VEPA 2ID3A 4LG3A 2JJ7A 2DMUA 2ZXHA 2WWYA 4ENJA 2N8GA 3M1CA 4YEJA 2PJPA 3G6EI 2VT3A 3FMRA 4MQVA 3K4JA 1V4RA 2QKLB 2DFEA 4L9TA 5KVRA 2HOEA 5ILSA 5BS6A 1WI9A 2IP2A 1VQKI 3E6DA 4IL6C 1SMYF 3E0JB 5H6RA 1R71A 3F8NA 2K9SA 1XSDA 1R00A 2QENA 1H88C 4CGZA 5FD5A 2ZJQF 3ZP5A 3OR1C 3GFIA 3HOVJ 3S16J 1R4MB 2K9NA 4FX0A 1A5JA 5D5WB 2DAOA 1I50J 2MBFA 2R5YB 1V5EA 3CCYA 1GVDA 3LSRA 2DPUA 5E3OA 2M4KA 5HLTA 1B6AA 3QPHA 3OSGA 3JR9A 2F2EA 2YS9A 3ISPA 3O8GA 3KEQA 4FX4A 3VYRB 4MEYF 2DCEA 3OOUA 2R7OA 3H35A 3CCVI 1IRGA 3E3VA 2HQAA 2ZMEB 4EM1A 5E1ZB 4ITVA 1XGNA 2BGCA 1O3QA 2JSPA 2MABA 3GFJA 4F52A 3PQKA 3S2WA 1FYMA 2WTEA 4EJTA 2WAFA 3PNYA 2CV2A 2FD5A 3ZMVA 5D6EA 2GLOA 5LGTA 3RKWA 4G7OF 5DUIA 2VKEA 4C9YA 2TRTA 4YG2F 1RKTA 3RDIA 1Y8QB 3I4MJ 4P5OA 4A3KJ 2DU9A 2K9QA 2K9LA 4HQMA 4CUGA 4JX4A 2L4MA 3K9TA 2OPTA 3FMQA 3V7CA 4ZC3A 1IJWC 5JI6A 1KU7A 3QODA 2UXNA 2NAZA 1DQUA 4XQFA 1IDYA 3ECOA 1MMGA 1XGMA 2LF7A 5KHDA 1PVEA 4BXUA 1FY7A 1FOYA 3LFKA 1OCOH 2W24A 2Y75A 1F1ZA 3BG5A 5E8GA 2HFHA 2OCEA 3ZMUA 4BBSJ 2MLKA 2OU2A 2OZUA 2QLZA 3L2VA 4YFXF 3GCMA 4L5EA 1A04A 2XAFA 3I3LA 3ZQLA 2X6YA 3G73A 1UMQA 1ON2A 5HDKA 4N9HA 3QOPA 5FFXA 1JGGA 4IJAA 4J01A 2Y69H 1QZZA 5F27A 2VE8A 2R5ZA 2BXZA 3HGGA 2A07F 4RAGA 5H6QA 5FRNA 1R1UA 5LGUA 4BHBA 5LFAA 2A6HF 5H20A 1T8IA 2Y31A 2Y0MA 3TDUC 4FT8A 4G12A 1F4KA 2XGEA 3CCLI 3WU2C 2DMNA 4E7LA 4FCYA 2YX7A 4PDKA 4D5CA 3V8JA 5HVQC 4QPOA 3M3YJ 3LSJA 4BH9A 3GO5A 2JA7J 3HTSB 2ELKA 4AU7A 1YFHA 3KP6A 3HZJA 4DNCA 3S15J 2M9HA 5CQGA 2IA0A 2HYGD 1LPQA 4FE4A 2FOKA 1TWHJ 5LLQA 4AUXA 1JTYA 3ZRGA 1U5TB 3W6JB 3H92A 3D1NI 2R5YA 4I02A 3D5LA 1DGRM 1K4SA 3M07A 2M30A 3BQYA 4YFNF 2MLGA 3OS2A 5E17F 1IUYA 1KGSA 1G3WA 3BG3A 1KZHA 1POGA 2IS1A 3E5UA 3M4OJ 1FEXA 3U21A 5E3MA 2RKHA 3S3NA 4Q47A 5F0CA 2HPMA 3F21A 1UHWA 1HDDC 4A3EJ 3I58A 2V6EA 1Y39A 1LUJB 2DT7B 4ZDLA 2EFOA 1BIAA 2MSYA 1U8BA 1DDNA 2WAQA 4XK4A 1EJ9A 4N9IA 5IP7J 2IRFG 2X9DA 1IV8A 5F1RA 3PO2J 1KQ9A 4HF2A 3GTQJ 2JK3A 4AIHA 3H3ZA 5FD6A 2DA1A 3ABKH 1UAAA 2Y30A 3OS1A 4A3MJ 1FIAA 5D4RA 2LK2A 3HSEA 2VODA 3DBLB 5LHGA 4HV5A 3F8FA 2COBA 1STZA 5LD2C 1HW2A 4NC6A 3HOZJ 2W85A 2ECCA 4HNUA 1IN6A 5E3NA 1HSJA 5D5UB 1W0TA 2CMPA 2VL8A 2VKDA 2MYSA 1WHUA 3ZQ7A 3AKZA 2ICWG 3S2DJ 3IKVA 2CO5A 4QWQA 4CZCA 1SD4A 3TO9A 1FOXA 5LGNA 1UCRA 4U7DA 4MTDA 4EMSA 3K4MA 2LY9A 3BTJA 4KMUX 2KZVA 3RYPA 4E7KA 5B66C 3GBGA 2IEKA 1ZR2A 4U7BA 2XVCA 1TQPA 1S3JA 4II2A 1IAWA 1RPWA 2XRLA 1SANA 2X85A 2VBWA 3CD6I 2OQGA 3Q9SA 1YOVB 2PG4A 4L0ZB 4XICA 3T0YA 4TV7A 3MEXA 4F7ZA 3B6AA 1RI7A 3ASNH 2E7WA 1Y1VJ 2DW4A 2HGCA 1HOMA 2R7DA 2IBDA 2XAQA 4BHPA 4LIVA 4OINF 4BE1A 2V7FA 4PGHA 2O61A 3SDBA 1JKQC 4ZYHA 3OWTA 2DTRA 3M8JA 3OYLA 1TL8A 4LJZF 4RBOA 2ZJ2A 1QNTA 1FZPB 3HYIA 4UB8C 4RB1A 2W00A 4MNUA 2J5PA 1J09A 2GXGA 4MGRA 4ESFA 2DK5A 3E5XA 4PK4A 4Y4RA 3FK7A 3QU6A 3CUOA 4CCMA 2PEXA 3D5RC 2XKPA 3CQZJ 4MHGA 5CJ9A 5EGOA 3KFWX 5CQEA 5CVJA 2BHYA 3AL0C 2NVQJ 1RZ4A 3DTEA 3F8BA 2CGPA 2BHZA 5KAIC 1LDDA 4Y15A 1X3UA 2H27A 3HOSA 1R5HA 2W84A 1A6QA 4M9XA 3JRBA 3CCJI 4IHSA 2PMZN 2L02A 3TO7A 2LKPA 5ILVA 2FQ3A 4E7HA 4M6XA 3RQ4A 1V54H 3HOUJ 2JVHA 4KISA 5AONA 4BYYA 3K4KA 3D0SA 1Z91A 2XDVA 4XIDA 1W5CC 4BUPA 1HA8A 2M8GX 2VASA 3ZQHA 4BGDA 3TKYA 1BI2A 1DP7P 5L3BA 4L0YB 1OYYA 2CUZA 5K1YA 1MH4A 5HS8A 1PUEE 3PO3J 4JOMA 3UR3C 1B4AA 2KIQA 2Q2EB 3R0AA 2IS4A 2X6WA 3DKWA 4Y3OA 1X1CA 3JRDA 2OC6A 3BDDA 4GCVA 3A01B 4B3AA 4FHTA 3P9IA 1OJLA 2RNGA 4C2UA 1LE8B 1YX5A 3B73A 2JWTA 3PFIA 5J1UA 4MIMA 5HS9A 1G6NA 4DJAA 4XOTA 3OYKA 3GZNB 1T08B 4YIFA 1T39A 2IGNA 5DTDA 2RREA 4NDLA 2Z33A 2OQRA 2E34A 1S72I 3KLOA 3AG1H 3K7AJ 2MD0A 2CUEA 3HSFA 3OMYA 2Q8KA 2GZWA 3E97A 5M3FJ 4GXOA 3GXOA 3ABTA 2EFWA 5BNGA 2HDWA 1MSEC 1HKQA 4X6AJ 1OCPA 4UXNA 2NVUB 5FFZA 5FO5A 5CVRA 4LOCA 3E6BA 1K6OA 2NNNA 3ZMZA 1ETOA 4M74A 1K78A 5J1YA 2VJ5A 2CYYA 2HQ5A 4IPAA 3BTCA 2NS8A 1D8KA 4E7SA 2IS6A 4DZJA 3DLLF 4C2MJ 3J81K 3H1CA 5EDNA 5E8IA 3UKGA 2D1HA 4M71A 3TW6A 1D0XA 2HWVA 4LB5A 2O7OA 5EEHA 2O3FA 5F08A 4IX7A 1LFUP 4CYCB 2B63J 2FXAA 4B47A 5LBQA 1KQ8A 3MKZA 3HPHA 3OYCA 1YIJI 3GFMA 2ZBKA 3K4CA 2LOOA 5CVUA 3S32A 4YRVA 5KNLA 4IRHA 3HHHA 5CPRB 3GTLJ 3IH4A 2DMPA 4I76A 1D1CA 3W3CA 1REPC 2L4AA 4XKWA 3S8PA 2LKSA 2XGDA 3SXYA 1MBHA 1T56A 2DA5A 2O0YA 2R7VA 1FMVA 2IS2A 3S2HJ 3MCZA 1BI1A 2IJLA 5M3MJ 2HEOA 2QCOA 3MFKA 4P96A 5DUKA 2ZJRF 4NUBA 2HDCA 3B02A 3DTKA 1U6GA 5DCMB 3BTIA 1E17A 2IA1A 1JKOC 4BU2A 1J9IA 2FBHA 1WKMA 2EFNA 2DA3A 2XHKA 5L3EA 3HGYA 3KPHA 4LD5A 1PP8F 4BE0A 3QP5A 2LMDA 3GLLA 5GPAA 5FKLA 4AVPA 2VJJA 4HDUA 3V7RA 1UZCA 2JN6A 4NC7A 5EF6A 2R7FA 3GTJJ 5EG0B 2L54A 3SZTA 5J40A 1EF4A 2HYFA 2KIUA 2EZLA 1L0OC 1OISA 3DBRB 3FM5A 4HEA2 4GO1A 1O3RA 3W6VA 3JCUC 1UFMA 1U9OA 2VIXA 1XN7A 2EA2A 1XCVA 3RJPA 4ANJA 1P4AA 3C2HA 3CESA 2HZDA 5DCFA 5B3SH 4EGZA 1U3EM 3CO7C 1AKHB 1RR7A 3JRCA 1O3TA
chains in the Genus database with same CATH topology
3EYIA 2PQ8A 3CJNA 3WGIA 2XROA 1Z6TA 2RV8A 1Z6RA 4YIIA 5FGMA 4OIPF 3SQNA 1FC3A 1DPUA 1HXDA 4EV0A 3GX4X 2FBKA 4ENKA 1S8NA 1K7AA 2KIMA 3U1DA 2P6TA 1BJAA 2AXLA 2RN7A 3KZYA 2A61A 4E70A 4ZYGA 4A5MA 3ECHA 2P5KA 4ETSA 3REOA 1KYZA 4WX9A 5KK1A 3VOEA 4LG0A 4Q5SF 4HW0A 1B59A 4NB5A 3TDZC 2M8EA 1TQMA 2A69F 3W6KB 4UV8A 4P9FA 3WTVC 2MC3A 1U2WA 3WE3A 5DCMA 2YPRA 4I2OA 1SAXA 1MGTA 4H0EA 2JPBA 1H9GA 2X0LA 1BIBA 2VBYA 4OOIA 1GVJA 1MJBA 1USTA 3T1BA 1YQAA 5ICCA 5BPIA 2P6SA 3T5XA 3RTRA 4O3MA 3EYYA 2K02A 1J59A 4L9VA 1LDKB 1GHCA 3WTYC 2D1VA 4HF1A 4I0BA 2BYVE 5HOOA 2PMUA 2HTSA 2J5OA 2QQAA 3F22A 2UWMA 3KE2A 2XV4S 2KRFA 1B1BA 3M8FA 1R36A 3ZMSA 1HQCA 4HX7A 5HS7A 3BJAA 4CYDA 4RB0A 1V3FA 2A6EF 2E1NA 5K5RA 4BHCA 5D5VB 4A6DA 2PLYA 4UVCA 2BV6A 5HDNA 3BY6A 2ESNA 3FWEA 4IXAA 1OPCA 3RKYA 4HLXA 3TGNA 4HAMA 2CWEA 2W25A 2Z5UA 3N4MA 4CICA 5FLXK 1T6SA 2HTJA 4AIKA 2RC4A 3WODF 2DT5A 2FMLA 5LEJA 5ED4A 3JSPA 3ZN0A 2GWRA 3M1EA 2STWA 1ON1A 2NYXA 4RAYA 4ZYEA 4S04A 3SZPA 4LK0F 1BC8C 1K79A 4ZH4F 1BN5A 1LEAA 2GA2A 1YW7A 1U5TC 1IXCA 2X4HA 2ZNYA 2WV0A 3R4KA 3GVAA 3K0LA 3GYHX 2H6CA 5DYMA 5HDGA 1G4DA 3ROUA 5CVVA 1NHAA 3WTWC 1LDJA 4HDVA 2CW0F 3BJ6A 3BWGA 4G8XA 1I1GA 1HSTA 2F5DA 1ULYA 5EEGA 3TQNA 3OOPA 3F6VA 1USSA 1MZBA 2H6BA 4A0YA 1G3TA 2DK8A 2ELHA 4WXCA 1MKMA 2VBXA 4LK1F 3FMSA 3R60A 1Q1HA 4EQQA 2ACJA 5BMZA 2V1UA 4JBAA 1ZN2A 4GGGA 4KDPA 2PBIA 4G94A 1JE8A 1KA8A 1JHFA 4HLYA 3EDPA 3BROA 3F3XA 4ZYDA 3LA2A 2ESHA 1KU2A 2ZMEA 3MAJA 5L3DA 1O7FA 2QYOA 1VTNC 2F5FA 5D8KB 2R3SA 1YS6A 2K4BA 3N97A 3F6OA 2QM3A 2ZFWA 1OR7A 1EV7A 1SMTA 3RI4A 3GWZA 1BOAA 3CUQB 1XDUA 4ESBA 3WTTC 1YG2A 2QWWA 2DLLA 2LDUA 2DPDA 3F8MA 4AD9A 3IRRA 5JVTA 1ZRCA 2G7HA 2EB7A 5D4SA 1J75A 3V7SA 2M87A 2FRHA 1H0MA 4R79A 2ISYA 2MH2A 4R1HA 5E1XA 2KIFA 3BP8A 2B0LA 1GXPA 1TW2A 3HRSA 4BAYA 4EJVA 4HOBA 1UHMA 2RVCA 3JAMK 5A2QK 2CSOA 2FE3A 4HF0A 2D45A 1WRJA 5TRDA 3HUGA 3M8EA 1U5TA 3DXJF 4LLLA 3ZMTA 4I98B 2GQQA 4G7ZF 4KA4A 2EJRA 2JSCA 1ZYRF 5LEKA 4A0XA 2JPCA 4B8XA 1L3LA 3R6SA 4G6DA 1LVAA 5IT9K 3ZMDA 5K5OA 2P5VA 1YIOA 4KMFA 1F5TA 2A68F 1P6RA 1CF7B 1I5ZA 1ZHFA 3JAMZ 1FP1D 1HKTA 1XB4A 2RGVA 2PN6A 5F6FA 1ZH5A 3H3UA 4RAZA 5FB2A 2Q0OA 2YX4A 2QQBA 4RGRA 1ZG3A 4EJWA 3TOBA 2QUFA 3CUQA 1MJAA 4I0AA 3SFZA 4PZJA 1DPRA 4KT5C 2W57A 4UNOA 3GLXA 4OU0A 1MDMB 4L5JA 1D5VA 2Z99A 4ON0A 3GZ5A 4A6EA 2P8TA 4Q48A 4M73A 1TLHB 2XAHA 5IT9Z 1ZGAA 4LMYA 3DEUA 3LAJA 4KIFA 2BE5F 3NQOA 4WXDA 3E6MA 1S6LA 1FNNA 2STTA 1LEBA 3O3KA 4BQAA 2G7UA 2COMA 1CGPA 1XMKA 3I5UA 4HA8A 4QLCU 1FPQA 4Z2YA 1WWXA 2E7XA 5ICEA 3GF2A 2YR2A 1QBJA 1B9MA 3T8RA 2JT1A 4ZZDA 4UUVA 3J80K 5JR3A 3SHFA 2FEZA 2NRAC 5L3FA 3V4GA 1SFXA 4XBFA 4XLPF 3O6BB 1C0WA 1MD0A 5F64A 1IN5A 4JK1X 1KQ0A 3J7AO 1RUOA 2F5CA 4Y13A 1R23A 1SD5A 3I4PA 3TO6A 2LF8A 1IN4A 3VFZA 3ULQB 2M45A 2FBIA 1CF7A 1FP2A 4KIBA 4XRFA 2O03A 4BNCA 4A12A 1RIOH 4EJOA 3J80Z 1R5GA 1FLIA 2RNJA 1B9NA 4LLNA 2ZKZA 4HV6A 1FYKA 2IW5A 3GUDA 3J81Z 2ZCWA 5BOXA 1J7KA 2M1BA 1YLFA 2F5EA 4EGYA 4LB6B 2L3DA 3E6CC 3K2ZA 2Q2EA 4L9JA 3FZVA 3FXUA 4RB3C 3I0TA 2OD5A 2MH9A 4O6JA 2XKOA 3LA7A 1R58A 3I59B 1EH6A 2K7LA 4OIRF 3RKXA 2FA5A 2UZKA 1PDNC 3GEZA 1E2XA 1EH8A 3AAFA 2V79A 3KP3A 5D5XB 2FF4A 3JTGA 2BEOA 3COAC 2OA4A 3L09A 3KP4A 1ZLJA 5AIPA 1QO0D 1R7JA 1BBYA 2A3SA 1ZRFA 2QBYB 1U78A 2XUBA 4MQ9F 3OV8A 1H9TA 4O5VA 1TTYA 2P4WA 4EJUA 2IVMA 1SD6A 1AWCA 2WC2A 1XMAA 4KICA 1I6XA 5CLSA 3I64A 4I09A 1SFEA 3ERED 2HS5A 1ZLKA 3R0JA 5JHUA 1IXRC 1ZREA 2Y48A 3QPTA 3WTUC 2D2WA 1EH7A 2YU3A 3O2PE 4OMYA 2Z3YA 1J5YA 1O3SA 3DQVC 1OKRA 3U9GA 4HZFA 4KFCA 3I59A 4D0PA 2YSRA 1YW8A 2HR3A 2E1CA 1XGOA 4GYGA 1LNWA 4N0BA 1TW3A 1ZRDA 3KLNA 1P2FA 4KYWA 1R1VA 2QZ8A 2FU4A 3M7GA 3JSOA 2IA2A 4R8HA 3WU0A 3LA3A 2FNAA 1TNSA 1RUNA 4MEXF 2VXZA 4A2UA 2VOOA 3K1NA 3VODA 3KEOA 3V8LA 2Z9OA 1KU3A 5D6FA 4M6YA 2ADUA 2DBBA 1ZAOA 4OIOF 4WK8F 4KNYA 1QZYA 