2PJPA

Structure of the mrna-binding domain of elongation factor selb from e.coli in complex with secis rna
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
121
structure length
121
Chain Sequence
FSEEQQAIWQKAEPLFGDEPWWVRDLAKETGTDEQAMRLTLRQAAQQGIITAIVKDRYYRNDRIVEFANMIRDLDQECGSTCAADFRDRLGVGRKLAIQILEYFDRIGFTRRRGNDHLLRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insight into a molecular switch in tandem winged-helix motifs from elongation factor SelB.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Translation/rna
molecule keywords SECIS RNA
total genus 44
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2007-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09107 SelB-wing_3 Elongation factor SelB, winged helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2pjpA02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2pjpA01
1FYKA 1B9NA 2BE5F 2QQBA 4BHPA 5CVUA 1S29A 4KIBA 3O2PE 4HX7A 2J5PA 2EV5A 2K4JA 4MGRA 3IRRA 2ISZA 1JXSA 5LGUA 5HDGA 3HYIA 4HV6A 3I5UA 4CZZA 3K69A 2UXXA 1TBXA 2CO5A 1LDKB 2FE3A 1ZYRF 4IPAA 2A3SA 1KYWA 3IWZA 4KNYA 1P4XA 2TDXA 3GF2A 4WXHA 1Y0UA 2V1UA 2WV0A 5DCFA 4H0EA 1WQ2A 2Q0OA 1G3TA 1DP7P 2ELHA 1A04A 4UVAA 3DV8A 1B59A 2FMYA 4U0YA 4FX4A 1J9IA 3V8LA 3IL2A 1FNNA 4S05A 1S7AA 3ROUA 3MZYA 4A5MA 3GFIA 4ETSA 2H6CA 1ZARA 2GIVA 2A61A 1IUYA 3DF8A 3EETA 3I0TA 4MEXF 1YW8A 4HOBA 1BOAA 2O8XA 4FT8A 1XGNA 2QWWA 3GZ5A 1YFHA 1G6NA 4BAYA 1J59A 2A07F 2X0LA 3J80K 2FNPA 3ZMUA 5LEKA 1K7AA 3GX4X 3CUQB 1ON1A 3LAJA 3O3KA 2PFBA 4U7BA 1UHWA 2QQAA 2A69F 1HW2A 1QZYA 2M87A 3IKTA 4MTEA 2A68F 4I2OA 4MHGA 1QBJA 3LA7A 5CVJA 1P6RA 1MZBA 4Q48A 1R1TA 3P7NA 2CWEA 4ENNA 1OR7A 3DEUA 2AS5F 3HOSA 2STTA 1DPUA 4JQFA 3M9AA 1T98A 4M72A 4IXAA 3ABTA 3TO6A 3MQ0A 3OV8A 3FF5A 2O6GE 5DUIA 3KEOA 2CSOA 1O3QA 1T39A 2NAZA 5DCMB 3SHFA 4OIQF 1WI9A 2EB7A 1GXQA 3L9FA 4A2UA 4ENJA 4Q5SF 1BN5A 1I1GA 2GXGA 3F72A 3L00A 1PP7U 3KP6A 5LHGA 2NNYA 1HBXG 3W6KB 4G7HF 4L9VA 4KA4A 4OMYA 3GZ6A 5D6FA 3E6MA 3HRSA 4U0VA 2KIMA 4E70A 1ZG5A 1BBYA 2MC3A 5FD6A 5CVVA 3F3XA 3SQNA 4D0PA 3E3VA 1X3UA 3I59B 5E20A 4O6JA 1H0MA 2FBHA 4CGZA 3W6JB 5F1RA 2QVOA 2MH2A 4BHBA 1YYVA 3MZHA 2MLKA 4WK8F 3WTUC 2EA4A 5IT3A 1FY7A 5H6RA 3RI4A 3MFKA 2HWVA 2FU4A 5D8LB 2DQRA 4RB2C 2EFWA 1FBUA 3LAPA 4CO8A 2K4BA 4RB3C 5TJJA 5AIQA 4HDUA 1GXPA 5HOOA 5D5VB 5E17F 1FZPB 1E2XA 1MJ9A 1YLFA 1LDDA 4AIKA 5ERIA 5JR3A 1TQIA 3QU3A 3S2WA 1IZ1A 2DLLA 2EV0A 2JT1A 3F6OA 3RYPA 3ZN0A 1R58A 3EYIA 3IC7A 1XSVA 3V8JA 1T0FA 5L3EA 2VN2A 4MQ9F 3LFKA 2RV8A 3NQOA 1FT9A 4LMYA 2BEOA 3BWGA 4M9ZA 3FX3A 5LLQA 2NS0A 3KLNA 4XLPF 2KIUA 2QZ8A 4EQQA 5E1ZB 4L9JA 4RAYA 1R5GA 4G9YA 1LEAA 5ICEA 3ERED 3BJAA 2IP2A 2K02A 3D0SA 5JHUA 4ESJA 1I27A 1B9MA 3O6BB 2MH9A 5JFRA 2VT3A 4DQ2A 1ZG1A 2RC4A 2EFOA 2V9VA 1ZRCA 4ESBA 4RGUA 2IA1A 2QYOA 2VBZA 4HDVA 2QBYB 2VE9A 4I0AA 2VC1A 1KU9A 1SMYF 4AVPA 1Z05A 3WU1B 1U6GA 4LFUA 4HQEA 2HQNA 3NEUA 2HQRA 2ESHA 4RGXA 3TOAA 3G73A 2WC2A 2FNAA 4PGGA 3WGIA 4LG0A 1CF7B 3N4MA 4L0YB 3CO6C 2VODA 1W7PA 2F5DA 2K7LA 3WTTC 4L9TA 1FOKA 1GVJA 4YIFA 1FWZA 3I54A 3RDIA 1ZAOA 1SFUA 4ENMA 1Z91A 1SAXA 3FM5A 1ZN2A 2RN7A 2XAGA 1IW7F 4OU0A 1V4RA 2VOOA 2RVCA 1TQMA 1PUEE 1SD7A 5FFZA 4WWCA 2YSRA 4EV0A 2IPQX 1G3YA 2GQQA 2CYYA 2YPRA 1YO5C 1DPRA 2DT5A 1P2FA 3FMSA 3LSTA 5CYVA 3K2ZA 4A6DA 1U8RA 1T38A 4XLNF 3P9CA 4M74A 4HV5A 4QWQA 4I09A 2GXBA 1BIBA 3R61A 1BI2A 3GFLA 3RJPA 2F2EA 3B73A 4YFKF 2NRAC 4G7ZF 2EFPA 1BI0A 1LB2A 1LJ9A 3CTAA 1GHCA 4IRGA 3WE2A 2EV6A 4KFCA 2QLZA 2GA1A 5DCMA 4EMSA 3QOPA 4CICA 4BXUA 4UV8A 3KEQA 4KN4X 3VOEA 2K27A 4P96A 4ON0A 4PZJA 3REOA 4EM0B 2ZMEA 1UCRA 4ASNA 3RKWA 3D5LA 4HX4A 1QNTA 4ZYDA 4YFXF 3KP2A 1R23A 2DTRA 3LQQA 3F23A 3RPUA 1LQ1A 2BBYA 4MQVA 5F6FA 3KP7A 4ENKA 3MEXA 2EWNA 1IXSB 2HDCA 4ESFA 2DW4A 3I4PA 2MLGA 2H27A 4UXNA 4WCGA 1ZLJA 2DPDA 2V79A 2XAFA 2JTVA 2W85A 1EH8A 1BI3A 3Q9VA 1V3FA 2L3DA 1Z6RA 2GWRA 3L2CA 1C0WA 5ED4A 2Y75A 3WODF 2HKXA 4Z2YA 1F5TA 3R0JA 1S6LA 2O03A 3BPVA 2BGCA 1J2XA 1ZG3A 2FRHA 1MDMB 4Y13A 1FPQA 2HGCA 5DUKA 1JHFA 1R1VA 3HRTA 1IRFA 2VXZA 1U3EM 5ILSA 1FP1D 3MWMA 2VONA 3KFWX 3JAMZ 3WTSC 1FX7A 3MAJA 2Q8KA 1FBQA 4ZYGA 4LK0F 5FFXA 4GO1A 3TKYA 2IA0A 1J5YA 4G94A 2AXLA 1IN5A 1IXCA 3P9KA 1SMTA 1IRGA 2BYVE 6PAXA 4QLCU 3FZVA 4OIOF 2P6TA 2XAJA 3CUOA 3FHZA 4UNOA 3BY6A 3FXRA 1B1BA 1BI1A 2MBFA 3WGGA 4B8XA 2W57A 2VE8A 3KCCA 1XCBA 3L7WA 4YG2F 5CVRA 1OMIA 4R8HA 1IF1A 5HLHA 2QUFA 2QENA 2RDPA 4AWXB 2EFNA 2MD5A 2V1DA 1OYWA 3F8NA 1PDNC 2A5YB 5ICCA 1HQCA 1HKQA 2FA5A 1IN6A 2HR3A 1KQ0A 3J80Z 1S7OA 4LB6B 3M8EA 3COAC 5L3CA 2QM3A 5ILVA 2ETHA 3TDUC 3E5QA 4IRHA 3DXJF 3ZQ7A 3WTXC 5HS9A 1EH7A 1QO0D 4LK1F 4PCQA 3DKWA 4HLYA 1IN8A 5D5UB 1XSDA 1H9GA 5LBQA 4G8XA 2ISYA 4JK1X 1L3LA 3E5XA 1R36A 4Y15A 3GO5A 5L3BA 2V6CA 3H3UA 2GAUA 2W25A 1AWCA 5BOXA 4Q4ZF 1D5VA 2RQPA 1STZA 1ODDA 2OZUA 1VTNC 1FC3A 2ZNYA 1RUOA 4N0BA 1MJBA 2KRFA 4LGWA 3QU6A 1W4MA 1XGSA 2L01A 1JHHA 4NQWA 3BPXA 1RI7A 2LSOA 3QP5A 4KN7X 4PDKA 4NB5A 4HW0A 2CFXA 3C7JA 3WGHA 5K5OA 4IVNA 2KIFA 2O0YA 1KGSA 3R60A 2LKPA 4DNCA 3GW2A 3NRVA 3KLOA 3GFJA 1KA8A 2K86A 5E1WA 4P55A 3ML6A 3F8FA 3KP3A 4MNUA 1P4AA 2CGPA 4Y17A 4WXDA 4OIRF 1J7KA 2CG4A 2C6YA 3KE2A 4XSZF 1MJAA 4M6YA 4LLLA 1BJAA 4KIGA 3N97A 3BZ6A 1XN7A 1KU2A 2Q2EA 3LA3A 4MEYF 3JSOA 4FX0A 1TNSA 4ZZDA 4KIFA 5AIPA 3ZMSA 1P92A 1RIOH 4ZH4F 2D1HA 1MKMA 1FP2A 3ZMVA 5LGTA 4OOIA 4KYWA 2GA2A 4JBAA 4A0YA 1HKSA 1D8JA 3QAHA 1ZRFA 2H94A 3M7GA 2ZXJA 4A12A 2P5VA 4G7OF 5D4RA 1BC8C 4UVCA 4AIHA 3EYYA 1FSHA 2VOPA 1MGTA 1XMKA 1K78A 4U0WA 1TQPA 4F7ZA 4G6QA 1O3TA 2UXNA 4WXCA 2DK5A 2ESNA 1ZHFA 2LNBA 4ZYEA 1LDJA 1SD6A 4I0BA 4HF1A 1ONVA 1XDUA 2HTJA 1KU3A 2PBIA 3I59A 1ZGAA 3F6VA 2DFIA 1RZ4A 3QPTA 2XVCA 5K5RA 4LJZF 4RAZA 2Y0MA 3IRQA 2W24A 2IVMA 5L3DA 1HXDA 1TW2A 4LB5A 4BYYA 2JZYA 4RGRA 2DAOA 4IHTA 3ZN1A 1SFEA 4EGYA 4NHJA 1UB9A 2OU2A 3PQKA 2JPBA 4BHCA 1HSJA 3M1EA 4S04A 2EK5A 2P5KA 1FYLA 1I1SA 2HFHA 4I98B 3AAFA 1RNLA 5DEQA 5A2QZ 1LVAA 1ON2A 3B02A 5ILUA 2ZO4A 3C18A 4LG0B 3HHGA 3PFIA 4KUMA 1W7PB 3HIFA 3KZZA 2XHKA 3OOPA 4GXOA 2ZCWA 3VEPA 4R79A 5FGMA 4LLNA 5HVQC 1HW1A 2R7FA 4IF4A 3RYRA 5D5WB 4OMZA 5L3FA 2IA2A 1YQAA 3C3WA 3V7SA 2IRFG 2M30A 3WE3A 4UV9A 4GGGA 1WKMA 5BMZA 3R0AA 2E1NA 1USSA 3TO7A 5TRDA 2MA3A 1R7JA 1IN4A 1OKRA 2PI0A 3JSPA 2L54A 1O57A 4RGSA 3CUQC 2YX4A 1Q1HA 4L5IA 5KK1A 1U2WA 2FOKA 5LHIA 2A6EF 2HYFA 2ZBKA 3FM3A 4U7DA 2D45A 2UZKA 3J81Z 1Z9CA 2Y48A 4N9IA 3HUGA 2COMA 4KICA 1YW9A 3GFMA 5ICFA 1YS6A 5D8KB 5BS6A 1F4KA 1PP8F 1FYMA 1ULYA 4L18B 1ZREA 3LWFA 5E18F 5IT9Z 1WSUA 4EJWA 1P4WA 4RB0A 4BNCA 3I53A 2CW0F 1BM9A 2JRTA 4N9HA 3PQJA 1EH6A 4A6EA 5K5QA 4L0ZB 3I58A 1D3YA 3SZTA 4CDGA 3SZPA 4KDPA 2O3FA 3GWZA 4HAMA 5IT9K 1TTYA 2PN6A 4GCVA 5FLXK 3CLOA 4XSXF 4KT5C 1R00A 2L02A 1XCVA 1Z1DA 2FBKA 3T8RA 2RGVA 3EQLF 2IT0A 2UWMA 2QBYA 4IJAA 2XRNA 3CJNA 5E1XA 4B09A 3GYHX 3U2RA 1CF7A 1XGMA 1UHMA 5J8FA 2KKOA 5EEHA 1E17A 2OQGA 1OYIA 3ZMDA 2XV4S 1TW3A 1U5TB 3F8BA 4ZZLA 3RIRA 3VB2A 1G3SA 3R6SA 3J7AO 3ELKA 3DP7A 5FB2A 4XRFA 4HF0A 1DUXC 2OQRA 2P4WA 1FBSA 1Z7UA 3V7RA 3HTSB 1L0OC 5EEGA 2FSWA 3I71A 3WG9A 1I6XA 3DQVC 1U78A 2FF4A 1BIAA 2HZTA 2LF7A 2XAQA 3T1BA 1O7FA 4LLGF 4I02A 5JI6A 1SD5A 1QPMA 5L3GA 1CGPA 2A6HF 3BROA 1TLHB 3TDZC 1XDSA 3V8KA 4FHTA 3ZMZA 5J6XA 2HEOA 2P7CB 3WTWC 4M73A 4IRIA 2F5EA 2Z99A 5FD5A 3IKVA 4UVBA 3CUQA 3RKXA 3SXYA 1ZH5A 4UUVA 1SD4A 4L5JA 4HLXA 2FXAA 2PMHA 3GXOA 3KETA 1Z6TA 1IXRC 1USTA 4A0ZA 3WTZA 4CXFA 5LEJA 1WWXA 3R4KA 4A0XA 2XGXA 2OZ6A 2Z3YA 2PLYA 3HRUA 3JW4A 5J8CA 3JAMK 2XKPA 4EJVA 4AIJA 3FXUA 4HA8A 2XAHA 3KP4A 5CLSA 2M8EA 4U88A 3MCZA 2OA4A 4O3MA 2M45A 1K78B 4OIPF 3CO7C 1S8NA 2DO7A 2HTSA 1OYYA 2QQ9A 2PJPA 3BJOA 1ZGJA 2ZJ2A 3E5UA 2HOEA 3GLXA 4O5VA 5HLGA 3V4GA 4HYEA 4HZFA 2L4AA 2M1BA 2GZWA 2CQKA 2G7UA 3H3ZA 3U9GA 3DPLC 3U1DA 2OD5A 3RTRA 1W5TA 2XROA 1I5ZA 4HQMA 4YIIA 2W84A 1U5TA 2YX7A 1YW7A 1H9TA 2DQLA 3HSFA 4KMUX 1BC7C 5DV5A 2BV6A 1HKTA 4LD5A 1WRJA 2ZMEB 5BPDA 2DU9A 3J81K 1G4DA 3SFZA 5A2QK 4CHUA 3K0LA 3BJ6A 1HSTA 5HS7A 2VBWA 2D1VA 1K6OA 3P9IA 3K1NA 2YU3A 3BDDA 2ZKZA 3VODA 4RS8A 3HHHA 4IHSA 2XUBA 5D5XB 2Z5UA 4P9UA 2FBIA 5LRRA 2LF8A 1HW5A 2P8TA 2M5WA 1OPCA 2ZFWA 3ZP5A 1YIOA 2DPUA 1K79A 3TGNA 1J0RA 5ICGA 5HDNA 5DYMA 2EA2A 4K2EA 4M9SA 3WTVC 2NNNA 3ECHA 3M8FA 1D8KA 1JGSA 1S3JA 3FMRA 1XB4A 3HSEA 3Q5FA 3FMQA 2IW5A 2P7VB 3ECOA 2WTEA 2KJCA 3BP8A 2E7WA 4M9XA 1R5HA 3HTUA 1MD0A 2B0LA 3K9TA 1MDMA 1YTYA 3HSRA 3HOTA 5H6QA 3KZYA 4M71A 2LDUA 1O3RA 1KYZA 4G6DA 5AONA 1QGPA 2VC0A 1IAWA 1EV7A 2D2WA 3HRMA 1LNWA 2XIGA 1R1UA 5KVRA 2PEXA 3TQNA 1FSEA 3F21A 5JVTA 4EM2A 2OAZA 2HKOA 2FQ3A 3IHUA 3E6CC 3LA2A 3T0YA 4XBFA 3F8CA 1UFMA 3GEZA 2R3SA 4EGZA 2RNJA 4KMFA 1REPC 5CVIA 3QPHA 1TNTA 2STWA 2F5CA 5D4SA 3BOQA 3ISPA 2KJBA 2H6BA 2PG4A 1YS7A 3H92A 4EJTA 3JTGA 4RB1A 2F5FA 1U5TC 2DBBA 2XKOA 5LHHA 2HS5A 4Q47A 1O3SA 4ZYHA 5DDGA 4P5OA 2L4MA 1W5SA 5HLIA 1AOYA 2X4HA 4YFNF 2EFQA 5HDKA 5LGNA 2Z33A 1NHAA 3V7CA 1SFXA 4I01A 3L09A 2VT2A 3I64A 2J5OA 2V1XA 4BQAA 2JPCA 2H09A 4HBLA 3TO9A 1LEBA 2PMUA 3E6DA 2XASA 1F1ZA 2EJRA 2YR2A 2R7DA 5FLXZ 4I7HA 1YG2A 2IJLA 5LRSA 2HYGD 5BQTA 1R22A 4UHTA 2RKHA 3ZPLA 2E7XA 3JTHA 1T6SA 1G3WA 5E8GA 1ZLKA 4MTDA 4P9FA 3T8TA 3FWEA 4L9NA 5H20A 4AD9A 3LQRA 1IN7A 4R1HA 4WF2A 3EDPA 3RKYA 1J75A 2ADUA 3K1MA 1RUNA 3K1PA 3WTYC 4GYIA 2DK8A 5CJ9A 3DFGA 3FXQA 2O61A 5D6EA 1JE8A 1XGOA 3KP5A 2NYXA 1T2KA 5DD4A 3CDHA 3QP6A 2P6SA 3RPQA 1QQIA 3VFZA 5DD8A 2Z9OA 2ACJA 1B4AA 1W7PD 3ABUA 4EM1A 4PGHA 3E6BA 4TV7A 5E8IA 1QZZA 5K1YA 3TOBA 3C1DA 2PQ8A 5BPIA 2P5LC 1XD7A 3ZMTA 2OBPA 1XSXA 1KQ8A 1B6AA 1XMAA 2FMLA 3DPTA 5FO5A 3G3ZA 4CYDA 3GVAA 3WU0A 4BH9A 1DDNA 3GUDA 3ULQB 3E97A 4EVIA 4A5NA 5F64A 2WWYA 2JSCA 4M6XA 2VBXA 5HS8A 3QRFF 2VBYA 1KU7A 1FLIA 2DI3A 2G7HA 2FEZA 2G9WA 2ZNZA 4HX8A 3Q9SA 4EJOA 4HF2A 1O7LA 1ZRDA 3T5XA 3F8MA 3IWFA 4WX9A 1KQ9A 2E1CA 1F9NA 3EUHA 4EJUA 3F22A 4OINF 4GYGA
chains in the Genus database with same CATH superfamily
5B3SH 1FYKA 2F4IA 3MKLA 1B9NA 2HPIA 2BE5F 2QQBA 2HDDA 4BHPA 5CVUA 4A3MJ 1S29A 1UJ8A 5E79C 4KIBA 1I3QJ 2K9NA 3O2PE 4HX7A 2ME0A 2J5PA 2EV5A 4CCJA 2K4JA 1T33A 2H8WA 4HPQA 1Z77A 1V55H 2QKMB 4CCLA 4MGRA 3BQZA 3IRRA 2ISZA 1JXSA 5IYCJ 3QWLA 4OAYA 5LGUA 2VJIA 5HDGA 3HYIA 4HV6A 3I5UA 3CJQB 2Z16A 4CZZA 3OYJA 1RKWA 2JA6J 3K69A 2UXXA 2VKHA 2DDAA 3MD2A 1X3WB 2BY2A 1TBXA 2CO5A 1LDKB 1APLC 2FE3A 1DP3A 1ZYRF 4IPAA 2A3SA 3OYKA 1KYWA 1WJDA 2OF7A 3IWZA 4KNYA 1P4XA 2TDXA 4UB8C 3JRHA 3GF2A 2AQFA 4WXHA 1Y0UA 2HXOA 2V1UA 2WV0A 3JREA 3H5NA 5DCFA 4H0EA 1WQ2A 2Q0OA 2Y9YA 1ETWA 3VYTB 3A01B 2FX0A 1G3TA 1DP7P 1MNMC 2DJIA 2ELHA 1A04A 3FKJA 1NK2P 4UVAA 3DV8A 1B59A 2FMYA 4XOTA 1Y0NA 4U0YA 4FX4A 4FCYA 1J9IA 3L2VA 3V8LA 3IL2A 1FNNA 3HPGA 4S05A 2F5VA 1F36A 1S7AA 2CQQA 4B1RA 3LSRA 2EZKA 5J1UA 3ROUA 2K9QA 3BTJA 3FXJA 3MZYA 3Q0UA 3ZQQA 4A5MA 5H2FC 3CCJI 2OTLI 1FEXA 4XKCA 3QQAA 3GFIA 5E3MA 1HA8A 2W4SA 2X9DA 4ETSA 1ZARA 2H6CA 2GIVA 4PJMA 5FKMA 2A61A 1IUYA 2AHQA 3DF8A 5IP9J 3EETA 2RQQA 3I0TA 4MEXF 1YW8A 2LFBA 4HOBA 1BJZA 1BOAA 1VQ9I 2DA1A 2ZFUA 2O8XA 4FT8A 1XGNA 4A3DJ 2QWWA 2K40A 1X58A 1RR7A 2HNHA 3GZ5A 1YFHA 2E60A 3K4KA 1G6NA 4BAYA 1J59A 2A07F 2X0LA 3Q3SA 3J80K 3BTIA 3LMMA 1OCPA 2FNPA 3ZMUA 3GTLJ 1S5LC 3S93A 5LEKA 1I50J 3K7AJ 3LSIA 5HLTA 5GPCA 1K7AA 1WJ5A 4XORA 1T56A 3GX4X 3CUQB 1WJBA 1ON1A 1OFCX 4QIWN 3LAJA 3O3KA 1YITI 2PFBA 4U7BA 1UHWA 1E3PA 2QQAA 4A3KJ 3C2BA 2X6YA 2A69F 1HW2A 1OJLA 1ITYA 1FOYA 2RNGA 1UMQA 2O8KA 1QZYA 2M87A 3IKTA 2KDOA 4MTEA 4C9YA 2JA5J 2A68F 1MSEC 2HOTA 4I2OA 4MHGA 1QBJA 3LA7A 1MIJA 3O8GA 5HNFA 4IZZA 1W36C 5CVJA 2ZMEC 4IHYA 1P6RA 1X1DA 1MZBA 4Q48A 1W5CC 1IJWC 1R1TA 2M7AA 3OY9A 2PMZA 3P7NA 1VI0A 4X0GA 2IAIA 2CWEA 4ENNA 2DXIA 1OR7A 3DEUA 2AS5F 3BR5A 3HOSA 3GTJJ 3SEZA 2STTA 1WH5A 1HC8A 1DPUA 3RKQA 1ZK8A 2DA4A 3NARA 2IS2A 2JA7J 2E5ZA 4JQFA 3IP4B 3M9AA 2VPRA 2LBFB 1T98A 2VASA 2ZJPF 4M72A 3CDIA 2KP6A 4XLFA 1AU7A 1YJNI 1H89C 3E1SA 3K6GA 2GOMA 4IXAA 3ABTA 4E7KA 3TO6A 3DTEA 3MQ0A 2DMUA 3RCOA 4ITVA 3PJRA 3OV8A 3FXMA 2JJ7A 2XGEA 3FF5A 1BR4A 5DUIA 2O6GE 1Z3YA 1VQOI 2R5YB 4M6VA 3KEOA 2CSOA 1O3QA 2WBMA 3PSFA 1T39A 2NAZA 5DCMB 3SHFA 3PO2J 1D1CA 4OIQF 1WI9A 1MNDA 2EB7A 4XKWA 2LC2A 1GXQA 3L9FA 2BVLA 4A2UA 5KHDA 1X4OA 3JRFA 4ENJA 2QA4I 3UKGA 4Q5SF 1BN5A 1I1GA 1XX5A 2GOXB 1WCMJ 2GXGA 5TGTA 3F72A 1X1BA 3L00A 1V5EA 1PP7U 3KP6A 5LHGA 3TBIA 2VL8A 2AQEA 2NNYA 5DM7F 1HBXG 2VXDA 3W6KB 4HRIA 2DOEA 4AYBN 1GDTA 4G7HF 1YOVB 1LFPA 4NBQA 2XF7A 4L9VA 2FD5A 5E3OA 4KA4A 2V6EA 4OMYA 3I4NJ 4FTHA 3GLLA 3GZ6A 3H9JA 3IH4A 5D6FA 3B6AA 3E6MA 3OYHA 2MD0A 2KPMA 3HRSA 4U0VA 3FIWA 2B9SA 2KIMA 4E70A 1ZG5A 3CCMI 1BBYA 1W1WE 2I8DA 2MC3A 5FD6A 5CVVA 4PJJA 3F3XA 2OC6A 3SQNA 4D0PA 3E3VA 1X3UA 3AG2H 3I59B 1Q1VA 5E20A 4O6JA 1LE8B 1H0MA 2JN6A 3HGYA 2HXIA 2FBHA 2HVRA 1NG6A 3M1CA 5CKTA 4CGZA 1EA3A 2DFFA 2RAEA 3OYMA 3W6JB 2M3AA 5F1RA 2QVOA 2LY1A 3IUOA 2CUJA 2MH2A 4BHBA 1YYVA 3MZHA 2MLKA 3MKWB 2EA4A 5IT3A 4WK8F 3WTUC 1FY7A 1WPKA 3BC8A 5H6RA 3RI4A 2H1KA 3MFKA 2HWVA 1X3ZB 2K5CA 2FU4A 3TMOA 5D8LB 2DQRA 2LY2A 3OS0A 4RB2C 2EFWA 1FBUA 3LAPA 4DIQA 4RM3A 4CO8A 4V2GA 2K4BA 4RB3C 2JQ7A 5TJJA 5AIQA 4HDUA 3CD6I 1Y8QB 2VJ5A 1GXPA 5HOOA 4DYRA 4C3IJ 5D5VB 2LVSA 5E17F 3BG9A 1FZPB 1KZHA 5CPRB 1E2XA 1MJ9A 4A3JJ 3DU5A 4ZJZA 1YLFA 3EUHC 4XRSG 1LDDA 3CCVI 4AIKA 5ERIA 4IEJA 5JR3A 1TQIA 3DPUA 3QU3A 2CU7A 4BL0B 3GZNB 3S2WA 1IZ1A 1QZEA 2DLLA 2EV0A 2JT1A 2CMPA 3FDYA 2LYCA 3F6OA 1A31A 5FLVA 4Z6YA 3RYPA 3ZN0A 1R58A 2PJRB 3EYIA 3IC7A 1N78A 3OYEA 1XSVA 2KMUA 4W97A 3V8JA 5F0FA 3AFHA 1T0FA 2W48A 5L3EA 2VN2A 3FXOA 3G1OA 1KONA 4MQ9F 3LFKA 2RV8A 3NQOA 3CCLI 1FT9A 4Y4RA 3BR6A 4LMYA 2BEOA 3BWGA 4C2MJ 4M9ZA 3FX3A 5LLQA 5EG0A 3X2QH 2NS0A 2DOFA 3KLNA 4XLPF 2KIUA 4BEHA 2QZ8A 4EQQA 5E1ZB 1OCOH 4HSRA 3UNGC 1IRXA 4A3FJ 4L9JA 4RAYA 1R5GA 4RA2A 4G9YA 4XN3A 1LEAA 1AA7A 4XKVA 1TT0A 5ICEA 2EILH 3ERED 1VQ8I 3VSLA 1P7IA 2K9LA 4UUTA 3IV5A 1RR8C 3BJAA 2X48A 2DA6A 2IP2A 2BHYA 2M2EA 2K02A 1VF9A 3H9QA 2VIXA 1QHHD 2GIZA 3D0SA 5JHUA 4ESJA 1I27A 4QPOA 3VPRA 1X1CA 2KZVA 2V9PA 3HM5A 1UHSA 1ETVA 1B9MA 3O6BB 1RETA 2WY8Q 3O8HA 2MH9A 5JFRA 2VT3A 4DQ2A 3PL8A 1JI8A 1ZG1A 2RC4A 2K9MA 3FBIB 1VFCA 1ETQA 2EFOA 2KIQA 2L7KA 2V9VA 2K9SA 2CUZA 1ZRCA 4P1WA 4ESBA 2VQLA 4RGUA 3CP2A 4UY8I 5DTDA 2IA1A 2QYOA 1GVDA 3QODA 2VBZA 4HDVA 1X2MA 2QBYB 5BNGA 3C2HA 2DODA 3RPUD 2VE9A 1PJRA 4I0AA 3ZQLA 2VC1A 1KU9A 3HDDA 1MBJA 1F43A 1SMYF 1Z05A 4AVPA 3WU1B 3OSGA 1U6GA 4LFUA 4HQEA 2DFHA 4KISA 2HQNA 4ZDLA 2R0QC 4IHWA 3HXLA 1XG1A 3B6CA 3NEUA 3ZQCA 2HQRA 3HC7A 1CQTA 4JYKA 2ESHA 4RGXA 1DGRM 3TOAA 5IYDJ 4BE2A 1ZKGA 4DZJA 3G73A 4ABZA 4BEHB 2WC2A 2FNAA 4PSWA 3CC2I 2KQRA 4PGGA 3WGIA 4LG0A 2COBA 1ETOA 2G0EA 1CF7B 3N4MA 2R7VA 4ZTFA 3K70C 2DMNA 3W6VA 3CO6C 4L0YB 2VODA 4BUPA 1W7PA 5DM6F 2F5DA 3ZCOA 1R6RA 2HI3A 2K7LA 3WTTC 4L9TA 3HOVJ 1FOKA 1GVJA 4YIFA 2E5NA 2DA5A 1H8AC 1FWZA 3I54A 3RDIA 1MMNA 1ZAOA 1SFUA 4ENMA 2DA7A 4PFOA 2XB5A 1Z91A 1SAXA 3FM5A 1FMWA 5J40A 4G6TB 1ZN2A 2JA2A 1EKEA 2RN7A 2XAGA 3EUAA 2LK2A 3H3VK 3S2DJ 3CZ6A 3OYDA 3ABKH 1IW7F 2CUEA 3D5RC 3CCSI 3JRGA 4M3BA 4OU0A 1V4RA 3DBLB 2VOOA 2E71A 2RVCA 1VQMI 4IOAF 1TQMA 4PSXA 2XGCA 4AM3A 1PUEE 1SD7A 2L9SA 5FFZA 4WWCA 2YSRA 4EV0A 5EYRA 2IPQX 1G3YA 4GFBA 2GQQA 3S1RJ 2CRGA 2CYYA 2ECBA 2YPRA 1YO5C 1A6IA 1DPRA 2DT5A 1P2FA 1T0FC 3FMSA 3LSTA 5CYVA 5B1AH 1K4TA 3K2ZA 3QPLA 3NAUA 4A6DA 1U8RA 2Y30A 1T38A 4XLNF 3S1MJ 1POGA 3P9CA 4M74A 2R4GA 2R93J 2ZC2A 4AYBA 4HV5A 4N4NB 4QWQA 4I09A 2GXBA 3ZQFA 2XSDC 1BIBA 3DKYA 2B7EA 3R61A 4KT6A 1YRNB 1BI2A 3GFLA 2BY0A 2IGMA 3RJPA 2F2EA 3B73A 2LY9A 4YFKF 5GTHC 3PNTA 2NRAC 4G7ZF 2XC7A 2EFPA 1BI0A 1ETKA 1LJ9A 3CTAA 1LB2A 4DJAA 1GHCA 4BY7J 2V9KA 4IRGA 1VQNI 3WE2A 1X4PA 5EGOB 4A3IJ 3VYRB 3UR3C 2HQ5A 3CMAI 2EV6A 2FOWA 2QLZA 4KFCA 2GA1A 1Z67A 5DCMA 2XPUA 4XLHA 1SVMA 4MO7A 2WADA 4EMSA 3QOPA 4GRIA 4CICA 1K4SA 3TW7A 4BXUA 4UV8A 3KEQA 4KN4X 4MLOA 3VOEA 3A03A 5FRMA 3S17J 2K27A 4P96A 2M4GA 1Z0XA 2VJJA 4MFEA 3ZGKA 4ON0A 4PZJA 5F04A 3HZJA 3REOA 3OIQA 3OIOA 4EM0B 2ZMEA 1UCRA 3IAS2 4ASNA 3RKWA 4BGDA 5J47A 3D5LA 3OYFA 2R5ZB 3BR2A 3RZDJ 3GCMA 4HX4A 1K83J 2WAFA 1QNTA 4QTRA 4ZYDA 4YFXF 1M1EB 2AXTC 3KP2A 4F52A 1R23A 5EZHA 1JUSA 2DTRA 3LQQA 1WJAA 3CCQI 3F23A 4B47A 3RPUA 1LQ1A 2BBYA 3KYDB 3U21A 4ZDOA 1LVKA 4MQVA 2X51A 3HOWJ 1R5ID 3HOXJ 5F6FA 3KP7A 4ENKA 3MEXA 2EWNA 4D5FA 1SEUA 3MKZA 5CQEA 4V19K 1IXSB 2HDCA 4ESFA 3SDGA 2DW4A 2VLAA 3I4PA 2XF6A 4E7LA 1EF4A 2MLGA 2H27A 1IO2A 1D0ZA 4UXNA 4WCGA 1ZLJA 2DPDA 2V79A 2XAFA 2JTVA 2W85A 1EH8A 5M5YJ 1BI3A 3Q9VA 1V3FA 4AC0A 1OCTC 3SFIA 3I9V2 1FIPA 3ZQIA 2L3DA 1Z6RA 3JRDA 2CV1A 1IC8A 1JKRC 2GWRA 5DS9A 3QYBA 3L2CA 1C0WA 2V1NA 5ED4A 2Y75A 3WODF 2HKXA 4Z2YA 1F5TA 3FK6A 1S6LA 3R0JA 4DYCA 2O03A 3BPVA 1Y39A 2BGCA 1J09A 1K6YA 4PJNA 5J1YA 1J2XA 1ZG3A 5C4XJ 2FRHA 1MDMB 5J4VA 3DLLF 4Y13A 4B43A 1UG0A 1FPQA 1HDPA 2LR8A 4I76A 2HGCA 2HVQA 1JUMA 3TP0A 5DUKA 1JHFA 1R1VA 3HRTA 1IRFA 2VXZA 1U3EM 2Z1DA 3BTCA 4FETA 5ILSA 5EGOA 4JOMA 2DN0A 1FP1D 2JVHA 3MWMA 4NNJA 2CW7A 1G8XA 1U0JA 1OR7C 5E3NA 1VQ4I 1MBEA 5KCMA 3L2WA 2VONA 3KFWX 4BJ5C 3JAMZ 2EBIA 4BDYA 3MZ8A 1FX7A 3WTSC 4II3A 4CCNA 2GBYA 3MAJA 2Q8KA 1FBQA 5B1BH 4ZYGA 4LK0F 1G59A 5FFXA 1B8IB 3SEQA 3PUBA 3KX2A 4GO1A 3EUKL 5LFAA 3OR2C 4KITB 3LNQA 3TKYA 