3JW4A 3BPXA 4HX4A 2VC1A 3K1MA 4G9YA 1TQIA 4PGGA 2XAJA 1BC7C 3KCCA 1QQIA 3BZ6A 3R61A 3KZZA 2JZYA 3WU1B 4B09A 1OYIA 1WSUA 3CLOA 2PI0A 2K27A 2PFBA 1KYWA 1XSVA 2ZNZA 5DD4A 5HLGA 1JHHA 2OBPA 3WTXC 4ESJA 3IKTA 2VC0A 1J0RA 2M5WA 2PMHA 3T8TA 3CTAA 1D3YA 1IW7F 1XCBA 2JRTA 3ELKA 4ENMA 1P92A 1RNLA 3KP5A 2QQ9A 1R22A 5CVIA 4G6QA 5ICFA 3MWMA 3LQRA 1KU9A 1W5SA 5FLXZ 5E20A 4IF4A 1I27A 5LHHA 3ZPLA 3WGGA 1Y0UA 5DV5A 4ASNA 3EQLF 1W4MA 5HLHA 3CDHA 2EFPA 4DQ2A 5J8FA 2DQLA 1ODDA 3I71A 3I53A 1UB9A 3WE2A 4IRIA 3GFLA 2MD5A 2FMYA 4WXHA 3CUQC 2XRNA 1YO5C 2P7CB 3QAHA 1FBSA 2VBZA 4AWXB 3MQ0A 3BOQA 3L7WA 3F8CA 1P4WA 3RIRA 4A0ZA 1FOKA 2LSOA 1FWZA 6PAXA 1ONVA 3RPUA 1XGSA 4A5NA 4HYEA 2TDXA 3GZ6A 3HOTA 4LLGF 3PQJA 5ILUA 3MZYA 1F9NA 1LJ9A 1TNTA 3HRUA 2IT0A 4LGWA 4Y17A 1OMIA 1SD7A 3FHZA 3I54A 3RYRA 2HKXA 3DP7A 1I1SA 3IWFA 4L9NA 3BPVA 5L3GA 3GW2A 3P9CA 3IHUA 2L01A 1YS7A 1W5TA 1BI3A 2HKOA 4IRGA 3IL2A 4P55A 2A5YB 5L3CA 4KIGA 4XLNF 2ZXJA 1FT9A 2H94A 4WCGA 2ISZA 3NRVA 5BQTA 2KKOA 3M9AA 2V9VA 5DDGA 3TOAA 3L9FA 2AS5F 2O6GE 3L00A 3K1PA 1S7OA 5ICGA 5LHIA 2VONA 1JXSA 1TBXA 2FSWA 3DF8A 4HQEA 3Q9VA 4UV9A 2VE9A 2V1XA 3F23A 3LWFA 1J2XA 1FX7A 4WF2A 3U2RA 1BM9A 1ZG1A 3WTSC 1W7PB 4ENNA 1IXSB 4U0YA 4Q4ZF 3EUHA 1K78B 3CO6C 2OAZA 4S05A 2VN2A 4RB2C 5A2QZ 2LNBA 1DUXC 1P4XA 1G3SA 1O57A 4RS8A 2OZ6A 3FF5A 1S7AA 2EV5A 2QVOA 3P9KA 2RQPA 3RPQA 3ZN1A 4CDGA 1YW9A 4JQFA 1FSHA 4I01A 2HQRA 1YTYA 2O8XA 2K4JA 1FBUA 1XDSA 4CO8A 5DEQA 4HBLA 4IVNA 4GYIA 4K2EA 2EWNA 3V8KA 1QPMA 3JTHA 3FM3A 5TJJA 3P7NA 1IZ1A 1MJ9A 3LAPA 4OMZA 1IF1A 1IN8A 1O7LA 4L5IA 5J6XA 3K69A 1AOYA 3LSTA 5ERIA 3WG9A 3Q5FA 3HHGA 4AIJA 2H09A 3IRQA 4CZZA 3KP2A 5J8CA 1W7PA 1R1TA 3MZHA 5HLIA 4EM2A 2IPQX 2EK5A 2G9WA 2P5LC 3DPTA 1HBXG 2CQKA 4UVBA 4CHUA 1LB2A 4I7HA 1ZGJA 3G3ZA 2C6YA 3HIFA 1T38A 3KP7A 2EV0A 3QU3A 2KJCA 4PCQA 3EETA 2UXXA 1MDMA 1HW1A 4KN4X 4U0VA 1XD7A 2DO7A 4LG0B 1T2KA 1W7PD 5JFRA 2EV6A 2XGXA 4M72A 2NNYA 1SFUA 3ABUA 4MTEA 3F72A 2DQRA 4EM0B 1T0FA 2EFQA 2EA4A 1Z1DA 1Z7UA 1FYLA 3E5QA 5LRSA 3LQQA 2VOPA 1OYWA 2CFXA 2GIVA 3BJOA 3QP6A 3FXRA 3WGHA 1HKSA 4M9ZA 3DPLC 3IC7A 1Z05A 1BI0A 4UHTA 1D8JA 3FX3A 5E18F 4G7HF 1JGSA 3C1DA 1QGPA 4P9UA 5LRRA 3C3WA 1FSEA 5DD8A 4LFUA 4XSZF 2KJBA 2CG4A 5CYVA 4YFKF 4NQWA 3HRTA 3HRMA 4M9SA 1PP7U 4RGSA 5D8LB 3ML6A 5IT3A 3DFGA 2XASA 1LQ1A 4EVIA 2ETHA 1G3YA 2NS0A 3VB2A 2MA3A 4KN7X 2K86A 1YYVA 2XIGA 1ZARA 1IRFA 1HW5A 4U88A 5E1WA 2ZO4A 1ZG5A 3C18A 4U0WA 4HX8A 4L18B 2RDPA 3HSRA 4RGXA 1Z9CA 4NHJA 1GXQA 3C7JA 2V6CA 4UVAA 1WQ2A 4WWCA 3KETA 5AIQA 2VT2A 2GA1A 2P7VB 2HQNA 2FNPA 1FBQA 1T98A 1S29A 3L2CA 2DI3A 3DV8A 5K5QA 3WTZA 2V1DA 1U8RA 2DFIA 2QBYA 4CXFA 4KUMA 1IN7A 2GAUA 4XSXF 3NEUA 3QRFF 3FXQA 2BBYA 2JTVA 4ZZLA 2XAGA 2HZTA 4RGUA 3HTUA 1XSXA 5BPDA 3IWZA 2GXBA 4IHTA 4OIQF 3VEPA 2WWYA 4ENJA 2PJPA 2VT3A 3FMRA 4MQVA 1V4RA 4L9TA 5KVRA 2HOEA 5ILSA 5BS6A 1WI9A 2IP2A 3E6DA 1SMYF 5H6RA 3F8NA 1XSDA 1R00A 2QENA 4CGZA 5FD5A 3ZP5A 3GFIA 4FX0A 5D5WB 2DAOA 2MBFA 2DPUA 1B6AA 3QPHA 2F2EA 3ISPA 3KEQA 4FX4A 4MEYF 1IRGA 3E3VA 2ZMEB 4EM1A 5E1ZB 1XGNA 2BGCA 1O3QA 3GFJA 3PQKA 3S2WA 1FYMA 2WTEA 4EJTA 3ZMVA 5D6EA 5LGTA 3RKWA 4G7OF 5DUIA 4YG2F 3RDIA 4P5OA 2DU9A 4HQMA 2L4MA 3K9TA 3FMQA 3V7CA 5JI6A 1KU7A 2UXNA 2NAZA 3ECOA 1XGMA 2LF7A 4BXUA 1FY7A 3LFKA 2W24A 2Y75A 1F1ZA 5E8GA 2HFHA 3ZMUA 2MLKA 2OU2A 2OZUA 2QLZA 4YFXF 1A04A 2XAFA 3G73A 1ON2A 5HDKA 4N9HA 3QOPA 5FFXA 4IJAA 1QZZA 2VE8A 2A07F 5H6QA 1R1UA 5LGUA 4BHBA 2A6HF 5H20A 2Y0MA 3TDUC 4FT8A 1F4KA 2YX7A 4PDKA 3V8JA 5HVQC 4BH9A 3GO5A 3HTSB 1YFHA 3KP6A 4DNCA 2IA0A 2HYGD 2FOKA 5LLQA 1U5TB 3W6JB 3H92A 4I02A 3D5LA 2M30A 4YFNF 2MLGA 5E17F 1IUYA 1KGSA 1G3WA 3E5UA 2RKHA 4Q47A 3F21A 1UHWA 3I58A 2EFOA 1BIAA 1DDNA 4N9IA 2IRFG 5F1RA 1KQ9A 4HF2A 4AIHA 5FD6A 3H3ZA 5D4RA 3HSEA 2VODA 5LHGA 4HV5A 3F8FA 1STZA 1HW2A 2W85A 1IN6A 1HSJA 5D5UB 3ZQ7A 3IKVA 2CO5A 4QWQA 1SD4A 3TO9A 5LGNA 1UCRA 4U7DA 4MTDA 4EMSA 4KMUX 3RYPA 4U7BA 2XVCA 1TQPA 1S3JA 1IAWA 2VBWA 2OQGA 3Q9SA 2PG4A 4L0ZB 3T0YA 4TV7A 3MEXA 4F7ZA 1RI7A 2E7WA 2HGCA 2DW4A 2R7DA 2XAQA 4BHPA 4OINF 4PGHA 2O61A 4ZYHA 2DTRA 4LJZF 2ZJ2A 1QNTA 1FZPB 3HYIA 4RB1A 4MNUA 2J5PA 2GXGA 4MGRA 4ESFA 2DK5A 3E5XA 3QU6A 3CUOA 2PEXA 2XKPA 4MHGA 5CJ9A 3KFWX 5CVJA 1RZ4A 3F8BA 2CGPA 1LDDA 4Y15A 1X3UA 2H27A 3HOSA 1R5HA 2W84A 4M9XA 4IHSA 2L02A 3TO7A 2LKPA 5ILVA 2FQ3A 4M6XA 5AONA 4BYYA 3D0SA 1Z91A 3TKYA 1BI2A 1DP7P 5L3BA 4L0YB 1OYYA 5K1YA 5HS8A 1PUEE 1B4AA 3R0AA 3DKWA 3BDDA 4GCVA 4FHTA 3P9IA 3B73A 3PFIA 5HS9A 1G6NA 4YIFA 1T39A 2Z33A 2OQRA 3KLOA 3HSFA 2Q8KA 2GZWA 3E97A 4GXOA 3GXOA 3ABTA 2EFWA 1HKQA 4UXNA 5FFZA 5FO5A 5CVRA 3E6BA 1K6OA 2NNNA 3ZMZA 4M74A 1K78A 2CYYA 4IPAA 1D8KA 3J81K 5E8IA 2D1HA 4M71A 2HWVA 4LB5A 5EEHA 2O3FA 2FXAA 5LBQA 1KQ8A 3GFMA 2ZBKA 5CVUA 4IRHA 3HHHA 1REPC 2L4AA 3SXYA 2O0YA 3MCZA 1BI1A 2IJLA 2HEOA 3MFKA 4P96A 5DUKA 2HDCA 3B02A 1U6GA 5DCMB 1E17A 2IA1A 1J9IA 2FBHA 1WKMA 2EFNA 2XHKA 5L3EA 4LD5A 1PP8F 3QP5A 4AVPA 4HDUA 3V7RA 2R7FA 2L54A 3SZTA 2HYFA 2KIUA 1L0OC 3FM5A 4GO1A 1O3RA 1UFMA 1XN7A 2EA2A 1XCVA 3RJPA 1P4AA 4EGZA 1U3EM 5DCFA 3CO7C 1O3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EYI A;  2PQ8 A;  3CJN A;  3WGI A;  2XRO A;  1Z6T A;  2RV8 A;  1Z6R A;  4YII A;  5FGM A;  4OIP F;  3SQN A;  1FC3 A;  1DPU A;  1HXD A;  4EV0 A;  3GX4 X;  2FBK A;  4ENK A;  1S8N A;  1K7A A;  2KIM A;  3U1D A;  2P6T A;  1BJA A;  2AXL A;  2RN7 A;  3KZY A;  2A61 A;  4E70 A;  4ZYG A;  4A5M A;  3ECH A;  2P5K A;  4ETS A;  3REO A;  1KYZ A;  4WX9 A;  5KK1 A;  3VOE A;  4LG0 A;  4Q5S F;  4HW0 A;  1B59 A;  4NB5 A;  3TDZ C;  2M8E A;  1TQM A;  2A69 F;  3W6K B;  4UV8 A;  4P9F A;  3WTV C;  2MC3 A;  1U2W A;  3WE3 A;  5DCM A;  2YPR A;  4I2O A;  1SAX A;  1MGT A;  4H0E A;  2JPB A;  1H9G A;  2X0L A;  1BIB A;  2VBY A;  4OOI A;  1GVJ A;  1MJB A;  1UST A;  3T1B A;  1YQA A;  5ICC A;  5BPI A;  2P6S A;  3T5X A;  3RTR A;  4O3M A;  3EYY A;  2K02 A;  1J59 A;  4L9V A;  1LDK B;  1GHC A;  3WTY C;  2D1V A;  4HF1 A;  4I0B A;  2BYV E;  5HOO A;  2PMU A;  2HTS A;  2J5O A;  2QQA A;  3F22 A;  2UWM A;  3KE2 A;  2XV4 S;  2KRF A;  1B1B A;  3M8F A;  1R36 A;  3ZMS A;  1HQC A;  4HX7 A;  5HS7 A;  3BJA A;  4CYD A;  4RB0 A;  1V3F A;  2A6E F;  2E1N A;  5K5R A;  4BHC A;  5D5V B;  4A6D A;  2PLY A;  4UVC A;  2BV6 A;  5HDN A;  3BY6 A;  2ESN A;  3FWE A;  4IXA A;  1OPC A;  3RKY A;  4HLX A;  3TGN A;  4HAM A;  2CWE A;  2W25 A;  2Z5U A;  3N4M A;  4CIC A;  5FLX K;  1T6S A;  2HTJ A;  4AIK A;  2RC4 A;  3WOD F;  2DT5 A;  2FML A;  5LEJ A;  5ED4 A;  3JSP A;  3ZN0 A;  2GWR A;  3M1E A;  2STW A;  1ON1 A;  2NYX A;  4RAY A;  4ZYE A;  4S04 A;  3SZP A;  4LK0 F;  1BC8 C;  1K79 A;  4ZH4 F;  1BN5 A;  1LEA A;  2GA2 A;  1YW7 A;  1U5T C;  1IXC A;  2X4H A;  2ZNY A;  2WV0 A;  3R4K A;  3GVA A;  3K0L A;  3GYH X;  2H6C A;  5DYM A;  5HDG A;  1G4D A;  3ROU A;  5CVV A;  1NHA A;  3WTW C;  1LDJ A;  4HDV A;  2CW0 F;  3BJ6 A;  3BWG A;  4G8X A;  1I1G A;  1HST A;  2F5D A;  1ULY A;  5EEG A;  3TQN A;  3OOP A;  3F6V A;  1USS A;  1MZB A;  2H6B A;  4A0Y A;  1G3T A;  2DK8 A;  2ELH A;  4WXC A;  1MKM A;  2VBX A;  4LK1 F;  3FMS A;  3R60 A;  1Q1H A;  4EQQ A;  2ACJ A;  5BMZ A;  2V1U A;  4JBA A;  1ZN2 A;  4GGG A;  4KDP A;  2PBI A;  4G94 A;  1JE8 A;  1KA8 A;  1JHF A;  4HLY A;  3EDP A;  3BRO A;  3F3X A;  4ZYD A;  3LA2 A;  2ESH A;  1KU2 A;  2ZME A;  3MAJ A;  5L3D A;  1O7F A;  2QYO A;  1VTN C;  2F5F A;  5D8K B;  2R3S A;  1YS6 A;  2K4B A;  3N97 A;  3F6O A;  2QM3 A;  2ZFW A;  1OR7 A;  1EV7 A;  1SMT A;  3RI4 A;  3GWZ A;  1BOA A;  3CUQ B;  1XDU A;  4ESB A;  3WTT C;  1YG2 A;  2QWW A;  2DLL A;  2LDU A;  2DPD A;  3F8M A;  4AD9 A;  3IRR A;  5JVT A;  1ZRC A;  2G7H A;  2EB7 A;  5D4S A;  1J75 A;  3V7S A;  2M87 A;  2FRH A;  1H0M A;  4R79 A;  2ISY A;  2MH2 A;  4R1H A;  5E1X A;  2KIF A;  3BP8 A;  2B0L A;  1GXP A;  1TW2 A;  3HRS A;  4BAY A;  4EJV A;  4HOB A;  1UHM A;  2RVC A;  3JAM K;  5A2Q K;  2CSO A;  2FE3 A;  4HF0 A;  2D45 A;  1WRJ A;  5TRD A;  3HUG A;  3M8E A;  1U5T A;  3DXJ F;  4LLL A;  3ZMT A;  4I98 B;  2GQQ A;  4G7Z F;  4KA4 A;  2EJR A;  2JSC A;  1ZYR F;  5LEK A;  4A0X A;  2JPC A;  4B8X A;  1L3L A;  3R6S A;  4G6D A;  1LVA A;  5IT9 K;  3ZMD A;  5K5O A;  2P5V A;  1YIO A;  4KMF A;  1F5T A;  2A68 F;  1P6R A;  1CF7 B;  1I5Z A;  1ZHF A;  3JAM Z;  1FP1 D;  1HKT A;  1XB4 A;  2RGV A;  2PN6 A;  5F6F A;  1ZH5 A;  3H3U A;  4RAZ A;  5FB2 A;  2Q0O A;  2YX4 A;  2QQB A;  4RGR A;  1ZG3 A;  4EJW A;  3TOB A;  2QUF A;  3CUQ A;  1MJA A;  4I0A A;  3SFZ A;  4PZJ A;  1DPR A;  4KT5 C;  2W57 A;  4UNO A;  3GLX A;  4OU0 A;  1MDM B;  4L5J A;  1D5V A;  2Z99 A;  4ON0 A;  3GZ5 A;  4A6E A;  2P8T A;  4Q48 A;  4M73 A;  1TLH B;  2XAH A;  