2IA0A 1IG7A 3LSHA 1J5YA 2A5WA 2Y9ZA 2IGOA 1Z21A 4G94A 1P7JA 2AXLA 1ZR2A 2K3PA 1IN5A 1YJWI 1IXCA 4B3XA 3P9KA 3MKYB 1T8IA 1SMTA 1IRGA 4JX6A 2BYVE 4XMYA 6PAXA 2X85A 4D5CA 4QLCU 3FZVA 4E4HA 4OIOF 2P6TA 2LMDA 2XAJA 3CUOA 3FHZA 4XIDA 1BW6A 2FQ4A 4UNOA 3BY6A 3FXRA 3IH3A 1B1BA 1BI1A 2MBFA 3WGGA 4BU2A 4B8XA 4JX5A 2W57A 4M3DA 2VE8A 4NC7A 3KCCA 1XCBA 3CMEI 3OYBA 2W7NA 1PVEA 3L7WA 2KRCA 4YG2F 5CVRA 1OMIA 4R8HA 1BA5A 1OLTA 5TISC 3K4MA 1FIAA 4F93B 4YIRX 1IF1A 2XPVA 4RLFA 2W1OA 1VQ6I 5HLHA 3F0CA 1W0TA 4DYQA 4IX7A 2JUGA 4RM2A 4A3LJ 2QUFA 2LP0A 2QENA 2RDPA 4CCKA 3OYCA 3OMYA 2XPWA 3HG9A 3M07A 4HG2A 5M3FJ 4AWXB 2PX9A 2EFNA 3LSPA 2MD5A 3HBLA 2V1DA 1FTTA 1OYWA 5IP7J 3F8NA 1PDNC 2A5YB 5ICCA 1HQCA 1HKQA 3W2VA 3SZGA 2ZSHB 2FA5A 2DT7B 1IN6A 2HR3A 2VQCA 4H4KC 1KQ0A 3J80Z 1S7OA 3H36A 2KHMA 3M8EA 4LB6B 3COAC 5EDNA 5L3CA 2QM3A 5ILVA 1FJLA 2ETHA 3I56I 3TDUC 3E5QA 4IRHA 3DXJF 3ZQ7A 2QCOA 3WTXC 4CUGA 2LLKA 2VKVA 3CLQA 2R5YA 2ZXHA 5HS9A 1EH7A 1QO0D 2BW3A 4LK1F 4PCQA 4AIDA 3DKWA 3FBNB 4HNVA 2JMWA 4HLYA 3ZRGA 4BQNA 1IN8A 5D5UB 1XSDA 3S3NA 1H9GA 4XLEA 4OAZA 5LBQA 2VUMJ 1MH3A 4G8XA 2ISYA 4JK1X 4IOCF 2ELKA 1L3LA 1WHUA 2UV1A 3E5XA 1R36A 3CF2A 4Y15A 3FXLA 3GO5A 5L3BA 2OTJI 2IS4A 2V6CA 3H3UA 4RAFA 2GAUA 2W25A 1IUFA 4S0HB 1S72I 1AWCA 4X1EA 2OCCH 5BOXA 4Q4ZF 1HCRA 1D5VA 2RQPA 3H35A 1STZA 1ODDA 2KL4A 2OZUA 1VTNC 3H1CA 1FC3A 2ZNYA 1LKXA 3FXKA 1TT5B 3K10A 2MSYA 1RUOA 4N0BA 1R9TJ 1MJBA 2KRFA 4LGWA 3QU6A 1W4MA 2XDVA 3ZQHA 3A01A 2PJRA 1XGSA 2L01A 1JHHA 2ZXIA 1X2NA 4NQWA 4DW6A 5F0CA 4BDZA 3BPXA 1RI7A 2LSOA 3QP5A 4KN7X 4PDKA 1LUJB 3RSNA 4RMNA 5E3LA 1FTZA 3JRBA 4NB5A 5GADJ 3HOUJ 3PFYA 4HW0A 2CFXA 3C7JA 4IO9F 3TL4X 2BXZA 1D1BA 3WGHA 2R7RA 3I55I 4PJ0C 1NG7A 5K5OA 4IVNA 2KIFA 2O0YA 1KGSA 3R60A 2LKPA 4HEA2 4DNCA 3GW2A 1U9NA 2ELJA 3NRVA 4E6KG 3KLOA 4RBOA 2WA0A 1KA8A 3GFJA 3A4CA 1BW5A 2K86A 5E1WA 4AU7A 5F08A 1U8BA 1TWFJ 5F1JA 1RPWA 4P55A 2NVQJ 3ML6A 1UAAA 1G2HA 3W2AA 3F8FA 3KP3A 1O4XA 3HOYJ 4MNUA 1P4AA 3K4BA 2CGPA 2I5UA 4IQJA 1JTYA 4UB6C 5B66C 4Y17A 1RRJA 4WXDA 4OIRF 4BXXJ 1J7KA 5EEAA 2IS1A 2ZJRF 1IV8A 2CG4A 1N77A 2C6YA 1WJCA 2DT6A 5C44J 1ZELA 3KE2A 3BZKA 1MJAA 4M6YA 4XSZF 4LLLA 1UG2A 1BJAA 1ZTRA 4KIGA 5K7HA 3N97A 2QSGX 3BZ6A 1XN7A 2OCEA 1KU2A 3DCFA 1ETYA 4G12A 2LOOA 2Q2EA 2Y69H 1S7EA 3LA3A 3S15J 4XONA 2NOGA 4MEYF 2Y0SA 4J00A 5KNLA 3HKZA 5M5XJ 3JSOA 2ZXWH 3ZR8X 1DQUA 1V5FA 2RREA 2R5ZA 5B5EC 3BR3A 4FX0A 2W82A 1TNSA 4ZZDA 1TL8A 3IAM2 4KIFA 5AIPA 3ZMSA 1P92A 2EH3A 3VDXA 1E3OC 3AG3H 4XM3A 1RIOH 4A3EJ 4ZH4F 1DU6A 2TCTA 2D1HA 1MKMA 1YX5A 1FP2A 3ZMVA 5LGTA 2Y2ZA 2ID6A 4OOIA 4KYWA 1S9HA 2BY3A 2VI6A 3ASNH 4QSHA 3DBHB 3DBRB 2GA2A 5JHFA 2QSFX 5IYBJ 2Y0SN 4JBAA 4PJLA 3JRAA 4A0YA 1HKSA 3BG5A 3GBGA 4ZC3A 3FKIJ 2LTPA 1D8JA 2OJED 2CW8A 3QAHA 1VQ7I 1ZRFA 4XR6A 2H94A 3M7GA 2ZXJA 3DU6A 2HYJA 4A12A 2P5VA 4BBRJ 4G7OF 2XSJC 4ANJA 3PIPF 2M4KA 1VQLI 2WB1N 5D4RA 1BC8C 2MW8A 1ORKA 4W1UA 4BXFA 4CCOA 1ZR4A 2F4MB 3LFUA 3OL4A 5JVGF 1MH4A 2WAEA 3HPHA 1E3HA 3PSIA 1ACIA 4UVCA 4AIHA 1JKQC 3EYYA 1QVUA 2L9VA 2VJ4A 1FSHA 1SANA 1TWAJ 5CQGA 2VOPA 4XK4A 1MGTA 2MC4A 1OCRH 1XMKA 2X6WA 2L2OA 3H5AA 1YRNA 2ZJQF 1K78A 4U0WA 4Y7NJ 1JT6A 1TQPA 4F7ZA 3BG6A 1BR2A 5GAGJ 4G6QA 1O3TA 2UXNA 4WXCA 2OV7A 4IL6C 2DK5A 2ESNA 4IHXA 2B63J 5K7FA 1ZHFA 2LNBA 4ZYEA 1LDJA 3PO3J 3OWTA 4D7MA 1SD6A 2DA3A 3I3LA 4A3CJ 4I0BA 4HF1A 4DBQA 1ONVA 1XDUA 2HTJA 1KU3A 2PBIA 3I59A 1TWCJ 1ZGAA 3F6VA 3WHBA 2DFIA 1RZ4A 3QPTA 2XVCA 4D7NA 5IPAA 4LJZF 5K5RA 3GTKJ 4RAZA 2Y0MA 2CJJA 3OL3A 1PUFA 3IRQA 2MGQA 1R49A 2W24A 2IVMA 5L3DA 5M5WJ 1HXDA 1TW2A 4LB5A 1JGGA 4BYYA 2FUG2 2JZYA 4C2TA 2AO9A 4RGRA 2DAOA 4IHTA 3ZN1A 1VZ0A 3RQ4A 1SFEA 3S1QJ 4EGYA 2M7BA 3CF5F 1H88C 1A35A 4NHJA 1UB9A 2OU2A 3PQKA 2JPBA 1SVOA 3VSKA 3MVPA 1MMDA 1HSJA 3M1EA 4B3AA 4BHCA 3TEDA 3M4OJ 2L9RA 4S04A 1A5JA 2F4OB 2X6XA 4M3EA 2EK5A 2P5KA 2YS9A 1FYLA 1VQKI 1I1SA 2HFHA 4I98B 4BE1A 2E35A 3AAFA 1QPIA 2IS6A 1RNLA 4CYCB 5DEQA 4F91B 5A2QZ 3KYCB 1LVAA 3F9KA 5EZGA 4HSTA 4OWRB 1HDDC 1ON2A 3B02A 4N4OB 1WJEA 5ILUA 2ZO4A 3JCUC 3C18A 4LG0B 3HHGA 3G1LA 3PFIA 2NVYJ 4KUMA 3CMMA 1W7PB 1Z7LA 4CSWA 3SDBA 3OSFA 2GXAA 2R7QA 3HIFA 1JKOC 3KZZA 2XHKA 2WV1A 3OOPA 4RAGA 2NXNB 4GXOA 2ZCWA 1AKHB 3VEPA 4R79A 5FGMA 2IEKA 1B72A 4LLNA 1R71A 2WAQA 5HVQC 1HW1A 1ERDA 2ICWG 2R7FA 4IF4A 2Q1ZB 3RYRA 3TW6A 4GDFA 2HOSA 5EJCA 5D5WB 4OMZA 5L3FA 2IA2A 1YQAA 4FE7A 3C3WA 2KISA 3V7SA 3S8PA 2IRFG 2M30A 3FK7A 2HZDA 3WE3A 4L5EA 1MBGA 4FQGA 4UV9A 4GGGA 1WKMA 2NS7A 5BMZA 3R0AA 4XKBA 4CCMA 1WFXA 2E1NA 2KRHA 1USSA 4E7ZA 3TO7A 1VNDA 1QU3A 2CQNA 5TRDA 5IY5H 1PYVA 2MA3A 2DA2A 2XGDA 2KDZA 1R7JA 2KT0A 4BQQA 4I6ZA 2LKXA 3LSMA 3D5SC 5HNHA 5FROA 1IN4A 3H0DA 1OKRA 3OR1C 2PI0A 1FOWA 3JSPA 2L54A 1O57A 1OQYA 3GMEA 4RGSA 1SVLA 1MBFA 4XICA 1Z3XA 3CUQC 2YX4A 1Q1HA 3OYIA 2BXYA 4L5IA 2VB6A 2P81A 3S3OA 5KK1A 1U2WA 2FOKA 5LHIA 4FASD 2A6EF 2HYFA 2ZBKA 3FM3A 2E2IJ 1DU0A 4U7DA 4OINF 2D45A 2UZKA 2CQ7A 3J81Z 4YEJA 2XB0X 1Z9CA 2Y48A 4N9IA 2WB1A 3HUGA 2COMA 3CCRI 4KICA 1YW9A 3GFMA 2EZIA 5ICFA 2IGKA 1YS6A 5D8KB 5BS6A 5J4YA 5EG0B 1F4KA 3GTPJ 1MMAA 1PP8F 1FYMA 1ULYA 3BR1A 3LSKA 4BKXA 4L18B 1ZREA 4KJZA 3OYNA 2Z2SB 3LWFA 4HNUA 5E18F 2W00A 1BL0A 5IT9Z 1Y1VJ 1WSUA 4EJWA 3DWLE 2XAUA 2NOJB 2YUSA 2BZTA 1P4WA 4RB0A 4BNCA 2JA8J 3I53A 2R7XA 2CW0F 1BM9A 1B72B 2ID3A 2R92J 2JRTA 4N9HA 3PQJA 1EH6A 4A6EA 5K5QA 4L0ZB 2X1CA 3I58A 4IQ4A 1D3YA 3SZTA 3HL2A 3CJTB 4CDGA 3SZPA 4KDPA 2O3FA 4DBRA 1TWGJ 3GWZA 4HAMA 2QEXI 2L0KA 5IT9K 1TTYA 2PN6A 2JWTA 4CA0A 4GCVA 5FLXK 3CLOA 4XSXF 3OS1A 4KT5C 1R00A 2L02A 3VYUB 3S3MA 1XCVA 3DEEA 5J3LA 1Z1DA 2FBKA 4D1QA 3T8RA 2RGVA 3EQLF 3Q0VA 3OYAA 3K70D 3GTGJ 2IT0A 2UWMA 2QBYA 3CMYA 2QQ8A 1OCCH 3QYFA 1RC9A 1TC3C 1BR1A 4IJAA 2XRNA 2E2JJ 3CJNA 5E1XA 2HU9A 4B09A 2CV2A 2JRMA 3GYHX 3AL0B 3U2RA 1CF7A 2VKDA 1XGMA 1UHMA 5J8FA 2F48A 2D5VA 2KKOA 5EEHA 1E17A 2OQGA 3RQIA 1OYIA 4ZYAA 3ZMDA 2XV4S 3SYTA 1TW3A 1U5TB 3NWSA 2DJNA 3F8BA 4ZZLA 4C30A 3OYLA 2CQXA 1RKTA 3AG4H 3RIRA 3VB2A 1TP4A 4AUXA 3ZOBA 1G3SA 2VKEA 3R6SA 2M0MA 4NDLA 3J7AO 4DGWB 3ABMH 3AKZA 1SFKA 3ELKA 4BJTA 3DP7A 5FB2A 1YJ9I 3BCBA 4XRFA 1R4NB 4HF0A 1DUXC 2OQRA 2Y31A 2EZHA 2P4WA 1FBSA 3P5JA 4E7HA 3A2KA 3H9GA 2V7FA 1Z7UA 2HDWA 3V7RA 3K4JA 3HTSB 1L0OC 4E7JA 3A02A 5EEGA 5JLXA 2FSWA 1MSFC 1D5YA 3I71A 2LKSA 3WG9A 1I6XA 2V4JC 3DQVC 1U78A 4V2FA 5LD2C 3PM1A 2FF4A 1MBHA 1BIAA 3W3CA 2HZTA 1HF0A 2LF7A 2XAQA 3T1BA 1O7FA 5FKOA 3H0GJ 4LLGF 3G1MA 3HJEA 2HPMA 4I02A 1QRYA 3CCEI 5JI6A 1SD5A 1QPMA 2DCEA 1LFBA 5L3GA 1CGPA 2A6HF 3BROA 1TLHB 3DTKA 1XDSA 3TDZC 3V8KA 4FHTA 3ZMZA 4MFDA 5J6XA 5FRNA 2HEOA 2P7CB 2E34A 5KAIC 3WTWC 4M73A 4MIMA 4IRIA 2IXSA 2F5EA 2Z99A 5FD5A 2MABA 3IKVA 4UVBA 1B8IA 4B48A 3CUQA 3RKXA 3SXYA 4BBSJ 1ZH5A 4YELA 1MMGA 4UUVA 5GAHJ 1SD4A 4L5JA 4HLXA 4Y3OA 2FXAA 1OISA 2PMHA 2LD5A 3GXOA 5HODA 3KETA 1Z6TA 1IXRC 1USTA 4A0ZA 3K2AA 3WTZA 4BS9A 3CQZJ 3CESA 5GAEJ 4CXFA 5LEJA 1WWXA 1WVRA 2VQGA 3J7AY 3R4KA 4A0XA 2XGXA 3FHNA 2GM4A 1LPQA 2OZ6A 3WU2C 5IOYA 2Z3YA 2PLYA 2E1OA 3HRUA 3JW4A 5J8CA 3JAMK 2XKPA 5IOZA 4NUBA 4EJVA 1WZ2A 1A6QA 2EIMH 4AIJA 4JX4A 2O7OA 4A69C 3FXUA 4RDUA 4HA8A 4LOCA 2XAHA 3KEYA 3KP4A 3S16J 2KLOA 3ESWB 2R7WA 5CLSA 2M8EA 2EZLA 4U88A 3TP3A 3MCZA 2OA4A 4XRSA 4M3FA 4O3MA 2M45A 2N8GA 1K78B 4OIPF 3JRIA 1S8NA 3CO7C 2DO7A 2HTSA 2E36A 3KYLA 1OYYA 3E0JB 2QQ9A 2NVUB 3OIPA 2PJPA 3BJOA 1WGXA 1ZGJA 2E1MC 2M34A 2ZJ2A 1NK3P 2KZGA 4NC6A 4PK4A 3E5UA 1JJ8C 2CFOA 2HOEA 3M3YJ 3GLXA 4O5VA 1JT0A 5F27A 4DZPA 5HLGA 1GT0C 4A3GJ 3V4GA 4XN0A 4HYEA 5GPAA 3ONQA 4HZFA 1RESA 2BVMA 5K7ZA 2L4AA 2M1BA 2DTZA 2R7ZJ 2GZWA 2CQKA 2EPFA 5C3EJ 3BTLA 2G7UA 3L1PA 3FISA 3H3ZA 3DPLC 3U9GA 4UUSB 3U1DA 3EPZA 2OD5A 2CUFA 3RTRA 3DLAA 1PUFB 2Q2EB 1W5TA 2QSHX 2XROA 1I5ZA 4HQMA 4YIIA 2QF7A 3BLYA 2W84A 1U5TA 3HOZJ 4I99C 2YX7A 1YW7A 1H9TA 2DQLA 2X6OA 1TWHJ 1D0YA 2GLOA 3HSFA 4KMUX 1BC7C 3QPSA 2NVTJ 3CC4I 3A0BC 5DV5A 5GTIC 2BV6A 3BG3A 3NWTA 1HKTA 1Y6IA 1K61A 4LD5A 3G71I 1XC5A 5C4JJ 3LSJA 1D1AA 2DYRH 1WRJA 2ZMEB 2O5RA 3WHCA 3KPHA 5BPDA 4CYCA 2BHZA 5M3MJ 3S2HJ 1WH7A 2DU9A 3WG7H 3J81K 3G4SI 3SFZA 5A2QK 1G4DA 4CHUA 1Y56A 3A1YA 3K0LA 4HNTA 3BJ6A 4A93J 2NS8A 3HUGB 3H5RA 1HSTA 5HS7A 5FJ8J 2VBWA 2D1VA 1K6OA 2LH9A 2R7OA 3P9IA 2F6CA 2DMTA 3K1NA 2YU3A 1FMVA 3BDDA 2L5QA 3A0HC 2ZKZA 3VODA 9ANTA 2CS3A 4RS8A 4E7SA 1NTCA 3HHHA 3C2GA 2VQHA 4IHSA 2XUBA 5D5XB 1XS9A 2Z5UA 1V54H 1ZGWA 4P9UA 4JP0A 1XPXA 4F55A 1YIJI 3G2BA 1UELB 2FBIA 5LRRA 2LF8A 1HW5A 3BG7A 2P8TA 2M5WA 1OPCA 2TRTA 2ZFWA 4ZTJA 3ZP5A 1YIOA 2DPUA 4LIUA 2V26A 3MN2A 3SJMA 1K79A 3TGNA 1J0RA 5ICGA 4EEFG 5HDNA 5DYMA 2EA2A 1GV2A 2QGUA 