5IT9 Z;  1ZGA A;  4LMY A;  3DEU A;  3LAJ A;  4KIF A;  2BE5 F;  3NQO A;  4WXD A;  3E6M A;  1S6L A;  1FNN A;  2STT A;  1LEB A;  3O3K A;  4BQA A;  2G7U A;  2COM A;  1CGP A;  1XMK A;  3I5U A;  4HA8 A;  4QLC U;  1FPQ A;  4Z2Y A;  1WWX A;  2E7X A;  5ICE A;  3GF2 A;  2YR2 A;  1QBJ A;  1B9M A;  3T8R A;  2JT1 A;  4ZZD A;  4UUV A;  3J80 K;  5JR3 A;  3SHF A;  2FEZ A;  2NRA C;  5L3F A;  3V4G A;  1SFX A;  4XBF A;  4XLP F;  3O6B B;  1C0W A;  1MD0 A;  5F64 A;  1IN5 A;  4JK1 X;  1KQ0 A;  3J7A O;  1RUO A;  2F5C A;  4Y13 A;  1R23 A;  1SD5 A;  3I4P A;  3TO6 A;  2LF8 A;  1IN4 A;  3VFZ A;  3ULQ B;  2M45 A;  2FBI A;  1CF7 A;  1FP2 A;  4KIB A;  4XRF A;  2O03 A;  4BNC A;  4A12 A;  1RIO H;  4EJO A;  3J80 Z;  1R5G A;  1FLI A;  2RNJ A;  1B9N A;  4LLN A;  2ZKZ A;  4HV6 A;  1FYK A;  2IW5 A;  3GUD A;  3J81 Z;  2ZCW A;  5BOX A;  1J7K A;  2M1B A;  1YLF A;  2F5E A;  4EGY A;  4LB6 B;  2L3D A;  3E6C C;  3K2Z A;  2Q2E A;  4L9J A;  3FZV A;  3FXU A;  4RB3 C;  3I0T A;  2OD5 A;  2MH9 A;  4O6J A;  2XKO A;  3LA7 A;  1R58 A;  3I59 B;  1EH6 A;  2K7L A;  4OIR F;  3RKX A;  2FA5 A;  2UZK A;  1PDN C;  3GEZ A;  1E2X A;  1EH8 A;  3AAF A;  2V79 A;  3KP3 A;  5D5X B;  2FF4 A;  3JTG A;  2BEO A;  3COA C;  2OA4 A;  3L09 A;  3KP4 A;  1ZLJ A;  5AIP A;  1QO0 D;  1R7J A;  1BBY A;  2A3S A;  1ZRF A;  2QBY B;  1U78 A;  2XUB A;  4MQ9 F;  3OV8 A;  1H9T A;  4O5V A;  1TTY A;  2P4W A;  4EJU A;  2IVM A;  1SD6 A;  1AWC A;  2WC2 A;  1XMA A;  4KIC A;  1I6X A;  5CLS A;  3I64 A;  4I09 A;  1SFE A;  3ERE D;  2HS5 A;  1ZLK A;  3R0J A;  5JHU A;  1IXR C;  1ZRE A;  2Y48 A;  3QPT A;  3WTU C;  2D2W A;  1EH7 A;  2YU3 A;  3O2P E;  4OMY A;  2Z3Y A;  1J5Y A;  1O3S A;  3DQV C;  1OKR A;  3U9G A;  4HZF A;  4KFC A;  3I59 A;  4D0P A;  2YSR A;  1YW8 A;  2HR3 A;  2E1C A;  1XGO A;  4GYG A;  1LNW A;  4N0B A;  1TW3 A;  1ZRD A;  3KLN A;  1P2F A;  4KYW A;  1R1V A;  2QZ8 A;  2FU4 A;  3M7G A;  3JSO A;  2IA2 A;  4R8H A;  3WU0 A;  3LA3 A;  2FNA A;  1TNS A;  1RUN A;  4MEX F;  2VXZ A;  4A2U A;  2VOO A;  3K1N A;  3VOD A;  3KEO A;  3V8L A;  2Z9O A;  1KU3 A;  5D6F A;  4M6Y A;  2ADU A;  2DBB A;  1ZAO A;  4OIO F;  4WK8 F;  4KNY A;  1QZY A;  3JW4 A;  3BPX A;  4HX4 A;  2VC1 A;  3K1M A;  4G9Y A;  1TQI A;  4PGG A;  2XAJ A;  1BC7 C;  3KCC A;  1QQI A;  3BZ6 A;  3R61 A;  3KZZ A;  2JZY A;  3WU1 B;  4B09 A;  1OYI A;  1WSU A;  3CLO A;  2PI0 A;  2K27 A;  2PFB A;  1KYW A;  1XSV A;  2ZNZ A;  5DD4 A;  5HLG A;  1JHH A;  2OBP A;  3WTX C;  4ESJ A;  3IKT A;  2VC0 A;  1J0R A;  2M5W A;  2PMH A;  3T8T A;  3CTA A;  1D3Y A;  1IW7 F;  1XCB A;  2JRT A;  3ELK A;  4ENM A;  1P92 A;  1RNL A;  3KP5 A;  2QQ9 A;  1R22 A;  5CVI A;  4G6Q A;  5ICF A;  3MWM A;  3LQR A;  1KU9 A;  1W5S A;  5FLX Z;  5E20 A;  4IF4 A;  1I27 A;  5LHH A;  3ZPL A;  3WGG A;  1Y0U A;  5DV5 A;  4ASN A;  3EQL F;  1W4M A;  5HLH A;  3CDH A;  2EFP A;  4DQ2 A;  5J8F A;  2DQL A;  1ODD A;  3I71 A;  3I53 A;  1UB9 A;  3WE2 A;  4IRI A;  3GFL A;  2MD5 A;  2FMY A;  4WXH A;  3CUQ C;  2XRN A;  1YO5 C;  2P7C B;  3QAH A;  1FBS A;  2VBZ A;  4AWX B;  3MQ0 A;  3BOQ A;  3L7W A;  3F8C A;  1P4W A;  3RIR A;  4A0Z A;  1FOK A;  2LSO A;  1FWZ A;  6PAX A;  1ONV A;  3RPU A;  1XGS A;  4A5N A;  4HYE A;  2TDX A;  3GZ6 A;  3HOT A;  4LLG F;  3PQJ A;  5ILU A;  3MZY A;  1F9N A;  1LJ9 A;  1TNT A;  3HRU A;  2IT0 A;  4LGW A;  4Y17 A;  1OMI A;  1SD7 A;  3FHZ A;  3I54 A;  3RYR A;  2HKX A;  3DP7 A;  1I1S A;  3IWF A;  4L9N A;  3BPV A;  5L3G A;  3GW2 A;  3P9C A;  3IHU A;  2L01 A;  1YS7 A;  1W5T A;  1BI3 A;  2HKO A;  4IRG A;  3IL2 A;  4P55 A;  2A5Y B;  5L3C A;  4KIG A;  4XLN F;  2ZXJ A;  1FT9 A;  2H94 A;  4WCG A;  2ISZ A;  3NRV A;  5BQT A;  2KKO A;  3M9A A;  2V9V A;  5DDG A;  3TOA A;  3L9F A;  2AS5 F;  2O6G E;  3L00 A;  3K1P A;  1S7O A;  5ICG A;  5LHI A;  2VON A;  1JXS A;  1TBX A;  2FSW A;  3DF8 A;  4HQE A;  3Q9V A;  4UV9 A;  2VE9 A;  2V1X A;  3F23 A;  3LWF A;  1J2X A;  1FX7 A;  4WF2 A;  3U2R A;  1BM9 A;  1ZG1 A;  3WTS C;  1W7P B;  4ENN A;  1IXS B;  4U0Y A;  4Q4Z F;  3EUH A;  1K78 B;  3CO6 C;  2OAZ A;  4S05 A;  2VN2 A;  4RB2 C;  5A2Q Z;  2LNB A;  1DUX C;  1P4X A;  1G3S A;  1O57 A;  4RS8 A;  2OZ6 A;  3FF5 A;  1S7A A;  2EV5 A;  2QVO A;  3P9K A;  2RQP A;  3RPQ A;  3ZN1 A;  4CDG A;  1YW9 A;  4JQF A;  1FSH A;  4I01 A;  2HQR A;  1YTY A;  2O8X A;  2K4J A;  1FBU A;  1XDS A;  4CO8 A;  5DEQ A;  4HBL A;  4IVN A;  4GYI A;  4K2E A;  2EWN A;  3V8K A;  1QPM A;  3JTH A;  3FM3 A;  5TJJ A;  3P7N A;  1IZ1 A;  1MJ9 A;  3LAP A;  4OMZ A;  1IF1 A;  1IN8 A;  1O7L A;  4L5I A;  5J6X A;  3K69 A;  1AOY A;  3LST A;  5ERI A;  3WG9 A;  3Q5F A;  3HHG A;  4AIJ A;  2H09 A;  3IRQ A;  4CZZ A;  3KP2 A;  5J8C A;  1W7P A;  1R1T A;  3MZH A;  5HLI A;  4EM2 A;  2IPQ X;  2EK5 A;  2G9W A;  2P5L C;  3DPT A;  1HBX G;  2CQK A;  4UVB A;  4CHU A;  1LB2 A;  4I7H A;  1ZGJ A;  3G3Z A;  2C6Y A;  3HIF A;  1T38 A;  3KP7 A;  2EV0 A;  3QU3 A;  2KJC A;  4PCQ A;  3EET A;  2UXX A;  1MDM A;  1HW1 A;  4KN4 X;  4U0V A;  1XD7 A;  2DO7 A;  4LG0 B;  1T2K A;  1W7P D;  5JFR A;  2EV6 A;  2XGX A;  4M72 A;  2NNY A;  1SFU A;  3ABU A;  4MTE A;  3F72 A;  2DQR A;  4EM0 B;  1T0F A;  2EFQ A;  2EA4 A;  1Z1D A;  1Z7U A;  1FYL A;  3E5Q A;  5LRS A;  3LQQ A;  2VOP A;  1OYW A;  2CFX A;  2GIV A;  3BJO A;  3QP6 A;  3FXR A;  3WGH A;  1HKS A;  4M9Z A;  3DPL C;  3IC7 A;  1Z05 A;  1BI0 A;  4UHT A;  1D8J A;  3FX3 A;  5E18 F;  4G7H F;  1JGS A;  3C1D A;  1QGP A;  4P9U A;  5LRR A;  3C3W A;  1FSE A;  5DD8 A;  4LFU A;  4XSZ F;  2KJB A;  2CG4 A;  5CYV A;  4YFK F;  4NQW A;  3HRT A;  3HRM A;  4M9S A;  1PP7 U;  4RGS A;  5D8L B;  3ML6 A;  5IT3 A;  3DFG A;  2XAS A;  1LQ1 A;  4EVI A;  2ETH A;  1G3Y A;  2NS0 A;  3VB2 A;  2MA3 A;  4KN7 X;  2K86 A;  1YYV A;  2XIG A;  1ZAR A;  1IRF A;  1HW5 A;  4U88 A;  5E1W A;  2ZO4 A;  1ZG5 A;  3C18 A;  4U0W A;  4HX8 A;  4L18 B;  2RDP A;  3HSR A;  4RGX A;  1Z9C A;  4NHJ A;  1GXQ A;  3C7J A;  2V6C A;  4UVA A;  1WQ2 A;  4WWC A;  3KET A;  5AIQ A;  2VT2 A;  2GA1 A;  2P7V B;  2HQN A;  2FNP A;  1FBQ A;  1T98 A;  1S29 A;  3L2C A;  2DI3 A;  3DV8 A;  5K5Q A;  3WTZ A;  2V1D A;  1U8R A;  2DFI A;  2QBY A;  4CXF A;  4KUM A;  1IN7 A;  2GAU A;  4XSX F;  3NEU A;  3QRF F;  3FXQ A;  2BBY A;  2JTV A;  4ZZL A;  2XAG A;  2HZT A;  4RGU A;  3HTU A;  1XSX A;  5BPD A;  3IWZ A;  2GXB A;  4IHT A;  4OIQ F;  3VEP A;  2WWY A;  4ENJ A;  2PJP A;  2VT3 A;  3FMR A;  4MQV A;  1V4R A;  4L9T A;  5KVR A;  2HOE A;  5ILS A;  5BS6 A;  1WI9 A;  2IP2 A;  3E6D A;  1SMY F;  5H6R A;  3F8N A;  1XSD A;  1R00 A;  2QEN A;  4CGZ A;  5FD5 A;  3ZP5 A;  3GFI A;  4FX0 A;  5D5W B;  2DAO A;  2MBF A;  2DPU A;  1B6A A;  3QPH A;  2F2E A;  3ISP A;  3KEQ A;  4FX4 A;  4MEY F;  1IRG A;  3E3V A;  2ZME B;  4EM1 A;  5E1Z B;  1XGN A;  2BGC A;  1O3Q A;  3GFJ A;  3PQK A;  3S2W A;  1FYM A;  2WTE A;  4EJT A;  3ZMV A;  5D6E A;  5LGT A;  3RKW A;  4G7O F;  5DUI A;  4YG2 F;  3RDI A;  4P5O A;  2DU9 A;  4HQM A;  2L4M A;  3K9T A;  3FMQ A;  3V7C A;  5JI6 A;  1KU7 A;  2UXN A;  2NAZ A;  3ECO A;  1XGM A;  2LF7 A;  4BXU A;  1FY7 A;  3LFK A;  2W24 A;  2Y75 A;  1F1Z A;  5E8G A;  2HFH A;  3ZMU A;  2MLK A;  2OU2 A;  2OZU A;  2QLZ A;  4YFX F;  1A04 A;  2XAF A;  3G73 A;  1ON2 A;  5HDK A;  4N9H A;  3QOP A;  5FFX A;  4IJA A;  1QZZ A;  2VE8 A;  2A07 F;  5H6Q A;  1R1U A;  5LGU A;  4BHB A;  2A6H F;  5H20 A;  2Y0M A;  3TDU C;  4FT8 A;  1F4K A;  2YX7 A;  4PDK A;  3V8J A;  5HVQ C;  4BH9 A;  3GO5 A;  3HTS B;  1YFH A;  3KP6 A;  4DNC A;  2IA0 A;  2HYG D;  2FOK A;  5LLQ A;  1U5T B;  3W6J B;  3H92 A;  4I02 A;  3D5L A;  2M30 A;  4YFN F;  2MLG A;  5E17 F;  1IUY A;  1KGS A;  1G3W A;  3E5U A;  2RKH A;  4Q47 A;  3F21 A;  1UHW A;  3I58 A;  2EFO A;  1BIA A;  1DDN A;  4N9I A;  2IRF G;  5F1R A;  1KQ9 A;  4HF2 A;  4AIH A;  5FD6 A;  3H3Z A;  5D4R A;  3HSE A;  2VOD A;  5LHG A;  4HV5 A;  3F8F A;  1STZ A;  1HW2 A;  2W85 A;  1IN6 A;  1HSJ A;  5D5U B;  3ZQ7 A;  3IKV A;  2CO5 A;  4QWQ A;  1SD4 A;  3TO9 A;  5LGN A;  1UCR A;  4U7D A;  4MTD A;  4EMS A;  4KMU X;  3RYP A;  4U7B A;  2XVC A;  1TQP A;  1S3J A;  1IAW A;  2VBW A;  2OQG A;  3Q9S A;  2PG4 A;  4L0Z B;  3T0Y A;  4TV7 A;  3MEX A;  4F7Z A;  1RI7 A;  2E7W A;  2HGC A;  2DW4 A;  2R7D A;  2XAQ A;  4BHP A;  4OIN F;  4PGH A;  2O61 A;  4ZYH A;  2DTR A;  4LJZ F;  2ZJ2 A;  1QNT A;  1FZP B;  3HYI A;  4RB1 A;  4MNU A;  2J5P A;  2GXG A;  4MGR A;  4ESF A;  2DK5 A;  3E5X A;  3QU6 A;  3CUO A;  2PEX A;  2XKP A;  4MHG A;  5CJ9 A;  3KFW X;  5CVJ A;  1RZ4 A;  3F8B A;  2CGP A;  1LDD A;  4Y15 A;  1X3U A;  2H27 A;  3HOS A;  1R5H A;  2W84 A;  4M9X A;  4IHS A;  2L02 A;  3TO7 A;  2LKP A;  5ILV A;  2FQ3 A;  4M6X A;  5AON A;  4BYY A;  3D0S A;  1Z91 A;  3TKY A;  1BI2 A;  1DP7 P;  5L3B A;  4L0Y B;  1OYY A;  5K1Y A;  5HS8 A;  1PUE E;  1B4A A;  3R0A A;  3DKW A;  3BDD A;  4GCV A;  4FHT A;  3P9I A;  3B73 A;  3PFI A;  5HS9 A;  1G6N A;  4YIF A;  1T39 A;  2Z33 A;  2OQR A;  3KLO A;  3HSF A;  2Q8K A;  2GZW A;  3E97 A;  4GXO A;  3GXO A;  3ABT A;  2EFW A;  1HKQ A;  4UXN A;  5FFZ A;  5FO5 A;  5CVR A;  3E6B A;  1K6O A;  2NNN A;  3ZMZ A;  4M74 A;  1K78 A;  2CYY A;  4IPA A;  1D8K A;  3J81 K;  5E8I A;  2D1H A;  4M71 A;  2HWV A;  4LB5 A;  5EEH A;  2O3F A;  2FXA A;  5LBQ A;  1KQ8 A;  3GFM A;  2ZBK A;  5CVU A;  4IRH A;  3HHH A;  1REP C;  2L4A A;  3SXY A;  2O0Y A;  3MCZ A;  1BI1 A;  2IJL A;  2HEO A;  3MFK A;  4P96 A;  5DUK A;  2HDC A;  3B02 A;  1U6G A;  5DCM B;  1E17 A;  2IA1 A;  1J9I A;  2FBH A;  1WKM A;  2EFN A;  2XHK A;  5L3E A;  4LD5 A;  1PP8 F;  3QP5 A;  4AVP A;  4HDU A;  3V7R A;  2R7F A;  2L54 A;  3SZT A;  2HYF A;  2KIU A;  1L0O C;  3FM5 A;  4GO1 A;  1O3R A;  1UFM A;  1XN7 A;  2EA2 A;  1XCV A;  3RJP A;  1P4A A;  4EGZ A;  1U3E M;  5DCF A;  3CO7 C;  1O3T A; 