3L2UA 4K2EA 1I39A 2JK3A 4M9SA 3WTVC 2NNNA 2BOLA 3ECHA 3M8FA 2ZSIB 1D8KA 1W36D 1JGSA 1S3JA 3FMRA 1XB4A 3CDLA 2E1MB 3HSEA 3U1KA 3Q5FA 3CCUI 3FMQA 2IW5A 2EQRA 2P7VB 3ECOA 2WTEA 1R4MB 3PNYA 2R7SA 3QYEA 4LG3A 2KJCA 2R7TA 1HOMA 3LOCA 3BP8A 2E7WA 4M9XA 1R5HA 2H8RA 3HTUA 1MD0A 2NVXJ 1MW7A 4PFPA 3DKXA 2B0LA 3VYSB 1JTXA 3K9TA 1MDMA 4NC8A 1YTYA 3MMYB 2MFZA 3HSRA 1IDYA 3HOTA 3ZXSA 1YE9A 4BE0A 1IRZA 3VWBA 5H6QA 5JLWA 3KZYA 3G6EI 1GLNA 4M71A 3K4NA 2LDUA 4C3JJ 1NH3A 1O3RA 2H1LA 1KYZA 3N05A 1YI2I 4G6DA 1T95A 5AONA 1LFUP 3GTMJ 3DTIA 1QGPA 2JVGA 2VC0A 2OPTA 3QOEA 1D0XA 1IAWA 1EV7A 2D2WA 4F92B 3HRMA 1HLVA 1LNWA 3PUFA 2XIGA 1R1UA 5KVRA 2PEXA 2L9NA 3TQNA 4BACA 4FISA 1FSEA 3F21A 5JVTA 2DMQA 1I6HJ 1SFOJ 3LL7A 3V42A 1YHQI 4XLAA 4B44A 2YU9J 4M3GA 2DMPA 1QA6A 1JKPC 4EM2A 2K3FA 2OAZA 2IBDA 3ERMA 1Y1WJ 2HKOA 2FQ3A 3IHUA 2O9LA 2I10A 3CJRB 2DOAA 3E6CC 2MG4A 1AKHA 3LA2A 3T0YA 4DOZA 4C2UA 4XBFA 4XNFA 4Y33A 3F8CA 2E19A 1UFMA 3DEWA 3GEZA 2R3SA 4EGZA 2RNJA 4KMFA 1REPC 1XMXA 2FJ1A 5CVIA 3QPHA 1I3AA 1ENHA 3BZCA 4PUSA 1TNTA 2STWA 3CCYA 1A36A 2X1EA 2F5CA 3W2WA 3OS2A 5D4SA 3BOQA 3HEFA 3ISPA 2KJBA 2H6BA 2PG4A 1YS7A 3H92A 4EJTA 3JTGA 4RB1A 2F5FA 3S1NJ 5KAFC 2ZB9A 1U5TC 2M0CA 3D1NI 3Q0WA 2DBBA 1ETXA 2XKOA 3K4CA 2DDBA 5LHHA 3J7YJ 3PNVA 1N25A 3AG1H 2HS5A 4Q47A 1O3SA 4ZYHA 1UZCA 4UUSA 5DDGA 4P5OA 2L4MA 1W5SA 5GP9A 5HLIA 2K85A 2WY7Q 1AOYA 2MYSA 2X4HA 4YFNF 2EFQA 4LITA 5HDKA 5LGNA 2Z33A 2CV0A 1TZLA 1NHAA 3V7CA 1SFXA 4D9JA 4I01A 4BY1J 3L09A 2VT2A 3ASOH 3I64A 1WJFA 2J5OA 2V1XA 3E7LA 4J01A 4BQAA 2JPCA 3K4LA 2X1DA 2LBFA 1N75A 2H09A 2LRDA 1GV5A 1JJ6C 4HBLA 3TO9A 4IKFA 1XTAA 3GTQJ 3IH2A 5FKLA 1LEBA 2PMUA 3E6DA 4II2A 2XASA 3HB9A 3HKZN 1F1ZA 3OYGA 3L2RA 2EJRA 2YR2A 2R7DA 5FLXZ 1X1AA 2A05A 4I7HA 2R7UA 1YG2A 2IJLA 4QPQA 5LRSA 5FKKA 3PIOF 2HYGD 3HGGA 3M8JA 4XLCA 1MBKA 1AHDP 5BQTA 1R22A 2CH0A 2P0WA 1U9OA 4UHTA 2RKHA 4CH7A 2E7XA 3ZPLA 2L7ZA 2L7FP 3JTHA 5J1RA 1T6SA 1G3WA 4F3QA 5E8GA 1IGNA 1P9QC 1V5GA 1ZLKA 4CZCA 4MTDA 4P9FA 3T8TA 3FWEA 4A3BJ 4L9NA 4XRMA 4Y52J 5H20A 4AD9A 4AVZA 3LQRA 1IN7A 3KZIC 3OOUA 4R1HA 4WF2A 3EDPA 3RKYA 1J75A 2ADUA 3K1MA 2BW3B 1RUNA 5IP6A 2KFDA 2EIKH 5EF6A 1VQ5I 3K1PA 3WTYC 4C3HJ 4GYIA 2DK8A 5CJ9A 1E0EA 2EIJH 4BJ6C 5FLMJ 2UUZA 3DFGA 3FXQA 4IHVA 2O61A 5D6EA 1JE8A 1OCZH 1WI3A 1XGOA 1X1PA 3CC7I 3KP5A 2NYXA 1T2KA 5DD4A 2M9HA 2A6TA 2HOAA 3CDHA 1YX3A 4J19A 4ZDPA 3QP6A 2P6SA 4X6AJ 4XOPA 1DGWY 3RPQA 1QQIA 3VFZA 5DD8A 2Z9OA 2ACJA 1B4AA 2VPLA 1T08B 2LREA 1W7PD 3ABUA 3JR9A 2XF5A 4EM1A 4PGHA 1LE8A 1MNEA 3E6BA 4RLQA 2XRLA 4TV7A 3CP8A 2OUMA 1QVTA 5E8IA 1EJ9A 1GUUA 3J7ZI 1QZZA 3GTOJ 3KIOA 4NQWB 3BT9A 2ME6A 5FKNA 5K1YA 2E2HJ 1JUPA 3L2QA 3TOBA 2HQAA 3C1DA 2L7MP 3JRCA 4XQFA 2LG4A 2IGNA 1W0UA 5F0HA 3S14J 2PQ8A 4EATA 5BPIA 2P5LC 1SC7A 1SAUA 1XD7A 2DYSH 2M8GX 4E7IA 2BY1A 2EINH 3BQYA 3ZMTA 2PMZN 4BQOA 4FE4A 4XL9A 1BOBA 2OBPA 1XSXA 2WAQN 3I4MJ 1KQ8A 1B6AA 1QHGA 1XMAA 2JUCA 2FMLA 3DPTA 5FO5A 3G3ZA 4CYDA 3GVAA 3WU0A 4BH9A 1DDNA 3GUDA 3ULQB 3E97A 4EVIA 4A5NA 3AL0C 2HVSA 3LSGA 5F64A 1IV6A 2WWYA 2JSCA 2ECCA 3ABLH 1VQPI 4M6XA 1MMSA 1FOXA 2VBXA 4B4CA 5HS8A 3QRFF 2VBYA 1KU7A 1IDZA 1FLIA 2DI3A 3BR0A 2G7HA 2JSPA 2QKLB 3RZOJ 1X19A 1Y8RB 2FEZA 2G9WA 2ZNZA 4HX8A 3Q9SA 4EJOA 4HF2A 1O7LA 1ZRDA 4YRVA 3ZQGA 2DFEA 4LIVA 4U87A 3T5XA 3F8MA 3S32A 3IWFA 4WX9A 1KQ9A 3F22A 1F9NA 3EUHA 4EJUA 1ZQ3P 2E1CA 3BCAA 4GYGA
chains in the Genus database with same CATH topology
1FYKA 1B9NA 2BE5F 2QQBA 4BHPA 5CVUA 1S29A 4KIBA 3O2PE 4HX7A 2J5PA 2EV5A 2K4JA 4MGRA 3IRRA 2ISZA 1JXSA 5LGUA 5HDGA 3HYIA 4HV6A 3I5UA 4CZZA 3K69A 2UXXA 1TBXA 2CO5A 1LDKB 2FE3A 1ZYRF 4IPAA 2A3SA 1KYWA 3IWZA 4KNYA 1P4XA 2TDXA 3GF2A 4WXHA 1Y0UA 2V1UA 2WV0A 5DCFA 4H0EA 1WQ2A 2Q0OA 1G3TA 1DP7P 2ELHA 1A04A 4UVAA 3DV8A 1B59A 2FMYA 4U0YA 4FX4A 1J9IA 3V8LA 3IL2A 1FNNA 4S05A 1S7AA 3ROUA 3MZYA 4A5MA 3GFIA 4ETSA 2H6CA 1ZARA 2GIVA 2A61A 1IUYA 3DF8A 3EETA 3I0TA 4MEXF 1YW8A 4HOBA 1BOAA 2O8XA 4FT8A 1XGNA 2QWWA 3GZ5A 1YFHA 1G6NA 4BAYA 1J59A 2A07F 2X0LA 3J80K 2FNPA 3ZMUA 5LEKA 1K7AA 3GX4X 3CUQB 1ON1A 3LAJA 3O3KA 2PFBA 4U7BA 1UHWA 2QQAA 2A69F 1HW2A 1QZYA 2M87A 3IKTA 4MTEA 2A68F 4I2OA 4MHGA 1QBJA 3LA7A 5CVJA 1P6RA 1MZBA 4Q48A 1R1TA 3P7NA 2CWEA 4ENNA 1OR7A 3DEUA 2AS5F 3HOSA 2STTA 1DPUA 4JQFA 3M9AA 1T98A 4M72A 4IXAA 3ABTA 3TO6A 3MQ0A 3OV8A 3FF5A 2O6GE 5DUIA 3KEOA 2CSOA 1O3QA 1T39A 2NAZA 5DCMB 3SHFA 4OIQF 1WI9A 2EB7A 1GXQA 3L9FA 4A2UA 4ENJA 4Q5SF 1BN5A 1I1GA 2GXGA 3F72A 3L00A 1PP7U 3KP6A 5LHGA 2NNYA 1HBXG 3W6KB 4G7HF 4L9VA 4KA4A 4OMYA 3GZ6A 5D6FA 3E6MA 3HRSA 4U0VA 2KIMA 4E70A 1ZG5A 1BBYA 2MC3A 5FD6A 5CVVA 3F3XA 3SQNA 4D0PA 3E3VA 1X3UA 3I59B 5E20A 4O6JA 1H0MA 2FBHA 4CGZA 3W6JB 5F1RA 2QVOA 2MH2A 4BHBA 1YYVA 3MZHA 2MLKA 4WK8F 3WTUC 2EA4A 5IT3A 1FY7A 5H6RA 3RI4A 3MFKA 2HWVA 2FU4A 5D8LB 2DQRA 4RB2C 2EFWA 1FBUA 3LAPA 4CO8A 2K4BA 4RB3C 5TJJA 5AIQA 4HDUA 1GXPA 5HOOA 5D5VB 5E17F 1FZPB 1E2XA 1MJ9A 1YLFA 1LDDA 4AIKA 5ERIA 5JR3A 1TQIA 3QU3A 3S2WA 1IZ1A 2DLLA 2EV0A 2JT1A 3F6OA 3RYPA 3ZN0A 1R58A 3EYIA 3IC7A 1XSVA 3V8JA 1T0FA 5L3EA 2VN2A 4MQ9F 3LFKA 2RV8A 3NQOA 1FT9A 4LMYA 2BEOA 3BWGA 4M9ZA 3FX3A 5LLQA 2NS0A 3KLNA 4XLPF 2KIUA 2QZ8A 4EQQA 5E1ZB 4L9JA 4RAYA 1R5GA 4G9YA 1LEAA 5ICEA 3ERED 3BJAA 2IP2A 2K02A 3D0SA 5JHUA 4ESJA 1I27A 1B9MA 3O6BB 2MH9A 5JFRA 2VT3A 4DQ2A 1ZG1A 2RC4A 2EFOA 2V9VA 1ZRCA 4ESBA 4RGUA 2IA1A 2QYOA 2VBZA 4HDVA 2QBYB 2VE9A 4I0AA 2VC1A 1KU9A 1SMYF 4AVPA 1Z05A 3WU1B 1U6GA 4LFUA 4HQEA 2HQNA 3NEUA 2HQRA 2ESHA 4RGXA 3TOAA 3G73A 2WC2A 2FNAA 4PGGA 3WGIA 4LG0A 1CF7B 3N4MA 4L0YB 3CO6C 2VODA 1W7PA 2F5DA 2K7LA 3WTTC 4L9TA 1FOKA 1GVJA 4YIFA 1FWZA 3I54A 3RDIA 1ZAOA 1SFUA 4ENMA 1Z91A 1SAXA 3FM5A 1ZN2A 2RN7A 2XAGA 1IW7F 4OU0A 1V4RA 2VOOA 2RVCA 1TQMA 1PUEE 1SD7A 5FFZA 4WWCA 2YSRA 4EV0A 2IPQX 1G3YA 2GQQA 2CYYA 2YPRA 1YO5C 1DPRA 2DT5A 1P2FA 3FMSA 3LSTA 5CYVA 3K2ZA 4A6DA 1U8RA 1T38A 4XLNF 3P9CA 4M74A 4HV5A 4QWQA 4I09A 2GXBA 1BIBA 3R61A 1BI2A 3GFLA 3RJPA 2F2EA 3B73A 4YFKF 2NRAC 4G7ZF 2EFPA 1BI0A 1LB2A 1LJ9A 3CTAA 1GHCA 4IRGA 3WE2A 2EV6A 4KFCA 2QLZA 2GA1A 5DCMA 4EMSA 3QOPA 4CICA 4BXUA 4UV8A 3KEQA 4KN4X 3VOEA 2K27A 4P96A 4ON0A 4PZJA 3REOA 4EM0B 2ZMEA 1UCRA 4ASNA 3RKWA 3D5LA 4HX4A 1QNTA 4ZYDA 4YFXF 3KP2A 1R23A 2DTRA 3LQQA 3F23A 3RPUA 1LQ1A 2BBYA 4MQVA 5F6FA 3KP7A 4ENKA 3MEXA 2EWNA 1IXSB 2HDCA 4ESFA 2DW4A 3I4PA 2MLGA 2H27A 4UXNA 4WCGA 1ZLJA 2DPDA 2V79A 2XAFA 2JTVA 2W85A 1EH8A 1BI3A 3Q9VA 1V3FA 2L3DA 1Z6RA 2GWRA 3L2CA 1C0WA 5ED4A 2Y75A 3WODF 2HKXA 4Z2YA 1F5TA 3R0JA 1S6LA 2O03A 3BPVA 2BGCA 1J2XA 1ZG3A 2FRHA 1MDMB 4Y13A 1FPQA 2HGCA 5DUKA 1JHFA 1R1VA 3HRTA 1IRFA 2VXZA 1U3EM 5ILSA 1FP1D 3MWMA 2VONA 3KFWX 3JAMZ 3WTSC 1FX7A 3MAJA 2Q8KA 1FBQA 4ZYGA 4LK0F 5FFXA 4GO1A 3TKYA 2IA0A 1J5YA 4G94A 2AXLA 1IN5A 1IXCA 3P9KA 1SMTA 1IRGA 2BYVE 6PAXA 4QLCU 3FZVA 4OIOF 2P6TA 2XAJA 3CUOA 3FHZA 4UNOA 3BY6A 3FXRA 1B1BA 1BI1A 2MBFA 3WGGA 4B8XA 2W57A 2VE8A 3KCCA 1XCBA 3L7WA 4YG2F 5CVRA 1OMIA 4R8HA 1IF1A 5HLHA 2QUFA 2QENA 2RDPA 4AWXB 2EFNA 2MD5A 2V1DA 1OYWA 3F8NA 1PDNC 2A5YB 5ICCA 1HQCA 1HKQA 2FA5A 1IN6A 2HR3A 1KQ0A 3J80Z 1S7OA 4LB6B 3M8EA 3COAC 5L3CA 2QM3A 5ILVA 2ETHA 3TDUC 3E5QA 4IRHA 3DXJF 3ZQ7A 3WTXC 5HS9A 1EH7A 1QO0D 4LK1F 4PCQA 3DKWA 4HLYA 1IN8A 5D5UB 1XSDA 1H9GA 5LBQA 4G8XA 2ISYA 4JK1X 1L3LA 3E5XA 1R36A 4Y15A 3GO5A 5L3BA 2V6CA 3H3UA 2GAUA 2W25A 1AWCA 5BOXA 4Q4ZF 1D5VA 2RQPA 1STZA 1ODDA 2OZUA 1VTNC 1FC3A 2ZNYA 1RUOA 4N0BA 1MJBA 2KRFA 4LGWA 3QU6A 1W4MA 1XGSA 2L01A 1JHHA 4NQWA 3BPXA 1RI7A 2LSOA 3QP5A 4KN7X 4PDKA 4NB5A 4HW0A 2CFXA 3C7JA 3WGHA 5K5OA 4IVNA 2KIFA 2O0YA 1KGSA 3R60A 2LKPA 4DNCA 3GW2A 3NRVA 3KLOA 3GFJA 1KA8A 2K86A 5E1WA 4P55A 3ML6A 3F8FA 3KP3A 4MNUA 1P4AA 2CGPA 4Y17A 4WXDA 4OIRF 1J7KA 2CG4A 2C6YA 3KE2A 4XSZF 1MJAA 4M6YA 4LLLA 1BJAA 4KIGA 3N97A 3BZ6A 1XN7A 1KU2A 2Q2EA 3LA3A 4MEYF 3JSOA 4FX0A 1TNSA 4ZZDA 4KIFA 5AIPA 3ZMSA 1P92A 1RIOH 4ZH4F 2D1HA 1MKMA 1FP2A 3ZMVA 5LGTA 4OOIA 4KYWA 2GA2A 4JBAA 4A0YA 1HKSA 1D8JA 3QAHA 1ZRFA 2H94A 3M7GA 2ZXJA 4A12A 2P5VA 4G7OF 5D4RA 1BC8C 4UVCA 4AIHA 3EYYA 1FSHA 2VOPA 1MGTA 1XMKA 1K78A 4U0WA 1TQPA 4F7ZA 4G6QA 1O3TA 2UXNA 4WXCA 2DK5A 2ESNA 1ZHFA 2LNBA 4ZYEA 1LDJA 1SD6A 4I0BA 4HF1A 1ONVA 1XDUA 2HTJA 1KU3A 2PBIA 3I59A 1ZGAA 3F6VA 2DFIA 1RZ4A 3QPTA 2XVCA 5K5RA 4LJZF 4RAZA 2Y0MA 3IRQA 2W24A 2IVMA 5L3DA 1HXDA 1TW2A 4LB5A 4BYYA 2JZYA 4RGRA 2DAOA 4IHTA 3ZN1A 1SFEA 4EGYA 4NHJA 1UB9A 2OU2A 3PQKA 2JPBA 4BHCA 1HSJA 3M1EA 4S04A 2EK5A 2P5KA 1FYLA 1I1SA 2HFHA 4I98B 3AAFA 1RNLA 5DEQA 5A2QZ 1LVAA 1ON2A 3B02A 5ILUA 2ZO4A 3C18A 4LG0B 3HHGA 3PFIA 4KUMA 1W7PB 3HIFA 3KZZA 2XHKA 3OOPA 4GXOA 2ZCWA 3VEPA 4R79A 5FGMA 4LLNA 5HVQC 1HW1A 2R7FA 4IF4A 3RYRA 5D5WB 4OMZA 5L3FA 2IA2A 1YQAA 3C3WA 3V7SA 2IRFG 2M30A 3WE3A 4UV9A 4GGGA 1WKMA 5BMZA 3R0AA 2E1NA 1USSA 3TO7A 5TRDA 2MA3A 1R7JA 1IN4A 1OKRA 2PI0A 3JSPA 2L54A 1O57A 4RGSA 3CUQC 2YX4A 1Q1HA 4L5IA 5KK1A 1U2WA 2FOKA 5LHIA 2A6EF 2HYFA 2ZBKA 3FM3A 4U7DA 2D45A 2UZKA 3J81Z 1Z9CA 2Y48A 4N9IA 3HUGA 2COMA 4KICA 1YW9A 3GFMA 5ICFA 1YS6A 5D8KB 5BS6A 1F4KA 1PP8F 1FYMA 1ULYA 4L18B 1ZREA 3LWFA 5E18F 5IT9Z 1WSUA 4EJWA 1P4WA 4RB0A 4BNCA 3I53A 2CW0F 1BM9A 2JRTA 4N9HA 3PQJA 1EH6A 4A6EA 5K5QA 4L0ZB 3I58A 1D3YA 3SZTA 4CDGA 3SZPA 4KDPA 2O3FA 3GWZA 4HAMA 5IT9K 1TTYA 2PN6A 4GCVA 5FLXK 3CLOA 4XSXF 4KT5C 1R00A 2L02A 1XCVA 1Z1DA 2FBKA 3T8RA 2RGVA 3EQLF 2IT0A 2UWMA 2QBYA 4IJAA 2XRNA 3CJNA 5E1XA 4B09A 3GYHX 3U2RA 1CF7A 1XGMA 1UHMA 5J8FA 2KKOA 5EEHA 1E17A 2OQGA 1OYIA 3ZMDA 2XV4S 1TW3A 1U5TB 3F8BA 4ZZLA 3RIRA 3VB2A 1G3SA 3R6SA 3J7AO 3ELKA 3DP7A 5FB2A 4XRFA 4HF0A 1DUXC 2OQRA 2P4WA 1FBSA 1Z7UA 3V7RA 3HTSB 1L0OC 5EEGA 2FSWA 3I71A 3WG9A 1I6XA 3DQVC 1U78A 2FF4A 1BIAA 2HZTA 2LF7A 2XAQA 3T1BA 1O7FA 4LLGF 4I02A 5JI6A 1SD5A 1QPMA 5L3GA 1CGPA 2A6HF 3BROA 1TLHB 3TDZC 1XDSA 3V8KA 4FHTA 3ZMZA 5J6XA 2HEOA 2P7CB 3WTWC 4M73A 4IRIA 2F5EA 2Z99A 5FD5A 3IKVA 4UVBA 3CUQA 3RKXA 3SXYA 1ZH5A 4UUVA 1SD4A 4L5JA 4HLXA 2FXAA 2PMHA 3GXOA 3KETA 1Z6TA 1IXRC 1USTA 4A0ZA 3WTZA 4CXFA 5LEJA 1WWXA 3R4KA 4A0XA 2XGXA 2OZ6A 2Z3YA 2PLYA 3HRUA 3JW4A 5J8CA 3JAMK 2XKPA 4EJVA 4AIJA 3FXUA 4HA8A 2XAHA 3KP4A 5CLSA 2M8EA 4U88A 3MCZA 2OA4A 4O3MA 2M45A 1K78B 4OIPF 3CO7C 1S8NA 2DO7A 2HTSA 1OYYA 2QQ9A 2PJPA 3BJOA 1ZGJA 2ZJ2A 3E5UA 2HOEA 3GLXA 4O5VA 5HLGA 3V4GA 4HYEA 4HZFA 2L4AA 2M1BA 2GZWA 2CQKA 2G7UA 3H3ZA 3U9GA 3DPLC 3U1DA 2OD5A 3RTRA 1W5TA 2XROA 1I5ZA 4HQMA 4YIIA 2W84A 1U5TA 2YX7A 1YW7A 1H9TA 2DQLA 3HSFA 4KMUX 1BC7C 5DV5A 2BV6A 1HKTA 4LD5A 1WRJA 2ZMEB 5BPDA 2DU9A 3J81K 1G4DA 3SFZA 5A2QK 4CHUA 3K0LA 3BJ6A 1HSTA 5HS7A 2VBWA 2D1VA 1K6OA 3P9IA 3K1NA 2YU3A 3BDDA 2ZKZA 3VODA 4RS8A 3HHHA 4IHSA 2XUBA 5D5XB 2Z5UA 4P9UA 2FBIA 5LRRA 2LF8A 1HW5A 2P8TA 2M5WA 1OPCA 2ZFWA 3ZP5A 1YIOA 2DPUA 1K79A 3TGNA 1J0RA 5ICGA 5HDNA 5DYMA 2EA2A 4K2EA 4M9SA 3WTVC 2NNNA 3ECHA 3M8FA 1D8KA 1JGSA 1S3JA 3FMRA 1XB4A 3HSEA 3Q5FA 3FMQA 2IW5A 2P7VB 3ECOA 2WTEA 2KJCA 3BP8A 2E7WA 4M9XA 1R5HA 3HTUA 1MD0A 2B0LA 3K9TA 1MDMA 1YTYA 3HSRA 3HOTA 5H6QA 3KZYA 4M71A 2LDUA 1O3RA 1KYZA 4G6DA 5AONA 1QGPA 2VC0A 1IAWA 1EV7A 2D2WA 3HRMA 1LNWA 2XIGA 1R1UA 5KVRA 2PEXA 3TQNA 1FSEA 3F21A 5JVTA 4EM2A 2OAZA 2HKOA 2FQ3A 3IHUA 3E6CC 3LA2A 3T0YA 4XBFA 3F8CA 1UFMA 3GEZA 2R3SA 4EGZA 2RNJA 4KMFA 1REPC 5CVIA 3QPHA 1TNTA 2STWA 2F5CA 5D4SA 3BOQA 3ISPA 2KJBA 2H6BA 2PG4A 1YS7A 3H92A 4EJTA 3JTGA 4RB1A 2F5FA 1U5TC 2DBBA 2XKOA 5LHHA 2HS5A 4Q47A 1O3SA 4ZYHA 5DDGA 4P5OA 2L4MA 1W5SA 5HLIA 1AOYA 2X4HA 4YFNF 2EFQA 5HDKA 5LGNA 2Z33A 1NHAA 3V7CA 1SFXA 4I01A 3L09A 2VT2A 3I64A 2J5OA 2V1XA 4BQAA 2JPCA 2H09A 4HBLA 3TO9A 1LEBA 2PMUA 3E6DA 2XASA 1F1ZA 2EJRA 2YR2A 2R7DA 5FLXZ 4I7HA 1YG2A 2IJLA 5LRSA 2HYGD 5BQTA 1R22A 4UHTA 2RKHA 3ZPLA 2E7XA 3JTHA 1T6SA 1G3WA 5E8GA 1ZLKA 4MTDA 4P9FA 3T8TA 3FWEA 4L9NA 5H20A 4AD9A 3LQRA 1IN7A 4R1HA 4WF2A 3EDPA 3RKYA 1J75A 2ADUA 3K1MA 1RUNA 3K1PA 3WTYC 4GYIA 2DK8A 5CJ9A 3DFGA 3FXQA 2O61A 5D6EA 1JE8A 1XGOA 3KP5A 2NYXA 1T2KA 5DD4A 3CDHA 3QP6A 2P6SA 3RPQA 1QQIA 3VFZA 5DD8A 2Z9OA 2ACJA 1B4AA 1W7PD 3ABUA 4EM1A 4PGHA 3E6BA 4TV7A 5E8IA 1QZZA 5K1YA 3TOBA 3C1DA 2PQ8A 5BPIA 2P5LC 1XD7A 3ZMTA 2OBPA 1XSXA 1KQ8A 1B6AA 1XMAA 2FMLA 3DPTA 5FO5A 3G3ZA 4CYDA 3GVAA 3WU0A 4BH9A 1DDNA 3GUDA 3ULQB 3E97A 4EVIA 4A5NA 5F64A 2WWYA 2JSCA 4M6XA 2VBXA 5HS8A 3QRFF 2VBYA 1KU7A 1FLIA 2DI3A 2G7HA 2FEZA 2G9WA 2ZNZA 4HX8A 3Q9SA 4EJOA 4HF2A 1O7LA 1ZRDA 3T5XA 3F8MA 3IWFA 4WX9A 1KQ9A 2E1CA 1F9NA 3EUHA 4EJUA 3F22A 4OINF 4GYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FYK A;  1B9N A;  2BE5 F;  2QQB A;  4BHP A;  5CVU A;  1S29 A;  4KIB A;  3O2P E;  4HX7 A;  2J5P A;  2EV5 A;  2K4J A;  4MGR A;  3IRR A;  2ISZ A;  1JXS A;  5LGU A;  5HDG A;  3HYI A;  4HV6 A;  3I5U A;  4CZZ A;  3K69 A;  2UXX A;  1TBX A;  2CO5 A;  1LDK B;  2FE3 A;  1ZYR F;  4IPA A;  2A3S A;  1KYW A;  3IWZ A;  4KNY A;  1P4X A;  2TDX A;  3GF2 A;  4WXH A;  1Y0U A;  2V1U A;  2WV0 A;  5DCF A;  4H0E A;  1WQ2 A;  2Q0O A;  1G3T A;  1DP7 P;  2ELH A;  1A04 A;  4UVA A;  3DV8 A;  1B59 A;  2FMY A;  4U0Y A;  4FX4 A;  1J9I A;  3V8L A;  3IL2 A;  1FNN A;  4S05 A;  1S7A A;  3ROU A;  3MZY A;  4A5M A;  3GFI A;  4ETS A;  2H6C A;  1ZAR A;  2GIV A;  2A61 A;  1IUY A;  3DF8 A;  3EET A;  3I0T A;  4MEX F;  1YW8 A;  4HOB A;  1BOA A;  2O8X A;  4FT8 A;  1XGN A;  2QWW A;  3GZ5 A;  1YFH A;  1G6N A;  4BAY A;  1J59 A;  2A07 F;  2X0L A;  3J80 K;  2FNP A;  3ZMU A;  5LEK A;  1K7A A;  3GX4 X;  3CUQ B;  1ON1 A;  3LAJ A;  3O3K A;  2PFB A;  4U7B A;  1UHW A;  2QQA A;  2A69 F;  1HW2 A;  1QZY A;  2M87 A;  3IKT A;  4MTE A;  2A68 F;  4I2O A;  4MHG A;  1QBJ A;  3LA7 A;  5CVJ A;  1P6R A;  1MZB A;  4Q48 A;  1R1T A;  3P7N A;  2CWE A;  4ENN A;  1OR7 A;  3DEU A;  2AS5 F;  3HOS A;  2STT A;  1DPU A;  4JQF A;  3M9A A;  1T98 A;  4M72 A;  4IXA A;  3ABT A;  3TO6 A;  3MQ0 A;  3OV8 A;  3FF5 A;  2O6G E;  5DUI A;  3KEO A;  2CSO A;  1O3Q A;  1T39 A;  2NAZ A;  5DCM B;  3SHF A;  4OIQ F;  1WI9 A;  2EB7 A;  1GXQ A;  3L9F A;  4A2U A;  4ENJ A;  4Q5S F;  1BN5 A;  1I1G A;  2GXG A;  3F72 A;  3L00 A;  1PP7 U;  3KP6 A;  5LHG A;  2NNY A;  1HBX G;  3W6K B;  4G7H F;  4L9V A;  4KA4 A;  4OMY A;  3GZ6 A;  5D6F A;  3E6M A;  3HRS A;  4U0V A;  2KIM A;  4E70 A;  1ZG5 A;  1BBY A;  2MC3 A;  5FD6 A;  5CVV A;  3F3X A;  3SQN A;  4D0P A;  3E3V A;  1X3U A;  3I59 B;  5E20 A;  4O6J A;  1H0M A;  2FBH A;  4CGZ A;  3W6J B;  5F1R A;  2QVO A;  2MH2 A;  4BHB A;  1YYV A;  3MZH A;  2MLK A;  4WK8 F;  3WTU C;  2EA4 A;  5IT3 A;  1FY7 A;  5H6R A;  3RI4 A;  3MFK A;  2HWV A;  2FU4 A;  5D8L B;  2DQR A;  4RB2 C;  2EFW A;  1FBU A;  3LAP A;  4CO8 A;  2K4B A;  4RB3 C;  5TJJ A;  5AIQ A;  4HDU A;  1GXP A;  5HOO A;  5D5V B;  5E17 F;  1FZP B;  1E2X A;  1MJ9 A;  1YLF A;  1LDD A;  4AIK A;  5ERI A;  5JR3 A;  1TQI A;  3QU3 A;  3S2W A;  1IZ1 A;  2DLL A;  2EV0 A;  2JT1 A;  3F6O A;  3RYP A;  3ZN0 A;  1R58 A;  3EYI A;  3IC7 A;  1XSV A;  3V8J A;  1T0F A;  5L3E A;  2VN2 A;  4MQ9 F;  3LFK A;  2RV8 A;  3NQO A;  1FT9 A;  4LMY A;  2BEO A;  3BWG A;  4M9Z A;  3FX3 A;  5LLQ A;  2NS0 A;  3KLN A;  4XLP F;  2KIU A;  2QZ8 A;  4EQQ A;  5E1Z B;  4L9J A;  4RAY A;  1R5G A;  4G9Y A;  1LEA A;  5ICE A;  3ERE D;  3BJA A;  2IP2 A;  2K02 A;  3D0S A;  5JHU A;  4ESJ A;  1I27 A;  1B9M A;  3O6B B;  2MH9 A;  5JFR A;  2VT3 A;  4DQ2 A;  1ZG1 A;  2RC4 A;  2EFO A;  2V9V A;  1ZRC A;  4ESB A;  4RGU A;  2IA1 A;  2QYO A;  2VBZ A;  4HDV A;  2QBY B;  2VE9 A;  4I0A A;  2VC1 A;  1KU9 A;  1SMY F;  4AVP A;  1Z05 A;  3WU1 B;  1U6G A;  4LFU A;  4HQE A;  2HQN A;  3NEU A;  2HQR A;  2ESH A;  4RGX A;  3TOA A;  3G73 A;  2WC2 A;  2FNA A;  4PGG A;  3WGI A;  4LG0 A;  1CF7 B;  3N4M A;  4L0Y B;  3CO6 C;  2VOD A;  1W7P A;  2F5D A;  2K7L A;  3WTT C;  4L9T A;  1FOK A;  1GVJ A;  4YIF A;  1FWZ A;  3I54 A;  3RDI A;  1ZAO A;  1SFU A;  4ENM A;  1Z91 A;  1SAX A;  3FM5 A;  1ZN2 A;  2RN7 A;  2XAG A;  1IW7 F;  4OU0 A;  1V4R A;  2VOO A;  2RVC A;  1TQM A;  1PUE E;  1SD7 A;  5FFZ A;  4WWC A;  2YSR A;  4EV0 A;  2IPQ X;  1G3Y A;  2GQQ A;  2CYY A;  2YPR A;  1YO5 C;  1DPR A;  2DT5 A;  1P2F A;  3FMS A;  3LST A;  5CYV A;  3K2Z A;  4A6D A;  1U8R A;  1T38 A;  4XLN F;  3P9C A;  4M74 A;  4HV5 A;  4QWQ A;  4I09 A;  2GXB A;  1BIB A;  3R61 A;  1BI2 A;  3GFL A;  3RJP A;  2F2E A;  3B73 A;  4YFK F;  2NRA C;  4G7Z F;  2EFP A;  1BI0 A;  1LB2 A;  1LJ9 A;  3CTA A;  1GHC A;  4IRG A;  3WE2 A;  2EV6 A;  4KFC A;  2QLZ A;  2GA1 A;  5DCM A;  4EMS A;  3QOP A;  4CIC A;  4BXU A;  4UV8 A;  3KEQ A;  4KN4 X;  3VOE A;  2K27 A;  4P96 A;  4ON0 A;  4PZJ A;  3REO A;  4EM0 B;  2ZME A;  1UCR A;  4ASN A;  3RKW A;  3D5L A;  4HX4 A;  1QNT A;  4ZYD A;  4YFX F;  3KP2 A;  1R23 A;  2DTR A;  3LQQ A;  3F23 A;  3RPU A;  1LQ1 A;  2BBY A;  4MQV A;  5F6F A;  3KP7 A;  4ENK A;  3MEX A;  2EWN A;  1IXS B;  2HDC A;  4ESF A;  2DW4 A;  3I4P A;  2MLG A;  2H27 A;  4UXN A;  4WCG A;  1ZLJ A;  2DPD A;  2V79 A;  2XAF A;  2JTV A;  2W85 A;  1EH8 A;  1BI3 A;  3Q9V A;  1V3F A;  2L3D A;  1Z6R A;  2GWR A;  3L2C A;  1C0W A;  5ED4 A;  2Y75 A;  3WOD F;  2HKX A;  4Z2Y A;  1F5T A;  3R0J A;  1S6L A;  2O03 A;  3BPV A;  2BGC A;  1J2X A;  1ZG3 A;  2FRH A;  1MDM B;  4Y13 A;  1FPQ A;  2HGC A;  5DUK A;  1JHF A;  1R1V A;  3HRT A;  1IRF