#chains in the Genus database with same CATH topology
 2HVS A;  1QPI A;  2LRD A;  2FQ4 A;  4DGW B;  3EYI A;  2E19 A;  2M0C A;  2H8R A;  2PQ8 A;  3CJN A;  3WGI A;  2XRO A;  1Z21 A;  1Z6T A;  3Q0W A;  2RV8 A;  1Z6R A;  1NTC A;  4YII A;  1MBE A;  4D7M A;  3G1M A;  5FGM A;  3CC4 I;  4OIP F;  2B7E A;  3IUO A;  1FC3 A;  1PJR A;  3ABL H;  2DMQ A;  3SQN A;  1DPU A;  1HXD A;  2EZK A;  4EV0 A;  1PYV A;  3GX4 X;  1YHQ I;  5FLV A;  2FBK A;  2NOG A;  2E1O A;  2VXD A;  2XB0 X;  4ENK A;  1S8N A;  3CF5 F;  4QIW N;  1K7A A;  2KIM A;  2EPF A;  3U1D A;  2LKX A;  2P6T A;  1BJA A;  2AXL A;  2RN7 A;  3KZY A;  4CYC A;  2XF6 A;  2AQF A;  1K61 A;  2A61 A;  3FDY A;  4E70 A;  3GTO J;  2ZSI B;  2LP0 A;  4ZYG A;  2KHM A;  4A5M A;  3ECH A;  2P5K A;  4ETS A;  3REO A;  1X4P A;  1KYZ A;  1IUF A;  4WX9 A;  2IGK A;  5KK1 A;  3VOE A;  1JKR C;  4LG0 A;  4DYC A;  4Q5S F;  2JA2 A;  4IEJ A;  4HW0 A;  1B59 A;  3BR1 A;  5IP9 J;  1MIJ A;  5IPA A;  4NB5 A;  2VQL A;  4XRM A;  3TDZ C;  1A35 A;  2PX9 A;  2M8E A;  1TQM A;  3WG7 H;  2A69 F;  1S7E A;  2HXO A;  3SZG A;  3W6K B;  4UV8 A;  5DS9 A;  4CCN A;  4P9F A;  3WTV C;  2TCT A;  2KRH A;  2MC3 A;  3L2W A;  4AID A;  2DT6 A;  1U2W A;  2P0W A;  3WE3 A;  2K5C A;  3IH3 A;  5F04 A;  5DCM A;  3H5N A;  5DM7 F;  2YPR A;  4I2O A;  5IOZ A;  3CMY A;  3I4N J;  3G1L A;  1SAX A;  1MGT A;  5EJC A;  2M34 A;  4XN0 A;  4H0E A;  2JMW A;  2O9L A;  5EG0 A;  3DCF A;  2XSJ C;  3SYT A;  1NH3 A;  2JPB A;  2Y2Z A;  1H9G A;  2X0L A;  1FTT A;  3EUK L;  1BIB A;  2VBY A;  3BCA A;  4OOI A;  4V2G A;  1GVJ A;  1MJB A;  1UST A;  2L2O A;  3T1B A;  1YQA A;  5GP9 A;  3ASO H;  5ICC A;  5BPI A;  2P6S A;  2VQC A;  4V2F A;  3T5X A;  4JX5 A;  3RTR A;  4NBQ A;  4BS9 A;  4DBR A;  4O3M A;  3EYY A;  2K02 A;  2M2E A;  1J59 A;  5F0H A;  2WV1 A;  4L9V A;  1AKH A;  2E71 A;  1LDK B;  2DA2 A;  2GM4 A;  1GHC A;  3WTY C;  2D1V A;  2BZT A;  3PM1 A;  3TL4 X;  2W1O A;  4HST A;  3K4B A;  3BR3 A;  4CH7 A;  4I0B A;  4HF1 A;  4A3I J;  2L0K A;  2BYV E;  4PFP A;  5HOO A;  2PMU A;  1HCR A;  2HTS A;  2J5O A;  2QQA A;  3F22 A;  3CC7 I;  4U87 A;  2UWM A;  3KE2 A;  2XV4 S;  1UG2 A;  4CCO A;  5B5E C;  1OFC X;  2I10 A;  3H9J A;  3OL4 A;  1I3A A;  2KRF A;  1MW7 A;  1B1B A;  4A69 C;  4IKF A;  2ZME C;  3M8F A;  1R36 A;  3ZMS A;  5C4X J;  1RET A;  1HQC A;  4HX7 A;  4Y33 A;  3BJA A;  5HS7 A;  4RB0 A;  4CYD A;  1V3F A;  2A6E F;  2VQH A;  1MMD A;  2E1N A;  2I8D A;  5K5R A;  1A36 A;  4BHC A;  4BEH B;  5D5V B;  3EPZ A;  2K40 A;  4A6D A;  2PLY A;  1LFB A;  3CP2 A;  4UVC A;  2DTZ A;  2BV6 A;  5HDN A;  1OR7 C;  4UUS B;  3BY6 A;  2F4I A;  3WHC A;  3CCE I;  1B72 B;  2ESN A;  5JLW A;  1NG6 A;  3FWE A;  3ERM A;  4IXA A;  1OPC A;  3RKY A;  2VLA A;  1YJW I;  4HLX A;  3TGN A;  4W1U A;  4HAM A;  2CWE A;  2W25 A;  2Z5U A;  4D1Q A;  3N4M A;  4CIC A;  5FLX K;  3JRE A;  1T6S A;  3KYL A;  2ME6 A;  2HTJ A;  5KCM A;  4RDU A;  3S1Q J;  4AIK A;  2AXT C;  1WH7 A;  3IAS 2;  2RC4 A;  3WOD F;  2DT5 A;  4DBQ A;  3LSI A;  1TZL A;  2FML A;  5LEJ A;  2L7K A;  5ED4 A;  3JSP A;  3ZN0 A;  3K4L A;  3LSH A;  5H2F C;  1VQO I;  2R7U A;  2GWR A;  1JKP C;  1VF9 A;  3M1E A;  5HNH A;  2NVX J;  2STW A;  3UNG C;  3H36 A;  2VKV A;  1ON1 A;  2NYX A;  4RAY A;  4ZYE A;  4XON A;  4XL9 A;  1Z7L A;  2WAQ N;  4S04 A;  3SZP A;  4LK0 F;  1BC8 C;  1K79 A;  2G0E A;  3A2K A;  1TWA J;  4ZH4 F;  2BY1 A;  2XPU A;  1QU3 A;  1BN5 A;  1LEA A;  2GA2 A;  3JRI A;  1WH5 A;  1YW7 A;  1U5T C;  5TGT A;  1IXC A;  1ENH A;  2JRM A;  2X4H A;  2ZNY A;  2WV0 A;  3R4K A;  3GVA A;  2DFF A;  2K85 A;  3K0L A;  3GYH X;  2H6C A;  5J3L A;  5DYM A;  4NNJ A;  5HDG A;  5M5Y J;  1G4D A;  2L9R A;  3ROU A;  5CVV A;  4IOA F;  1NHA A;  4IQ4 A;  3WTW C;  1LDJ A;  3NAU A;  4HDV A;  2EBI A;  2JA5 J;  2CW0 F;  3FXJ A;  3BJ6 A;  3BWG A;  1X4O A;  4G8X A;  2MG4 A;  2CQQ A;  3FIS A;  4M3D A;  3E1S A;  5GTI C;  2HYJ A;  1I1G A;  1HST A;  2F5D A;  1ULY A;  5EEG A;  2QA4 I;  3TQN A;  4E7I A;  3OOP A;  2Y9Y A;  3F6V A;  1USS A;  3Q3S A;  1MZB A;  2H6B A;  4A0Y A;  4ZYA A;  4AC0 A;  4BEH A;  1G3T A;  4XLH A;  2NVY J;  2DK8 A;  4PJJ A;  4C2T A;  3IP4 B;  2ELH A;  2R7W A;  4WXC A;  2LD5 A;  4IO9 F;  1VQ5 I;  1MKM A;  3MN2 A;  2VBX A;  4LK1 F;  3VPR A;  4C3I J;  3AG4 H;  5JVG F;  2EZI A;  3FMS A;  3R60 A;  3OYN A;  2R7Z J;  1B72 A;  5GAD J;  1Q1H A;  2KFD A;  3V42 A;  4BQO A;  4EQQ A;  2XF5 A;  4HRI A;  4A3L J;  2ACJ A;  3LFU A;  2L9S A;  5BMZ A;  2V1U A;  3ZQF A;  3HUG B;  4JBA A;  1ZN2 A;  4GGG A;  2H8W A;  3E7L A;  4KDP A;  1MBJ A;  3ZQC A;  2JVG A;  2DA6 A;  2PBI A;  5FRM A;  3BC8 A;  3HM5 A;  4G94 A;  1JE8 A;  4DOZ A;  1KA8 A;  1TWG J;  4FAS D;  3RKQ A;  3HJE A;  1JHF A;  2EH3 A;  4HLY A;  3EDP A;  3BRO A;  2XGC A;  1WFX A;  1VQ6 I;  3F3X A;  4DYQ A;  4OWR B;  4ZYD A;  3LA2 A;  2ESH A;  1KU2 A;  2ZME A;  2BVM A;  3MAJ A;  2GOM A;  5L3D A;  1O7F A;  2HDD A;  2VB6 A;  1Y6I A;  4J19 A;  2JUC A;  4XLE A;  4G6T B;  2QYO A;  1VTN C;  2F5F A;  2W7N A;  1ZR4 A;  2DJI A;  5D8K B;  2R3S A;  1YS6 A;  2K4B A;  3QQA A;  3N97 A;  3F6O A;  2QM3 A;  1UG0 A;  2ZFW A;  4GDF A;  1OR7 A;  1ETX A;  1EV7 A;  1SMT A;  3OYB A;  3QYF A;  2X1D A;  1MH3 A;  3FHN A;  3RI4 A;  3GWZ A;  2R92 J;  1BOA A;  1WJC A;  5GTH C;  3CUQ B;  1XDU A;  4ESB A;  3WTT C;  2KL4 A;  1YG2 A;  2QWW A;  2MGQ A;  4YEL A;  3ZXS A;  2DLL A;  2LDU A;  2DPD A;  3F8M A;  2EIN H;  3OIQ A;  3A4C A;  4AD9 A;  3IRR A;  1WCM J;  2BOL A;  5JVT A;  1ZRC A;  2G7H A;  2EB7 A;  2OUM A;  5J4V A;  4XN3 A;  5D4S A;  1J75 A;  3FXK A;  3V7S A;  1KON A;  5K7Z A;  3K6G A;  2CFO A;  1D0Y A;  2M87 A;  3W2V A;  2FRH A;  1H0M A;  3FXL A;  4R79 A;  2ISY A;  2MH2 A;  2W48 A;  3GTG J;  1JUM A;  4R1H A;  5E1X A;  3CCQ I;  3TP0 A;  3HB9 A;  3FBI B;  2KIF A;  1N75 A;  4BQQ A;  4RMN A;  5JHF A;  3BQZ A;  3BP8 A;  2B0L A;  1GXP A;  1TW2 A;  3HRS A;  3PNT A;  2CV0 A;  4BAY A;  3PIO F;  1HDP A;  4EJV A;  4HOB A;  1UHM A;  4XLF A;  2RVC A;  3JAM K;  5A2Q K;  1TP4 A;  2CSO A;  2FE3 A;  4HF0 A;  1VFC A;  4IHX A;  2QGU A;  3BR6 A;  2D45 A;  2W82 A;  1WRJ A;  1XG1 A;  5TRD A;  3HUG A;  4D9J A;  5FKO A;  3M8E A;  1U5T A;  2DOD A;  4AVZ A;  1Y8R B;  3DXJ F;  2CJJ A;  4LLL A;  3ZMT A;  3QOE A;  4I98 B;  2GQQ A;  2ELJ A;  3H0G J;  4G7Z F;  4KA4 A;  2EJR A;  2JSC A;  1ZYR F;  1H8A C;  2KMU A;  2NS7 A;  5LEK A;  3VYU B;  3HPG A;  1BW5 A;  2HOA A;  4BL0 B;  4A0X A;  1P7I A;  2JPC A;  2W4S A;  2LG4 A;  1W1W E;  2R0Q C;  4B8X A;  1L3L A;  3R6S A;  4G6D A;  4HNV A;  1LVA A;  2LYC A;  4MO7 A;  2HU9 A;  3ZMD A;  1MSF C;  5IT9 K;  1E0E A;  5K5O A;  3H5R A;  3S1M J;  2P5V A;  1TWF J;  1YIO A;  2HVR A;  2QSF X;  4KMF A;  1WJA A;  2LY2 A;  1F5T A;  2BW3 B;  3GTM J;  3AFH A;  2A68 F;  1P6R A;  3OIO A;  1CF7 B;  2L9V A;  1I5Z A;  4XKV A;  4BY1 J;  1ZHF A;  3JAM Z;  1XMX A;  4XRS A;  2GXA A;  1FP1 D;  1HKT A;  1XB4 A;  2RGV A;  1X58 A;  2JA6 J;  2EZH A;  2NXN B;  2PN6 A;  5F6F A;  1QA6 A;  1ZH5 A;  1B8I B;  1WJ5 A;  3H3U A;  3H0D A;  4RAZ A;  5FB2 A;  4RLF A;  1Z67 A;  2Q0O A;  2YX4 A;  2QQB A;  4P1W A;  4RGR A;  1ZG3 A;  1BR1 A;  4EJW A;  3TOB A;  2QUF A;  1W36 C;  3CUQ A;  1MJA A;  4I0A A;  2DN0 A;  3BR0 A;  4PZJ A;  3SFZ A;  1UHS A;  1X1A A;  5EZH A;  1DPR A;  4KT5 C;  2W57 A;  1HF0 A;  3OYF A;  3GLX A;  4OU0 A;  1MDM B;  1JJ6 C;  4UNO A;  1FIP A;  4L5J A;  4XOR A;  2JUG A;  5IYD J;  3GTP J;  1D5V A;  2Z99 A;  4ON0 A;  3GZ5 A;  4A6E A;  4RM2 A;  2P8T A;  4M73 