A;  2VXZ A;  1U3E M;  5ILS A;  1FP1 D;  3MWM A;  2VON A;  3KFW X;  3JAM Z;  3WTS C;  1FX7 A;  3MAJ A;  2Q8K A;  1FBQ A;  4ZYG A;  4LK0 F;  5FFX A;  4GO1 A;  3TKY A;  2IA0 A;  1J5Y A;  4G94 A;  2AXL A;  1IN5 A;  1IXC A;  3P9K A;  1SMT A;  1IRG A;  2BYV E;  6PAX A;  4QLC U;  3FZV A;  4OIO F;  2P6T A;  2XAJ A;  3CUO A;  3FHZ A;  4UNO A;  3BY6 A;  3FXR A;  1B1B A;  1BI1 A;  2MBF A;  3WGG A;  4B8X A;  2W57 A;  2VE8 A;  3KCC A;  1XCB A;  3L7W A;  4YG2 F;  5CVR A;  1OMI A;  4R8H A;  1IF1 A;  5HLH A;  2QUF A;  2QEN A;  2RDP A;  4AWX B;  2EFN A;  2MD5 A;  2V1D A;  1OYW A;  3F8N A;  1PDN C;  2A5Y B;  5ICC A;  1HQC A;  1HKQ A;  2FA5 A;  1IN6 A;  2HR3 A;  1KQ0 A;  3J80 Z;  1S7O A;  4LB6 B;  3M8E A;  3COA C;  5L3C A;  2QM3 A;  5ILV A;  2ETH A;  3TDU C;  3E5Q A;  4IRH A;  3DXJ F;  3ZQ7 A;  3WTX C;  5HS9 A;  1EH7 A;  1QO0 D;  4LK1 F;  4PCQ A;  3DKW A;  4HLY A;  1IN8 A;  5D5U B;  1XSD A;  1H9G A;  5LBQ A;  4G8X A;  2ISY A;  4JK1 X;  1L3L A;  3E5X A;  1R36 A;  4Y15 A;  3GO5 A;  5L3B A;  2V6C A;  3H3U A;  2GAU A;  2W25 A;  1AWC A;  5BOX A;  4Q4Z F;  1D5V A;  2RQP A;  1STZ A;  1ODD A;  2OZU A;  1VTN C;  1FC3 A;  2ZNY A;  1RUO A;  4N0B A;  1MJB A;  2KRF A;  4LGW A;  3QU6 A;  1W4M A;  1XGS A;  2L01 A;  1JHH A;  4NQW A;  3BPX A;  1RI7 A;  2LSO A;  3QP5 A;  4KN7 X;  4PDK A;  4NB5 A;  4HW0 A;  2CFX A;  3C7J A;  3WGH A;  5K5O A;  4IVN A;  2KIF A;  2O0Y A;  1KGS A;  3R60 A;  2LKP A;  4DNC A;  3GW2 A;  3NRV A;  3KLO A;  3GFJ A;  1KA8 A;  2K86 A;  5E1W A;  4P55 A;  3ML6 A;  3F8F A;  3KP3 A;  4MNU A;  1P4A A;  2CGP A;  4Y17 A;  4WXD A;  4OIR F;  1J7K A;  2CG4 A;  2C6Y A;  3KE2 A;  4XSZ F;  1MJA A;  4M6Y A;  4LLL A;  1BJA A;  4KIG A;  3N97 A;  3BZ6 A;  1XN7 A;  1KU2 A;  2Q2E A;  3LA3 A;  4MEY F;  3JSO A;  4FX0 A;  1TNS A;  4ZZD A;  4KIF A;  5AIP A;  3ZMS A;  1P92 A;  1RIO H;  4ZH4 F;  2D1H A;  1MKM A;  1FP2 A;  3ZMV A;  5LGT A;  4OOI A;  4KYW A;  2GA2 A;  4JBA A;  4A0Y A;  1HKS A;  1D8J A;  3QAH A;  1ZRF A;  2H94 A;  3M7G A;  2ZXJ A;  4A12 A;  2P5V A;  4G7O F;  5D4R A;  1BC8 C;  4UVC A;  4AIH A;  3EYY A;  1FSH A;  2VOP A;  1MGT A;  1XMK A;  1K78 A;  4U0W A;  1TQP A;  4F7Z A;  4G6Q A;  1O3T A;  2UXN A;  4WXC A;  2DK5 A;  2ESN A;  1ZHF A;  2LNB A;  4ZYE A;  1LDJ A;  1SD6 A;  4I0B A;  4HF1 A;  1ONV A;  1XDU A;  2HTJ A;  1KU3 A;  2PBI A;  3I59 A;  1ZGA A;  3F6V A;  2DFI A;  1RZ4 A;  3QPT A;  2XVC A;  5K5R A;  4LJZ F;  4RAZ A;  2Y0M A;  3IRQ A;  2W24 A;  2IVM A;  5L3D A;  1HXD A;  1TW2 A;  4LB5 A;  4BYY A;  2JZY A;  4RGR A;  2DAO A;  4IHT A;  3ZN1 A;  1SFE A;  4EGY A;  4NHJ A;  1UB9 A;  2OU2 A;  3PQK A;  2JPB A;  4BHC A;  1HSJ A;  3M1E A;  4S04 A;  2EK5 A;  2P5K A;  1FYL A;  1I1S A;  2HFH A;  4I98 B;  3AAF A;  1RNL A;  5DEQ A;  5A2Q Z;  1LVA A;  1ON2 A;  3B02 A;  5ILU A;  2ZO4 A;  3C18 A;  4LG0 B;  3HHG A;  3PFI A;  4KUM A;  1W7P B;  3HIF A;  3KZZ A;  2XHK A;  3OOP A;  4GXO A;  2ZCW A;  3VEP A;  4R79 A;  5FGM A;  4LLN A;  5HVQ C;  1HW1 A;  2R7F A;  4IF4 A;  3RYR A;  5D5W B;  4OMZ A;  5L3F A;  2IA2 A;  1YQA A;  3C3W A;  3V7S A;  2IRF G;  2M30 A;  3WE3 A;  4UV9 A;  4GGG A;  1WKM A;  5BMZ A;  3R0A A;  2E1N A;  1USS A;  3TO7 A;  5TRD A;  2MA3 A;  1R7J A;  1IN4 A;  1OKR A;  2PI0 A;  3JSP A;  2L54 A;  1O57 A;  4RGS A;  3CUQ C;  2YX4 A;  1Q1H A;  4L5I A;  5KK1 A;  1U2W A;  2FOK A;  5LHI A;  2A6E F;  2HYF A;  2ZBK A;  3FM3 A;  4U7D A;  2D45 A;  2UZK A;  3J81 Z;  1Z9C A;  2Y48 A;  4N9I A;  3HUG A;  2COM A;  4KIC A;  1YW9 A;  3GFM A;  5ICF A;  1YS6 A;  5D8K B;  5BS6 A;  1F4K A;  1PP8 F;  1FYM A;  1ULY A;  4L18 B;  1ZRE A;  3LWF A;  5E18 F;  5IT9 Z;  1WSU A;  4EJW A;  1P4W A;  4RB0 A;  4BNC A;  3I53 A;  2CW0 F;  1BM9 A;  2JRT A;  4N9H A;  3PQJ A;  1EH6 A;  4A6E A;  5K5Q A;  4L0Z B;  3I58 A;  1D3Y A;  3SZT A;  4CDG A;  3SZP A;  4KDP A;  2O3F A;  3GWZ A;  4HAM A;  5IT9 K;  1TTY A;  2PN6 A;  4GCV A;  5FLX K;  3CLO A;  4XSX F;  4KT5 C;  1R00 A;  2L02 A;  1XCV A;  1Z1D A;  2FBK A;  3T8R A;  2RGV A;  3EQL F;  2IT0 A;  2UWM A;  2QBY A;  4IJA A;  2XRN A;  3CJN A;  5E1X A;  4B09 A;  3GYH X;  3U2R A;  1CF7 A;  1XGM A;  1UHM A;  5J8F A;  2KKO A;  5EEH A;  1E17 A;  2OQG A;  1OYI A;  3ZMD A;  2XV4 S;  1TW3 A;  1U5T B;  3F8B A;  4ZZL A;  3RIR A;  3VB2 A;  1G3S A;  3R6S A;  3J7A O;  3ELK A;  3DP7 A;  5FB2 A;  4XRF A;  4HF0 A;  1DUX C;  2OQR A;  2P4W A;  1FBS A;  1Z7U A;  3V7R A;  3HTS B;  1L0O C;  5EEG A;  2FSW A;  3I71 A;  3WG9 A;  1I6X A;  3DQV C;  1U78 A;  2FF4 A;  1BIA A;  2HZT A;  2LF7 A;  2XAQ A;  3T1B A;  1O7F A;  4LLG F;  4I02 A;  5JI6 A;  1SD5 A;  1QPM A;  5L3G A;  1CGP A;  2A6H F;  3BRO A;  1TLH B;  3TDZ C;  1XDS A;  3V8K A;  4FHT A;  3ZMZ A;  5J6X A;  2HEO A;  2P7C B;  3WTW C;  4M73 A;  4IRI A;  2F5E A;  2Z99 A;  5FD5 A;  3IKV A;  4UVB A;  3CUQ A;  3RKX A;  3SXY A;  1ZH5 A;  4UUV A;  1SD4 A;  4L5J A;  4HLX A;  2FXA A;  2PMH A;  3GXO A;  3KET A;  1Z6T A;  1IXR C;  1UST A;  4A0Z A;  3WTZ A;  4CXF A;  5LEJ A;  1WWX A;  3R4K A;  4A0X A;  2XGX A;  2OZ6 A;  2Z3Y A;  2PLY A;  3HRU A;  3JW4 A;  5J8C A;  3JAM K;  2XKP A;  4EJV A;  4AIJ A;  3FXU A;  4HA8 A;  2XAH A;  3KP4 A;  5CLS A;  2M8E A;  4U88 A;  3MCZ A;  2OA4 A;  4O3M A;  2M45 A;  1K78 B;  4OIP F;  3CO7 C;  1S8N A;  2DO7 A;  2HTS A;  1OYY A;  2QQ9 A;  2PJP A;  3BJO A;  1ZGJ A;  2ZJ2 A;  3E5U A;  2HOE A;  3GLX A;  4O5V A;  5HLG A;  3V4G A;  4HYE A;  4HZF A;  2L4A A;  2M1B A;  2GZW A;  2CQK A;  2G7U A;  3H3Z A;  3U9G A;  3DPL C;  3U1D A;  2OD5 A;  3RTR A;  1W5T A;  2XRO A;  1I5Z A;  4HQM A;  4YII A;  2W84 A;  1U5T A;  2YX7 A;  1YW7 A;  1H9T A;  2DQL A;  3HSF A;  4KMU X;  1BC7 C;  5DV5 A;  2BV6 A;  1HKT A;  4LD5 A;  1WRJ A;  2ZME B;  5BPD A;  2DU9 A;  3J81 K;  1G4D A;  3SFZ A;  5A2Q K;  4CHU A;  3K0L A;  3BJ6 A;  1HST A;  5HS7 A;  2VBW A;  2D1V A;  1K6O A;  3P9I A;  3K1N A;  2YU3 A;  3BDD A;  2ZKZ A;  3VOD A;  4RS8 A;  3HHH A;  4IHS A;  2XUB A;  5D5X B;  2Z5U A;  4P9U A;  2FBI A;  5LRR A;  2LF8 A;  1HW5 A;  2P8T A;  2M5W A;  1OPC A;  2ZFW A;  3ZP5 A;  1YIO A;  2DPU A;  1K79 A;  3TGN A;  1J0R A;  5ICG A;  5HDN A;  5DYM A;  2EA2 A;  4K2E A;  4M9S A;  3WTV C;  2NNN A;  3ECH A;  3M8F A;  1D8K A;  1JGS A;  1S3J A;  3FMR A;  1XB4 A;  3HSE A;  3Q5F A;  3FMQ A;  2IW5 A;  2P7V B;  3ECO A;  2WTE A;  2KJC A;  3BP8 A;  2E7W A;  4M9X A;  1R5H A;  3HTU A;  1MD0 A;  2B0L A;  3K9T A;  1MDM A;  1YTY A;  3HSR A;  3HOT A;  5H6Q A;  3KZY A;  4M71 A;  2LDU A;  1O3R A;  1KYZ A;  4G6D A;  5AON A;  1QGP A;  2VC0 A;  1IAW A;  1EV7 A;  2D2W A;  3HRM A;  1LNW A;  2XIG A;  1R1U A;  5KVR A;  2PEX A;  3TQN A;  1FSE A;  3F21 A;  5JVT A;  4EM2 A;  2OAZ A;  2HKO A;  2FQ3 A;  3IHU A;  3E6C C;  3LA2 A;  3T0Y A;  4XBF A;  3F8C A;  1UFM A;  3GEZ A;  2R3S A;  4EGZ A;  2RNJ A;  4KMF A;  1REP C;  5CVI A;  3QPH A;  1TNT A;  2STW A;  2F5C A;  5D4S A;  3BOQ A;  3ISP A;  2KJB A;  2H6B A;  2PG4 A;  1YS7 A;  3H92 A;  4EJT A;  3JTG A;  4RB1 A;  2F5F A;  1U5T C;  2DBB A;  2XKO A;  5LHH A;  2HS5 A;  4Q47 A;  1O3S A;  4ZYH A;  5DDG A;  4P5O A;  2L4M A;  1W5S A;  5HLI A;  1AOY A;  2X4H A;  4YFN F;  2EFQ A;  5HDK A;  5LGN A;  2Z33 A;  1NHA A;  3V7C A;  1SFX A;  4I01 A;  3L09 A;  2VT2 A;  3I64 A;  2J5O A;  2V1X A;  4BQA A;  2JPC A;  2H09 A;  4HBL A;  3TO9 A;  1LEB A;  2PMU A;  3E6D A;  2XAS A;  1F1Z A;  2EJR A;  2YR2 A;  2R7D A;  5FLX Z;  4I7H A;  1YG2 A;  2IJL A;  5LRS A;  2HYG D;  5BQT A;  1R22 A;  4UHT A;  2RKH A;  3ZPL A;  2E7X A;  3JTH A;  1T6S A;  1G3W A;  5E8G A;  1ZLK A;  4MTD A;  4P9F A;  3T8T A;  3FWE A;  4L9N A;  5H20 A;  4AD9 A;  3LQR A;  1IN7 A;  4R1H A;  4WF2 A;  3EDP A;  3RKY A;  1J75 A;  2ADU A;  3K1M A;  1RUN A;  3K1P A;  3WTY C;  4GYI A;  2DK8 A;  5CJ9 A;  3DFG A;  3FXQ A;  2O61 A;  5D6E A;  1JE8 A;  1XGO A;  3KP5 A;  2NYX A;  1T2K A;  5DD4 A;  3CDH A;  3QP6 A;  2P6S A;  3RPQ A;  1QQI A;  3VFZ A;  5DD8 A;  2Z9O A;  2ACJ A;  1B4A A;  1W7P D;  3ABU A;  4EM1 A;  4PGH A;  3E6B A;  4TV7 A;  5E8I A;  1QZZ A;  5K1Y A;  3TOB A;  3C1D A;  2PQ8 A;  5BPI A;  2P5L C;  1XD7 A;  3ZMT A;  2OBP A;  1XSX A;  1KQ8 A;  1B6A A;  1XMA A;  2FML A;  3DPT A;  5FO5 A;  3G3Z A;  4CYD A;  3GVA A;  3WU0 A;  4BH9 A;  1DDN A;  3GUD A;  3ULQ B;  3E97 A;  4EVI A;  4A5N A;  5F64 A;  2WWY A;  2JSC A;  4M6X A;  2VBX A;  5HS8 A;  3QRF F;  2VBY A;  1KU7 A;  1FLI A;  2DI3 A;  2G7H A;  2FEZ A;  2G9W A;  2ZNZ A;  4HX8 A;  3Q9S A;  4EJO A;  4HF2 A;  1O7L A;  1ZRD A;  3T5X A;  3F8M A;  3IWF A;  4WX9 A;  1KQ9 A;  2E1C A;  1F9N A;  3EUH A;  4EJU A;  3F22 A;  4OIN F;  4GYG A; 