A;  1TLH B;  2XAH A;  4Q48 A;  5IT9 Z;  1ZGA A;  4LMY A;  1TT0 A;  5EEA A;  3DEU A;  3VYS B;  4ABZ A;  2ZFU A;  2DOE A;  3LAJ A;  2H1L A;  1I3Q J;  4KIF A;  2V9P A;  2BE5 F;  3NQO A;  1VI0 A;  1K6Y A;  3EUA A;  4WXD A;  3JRA A;  3E6M A;  1S6L A;  1X3W B;  5C4J J;  1FNN A;  2R7S A;  4H4K C;  2STT A;  1LEB A;  3O3K A;  3ESW B;  4BQA A;  1DGW Y;  4IHY A;  2G7U A;  2COM A;  3KIO A;  4FE7 A;  1CGP A;  1QVT A;  1XMK A;  3I5U A;  4HA8 A;  2KRC A;  2Y9Z A;  4QLC U;  3PL8 A;  3HOX J;  1FPQ A;  2NOJ B;  4Z2Y A;  2R7Q A;  1X1B A;  3BTL A;  2FUG 2;  2WY8 Q;  1WWX A;  2E7X A;  2DMT A;  5ICE A;  3GF2 A;  2YR2 A;  4EEF G;  1QBJ A;  1B9M A;  3T8R A;  2JT1 A;  4CCJ A;  1E3P A;  4ZZD A;  4UUV A;  3J80 K;  5JR3 A;  1MNE A;  4DZP A;  3SHF A;  2FEZ A;  2NRA C;  5L3F A;  3V4G A;  1MBK A;  1WGX A;  1SVO A;  1SFX A;  4XBF A;  4XLP F;  3O6B B;  3KYD B;  1C0W A;  1UJ8 A;  1MD0 A;  5F64 A;  1IN5 A;  4D7N A;  1VQL I;  3NWT A;  3ONQ A;  4JK1 X;  1KQ0 A;  3J7A O;  1RUO A;  2F5C A;  2ME0 A;  3LSM A;  4W97 A;  3CZ6 A;  4IQJ A;  4Y13 A;  1R23 A;  1SD5 A;  3I4P A;  4PFO A;  4N4N B;  2UUZ A;  2BW3 A;  3TO6 A;  1MBF A;  2LF8 A;  2R4G A;  1IN4 A;  3VFZ A;  3ULQ B;  2M45 A;  2FBI A;  1CF7 A;  1FP2 A;  4RM3 A;  2GIZ A;  4KIB A;  3BG9 A;  4NQW B;  2KLO A;  4XRF A;  2O03 A;  3HG9 A;  4BNC A;  4A12 A;  1RIO H;  4EJO A;  1BR2 A;  1B8I A;  3VSL A;  2K9M A;  4DYR A;  3OYA A;  3J80 Z;  1R5G A;  2LC2 A;  1FLI A;  2RNJ A;  1B9N A;  4N4O B;  4IZZ A;  4LLN A;  2PMZ A;  2DJN A;  2ZKZ A;  4HV6 A;  2BY0 A;  1FYK A;  2IW5 A;  1YJN I;  3S14 J;  2I5U A;  2V1N A;  3GUD A;  3J81 Z;  2ZCW A;  2F4M B;  5BOX A;  1J7K A;  2M1B A;  3OL3 A;  1YLF A;  1U0J A;  3FBN B;  2F5E A;  5IYB J;  4EGY A;  3ABM H;  4LB6 B;  3SJM A;  4Y7N J;  2L3D A;  3E6C C;  3K2Z A;  3DLA A;  2Q2E A;  4L9J A;  3FZV A;  1K83 J;  1QHG A;  3OY9 A;  3FXU A;  4RB3 C;  2LH9 A;  3TP3 A;  3A01 A;  3I0T A;  2OD5 A;  2MH9 A;  4O6J A;  3SEQ A;  1OCR H;  1BL0 A;  4UY8 I;  1SFK A;  3RQI A;  2XKO A;  3BZC A;  3LA7 A;  1LE8 A;  3HOW J;  1R58 A;  1GT0 C;  3LSK A;  3I59 B;  1EH6 A;  4NC8 A;  1RC9 A;  2MFZ A;  1VQ4 I;  2K7L A;  4OIR F;  3RKX A;  2FA5 A;  2UZK A;  2BY2 A;  1G8X A;  1PDN C;  4DIQ A;  3GEZ A;  1E2X A;  4X0G A;  1EH8 A;  3QPL A;  3OYM A;  3AAF A;  2V79 A;  3S17 J;  2ZB9 A;  3KP3 A;  2UV1 A;  1X1P A;  5D5X B;  2FF4 A;  3JTG A;  2BEO A;  3COA C;  2OA4 A;  3L09 A;  3KP4 A;  3OYE A;  2CV1 A;  1ZLJ A;  3F9K A;  5AIP A;  1QO0 D;  1R7J A;  3OS0 A;  3TED A;  1ZTR A;  1BBY A;  2A3S A;  1PUF B;  4B3X A;  2BY3 A;  1OQY A;  1ZRF A;  2QBY B;  4B1R A;  1JUP A;  1K4T A;  1U78 A;  2XUB A;  2X1C A;  2EIL H;  4A3B J;  4MQ9 F;  3VSK A;  3OV8 A;  2OF7 A;  1IRZ A;  1H9T A;  2BVL A;  4O5V A;  4AYB N;  3MKW B;  1I6H J;  1TTY A;  3G4S I;  2P4W A;  4EJU A;  3I56 I;  1RRJ A;  3QPS A;  2IVM A;  1BR4 A;  1SD6 A;  3MKL A;  4M3E A;  1AWC A;  2WC2 A;  1XMA A;  2E1M B;  4KIC A;  1I6X A;  5CLS A;  3I64 A;  2Y0S A;  2KP6 A;  4S0H B;  2CUJ A;  2QKM B;  2R7X A;  3PUB A;  1EKE A;  4KJZ A;  1W36 D;  4I09 A;  1SFE A;  3ERE D;  2HS5 A;  1WZ2 A;  1ZLK A;  1ETQ A;  1AU7 A;  3R0J A;  2WAD A;  5JHU A;  1IXR C;  1ZEL A;  2CU7 A;  3PIP F;  1ZRE A;  2Y48 A;  1V55 H;  2ECB A;  2E5Z A;  3QPT A;  4QTR A;  3WTU C;  1VND A;  2D2W A;  2KDO A;  3ZQG A;  1EH7 A;  4E6K G;  2YU3 A;  3HKZ A;  3HEF A;  4QSH A;  2WB1 A;  4OAY A;  5C3E J;  5J1R A;  1E3O C;  3O2P E;  4OMY A;  4A3G J;  4BXX J;  3OR2 C;  4F55 A;  4BE2 A;  2V9K A;  2Z3Y A;  5KAF C;  1J5Y A;  1O3S A;  3DQV C;  1OKR A;  3OYH A;  3U9G A;  4FQG A;  1U9N A;  3ZGK A;  3S3O A;  4HZF A;  4B44 A;  2CQ7 A;  2F48 A;  3BZK A;  4KFC A;  2HOT A;  2WA0 A;  4XRS G;  3I59 A;  4D0P A;  3CJT B;  1XTA A;  2YSR A;  1P7J A;  1YW8 A;  2HR3 A;  4Z6Y A;  2E1C A;  1MNM C;  1XGO A;  4GYG A;  1LNW A;  4N0B A;  1TW3 A;  1ZRD A;  2H1K A;  2VJ4 A;  3I55 I;  3KLN A;  1P2F A;  1ETY A;  3LL7 A;  1R1V A;  1OLT A;  1Z0X A;  4KYW A;  2M3A A;  2QZ8 A;  2FU4 A;  5EYR A;  4B43 A;  5IOY A;  3HC7 A;  3M7G A;  4BJ6 C;  3JSO A;  2IA2 A;  5F1J A;  4R8H A;  2X48 A;  3WU0 A;  4V19 K;  3LA3 A;  2FNA A;  1TNS A;  2R7T A;  3FK6 A;  1RUN A;  4MEX F;  2VXZ A;  4A2U A;  4D5F A;  3K1N A;  2VOO A;  1F36 A;  5F0F A;  1AHD P;  1EA3 A;  3VOD A;  3KEO A;  3V8L A;  2KZG A;  4M3G A;  2Z9O A;  1WPK A;  1DP3 A;  1ORK A;  1KU3 A;  3MD2 A;  2BXY A;  1PUF A;  5D6F A;  2Z16 A;  4M6Y A;  1A31 A;  3A1Y A;  3PSI A;  2GOX B;  3FIW A;  3N05 A;  2HNH A;  2ADU A;  3L2Q A;  2DXI A;  2CW7 A;  4A3J J;  1GDT A;  2IAI A;  2DBB A;  1ZAO A;  3CJR B;  3TW7 A;  1ETK A;  2P81 A;  1SEU A;  3K70 D;  2L7Z A;  4OIO F;  3QYB A;  5GPC A;  4WK8 F;  4KNY A;  1QZY A;  3JW4 A;  3BPX A;  1MMS A;  1QRY A;  1X1D A;  4HX4 A;  3B6C A;  3KEY A;  1S5L C;  1QHH D;  2VC1 A;  3RZD J;  3K1M A;  4G9Y A;  2ID6 A;  2M7B A;  3K4N A;  3OSF A;  3J7A Y;  1TQI A;  3DEW A;  4PGG A;  2XAJ A;  2DDA A;  1BC7 C;  3KCC A;  1QQI A;  3BZ6 A;  3G71 I;  3R61 A;  3KZZ A;  2E2I J;  2JZY A;  1WJF A;  3WU1 B;  4A93 J;  2XSD C;  2LVS A;  3PUF A;  1N25 A;  4B09 A;  1OYI A;  1WSU A;  4ZTF A;  3A03 A;  4F92 B;  1M1E B;  3CLO A;  2PI0 A;  4IHV A;  3WHB A;  2K27 A;  2PFB A;  1KYW A;  1XSV A;  2CQX A;  2ZNZ A;  1TC3 C;  3W2W A;  3AG2 H;  1W0U A;  1VQ8 I;  5DD4 A;  3IAM 2;  5HLG A;  1JHH A;  2OBP A;  1OCT C;  3WTX C;  4ESJ A;  1BJZ A;  3OYD A;  3ZCO A;  3SEZ A;  3IKT A;  2VC0 A;  2DYR H;  2OV7 A;  1J0R A;  1SVL A;  1GUU A;  2M5W A;  2PMH A;  1DU6 A;  3T8T A;  3CTA A;  1D3Y A;  3C2G A;  1CQT A;  1IW7 F;  1G59 A;  3LMM A;  1XCB A;  2JRT A;  3ELK A;  2QQ8 A;  4PJM A;  3BG6 A;  3F0C A;  3FKI J;  3CME I;  4ENM A;  1MND A;  1P92 A;  1RNL A;  3KP5 A;  2QQ9 A;  1R22 A;  5CVI A;  4A3C J;  2FJ1 A;  4G6Q A;  5ICF A;  2LBF B;  3MWM A;  3LQR A;  1KU9 A;  1W5S A;  5FLX Z;  2R7R A;  3H5A A;  1WJE A;  5E20 A;  4IF4 A;  1I27 A;  3DTI A;  3BG7 A;  5LHH A;  2WBM A;  5FLM J;  3DWL E;  5K7H A;  3ZPL A;  3WGG A;  4B48 A;  3TMO A;  3L2U A;  1Y0U A;  2XC7 A;  4RAF A;  1YE9 A;  1XS9 A;  5DV5 A;  5J47 A;  1NK2 P;  1TWC J;  1D1B A;  4ASN A;  1G2H A;  3FXO A;  2L9N A;  2O5R A;  4C3J J;  2VQG A;  4PJ0 C;  1QVU A;  3EUH C;  3EQL F;  3CJQ B;  5DM6 F;  1W4M A;  5HLH A;  2V26 A;  3CDH A;  2OTJ I;  2EFP A;  4DQ2 A;  5J8F A;  2XF7 A;  1SFO J;  5J4Y A;  3CDI A;  1N77 A;  2E2J J;  2DQL A;  3L2R A;  3VWB A;  3HOY J;  1ODD A;  3I71 A;  2DOF A;  3I53 A;  2RQQ A;  4UUS A;  1UB9 A;  1AA7 A;  1XPX A;  3WE2 A;  4IRI A;  3GFL A;  2MD5 A;  2FMY A;  2R93 J;  1ACI A;  1SVM A;  4WXH A;  3G1O A;  1P9Q C;  3CUQ C;  4I99 C;  1Q1V A;  2XRN A;  1YO5 C;  3OIP A;  3JRH A;  2EIM H;  2P7C B;  3KYC B;  3QAH A;  1FBS A;  2VBZ A;  4AWX B;  3MQ0 A;  3BOQ A;  3L7W A;  3F8C A;  1P4W A;  4M3B A;  3RIR A;  4A0Z A;  3CP8 A;  1IO2 A;  1X2M A;  1FOK A;  4CCK A;  3LOC A;  5HOD A;  4FET A;  2O8K A;  2OTL I;  1WJD A;  2KQR A;  2LLK A;  4LIT A;  4EAT A;  2LSO A;  2X1E A;  1FWZ A;  1ERD A;  4FIS A;  4F91 B;  3BR5 A;  1Z3Y A;  6PAX A;  1IV6 A;  1ONV A;  3RPU A;  3AG3 H;  2HXI A;  1XGS A;  4E7J A;  4A5N A;  4HYE A;  2TDX A;  3GZ6 A;  3HOT A;  4C3H J;  4LLG F;  3PQJ A;  5ILU A;  3MZY A;  1F9N A;  2E60 A;  2K3F A;  1LJ9 A;  1TNT A;  3HRU A;  2IT0 A;  3ZQQ A;  3DU6 A;  4LGW A;  4Y17 A;  4YIR X;  1OMI A;  4ZDO A;  2VPR A;  1SD7 A;  1YJ9 I;  1R49 A;  3FHZ A;  5EGO B;  1A6I A;  3I54 A;  1R6R A;  2LBF A;  3RYR A;  2HKX A;  3DP7 A;  1I1S A;  4E7Z A;  2ZJP F;  3IWF A;  4L9N A;  1RKW A;  3BPV A;  3GW2 A;  5L3G A;  3J7Y J;  3DEE A;  2XPW A;  3P9C A;  1T33 A;  3DKY A;  3HDD A;  5FKN A;  3LNQ A;  3IHU A;  2L01 A;  5E3L A;  3PNV A;  1YS7 A;  4HNT A;  1W5T A;  2DOA A;  4BY7 J;  1H89 C;  3DKX A;  4F93 B;  3CMM A;  3IV5 A;  5IP6 A;  1BI3 A;  2HKO A;  2E5N A;  2RAE A;  4IRG A;  2M7A A;  3H9G A;  3RPU D;  3IL2 A;  2E35 A;  4P55 A;  3D5S C;  2A5Y B;  4BJ5 C;  1R4N B;  5L3C A;  3RSN A;  3MMY B;  4KIG A;  4XLN F;  2ZXJ A;  1FT9 A;  1E3H A;  2H94 A;  4WCG A;  1DU0 A;  3J7Z I;  2ISZ A;  3NRV A;  2A5W A;  3A0H C;  2HI3 A;  5BQT A;  3OYG A;  2KKO A;  3M9A A;  2V9V A;  5DDG A;  3TOA A;  3PFY A;  2LFB A;  5GAE J;  3L9F A;  4XKB A;  2AS5 F;  3NWS A;  1R9T J;  2JQ7 A;  2O6G E;  1ITY A;  3L00 A;  1RR8 C;  1SAU A;  5GAH J;  3K10 A;  1FTZ A;  5CKT A;  3K1P A;  1APL C;  1S7O A;  5ICG A;  5LHI A;  2VON A;  3CCU I;  2QSG X;  1JT6 A;  1JXS A;  1TBX A;  3S1N J;  3DF8 A;  2FSW A;  2XAU A;  3HXL A;  3KX2 A;  4HQE A;  2VJI A;  3Q9V A;  4UV9 A;  2AO9 A;  1X19 A;  1X2N A;  1TT5 B;  2VE9 A;  3LSP A;  3VYT B;  2V1X A;  3ZR8 X;  3F23 A;  3LWF A;  1D5Y A;  3RZO J;  1J2X A;  3MZ8 A;  3BLY A;  2FOW A;  4HG2 A;  1FX7 A;  1MMA A;  1ETV A;  4UB6 C;  4WF2 A;  3U2R A;  2CRG A;  1BM9 A;  1ZG1 A;  3WTS C;  4I6Z A;  4OAZ A;  1T0F C;  1W7P B;  1F43 A;  4ENN A;  1IXS B;  2LTP A;  4U0Y A;  4Q4Z F;  2KPM A;  2HPI A;  4BKX A;  3EUH A;  4MFE A;  4XMY A;  1K78 B;  3CO6 C;  1ZKG A;  4BDY A;  2OAZ A;  4XM3 A;  2Z1D A;  2L7M P;  4S05 A;  2E36 A;  1D1A A;  3GME A;  2X6X A;  2VN2 A;  4RB2 C;  5A2Q Z;  2LNB A;  2Z2S B;  1DUX C;  2FX0 A;  1P4X A;  1ZGW A;  4BQN A;  1G3S A;  4HPQ A;  1O57 A;  4XKC A;  4RS8 A;  2CUF A;  2OZ6 A;  1MBG A;  3FF5 A;  4BDZ A;  4MLO A;  3QYE A;  4A3D J;  1S7A A;  2EV5 A;  2QVO A;  3Q0V A;  3P9K A;  3IH2 A;  2RQP A;  3RPQ A;  3ZN1 A;  4CDG A;  4II3 A;  1YW9 A;  4JQF A;  3L1P A;  4GRI A;  5EZG A;  3QWL A;  1OCZ H;  2XPV A;  3H9Q A;  1FSH A;  2DA7 A;  4I01 A;  4PSX A;  3HBL A;  1Y0N A;  2HQR A;  4QPQ A;  2F5V A;  3HL2 A;  1YTY A;  2O8X A;  5E79 C;  2K4J A;  3PSF A;  1FBU A;  2DFH A;  4CA0 A;  1XDS A;  4CO8 A;  5DEQ A;  4HBL A;  4IVN A;  4GYI A;  1JT0 A;  4K2E A;  2EWN A;  2CS3 A;  3V8K A;  1QPM A;  4CCL A;  5K7F A;  3JTH A;  3FM3 A;  4HSR A;  2HOS A;  2Q1Z B;  3GTK J;  5TJJ A;  4BBR J;  5FRO A;  4B4C A;  1NK3 P;  3RCO A;  3P7N A;  1IZ1 A;  1MJ9 A;  3LAP A;  4OMZ A;  4KT6 A;  2PJR B;  1IF1 A;  1IN8 A;  1O7L A;  2B9S A;  4L5I A;  2XB5 A;  5J6X A;  3K69 A;  1AOY A;  2KDZ A;  3AL0 B;  1LVK A;  3SDG A;  1T95 A;  1Z77 A;  1ZK8 A;  2CQN A;  3X2Q H;  1Y1W J;  3LST A;  5ERI A;  3WG9 A;  5GAG J;  3Q5F A;  3HHG A;  4AIJ A;  2LRE A;  5B1B H;  3SFI A;  2H09 A;  2E2H J;  3IRQ A;  4PSW A;  4CZZ A;  3KP2 A;  5J8C A;  2ZXW H;  4X1E A;  2OCC H;  1W7P A;  1R1T A;  2A6T A;  4IOC F;  3MZH A;  4C30 A;  5HLI A;  4M6V A;  3W2A A;  1UEL B;  4EM2 A;  1X3Z B;  2M0M A;  2IPQ X;  1VQ9 I;  2ZXI A;  1FOW A;  4CSW A;  3K70 C;  2EK5 A;  2G9W A;  1IGN A;  2P5L C;  3JRG A;  3DPT A;  1HBX G;  3A02 A;  3MVP A;  2CQK A;  4UVB A;  4FTH A;  4CHU A;  2GBY A;  1LB2 A;  4I7H A;  4PJL A;  1ZGJ A;  2Y0S N;  3G3Z A;  2C6Y A;  3FXM A;  3HIF A;  4DW6 A;  3ZOB A;  3KP7 A;  4XLC A;  1T38 A;  1HLV A;  2EV0 A;  1GV2 A;  2ZC2 A;  3QU3 A;  4PJN A;  2KJC A;  4PCQ A;  3EET A;  1FJL A;  2UXX A;  3CDL A;  1MDM A;  1HW1 A;  4KN4 X;  4U0V A;  1XD7 A;  2DO7 A;  2EIK H;  4LG0 B;  5C44 J;  1T2K A;  1YX3 A;  2AQE A;  2WY7 Q;  1W7P D;  4JP0 A;  5JFR A;  5JLX A;  2EV6 A;  2XGX A;  4M72 A;  2NNY A;  1SFU A;  3HKZ N;  3ABU A;  2WB1 N;  3BR2 A;  4MTE A;  1O4X A;  2QSH X;  3F72 A;  2DQR A;  2LR8 A;  2DDB A;  4EM0 B;  1T0F A;  2EFQ A;  2EA4 A;  1Z1D A;  1Z7U A;  2VI6 A;  1FYL A;  3O8H A;  3E5Q A;  2E1M C;  4BXF A;  5LRS A;  1JI8 A;  3LQQ A;  2VOP A;  5IYC J;  2IGO A;  1OYW A;  2CFX A;  2GIV A;  3BJO A;  4BJT A;  5FJ8 J;  4ZDP A;  1V5G A;  1YRN B;  3QP6 A;  1VQM I;  1SC7 A;  3FXR A;  2VKH A;  3WGH A;  1HKS A;  2DYS H;  3DPL C;  4M9Z A;  1ZQ3 P;  2PJR A;  3IC7 A;  1Z05 A;  2AHQ A;  5TIS C;  1BI0 A;  4UHT A;  2KIS A;  1D8J A;  3FX3 A;  1LFP A;  1I39 A;  4JYK A;  1ETW A;  1IC8 A;  4BAC A;  4AM3 A;  4XNF A;  1S9H A;  3ZQI A;  3S1R J;  2VUM J;  3CF2 A;  5E18 F;  4G7H F;  3C2B A;  4KIT B;  1JGS A;  3C1D A;  1QGP A;  4P9U A;  5LRR A;  3C3W A;  4ZJZ A;  1FSE A;  5DD8 A;  2QEX I;  3PJR A;  5IY5 H;  3A0B C;  2HVQ A;  4LFU A;  4F3Q A;  4A3F J;  4M3F A;  4XSZ F;  2X6O A;  9ANT A;  2KJB A;  2CG4 A;  5M5W J;  4UUT A;  5CYV A;  1IG7 A;  4Y52 J;  1VQ7 I;  4J00 A;  5FKM A;  4YFK F;  1N78 A;  3CCM I;  1GV5 A;  4NQW A;  1YIT I;  3HRT A;  3CMA I;  1BA5 A;  3HRM A;  1VQN I;  4M9S A;  1PP7 U;  4RGS A;  5D8L B;  3ML6 A;  4XR6 A;  5IT3 A;  3DFG A;  2XAS A;  2ZSH B;  3CLQ A;  1LQ1 A;  4EVI A;  2CW8 A;  2ETH A;  1JJ8 C;  1G3Y A;  2NS0 A;  3VB2 A;  2MC4 A;  2WAE A;  2MA3 A;  4RLQ A;  4KN7 X;  2K86 A;  1YYV A;  1R5I D;  2DA4 A;  3I9V 2;  2XIG A;  1ZAR A;  1VZ0 A;  1IRF A;  3DPU A;  2X51 A;  4IHW A;  1HW5 A;  1NG7 A;  1WVR A;  4U88 A;  1WJB A;  2A05 A;  2V4J C;  5E1W A;  2ZO4 A;  4MFD A;  3S93 A;  5M5X J;  2IGM A;  1ZG5 A;  3C18 A;  1YI2 I;  3K2A A;  4U0W A;  4HX8 A;  4L18 B;  2RDP A;  3HSR A;  4RGX A;  2M4G A;  1V5F A;  1Z9C A;  3CCR I;  4NHJ A;  1GXQ A;  3C7J A;  2VPL A;  2V6C A;  1MMN A;  2EIJ H;  4UVA A;  3TBI A;  1WQ2 A;  3BT9 A;  4WWC A;  3KET A;  4ZTJ A;  5AIQ A;  2VT2 A;  2QF7 A;  1JUS A;  4GFB A;  1D0Z A;  2GA1 A;  2P7V B;  1BOB A;  1WI3 A;  3JRF A;  2L5Q A;  2OJE D;  2HQN A;  2FNP A;  3DBH B;  2F6C A;  2NVT J;  2IXS A;  1YRN A;  1JTX A;  1GLN A;  1FBQ A;  3CC2 I;  1T98 A;  1S29 A;  3CCS I;  5HNF A;  3G2B A;  3DU5 A;  1IDZ A;  2YUS A;  3L2C A;  2D5V A;  1IRX A;  2DI3 A;  2LY1 A;  3DV8 A;  4XOP A;  3H3V K;  3Q0U A;  3P5J A;  1RES A;  1XX5 A;  5K5Q A;  3MKY B;  3LSG A;  3S3M A;  2YU9 J;  5FKK A;  1LKX A;  3WTZ A;  4PUS A;  2V1D A;  2F4O B;  1XC5 A;  1HC8 A;  3BCB A;  1VQP I;  4RA2 A;  1Y56 A;  1BW6 A;  4E4H A;  4XLA A;  1U8R A;  3VDX A;  2DFI A;  1FMW A;  2K3P A;  1Z3X A;  4CXF A;  4JX6 A;  4KUM A;  1IN7 A;  2GAU A;  3NAR A;  3OYJ A;  2QBY A;  3FKJ A;  1OCC H;  4XSX F;  3NEU A;  3QRF F;  3OYI A;  3FXQ A;  2BBY A;  2JTV A;  2KT0 A;  2CH0 A;  4ZZL A;  2XAG A;  5B1A H;  2HZT A;  2MW8 A;  3HTU A;  1XSX A;  4RGU A;  5BPD A;  3U1K A;  2L7F P;  3IWZ A;  2EQR A;  1QZE A;  2GXB A;  4IHT A;  4OIQ F;  2JA8 J;  4LIU A;  3KZI C;  4AYB A;  2R5Z B;  3VEP A;  2ID3 A;  4LG3 A;  2JJ7 A;  2DMU A;  2ZXH A;  2WWY A;  4ENJ A;  2N8G A;  3M1C A;  4YEJ A;  2PJP A;  3G6E I;  2VT3 A;  3FMR A;  4MQV A;  3K4J A;  1V4R A;  2QKL B;  2DFE A;  4L9T A;  5KVR A;  2HOE A;  5ILS A;  5BS6 A;  1WI9 A;  2IP2 A;  1VQK I;  3E6D A;  4IL6 C;  1SMY F;  3E0J B;  5H6R A;  1R71 A;  3F8N A;  2K9S A;  1XSD A;  1R00 A;  2QEN A;  1H88 C;  4CGZ A;  5FD5 A;  2ZJQ F;  3ZP5 A;  3OR1 C;  3GFI A;  3HOV J;  3S16 J;  1R4M B;  2K9N A;  4FX0 A;  1A5J A;  5D5W B;  2DAO A;  1I50 J;  2MBF A;  2R5Y B;  1V5E A;  3CCY A;  1GVD A;  3LSR A;  2DPU A;  5E3O A;  2M4K A;  5HLT A;  1B6A A;  3QPH A;  3OSG A;  3JR9 A;  2F2E A;  2YS9 A;  3ISP A;  3O8G A;  3KEQ A;  4FX4 A;  3VYR B;  4MEY F;  2DCE A;  3OOU A;  2R7O A;  3H35 A;  3CCV I;  1IRG A;  3E3V A;  2HQA A;  2ZME B;  4EM1 A;  5E1Z B;  4ITV A;  1XGN A;  2BGC A;  1O3Q A;  2JSP A;  2MAB A;  3GFJ A;  4F52 A;  3PQK A;  3S2W A;  1FYM A;  2WTE A;  4EJT A;  2WAF A;  3PNY A;  2CV2 A;  2FD5 A;  3ZMV A;  5D6E A;  2GLO A;  5LGT A;  3RKW A;  4G7O F;  5DUI A;  2VKE A;  4C9Y A;  2TRT A;  4YG2 F;  1RKT A;  3RDI A;  1Y8Q B;  3I4M J;  4P5O A;  4A3K J;  2DU9 A;  2K9Q A;  2K9L A;  4HQM A;  4CUG A;  4JX4 A;  2L4M A;  3K9T A;  2OPT A;  3FMQ A;  3V7C A;  4ZC3 A;  1IJW C;  5JI6 A;  1KU7 A;  3QOD A;  2UXN A;  2NAZ A;  1DQU A;  4XQF A;  1IDY A;  3ECO A;  1MMG A;  1XGM A;  2LF7 A;  5KHD A;  1PVE A;  4BXU A;  1FY7 A;  1FOY A;  3LFK A;  1OCO H;  2W24 A;  2Y75 A;  1F1Z A;  3BG5 A;  5E8G A;  2HFH A;  2OCE A;  3ZMU A;  4BBS J;  2MLK A;  2OU2 A;  2OZU A;  2QLZ A;  3L2V A;  4YFX F;  3GCM A;  4L5E A;  1A04 A;  2XAF A;  3I3L A;  3ZQL A;  2X6Y A;  3G73 A;  1UMQ A;  1ON2 A;  5HDK A;  4N9H A;  3QOP A;  5FFX A;  1JGG A;  4IJA A;  4J01 A;  2Y69 H;  1QZZ A;  5F27 A;  2VE8 A;  2R5Z A;  2BXZ A;  3HGG A;  2A07 F;  4RAG A;  5H6Q A;  5FRN A;  1R1U A;  5LGU A;  4BHB A;  5LFA A;  2A6H F;  5H20 A;  1T8I A;  2Y31 A;  2Y0M A;  3TDU C;  4FT8 A;  4G12 A;  1F4K A;  2XGE A;  3CCL I;  3WU2 C;  2DMN A;  4E7L A;  4FCY A;  2YX7 A;  4PDK A;  4D5C A;  3V8J A;  5HVQ C;  4QPO A;  3M3Y J;  3LSJ A;  4BH9 A;  3GO5 A;  2JA7 J;  3HTS B;  2ELK A;  4AU7 A;  1YFH A;  3KP6 A;  3HZJ A;  4DNC A;  3S15 J;  2M9H A;  5CQG A;  2IA0 A;  2HYG D;  1LPQ A;  4FE4 A;  2FOK A;  1TWH J;  5LLQ A;  4AUX A;  1JTY A;  3ZRG A;  1U5T B;  3W6J B;  3H92 A;  3D1N I;  2R5Y A;  4I02 A;  3D5L A;  1DGR M;  1K4S A;  3M07 A;  2M30 A;  3BQY A;  4YFN F;  2MLG A;  3OS2 A;  5E17 F;  1IUY A;  1KGS A;  1G3W A;  3BG3 A;  1KZH A;  1POG A;  2IS1 A;  3E5U A;  3M4O J;  1FEX A;  3U21 A;  5E3M A;  2RKH A;  3S3N A;  4Q47 A;  5F0C A;  2HPM A;  3F21 A;  1UHW A;  1HDD C;  4A3E J;  3I58 A;  2V6E A;  1Y39 A;  1LUJ B;  2DT7 B;  4ZDL A;  2EFO A;  1BIA A;  2MSY A;  1U8B A;  1DDN A;  2WAQ A;  4XK4 A;  1EJ9 A;  4N9I A;  5IP7 J;  2IRF G;  2X9D A;  1IV8 A;  5F1R A;  3PO2 J;  1KQ9 A;  4HF2 A;  3GTQ J;  2JK3 A;  4AIH A;  3H3Z A;  5FD6 A;  2DA1 A;  3ABK H;  1UAA A;  2Y30 A;  3OS1 A;  4A3M J;  1FIA A;  5D4R A;  2LK2 A;  3HSE A;  2VOD A;  3DBL B;  5LHG A;  4HV5 A;  3F8F A;  2COB A;  1STZ A;  5LD2 C;  1HW2 A;  4NC6 A;  3HOZ J;  2W85 A;  2ECC A;  4HNU A;  1IN6 A;  5E3N A;  1HSJ A;  5D5U B;  1W0T A;  2CMP A;  2VL8 A;  2VKD A;  2MYS A;  