#chains in the Genus database with same CATH topology
 5B3S H;  1FYK A;  2F4I A;  3MKL A;  1B9N A;  2HPI A;  2BE5 F;  2QQB A;  2HDD A;  4BHP A;  5CVU A;  4A3M J;  1S29 A;  1UJ8 A;  5E79 C;  4KIB A;  1I3Q J;  2K9N A;  3O2P E;  4HX7 A;  2ME0 A;  2J5P A;  2EV5 A;  4CCJ A;  2K4J A;  1T33 A;  2H8W A;  4HPQ A;  1Z77 A;  1V55 H;  2QKM B;  4CCL A;  4MGR A;  3BQZ A;  3IRR A;  2ISZ A;  1JXS A;  5IYC J;  3QWL A;  4OAY A;  5LGU A;  2VJI A;  5HDG A;  3HYI A;  4HV6 A;  3I5U A;  3CJQ B;  2Z16 A;  4CZZ A;  3OYJ A;  1RKW A;  2JA6 J;  3K69 A;  2UXX A;  2VKH A;  2DDA A;  3MD2 A;  1X3W B;  2BY2 A;  1TBX A;  2CO5 A;  1LDK B;  1APL C;  2FE3 A;  1DP3 A;  1ZYR F;  4IPA A;  2A3S A;  3OYK A;  1KYW A;  1WJD A;  2OF7 A;  3IWZ A;  4KNY A;  1P4X A;  2TDX A;  4UB8 C;  3JRH A;  3GF2 A;  2AQF A;  4WXH A;  1Y0U A;  2HXO A;  2V1U A;  2WV0 A;  3JRE A;  3H5N A;  5DCF A;  4H0E A;  1WQ2 A;  2Q0O A;  2Y9Y A;  1ETW A;  3VYT B;  3A01 B;  2FX0 A;  1G3T A;  1DP7 P;  1MNM C;  2DJI A;  2ELH A;  1A04 A;  3FKJ A;  1NK2 P;  4UVA A;  3DV8 A;  1B59 A;  2FMY A;  4XOT A;  1Y0N A;  4U0Y A;  4FX4 A;  4FCY A;  1J9I A;  3L2V A;  3V8L A;  3IL2 A;  1FNN A;  3HPG A;  4S05 A;  2F5V A;  1F36 A;  1S7A A;  2CQQ A;  4B1R A;  3LSR A;  2EZK A;  5J1U A;  3ROU A;  2K9Q A;  3BTJ A;  3FXJ A;  3MZY A;  3Q0U A;  3ZQQ A;  4A5M A;  5H2F C;  3CCJ I;  2OTL I;  1FEX A;  4XKC A;  3QQA A;  3GFI A;  5E3M A;  1HA8 A;  2W4S A;  2X9D A;  4ETS A;  1ZAR A;  2H6C A;  2GIV A;  4PJM A;  5FKM A;  2A61 A;  1IUY A;  2AHQ A;  3DF8 A;  5IP9 J;  3EET A;  2RQQ A;  3I0T A;  4MEX F;  1YW8 A;  2LFB A;  4HOB A;  1BJZ A;  1BOA A;  1VQ9 I;  2DA1 A;  2ZFU A;  2O8X A;  4FT8 A;  1XGN A;  4A3D J;  2QWW A;  2K40 A;  1X58 A;  1RR7 A;  2HNH A;  3GZ5 A;  1YFH A;  2E60 A;  3K4K A;  1G6N A;  4BAY A;  1J59 A;  2A07 F;  2X0L A;  3Q3S A;  3J80 K;  3BTI A;  3LMM A;  1OCP A;  2FNP A;  3ZMU A;  3GTL J;  1S5L C;  3S93 A;  5LEK A;  1I50 J;  3K7A J;  3LSI A;  5HLT A;  5GPC A;  1K7A A;  1WJ5 A;  4XOR A;  1T56 A;  3GX4 X;  3CUQ B;  1WJB A;  1ON1 A;  1OFC X;  4QIW N;  3LAJ A;  3O3K A;  1YIT I;  2PFB A;  4U7B A;  1UHW A;  1E3P A;  2QQA A;  4A3K J;  3C2B A;  2X6Y A;  2A69 F;  1HW2 A;  1OJL A;  1ITY A;  1FOY A;  2RNG A;  1UMQ A;  2O8K A;  1QZY A;  2M87 A;  3IKT A;  2KDO A;  4MTE A;  4C9Y A;  2JA5 J;  2A68 F;  1MSE C;  2HOT A;  4I2O A;  4MHG A;  1QBJ A;  3LA7 A;  1MIJ A;  3O8G A;  5HNF A;  4IZZ A;  1W36 C;  5CVJ A;  2ZME C;  4IHY A;  1P6R A;  1X1D A;  1MZB A;  4Q48 A;  1W5C C;  1IJW C;  1R1T A;  2M7A A;  3OY9 A;  2PMZ A;  3P7N A;  1VI0 A;  4X0G A;  2IAI A;  2CWE A;  4ENN A;  2DXI A;  1OR7 A;  3DEU A;  2AS5 F;  3BR5 A;  3HOS A;  3GTJ J;  3SEZ A;  2STT A;  1WH5 A;  1HC8 A;  1DPU A;  3RKQ A;  1ZK8 A;  2DA4 A;  3NAR A;  2IS2 A;  2JA7 J;  2E5Z A;  4JQF A;  3IP4 B;  3M9A A;  2VPR A;  2LBF B;  1T98 A;  2VAS A;  2ZJP F;  4M72 A;  3CDI A;  2KP6 A;  4XLF A;  1AU7 A;  1YJN I;  1H89 C;  3E1S A;  3K6G A;  2GOM A;  4IXA A;  3ABT A;  4E7K A;  3TO6 A;  3DTE A;  3MQ0 A;  2DMU A;  3RCO A;  4ITV A;  3PJR A;  3OV8 A;  3FXM A;  2JJ7 A;  2XGE A;  3FF5 A;  1BR4 A;  5DUI A;  2O6G E;  1Z3Y A;  1VQO I;  2R5Y B;  4M6V A;  3KEO A;  2CSO A;  1O3Q A;  2WBM A;  3PSF A;  1T39 A;  2NAZ A;  5DCM B;  3SHF A;  3PO2 J;  1D1C A;  4OIQ F;  1WI9 A;  1MND A;  2EB7 A;  4XKW A;  2LC2 A;  1GXQ A;  3L9F A;  2BVL A;  4A2U A;  5KHD A;  1X4O A;  3JRF A;  4ENJ A;  2QA4 I;  3UKG A;  4Q5S F;  1BN5 A;  1I1G A;  1XX5 A;  2GOX B;  1WCM J;  2GXG A;  5TGT A;  3F72 A;  1X1B A;  3L00 A;  1V5E A;  1PP7 U;  3KP6 A;  5LHG A;  3TBI A;  2VL8 A;  2AQE A;  2NNY A;  5DM7 F;  1HBX G;  2VXD A;  3W6K B;  4HRI A;  2DOE A;  4AYB N;  1GDT A;  4G7H F;  1YOV B;  1LFP A;  4NBQ A;  2XF7 A;  4L9V A;  2FD5 A;  5E3O A;  4KA4 A;  2V6E A;  4OMY A;  3I4N J;  4FTH A;  3GLL A;  3GZ6 A;  3H9J A;  3IH4 A;  5D6F A;  3B6A A;  3E6M A;  3OYH A;  2MD0 A;  2KPM A;  3HRS A;  4U0V A;  3FIW A;  2B9S A;  2KIM A;  4E70 A;  1ZG5 A;  3CCM I;  1BBY A;  1W1W E;  2I8D A;  2MC3 A;  5FD6 A;  5CVV A;  4PJJ A;  3F3X A;  2OC6 A;  3SQN A;  4D0P A;  3E3V A;  1X3U A;  3AG2 H;  3I59 B;  1Q1V A;  5E20 A;  4O6J A;  1LE8 B;  1H0M A;  2JN6 A;  3HGY A;  2HXI A;  2FBH A;  2HVR A;  1NG6 A;  3M1C A;  5CKT A;  4CGZ A;  1EA3 A;  2DFF A;  2RAE A;  3OYM A;  3W6J B;  2M3A A;  5F1R A;  2QVO A;  2LY1 A;  3IUO A;  2CUJ A;  2MH2 A;  4BHB A;  1YYV A;  3MZH A;  2MLK A;  3MKW B;  2EA4 A;  5IT3 A;  4WK8 F;  3WTU C;  1FY7 A;  1WPK A;  3BC8 A;  5H6R A;  3RI4 A;  2H1K A;  3MFK A;  2HWV A;  1X3Z B;  2K5C A;  2FU4 A;  3TMO A;  5D8L B;  2DQR A;  2LY2 A;  3OS0 A;  4RB2 C;  2EFW A;  1FBU A;  3LAP A;  4DIQ A;  4RM3 A;  4CO8 A;  4V2G A;  2K4B A;  4RB3 C;  2JQ7 A;  5TJJ A;  5AIQ A;  4HDU A;  3CD6 I;  1Y8Q B;  2VJ5 A;  1GXP A;  5HOO A;  4DYR A;  4C3I J;  5D5V B;  2LVS A;  5E17 F;  3BG9 A;  1FZP B;  1KZH A;  5CPR B;  1E2X A;  1MJ9 A;  4A3J J;  3DU5 A;  4ZJZ A;  1YLF A;  3EUH C;  4XRS G;  1LDD A;  3CCV I;  4AIK A;  5ERI A;  4IEJ A;  5JR3 A;  1TQI A;  3DPU A;  3QU3 A;  2CU7 A;  4BL0 B;  3GZN B;  3S2W A;  1IZ1 A;  1QZE A;  2DLL A;  2EV0 A;  2JT1 A;  2CMP A;  3FDY A;  2LYC A;  3F6O A;  1A31 A;  5FLV A;  4Z6Y A;  3RYP A;  3ZN0 A;  1R58 A;  2PJR B;  3EYI A;  3IC7 A;  1N78 A;  3OYE A;  1XSV A;  2KMU A;  4W97 A;  3V8J A;  5F0F A;  3AFH A;  1T0F A;  2W48 A;  5L3E A;  2VN2 A;  3FXO A;  3G1O A;  1KON A;  4MQ9 F;  3LFK A;  2RV8 A;  3NQO A;  3CCL I;  1FT9 A;  4Y4R A;  3BR6 A;  4LMY A;  2BEO A;  3BWG A;  4C2M J;  4M9Z A;  3FX3 A;  5LLQ A;  5EG0 A;  3X2Q H;  2NS0 A;  2DOF A;  3KLN A;  4XLP F;  2KIU A;  4BEH A;  2QZ8 A;  4EQQ A;  5E1Z B;  1OCO H;  4HSR A;  3UNG C;  1IRX A;  4A3F J;  4L9J A;  4RAY A;  1R5G A;  4RA2 A;  4G9Y A;  4XN3 A;  1LEA A;  1AA7 A;  4XKV A;  1TT0 A;  5ICE A;  2EIL H;  3ERE D;  1VQ8 I;  3VSL A;  1P7I A;  2K9L A;  4UUT A;  3IV5 A;  1RR8 C;  3BJA A;  2X48 A;  2DA6 A;  2IP2 A;  2BHY A;  2M2E A;  2K02 A;  1VF9 A;  3H9Q A;  2VIX A;  1QHH D;  2GIZ A;  3D0S A;  5JHU A;  4ESJ A;  1I27 A;  4QPO A;  3VPR A;  1X1C A;  2KZV A;  2V9P A;  3HM5 A;  1UHS A;  1ETV A;  1B9M A;  3O6B B;  1RET A;  2WY8 Q;  3O8H A;  2MH9 A;  5JFR A;  2VT3 A;  4DQ2 A;  3PL8 A;  1JI8 A;  1ZG1 A;  2RC4 A;  2K9M A;  3FBI B;  1VFC A;  1ETQ A;  2EFO A;  2KIQ A;  2L7K A;  2V9V A;  2K9S A;  2CUZ A;  1ZRC A;  4P1W A;  4ESB A;  2VQL A;  4RGU A;  3CP2 A;  4UY8 I;  5DTD A;  2IA1 A;  2QYO A;  1GVD A;  3QOD A;  2VBZ A;  4HDV A;  1X2M A;  2QBY B;  5BNG A;  3C2H A;  2DOD A;  3RPU D;  2VE9 A;  1PJR A;  4I0A A;  3ZQL A;  2VC1 A;  1KU9 A;  3HDD A;  1MBJ A;  1F43 A;  1SMY F;  1Z05 A;  4AVP A;  3WU1 B;  3OSG A;  1U6G A;  4LFU A;  4HQE A;  2DFH A;  4KIS A;  2HQN A;  4ZDL A;  2R0Q C;  4IHW A;  3HXL A;  1XG1 A;  3B6C A;  3NEU A;  3ZQC A;  2HQR A;  3HC7 A;  1CQT A;  4JYK A;  2ESH A;  4RGX A;  1DGR M;  3TOA A;  5IYD J;  4BE2 A;  1ZKG A;  4DZJ A;  3G73 A;  4ABZ A;  4BEH B;  2WC2 A;  2FNA A;  4PSW A;  3CC2 I;  2KQR A;  4PGG A;  3WGI A;  4LG0 A;  2COB A;  1ETO A;  2G0E A;  1CF7 B;  3N4M A;  2R7V A;  4ZTF A;  3K70 C;  2DMN A;  3W6V A;  3CO6 C;  4L0Y B;  2VOD A;  4BUP A;  1W7P A;  5DM6 F;  2F5D A;  3ZCO A;  1R6R A;  2HI3 A;  2K7L A;  3WTT C;  4L9T A;  3HOV J;  1FOK A;  1GVJ A;  4YIF A;  2E5N A;  2DA5 A;  1H8A C;  1FWZ A;  3I54 A;  3RDI A;  1MMN A;  1ZAO A;  1SFU A;  4ENM A;  2DA7 A;  4PFO A;  2XB5 A;  1Z91 A;  1SAX A;  3FM5 A;  1FMW A;  5J40 A;  4G6T B;  1ZN2 A;  2JA2 A;  1EKE A;  2RN7 A;  2XAG A;  3EUA A;  2LK2 A;  3H3V K;  3S2D J;  3CZ6 A;  3OYD A;  3ABK H;  1IW7 F;  2CUE A;  3D5R C;  3CCS I;  3JRG A;  4M3B A;  4OU0 A;  1V4R A;  3DBL B;  2VOO A;  2E71 A;  2RVC A;  1VQM I;  4IOA F;  1TQM A;  4PSX A;  2XGC A;  4AM3 A;  1PUE E;  1SD7 A;  2L9S A;  5FFZ A;  4WWC A;  2YSR A;  4EV0 A;  5EYR A;  2IPQ X;  1G3Y A;  4GFB A;  2GQQ A;  3S1R J;  2CRG A;  2CYY A;  2ECB A;  2YPR A;  1YO5 C;  1A6I A;  1DPR A;  2DT5 A;  1P2F A;  1T0F C;  3FMS A;  3LST A;  5CYV A;  5B1A H;  1K4T A;  3K2Z A;  3QPL A;  3NAU A;  4A6D A;  1U8R A;  2Y30 A;  1T38 A;  4XLN F;  3S1M J;  1POG A;  3P9C A;  4M74 A;  2R4G A;  2R93 J;  2ZC2 A;  4AYB A;  4HV5 A;  4N4N B;  4QWQ A;  4I09 A;  2GXB A;  3ZQF A;  2XSD C;  1BIB A;  3DKY A;  2B7E A;  3R61 A;  4KT6 A;  1YRN B;  1BI2 A;  3GFL A;  2BY0 A;  2IGM A;  3RJP A;  2F2E A;  3B73 A;  2LY9 A;  4YFK F;  5GTH C;  3PNT A;  2NRA C;  4G7Z F;  2XC7 A;  2EFP