1WHU A;  3ZQ7 A;  3AKZ A;  2ICW G;  3S2D J;  3IKV A;  2CO5 A;  4QWQ A;  4CZC A;  1SD4 A;  3TO9 A;  1FOX A;  5LGN A;  1UCR A;  4U7D A;  4MTD A;  4EMS A;  3K4M A;  2LY9 A;  3BTJ A;  4KMU X;  2KZV A;  3RYP A;  4E7K A;  5B66 C;  3GBG A;  2IEK A;  1ZR2 A;  4U7B A;  2XVC A;  1TQP A;  1S3J A;  4II2 A;  1IAW A;  1RPW A;  2XRL A;  1SAN A;  2X85 A;  2VBW A;  3CD6 I;  2OQG A;  3Q9S A;  1YOV B;  2PG4 A;  4L0Z B;  4XIC A;  3T0Y A;  4TV7 A;  3MEX A;  4F7Z A;  3B6A A;  1RI7 A;  3ASN H;  2E7W A;  1Y1V J;  2DW4 A;  2HGC A;  1HOM A;  2R7D A;  2IBD A;  2XAQ A;  4BHP A;  4LIV A;  4OIN F;  4BE1 A;  2V7F A;  4PGH A;  2O61 A;  3SDB A;  1JKQ C;  4ZYH A;  3OWT A;  2DTR A;  3M8J A;  3OYL A;  1TL8 A;  4LJZ F;  4RBO A;  2ZJ2 A;  1QNT A;  1FZP B;  3HYI A;  4UB8 C;  4RB1 A;  2W00 A;  4MNU A;  2J5P A;  1J09 A;  2GXG A;  4MGR A;  4ESF A;  2DK5 A;  3E5X A;  4PK4 A;  4Y4R A;  3FK7 A;  3QU6 A;  3CUO A;  4CCM A;  2PEX A;  3D5R C;  2XKP A;  3CQZ J;  4MHG A;  5CJ9 A;  5EGO A;  3KFW X;  5CQE A;  5CVJ A;  2BHY A;  3AL0 C;  2NVQ J;  1RZ4 A;  3DTE A;  3F8B A;  2CGP A;  2BHZ A;  5KAI C;  1LDD A;  4Y15 A;  1X3U A;  2H27 A;  3HOS A;  1R5H A;  2W84 A;  1A6Q A;  4M9X A;  3JRB A;  3CCJ I;  4IHS A;  2PMZ N;  2L02 A;  3TO7 A;  2LKP A;  5ILV A;  2FQ3 A;  4E7H A;  4M6X A;  3RQ4 A;  1V54 H;  3HOU J;  2JVH A;  4KIS A;  5AON A;  4BYY A;  3K4K A;  3D0S A;  1Z91 A;  2XDV A;  4XID A;  1W5C C;  4BUP A;  1HA8 A;  2M8G X;  2VAS A;  3ZQH A;  4BGD A;  3TKY A;  1BI2 A;  1DP7 P;  5L3B A;  4L0Y B;  1OYY A;  2CUZ A;  5K1Y A;  1MH4 A;  5HS8 A;  1PUE E;  3PO3 J;  4JOM A;  3UR3 C;  1B4A A;  2KIQ A;  2Q2E B;  3R0A A;  2IS4 A;  2X6W A;  3DKW A;  4Y3O A;  1X1C A;  3JRD A;  2OC6 A;  3BDD A;  4GCV A;  3A01 B;  4B3A A;  4FHT A;  3P9I A;  1OJL A;  2RNG A;  4C2U A;  1LE8 B;  1YX5 A;  3B73 A;  2JWT A;  3PFI A;  5J1U A;  4MIM A;  5HS9 A;  1G6N A;  4DJA A;  4XOT A;  3OYK A;  3GZN B;  1T08 B;  4YIF A;  1T39 A;  2IGN A;  5DTD A;  2RRE A;  4NDL A;  2Z33 A;  2OQR A;  2E34 A;  1S72 I;  3KLO A;  3AG1 H;  3K7A J;  2MD0 A;  2CUE A;  3HSF A;  3OMY A;  2Q8K A;  2GZW A;  3E97 A;  5M3F J;  4GXO A;  3GXO A;  3ABT A;  2EFW A;  5BNG A;  2HDW A;  1MSE C;  1HKQ A;  4X6A J;  1OCP A;  4UXN A;  2NVU B;  5FFZ A;  5FO5 A;  5CVR A;  4LOC A;  3E6B A;  1K6O A;  2NNN A;  3ZMZ A;  1ETO A;  4M74 A;  1K78 A;  5J1Y A;  2VJ5 A;  2CYY A;  2HQ5 A;  4IPA A;  3BTC A;  2NS8 A;  1D8K A;  4E7S A;  2IS6 A;  4DZJ A;  3DLL F;  4C2M J;  3J81 K;  3H1C A;  5EDN A;  5E8I A;  3UKG A;  2D1H A;  4M71 A;  3TW6 A;  1D0X A;  2HWV A;  4LB5 A;  2O7O A;  5EEH A;  2O3F A;  5F08 A;  4IX7 A;  1LFU P;  4CYC B;  2B63 J;  2FXA A;  4B47 A;  5LBQ A;  1KQ8 A;  3MKZ A;  3HPH A;  3OYC A;  1YIJ I;  3GFM A;  2ZBK A;  3K4C A;  2LOO A;  5CVU A;  3S32 A;  4YRV A;  5KNL A;  4IRH A;  3HHH A;  5CPR B;  3GTL J;  3IH4 A;  2DMP A;  4I76 A;  1D1C A;  3W3C A;  1REP C;  2L4A A;  4XKW A;  3S8P A;  2LKS A;  2XGD A;  3SXY A;  1MBH A;  1T56 A;  2DA5 A;  2O0Y A;  2R7V A;  1FMV A;  2IS2 A;  3S2H J;  3MCZ A;  1BI1 A;  2IJL A;  5M3M J;  2HEO A;  2QCO A;  3MFK A;  4P96 A;  5DUK A;  2ZJR F;  4NUB A;  2HDC A;  3B02 A;  3DTK A;  1U6G A;  5DCM B;  3BTI A;  1E17 A;  2IA1 A;  1JKO C;  4BU2 A;  1J9I A;  2FBH A;  1WKM A;  2EFN A;  2DA3 A;  2XHK A;  5L3E A;  3HGY A;  3KPH A;  4LD5 A;  1PP8 F;  4BE0 A;  3QP5 A;  2LMD A;  3GLL A;  5GPA A;  5FKL A;  4AVP A;  2VJJ A;  4HDU A;  3V7R A;  1UZC A;  2JN6 A;  4NC7 A;  5EF6 A;  2R7F A;  3GTJ J;  5EG0 B;  2L54 A;  3SZT A;  5J40 A;  1EF4 A;  2HYF A;  2KIU A;  2EZL A;  1L0O C;  1OIS A;  3DBR B;  3FM5 A;  4HEA 2;  4GO1 A;  1O3R A;  3W6V A;  3JCU C;  1UFM A;  1U9O A;  2VIX A;  1XN7 A;  2EA2 A;  1XCV A;  3RJP A;  4ANJ A;  1P4A A;  3C2H A;  3CES A;  2HZD A;  5DCF A;  5B3S H;  4EGZ A;  1U3E M;  3CO7 C;  1AKH B;  1RR7 A;  3JRC A;  1O3T A; 
#chains in the Genus database with same CATH homology
 3EYI A;  2PQ8 A;  3CJN A;  3WGI A;  2XRO A;  1Z6T A;  2RV8 A;  1Z6R A;  4YII A;  5FGM A;  4OIP F;  3SQN A;  1FC3 A;  1DPU A;  1HXD A;  4EV0 A;  3GX4 X;  2FBK A;  4ENK A;  1S8N A;  1K7A A;  2KIM A;  3U1D A;  2P6T A;  1BJA A;  2AXL A;  2RN7 A;  3KZY A;  2A61 A;  4E70 A;  4ZYG A;  4A5M A;  3ECH A;  2P5K A;  4ETS A;  3REO A;  1KYZ A;  4WX9 A;  5KK1 A;  3VOE A;  4LG0 A;  4Q5S F;  4HW0 A;  1B59 A;  4NB5 A;  3TDZ C;  2M8E A;  1TQM A;  2A69 F;  3W6K B;  4UV8 A;  4P9F A;  3WTV C;  2MC3 A;  1U2W A;  3WE3 A;  5DCM A;  2YPR A;  4I2O A;  1SAX A;  1MGT A;  4H0E A;  2JPB A;  1H9G A;  2X0L A;  1BIB A;  2VBY A;  4OOI A;  1GVJ A;  1MJB A;  1UST A;  3T1B A;  1YQA A;  5ICC A;  5BPI A;  2P6S A;  3T5X A;  3RTR A;  4O3M A;  3EYY A;  2K02 A;  1J59 A;  4L9V A;  1LDK B;  1GHC A;  3WTY C;  2D1V A;  4HF1 A;  4I0B A;  2BYV E;  5HOO A;  2PMU A;  2HTS A;  2J5O A;  2QQA A;  3F22 A;  2UWM A;  3KE2 A;  2XV4 S;  2KRF A;  1B1B A;  3M8F A;  1R36 A;  3ZMS A;  1HQC A;  4HX7 A;  5HS7 A;  3BJA A;  4CYD A;  4RB0 A;  1V3F A;  2A6E F;  2E1N A;  5K5R A;  4BHC A;  5D5V B;  4A6D A;  2PLY A;  4UVC A;  2BV6 A;  5HDN A;  3BY6 A;  2ESN A;  3FWE A;  4IXA A;  1OPC A;  3RKY A;  4HLX A;  3TGN A;  4HAM A;  2CWE A;  2W25 A;  2Z5U A;  3N4M A;  4CIC A;  5FLX K;  1T6S A;  2HTJ A;  4AIK A;  2RC4 A;  3WOD F;  2DT5 A;  2FML A;  5LEJ A;  5ED4 A;  3JSP A;  3ZN0 A;  2GWR A;  3M1E A;  2STW A;  1ON1 A;  2NYX A;  4RAY A;  4ZYE A;  4S04 A;  3SZP A;  4LK0 F;  1BC8 C;  1K79 A;  4ZH4 F;  1BN5 A;  1LEA A;  2GA2 A;  1YW7 A;  1U5T C;  1IXC A;  2X4H A;  2ZNY A;  2WV0 A;  3R4K A;  3GVA A;  3K0L A;  3GYH X;  2H6C A;  5DYM A;  5HDG A;  1G4D A;  3ROU A;  5CVV A;  1NHA A;  3WTW C;  1LDJ A;  4HDV A;  2CW0 F;  3BJ6 A;  3BWG A;  4G8X A;  1I1G A;  1HST A;  2F5D A;  1ULY A;  5EEG A;  3TQN A;  3OOP A;  3F6V A;  1USS A;  1MZB A;  2H6B A;  4A0Y A;  1G3T A;  2DK8 A;  2ELH A;  4WXC A;  1MKM A;  2VBX A;  4LK1 F;  3FMS A;  3R60 A;  1Q1H A;  4EQQ A;  2ACJ A;  5BMZ A;  2V1U A;  4JBA A;  1ZN2 A;  4GGG A;  4KDP A;  2PBI A;  4G94 A;  1JE8 A;  1KA8 A;  1JHF A;  4HLY A;  3EDP A;  3BRO A;  3F3X A;  4ZYD A;  3LA2 A;  2ESH A;  1KU2 A;  2ZME A;  3MAJ A;  5L3D A;  1O7F A;  2QYO A;  1VTN C;  2F5F A;  5D8K B;  2R3S A;  1YS6 A;  2K4B A;  3N97 A;  3F6O A;  2QM3 A;  2ZFW A;  1OR7 A;  1EV7 A;  1SMT A;  3RI4 A;  3GWZ A;  1BOA A;  3CUQ B;  1XDU A;  4ESB A;  3WTT C;  1YG2 A;  2QWW A;  2DLL A;  2LDU A;  2DPD A;  3F8M A;  4AD9 A;  3IRR A;  5JVT A;  1ZRC A;  2G7H A;  2EB7 A;  5D4S A;  1J75 A;  3V7S A;  2M87 A;  2FRH A;  1H0M A;  4R79 A;  2ISY A;  2MH2 A;  4R1H A;  5E1X A;  2KIF A;  3BP8 A;  2B0L A;  1GXP A;  1TW2 A;  3HRS A;  4BAY A;  4EJV A;  4HOB A;  1UHM A;  2RVC A;  3JAM K;  5A2Q K;  2CSO A;  2FE3 A;  4HF0 A;  2D45 A;  1WRJ A;  5TRD A;  3HUG A;  3M8E A;  1U5T A;  3DXJ F;  4LLL A;  3ZMT A;  4I98 B;  2GQQ A;  4G7Z F;  4KA4 A;  2EJR A;  2JSC A;  1ZYR F;  5LEK A;  4A0X A;  2JPC A;  4B8X A;  1L3L A;  3R6S A;  4G6D A;  1LVA A;  5IT9 K;  3ZMD A;  5K5O A;  2P5V A;  1YIO A;  4KMF A;  1F5T A;  2A68 F;  1P6R A;  1CF7 B;  1I5Z A;  1ZHF A;  3JAM Z;  1FP1 D;  1HKT A;  1XB4 A;  2RGV A;  2PN6 A;  5F6F A;  1ZH5 A;  3H3U A;  4RAZ A;  5FB2 A;  2Q0O A;  2YX4 A;  2QQB A;  4RGR A;  1ZG3 A;  4EJW A;  3TOB A;  2QUF A;  3CUQ A;  1MJA A;  4I0A A;  3SFZ A;  4PZJ A;  1DPR A;  4KT5 C;  2W57 A;  4UNO A;  3GLX A;  4OU0 A;  1MDM B;  4L5J A;  1D5V A;  2Z99 A;  4ON0 A;  3GZ5 A;  4A6E A;  2P8T A;  4Q48 A;  4M73 A;  1TLH B;  2XAH A;  5IT9 Z;  1ZGA A;  4LMY A;  3DEU A;  3LAJ A;  4KIF A;  2BE5 F;  3NQO A;  4WXD A;  3E6M A;  1S6L A;  1FNN A;  2STT A;  1LEB A;  3O3K A;  4BQA A;  2G7U A;  2COM A;  1CGP A;  1XMK A;  3I5U A;  4HA8 A;  4QLC U;  1FPQ A;  4Z2Y A;  1WWX A;  2E7X A;  5ICE A;  3GF2 A;  2YR2 A;  1QBJ A;  1B9M A;  3T8R A;  2JT1 A;  4ZZD A;  4UUV A;  3J80 K;  5JR3 A;  3SHF A;  2FEZ A;  2NRA C;  5L3F A;  3V4G A;  1SFX A;  4XBF A;  4XLP F;  3O6B B;  1C0W A;  1MD0 A;  5F64 A;  1IN5 A;  4JK1 X;  1KQ0 A;  3J7A O;  1RUO A;  2F5C A;  4Y13 A;  1R23 A;  1SD5 A;  3I4P A;  3TO6 A;  2LF8 A;  1IN4 A;  3VFZ A;  3ULQ B;  2M45 A;  2FBI A;  1CF7 A;  1FP2 A;  4KIB A;  4XRF A;  2O03 A;  4BNC A;  4A12 A;  1RIO H;  4EJO A;  3J80 Z;  1R5G A;  1FLI A;  2RNJ A;  1B9N A;  4LLN A;  2ZKZ A;  4HV6 A;  1FYK A;  2IW5 A;  3GUD A;  3J81 Z;  2ZCW A;  5BOX A;  1J7K A;  2M1B A;  1YLF A;  2F5E A;  4EGY A;  4LB6 B;  2L3D A;  3E6C C;  3K2Z A;  2Q2E A;  4L9J A;  3FZV A;  3FXU A;  4RB3 C;  3I0T A;  2OD5 A;  2MH9 A;  4O6J A;  2XKO A;  3LA7 A;  1R58 A;  3I59 B;  1EH6 A;  2K7L A;  4OIR F;  3RKX A;  2FA5 A;  2UZK A;  1PDN C;  3GEZ A;  1E2X A;  1EH8 A;  3AAF A;  2V79 A;  3KP3 A;  5D5X B;  2FF4 A;  3JTG A;  2BEO A;  3COA C;  2OA4 A;  3L09 A;  3KP4 A;  1ZLJ A;  5AIP A;  1QO0 D;  1R7J A;  1BBY A;  2A3S A;  1ZRF A;  2QBY B;  1U78 A;  2XUB A;  4MQ9 F;  3OV8 A;  1H9T A;  4O5V A;  1TTY A;  2P4W A;  4EJU A;  2IVM A;  1SD6 A;  1AWC A;  2WC2 A;  1XMA A;  4KIC A;  1I6X A;  5CLS A;  3I64 A;  4I09 A;  1SFE A;  3ERE D;  2HS5 A;  1ZLK A;  3R0J A;  5JHU A;  1IXR C;  1ZRE A;  2Y48 A;  3QPT A;  3WTU C;  2D2W A;  1EH7 A;  2YU3 A;  3O2P E;  4OMY A;  2Z3Y A;  1J5Y A;  1O3S A;  3DQV C;  1OKR A;  3U9G A;  4HZF A;  4KFC A;  3I59 A;  4D0P A;  2YSR A;  1YW8 A;  2HR3 A;  2E1C A;  1XGO A;  4GYG A;  1LNW A;  4N0B A;  1TW3 A;  1ZRD A;  3KLN A;  1P2F A;  4KYW A;  1R1V A;  2QZ8 A;  2FU4 A;  3M7G A;  3JSO A;  2IA2 A;  4R8H A;  3WU0 A;  3LA3 A;  2FNA A;  1TNS A;  1RUN A;  4MEX F;  2VXZ A;  4A2U A;  2VOO A;  3K1N A;  3VOD A;  3KEO A;  3V8L A;  2Z9O A;  1KU3 A;  5D6F A;  4M6Y A;  2ADU A;  2DBB A;  1ZAO A;  4OIO F;  4WK8 F;  4KNY A;  1QZY A;  3JW4 A;  3BPX A;  4HX4 A;  2VC1 A;  3K1M A;  4G9Y A;  1TQI A;  4PGG A;  2XAJ A;  1BC7 C;  3KCC A;  1QQI A;  3BZ6 A;  3R61 A;  3KZZ A;  2JZY A;  3WU1 B;  4B09 A;  1OYI A;  1WSU A;  3CLO A;  2PI0 A;  2K27 A;  2PFB A;  1KYW A;  1XSV A;  2ZNZ A;  5DD4 A;  5HLG A;  1JHH A;  2OBP A;  3WTX C;  4ESJ A;  3IKT A;  2VC0 A;  1J0R A;  2M5W A;  2PMH A;  3T8T A;  3CTA A;  1D3Y A;  1IW7 F;  1XCB A;  2JRT A;  3ELK A;  4ENM A;  1P92 A;  1RNL A;  3KP5 A;  2QQ9 A;  1R22 A;  5CVI A;  4G6Q A;  5ICF A;  3MWM A;  3LQR A;  1KU9 A;  1W5S A;  5FLX Z;  5E20 A;  4IF4 A;  1I27 A;  5LHH A;  3ZPL A;  3WGG A;  1Y0U A;  5DV5 A;  4ASN A;  3EQL F;  1W4M A;  5HLH A;  3CDH A;  2EFP A;  4DQ2 A;  5J8F A;  2DQL A;  1ODD A;  3I71 A;  3I53 A;  1UB9 A;  3WE2 A;  4IRI A;  3GFL A;  2MD5 A;  2FMY A;  4WXH A;  3CUQ C;  2XRN A;  1YO5 C;  2P7C B;  3QAH A;  1FBS A;  2VBZ A;  4AWX B;  3MQ0 A;  3BOQ A;  3L7W A;  3F8C A;  1P4W A;  3RIR A;  4A0Z A;  1FOK A;  2LSO A;  1FWZ A;  6PAX A;  1ONV A;  3RPU A;  1XGS A;  4A5N A;  4HYE A;  2TDX A;  3GZ6 A;  3HOT A;  4LLG F;  3PQJ A;  5ILU A;  3MZY A;  1F9N A;  1LJ9 A;  1TNT A;  3HRU A;  2IT0 A;  4LGW A;  4Y17 A;  1OMI A;  1SD7 A;  3FHZ A;  3I54 A;  3RYR A;  2HKX A;  3DP7 A;  1I1S A;  3IWF A;  4L9N A;  3BPV A;  5L3G A;  3GW2 A;  3P9C A;  3IHU A;  2L01 A;  1YS7 A;  1W5T A;  1BI3 A;  2HKO A;  4IRG A;  3IL2 A;  4P55 A;  2A5Y B;  5L3C A;  4KIG A;  4XLN F;  2ZXJ A;  1FT9 A;  2H94 A;  4WCG A;  2ISZ A;  3NRV A;  5BQT A;  2KKO A;  3M9A A;  2V9V A;  5DDG A;  3TOA A;  3L9F A;  2AS5 F;  2O6G E;  3L00 A;  3K1P A;  1S7O A;  5ICG A;  5LHI A;  2VON A;  1JXS A;  1TBX A;  2FSW A;  3DF8 A;  4HQE A;  3Q9V A;  4UV9 A;  2VE9 A;  2V1X A;  3F23 A;  3LWF A;  1J2X A;  1FX7 A;  4WF2 A;  3U2R A;  1BM9 A;  1ZG1 A;  3WTS C;  1W7P B;  4ENN A;  1IXS B;  4U0Y A;  4Q4Z F;  3EUH A;  1K78 B;  3CO6 C;  2OAZ A;  4S05 A;  2VN2 A;  4RB2 C;  5A2Q Z;  2LNB A;  1DUX C;  1P4X A;  1G3S A;  1O57 A;  4RS8 A;  2OZ6 A;  3FF5 A;  1S7A A;  2EV5 A;  2QVO A;  3P9K A;  2RQP A;  3RPQ A;  3ZN1 A;  4CDG A;  1YW9 A;  4JQF A;  1FSH A;  4I01 A;  2HQR A;  1YTY A;  2O8X A;  2K4J A;  1FBU A;  1XDS A;  4CO8 A;  5DEQ A;  4HBL A;  4IVN A;  4GYI A;  4K2E A;  2EWN A;  3V8K A;  1QPM A;  3JTH A;  3FM3 A;  5TJJ A;  3P7N A;  1IZ1 A;  1MJ9 A;  3LAP A;  4OMZ A;  1IF1 A;  1IN8 A;  1O7L A;  4L5I A;  5J6X A;  3K69 A;  1AOY A;  3LST A;  5ERI A;  3WG9 A;  3Q5F A;  3HHG A;  4AIJ A;  2H09 A;  3IRQ A;  4CZZ A;  3KP2 A;  5J8C A;  1W7P A;  1R1T A;  3MZH A;  5HLI A;  4EM2 A;  2IPQ X;  2EK5 A;  2G9W A;  2P5L C;  3DPT A;  1HBX G;  2CQK A;  4UVB A;  4CHU A;  1LB2 A;  4I7H A;  1ZGJ A;  3G3Z A;  2C6Y A;  3HIF A;  1T38 A;  3KP7 A;  2EV0 A;  3QU3 A;  2KJC A;  4PCQ A;  3EET A;  2UXX A;  1MDM A;  1HW1 A;  4KN4 X;  4U0V A;  1XD7 A;  2DO7 A;  4LG0 B;  1T2K A;  1W7P D;  5JFR A;  2EV6 A;  2XGX A;  4M72 A;  2NNY A;  1SFU A;  3ABU A;  4MTE A;  3F72 A;  2DQR A;  4EM0 B;  1T0F A;  2EFQ A;  2EA4 A;  1Z1D A;  1Z7U A;  1FYL A;  3E5Q A;  5LRS A;  3LQQ A;  2VOP A;  1OYW A;  2CFX A;  2GIV A;  3BJO A;  3QP6 A;  3FXR A;  3WGH A;  1HKS A;  4M9Z A;  3DPL C;  3IC7 A;  1Z05 A;  1BI0 A;  4UHT A;  1D8J A;  3FX3 A;  5E18 F;  4G7H F;  1JGS A;  3C1D A;  1QGP A;  4P9U A;  5LRR A;  3C3W A;  1FSE A;  5DD8 A;  4LFU A;  4XSZ F;  2KJB A;  2CG4 A;  5CYV A;  4YFK F;  4NQW A;  3HRT A;  3HRM A;  4M9S A;  1PP7 U;  4RGS A;  5D8L B;  3ML6 A;  5IT3 A;  3DFG A;  2XAS A;  1LQ1 A;  4EVI A;  2ETH A;  1G3Y A;  2NS0 A;  3VB2 A;  2MA3 A;  4KN7 X;  2K86 A;  1YYV A;  2XIG A;  1ZAR A;  1IRF A;  1HW5 A;  4U88 A;  5E1W A;  2ZO4 A;  1ZG5 A;  3C18 A;  4U0W A;  4HX8 A;  4L18 B;  2RDP A;  3HSR A;  4RGX A;  1Z9C A;  4NHJ A;  1GXQ A;  3C7J A;  2V6C A;  4UVA A;  1WQ2 A;  4WWC A;  3KET A;  5AIQ A;  2VT2 A;  2GA1 A;  2P7V B;  2HQN A;  2FNP A;  1FBQ A;  1T98 A;  1S29 A;  3L2C A;  2DI3 A;  3DV8 A;  5K5Q A;  3WTZ A;  2V1D A;  1U8R A;  2DFI A;  2QBY A;  4CXF A;  4KUM A;  1IN7 A;  2GAU A;  4XSX F;  3NEU A;  3QRF F;  3FXQ A;  2BBY A;  2JTV A;  4ZZL A;  2XAG A;  2HZT A;  4RGU A;  3HTU A;  1XSX A;  5BPD A;  3IWZ A;  2GXB A;  4IHT A;  4OIQ F;  3VEP A;  2WWY A;  4ENJ A;  2PJP A;  2VT3 A;  3FMR A;  4MQV A;  1V4R A;  4L9T A;  5KVR A;  2HOE A;  5ILS A;  5BS6 A;  1WI9 A;  2IP2 A;  3E6D A;  1SMY F;  5H6R A;  3F8N A;  1XSD A;  1R00 A;  2QEN A;  4CGZ A;  5FD5 A;  3ZP5 A;  3GFI A;  4FX0 A;  5D5W B;  2DAO A;  2MBF A;  2DPU A;  1B6A A;  3QPH A;  2F2E A;  3ISP A;  3KEQ A;  4FX4 A;  4MEY F;  1IRG A;  3E3V A;  2ZME B;  4EM1 A;  5E1Z B;  1XGN A;  2BGC A;  1O3Q A;  3GFJ A;  3PQK A;  3S2W A;  1FYM A;  2WTE A;  4EJT A;  3ZMV A;  5D6E A;  5LGT A;  3RKW A;  4G7O F;  5DUI A;  4YG2 F;  3RDI A;  4P5O A;  2DU9 A;  4HQM A;  2L4M A;  3K9T A;  3FMQ A;  3V7C A;  5JI6 A;  1KU7 A;  2UXN A;  2NAZ A;  3ECO A;  1XGM A;  2LF7 A;  4BXU A;  1FY7 A;  3LFK A;  2W24 A;  2Y75 A;  1F1Z A;  5E8G A;  2HFH A;  3ZMU A;  2MLK A;  2OU2 A;  2OZU A;  2QLZ A;  4YFX F;  1A04 A;  2XAF A;  3G73 A;  1ON2 A;  5HDK A;  4N9H A;  3QOP A;  5FFX A;  4IJA A;  1QZZ A;  2VE8 A;  2A07 F;  5H6Q A;  1R1U A;  5LGU A;  4BHB A;  2A6H F;  5H20 A;  2Y0M A;  3TDU C;  4FT8 A;  1F4K A;  2YX7 A;  4PDK A;  3V8J A;  5HVQ C;  4BH9 A;  3GO5 A;  3HTS B;  1YFH A;  3KP6 A;  4DNC A;  2IA0 A;  2HYG D;  2FOK A;  5LLQ A;  1U5T B;  3W6J B;  3H92 A;  4I02 A;  3D5L A;  2M30 A;  4YFN F;  2MLG A;  5E17 F;  1IUY A;  1KGS A;  1G3W A;  3E5U A;  2RKH A;  4Q47 A;  3F21 A;  1UHW A;  3I58 A;  2EFO A;  1BIA A;  1DDN A;  4N9I A;  2IRF G;  5F1R A;  1KQ9 A;  4HF2 A;  4AIH A;  5FD6 A;  3H3Z A;  5D4R A;  3HSE A;  2VOD A;  5LHG A;  4HV5 A;  3F8F A;  1STZ A;  1HW2 A;  2W85 A;  1IN6 A;  1HSJ A;  5D5U B;  3ZQ7 A;  3IKV A;  2CO5 A;  4QWQ A;  1SD4 A;  3TO9 A;  5LGN A;  1UCR A;  4U7D A;  4MTD A;  4EMS A;  4KMU X;  3RYP A;  4U7B A;  2XVC A;  1TQP A;  1S3J A;  1IAW A;  2VBW A;  2OQG A;  3Q9S A;  2PG4 A;  4L0Z B;  3T0Y A;  4TV7 A;  3MEX A;  4F7Z A;  1RI7 A;  2E7W A;  2HGC A;  2DW4 A;  2R7D A;  2XAQ A;  4BHP A;  4OIN F;  4PGH A;  2O61 A;  4ZYH A;  2DTR A;  4LJZ F;  2ZJ2 A;  1QNT A;  1FZP B;  3HYI A;  4RB1 A;  4MNU A;  2J5P A;  2GXG A;  4MGR A;  4ESF A;  2DK5 A;  3E5X A;  3QU6 A;  3CUO A;  2PEX A;  2XKP A;  4MHG A;  5CJ9 A;  3KFW X;  5CVJ A;  1RZ4 A;  3F8B A;  2CGP A;  1LDD A;  4Y15 A;  1X3U A;  2H27 A;  3HOS A;  1R5H A;  2W84 A;  4M9X A;  4IHS A;  2L02 A;  3TO7 A;  2LKP A;  5ILV A;  2FQ3 A;  4M6X A;  5AON A;  4BYY A;  3D0S A;  1Z91 A;  3TKY A;  1BI2 A;  1DP7 P;  5L3B A;  4L0Y B;  1OYY A;  5K1Y A;  5HS8 A;  1PUE E;  1B4A A;  3R0A A;  3DKW A;  3BDD A;  4GCV A;  4FHT A;  3P9I A;  3B73 A;  3PFI A;  5HS9 A;  1G6N A;  4YIF A;  1T39 A;  2Z33 A;  2OQR A;  3KLO A;  3HSF A;  2Q8K A;  2GZW A;  3E97 A;  4GXO A;  3GXO A;  3ABT A;  2EFW A;  1HKQ A;  4UXN A;  5FFZ A;  5FO5 A;  5CVR A;  3E6B A;  1K6O A;  2NNN A;  3ZMZ A;  4M74 A;  1K78 A;  2CYY A;  4IPA A;  1D8K A;  3J81 K;  5E8I A;  2D1H A;  4M71 A;  2HWV A;  4LB5 A;  5EEH A;  2O3F A;  2FXA A;  5LBQ A;  1KQ8 A;  3GFM A;  2ZBK A;  5CVU A;  4IRH A;  3HHH A;  1REP C;  2L4A A;  3SXY A;  2O0Y A;  3MCZ A;  1BI1 A;  2IJL A;  2HEO A;  3MFK A;  4P96 A;  5DUK A;  2HDC A;  3B02 A;  1U6G A;  5DCM B;  1E17 A;  2IA1 A;  1J9I A;  2FBH A;  1WKM A;  2EFN A;  2XHK A;  5L3E A;  4LD5 A;  1PP8 F;  3QP5 A;  4AVP A;  4HDU A;  3V7R A;  2R7F A;  2L54 A;  3SZT A;  2HYF A;  2KIU A;  1L0O C;  3FM5 A;  4GO1 A;  1O3R A;  1UFM A;  1XN7 A;  2EA2 A;  1XCV A;  3RJP A;  1P4A A;  4EGZ A;  1U3E M;  5DCF A;  3CO7 C;  1O3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...