A;  1BI0 A;  1ETK A;  1LJ9 A;  3CTA A;  1LB2 A;  4DJA A;  1GHC A;  4BY7 J;  2V9K A;  4IRG A;  1VQN I;  3WE2 A;  1X4P A;  5EGO B;  4A3I J;  3VYR B;  3UR3 C;  2HQ5 A;  3CMA I;  2EV6 A;  2FOW A;  2QLZ A;  4KFC A;  2GA1 A;  1Z67 A;  5DCM A;  2XPU A;  4XLH A;  1SVM A;  4MO7 A;  2WAD A;  4EMS A;  3QOP A;  4GRI A;  4CIC A;  1K4S A;  3TW7 A;  4BXU A;  4UV8 A;  3KEQ A;  4KN4 X;  4MLO A;  3VOE A;  3A03 A;  5FRM A;  3S17 J;  2K27 A;  4P96 A;  2M4G A;  1Z0X A;  2VJJ A;  4MFE A;  3ZGK A;  4ON0 A;  4PZJ A;  5F04 A;  3HZJ A;  3REO A;  3OIQ A;  3OIO A;  4EM0 B;  2ZME A;  1UCR A;  3IAS 2;  4ASN A;  3RKW A;  4BGD A;  5J47 A;  3D5L A;  3OYF A;  2R5Z B;  3BR2 A;  3RZD J;  3GCM A;  4HX4 A;  1K83 J;  2WAF A;  1QNT A;  4QTR A;  4ZYD A;  4YFX F;  1M1E B;  2AXT C;  3KP2 A;  4F52 A;  1R23 A;  5EZH A;  1JUS A;  2DTR A;  3LQQ A;  1WJA A;  3CCQ I;  3F23 A;  4B47 A;  3RPU A;  1LQ1 A;  2BBY A;  3KYD B;  3U21 A;  4ZDO A;  1LVK A;  4MQV A;  2X51 A;  3HOW J;  1R5I D;  3HOX J;  5F6F A;  3KP7 A;  4ENK A;  3MEX A;  2EWN A;  4D5F A;  1SEU A;  3MKZ A;  5CQE A;  4V19 K;  1IXS B;  2HDC A;  4ESF A;  3SDG A;  2DW4 A;  2VLA A;  3I4P A;  2XF6 A;  4E7L A;  1EF4 A;  2MLG A;  2H27 A;  1IO2 A;  1D0Z A;  4UXN A;  4WCG A;  1ZLJ A;  2DPD A;  2V79 A;  2XAF A;  2JTV A;  2W85 A;  1EH8 A;  5M5Y J;  1BI3 A;  3Q9V A;  1V3F A;  4AC0 A;  1OCT C;  3SFI A;  3I9V 2;  1FIP A;  3ZQI A;  2L3D A;  1Z6R A;  3JRD A;  2CV1 A;  1IC8 A;  1JKR C;  2GWR A;  5DS9 A;  3QYB A;  3L2C A;  1C0W A;  2V1N A;  5ED4 A;  2Y75 A;  3WOD F;  2HKX A;  4Z2Y A;  1F5T A;  3FK6 A;  1S6L A;  3R0J A;  4DYC A;  2O03 A;  3BPV A;  1Y39 A;  2BGC A;  1J09 A;  1K6Y A;  4PJN A;  5J1Y A;  1J2X A;  1ZG3 A;  5C4X J;  2FRH A;  1MDM B;  5J4V A;  3DLL F;  4Y13 A;  4B43 A;  1UG0 A;  1FPQ A;  1HDP A;  2LR8 A;  4I76 A;  2HGC A;  2HVQ A;  1JUM A;  3TP0 A;  5DUK A;  1JHF A;  1R1V A;  3HRT A;  1IRF A;  2VXZ A;  1U3E M;  2Z1D A;  3BTC A;  4FET A;  5ILS A;  5EGO A;  4JOM A;  2DN0 A;  1FP1 D;  2JVH A;  3MWM A;  4NNJ A;  2CW7 A;  1G8X A;  1U0J A;  1OR7 C;  5E3N A;  1VQ4 I;  1MBE A;  5KCM A;  3L2W A;  2VON A;  3KFW X;  4BJ5 C;  3JAM Z;  2EBI A;  4BDY A;  3MZ8 A;  1FX7 A;  3WTS C;  4II3 A;  4CCN A;  2GBY A;  3MAJ A;  2Q8K A;  1FBQ A;  5B1B H;  4ZYG A;  4LK0 F;  1G59 A;  5FFX A;  1B8I B;  3SEQ A;  3PUB A;  3KX2 A;  4GO1 A;  3EUK L;  5LFA A;  3OR2 C;  4KIT B;  3LNQ A;  3TKY A;  2IA0 A;  1IG7 A;  3LSH A;  1J5Y A;  2A5W A;  2Y9Z A;  2IGO A;  1Z21 A;  4G94 A;  1P7J A;  2AXL A;  1ZR2 A;  2K3P A;  1IN5 A;  1YJW I;  1IXC A;  4B3X A;  3P9K A;  3MKY B;  1T8I A;  1SMT A;  1IRG A;  4JX6 A;  2BYV E;  4XMY A;  6PAX A;  2X85 A;  4D5C A;  4QLC U;  3FZV A;  4E4H A;  4OIO F;  2P6T A;  2LMD A;  2XAJ A;  3CUO A;  3FHZ A;  4XID A;  1BW6 A;  2FQ4 A;  4UNO A;  3BY6 A;  3FXR A;  3IH3 A;  1B1B A;  1BI1 A;  2MBF A;  3WGG A;  4BU2 A;  4B8X A;  4JX5 A;  2W57 A;  4M3D A;  2VE8 A;  4NC7 A;  3KCC A;  1XCB A;  3CME I;  3OYB A;  2W7N A;  1PVE A;  3L7W A;  2KRC A;  4YG2 F;  5CVR A;  1OMI A;  4R8H A;  1BA5 A;  1OLT A;  5TIS C;  3K4M A;  1FIA A;  4F93 B;  4YIR X;  1IF1 A;  2XPV A;  4RLF A;  2W1O A;  1VQ6 I;  5HLH A;  3F0C A;  1W0T A;  4DYQ A;  4IX7 A;  2JUG A;  4RM2 A;  4A3L J;  2QUF A;  2LP0 A;  2QEN A;  2RDP A;  4CCK A;  3OYC A;  3OMY A;  2XPW A;  3HG9 A;  3M07 A;  4HG2 A;  5M3F J;  4AWX B;  2PX9 A;  2EFN A;  3LSP A;  2MD5 A;  3HBL A;  2V1D A;  1FTT A;  1OYW A;  5IP7 J;  3F8N A;  1PDN C;  2A5Y B;  5ICC A;  1HQC A;  1HKQ A;  3W2V A;  3SZG A;  2ZSH B;  2FA5 A;  2DT7 B;  1IN6 A;  2HR3 A;  2VQC A;  4H4K C;  1KQ0 A;  3J80 Z;  1S7O A;  3H36 A;  2KHM A;  3M8E A;  4LB6 B;  3COA C;  5EDN A;  5L3C A;  2QM3 A;  5ILV A;  1FJL A;  2ETH A;  3I56 I;  3TDU C;  3E5Q A;  4IRH A;  3DXJ F;  3ZQ7 A;  2QCO A;  3WTX C;  4CUG A;  2LLK A;  2VKV A;  3CLQ A;  2R5Y A;  2ZXH A;  5HS9 A;  1EH7 A;  1QO0 D;  2BW3 A;  4LK1 F;  4PCQ A;  4AID A;  3DKW A;  3FBN B;  4HNV A;  2JMW A;  4HLY A;  3ZRG A;  4BQN A;  1IN8 A;  5D5U B;  1XSD A;  3S3N A;  1H9G A;  4XLE A;  4OAZ A;  5LBQ A;  2VUM J;  1MH3 A;  4G8X A;  2ISY A;  4JK1 X;  4IOC F;  2ELK A;  1L3L A;  1WHU A;  2UV1 A;  3E5X A;  1R36 A;  3CF2 A;  4Y15 A;  3FXL A;  3GO5 A;  5L3B A;  2OTJ I;  2IS4 A;  2V6C A;  3H3U A;  4RAF A;  2GAU A;  2W25 A;  1IUF A;  4S0H B;  1S72 I;  1AWC A;  4X1E A;  2OCC H;  5BOX A;  4Q4Z F;  1HCR A;  1D5V A;  2RQP A;  3H35 A;  1STZ A;  1ODD A;  2KL4 A;  2OZU A;  1VTN C;  3H1C A;  1FC3 A;  2ZNY A;  1LKX A;  3FXK A;  1TT5 B;  3K10 A;  2MSY A;  1RUO A;  4N0B A;  1R9T J;  1MJB A;  2KRF A;  4LGW A;  3QU6 A;  1W4M A;  2XDV A;  3ZQH A;  3A01 A;  2PJR A;  1XGS A;  2L01 A;  1JHH A;  2ZXI A;  1X2N A;  4NQW A;  4DW6 A;  5F0C A;  4BDZ A;  3BPX A;  1RI7 A;  2LSO A;  3QP5 A;  4KN7 X;  4PDK A;  1LUJ B;  3RSN A;  4RMN A;  5E3L A;  1FTZ A;  3JRB A;  4NB5 A;  5GAD J;  3HOU J;  3PFY A;  4HW0 A;  2CFX A;  3C7J A;  4IO9 F;  3TL4 X;  2BXZ A;  1D1B A;  3WGH A;  2R7R A;  3I55 I;  4PJ0 C;  1NG7 A;  5K5O A;  4IVN A;  2KIF A;  2O0Y A;  1KGS A;  3R60 A;  2LKP A;  4HEA 2;  4DNC A;  3GW2 A;  1U9N A;  2ELJ A;  3NRV A;  4E6K G;  3KLO A;  4RBO A;  2WA0 A;  1KA8 A;  3GFJ A;  3A4C A;  1BW5 A;  2K86 A;  5E1W A;  4AU7 A;  5F08 A;  1U8B A;  1TWF J;  5F1J A;  1RPW A;  4P55 A;  2NVQ J;  3ML6 A;  1UAA A;  1G2H A;  3W2A A;  3F8F A;  3KP3 A;  1O4X A;  3HOY J;  4MNU A;  1P4A A;  3K4B A;  2CGP A;  2I5U A;  4IQJ A;  1JTY A;  4UB6 C;  5B66 C;  4Y17 A;  1RRJ A;  4WXD A;  4OIR F;  4BXX J;  1J7K A;  5EEA A;  2IS1 A;  2ZJR F;  1IV8 A;  2CG4 A;  1N77 A;  2C6Y A;  1WJC A;  2DT6 A;  5C44 J;  1ZEL A;  3KE2 A;  3BZK A;  1MJA A;  4M6Y A;  4XSZ F;  4LLL A;  1UG2 A;  1BJA A;  1ZTR A;  4KIG A;  5K7H A;  3N97 A;  2QSG X;  3BZ6 A;  1XN7 A;  2OCE A;  1KU2 A;  3DCF A;  1ETY A;  4G12 A;  2LOO A;  2Q2E A;  2Y69 H;  1S7E A;  3LA3 A;  3S15 J;  4XON A;  2NOG A;  4MEY F;  2Y0S A;  4J00 A;  5KNL A;  3HKZ A;  5M5X J;  3JSO A;  2ZXW H;  3ZR8 X;  1DQU A;  1V5F A;  2RRE A;  2R5Z A;  5B5E C;  3BR3 A;  4FX0 A;  2W82 A;  1TNS A;  4ZZD A;  1TL8 A;  3IAM 2;  4KIF A;  5AIP A;  3ZMS A;  1P92 A;  2EH3 A;  3VDX A;  1E3O C;  3AG3 H;  4XM3 A;  1RIO H;  4A3E J;  4ZH4 F;  1DU6 A;  2TCT A;  2D1H A;  1MKM A;  1YX5 A;  1FP2 A;  3ZMV A;  5LGT A;  2Y2Z A;  2ID6 A;  4OOI A;  4KYW A;  1S9H A;  2BY3 A;  2VI6 A;  3ASN H;  4QSH A;  3DBH B;  3DBR B;  2GA2 A;  5JHF A;  2QSF X;  5IYB J;  2Y0S N;  4JBA A;  4PJL A;  3JRA A;  4A0Y A;  1HKS A;  3BG5 A;  3GBG A;  4ZC3 A;  3FKI J;  2LTP A;  1D8J A;  2OJE D;  2CW8 A;  3QAH A;  1VQ7 I;  1ZRF A;  4XR6 A;  2H94 A;  3M7G A;  2ZXJ A;  3DU6 A;  2HYJ A;  4A12 A;  2P5V A;  4BBR J;  4G7O F;  2XSJ C;  4ANJ A;  3PIP F;  2M4K A;  1VQL I;  2WB1 N;  5D4R A;  1BC8 C;  2MW8 A;  1ORK A;  4W1U A;  4BXF A;  4CCO A;  1ZR4 A;  2F4M B;  3LFU A;  3OL4 A;  5JVG F;  1MH4 A;  2WAE A;  3HPH A;  1E3H A;  3PSI A;  1ACI A;  4UVC A;  4AIH A;  1JKQ C;  3EYY A;  1QVU A;  2L9V A;  2VJ4 A;  1FSH A;  1SAN A;  1TWA J;  5CQG A;  2VOP A;  4XK4 A;  1MGT A;  2MC4 A;  1OCR H;  1XMK A;  2X6W A;  2L2O A;  3H5A A;  1YRN A;  2ZJQ F;  1K78 A;  4U0W A;  4Y7N J;  1JT6 A;  1TQP A;  4F7Z A;  3BG6 A;  1BR2 A;  5GAG J;  4G6Q A;  1O3T A;  2UXN A;  4WXC A;  2OV7 A;  4IL6 C;  2DK5 A;  2ESN A;  4IHX A;  2B63 J;  5K7F A;  1ZHF A;  2LNB A;  4ZYE A;  1LDJ A;  3PO3 J;  3OWT A;  4D7M A;  1SD6 A;  2DA3 A;  3I3L A;  4A3C J;  4I0B A;  4HF1 A;  4DBQ A;  1ONV A;  1XDU A;  2HTJ A;  1KU3 A;  2PBI A;  3I59 A;  1TWC J;  1ZGA A;  3F6V A;  3WHB A;  2DFI A;  1RZ4 A;  3QPT A;  2XVC A;  4D7N A;  5IPA A;  4LJZ F;  5K5R A;  3GTK J;  4RAZ A;  2Y0M A;  2CJJ A;  3OL3 A;  1PUF A;  3IRQ A;  2MGQ A;  1R49 A;  2W24 A;  2IVM A;  5L3D A;  5M5W J;  1HXD A;  1TW2 A;  4LB5 A;  1JGG A;  4BYY A;  2FUG 2;  2JZY A;  4C2T A;  2AO9 A;  4RGR A;  2DAO A;  4IHT A;  3ZN1 A;  1VZ0 A;  3RQ4 A;  1SFE A;  3S1Q J;  4EGY A;  2M7B A;  3CF5 F;  1H88 C;  1A35 A;  4NHJ A;  1UB9 A;  2OU2 A;  3PQK A;  2JPB A;  1SVO A;  3VSK A;  3MVP A;  1MMD A;  1HSJ A;  3M1E A;  4B3A A;  4BHC A;  3TED A;  3M4O J;  2L9R A;  4S04 A;  1A5J A;  2F4O B;  2X6X A;  4M3E A;  2EK5 A;  2P5K A;  2YS9 A;  1FYL A;  1VQK I;  1I1S A;  2HFH A;  4I98 B;  4BE1 A;  2E35 A;  3AAF A;  1QPI A;  2IS6 A;  1RNL A;  4CYC B;  5DEQ A;  4F91 B;  5A2Q Z;  3KYC B;  1LVA A;  3F9K A;  5EZG A;  4HST A;  4OWR B;  1HDD C;  1ON2 A;  3B02 A;  4N4O B;  1WJE A;  5ILU A;  2ZO4 A;  3JCU C;  3C18 A;  4LG0 B;  3HHG A;  3G1L A;  3PFI A;  2NVY J;  4KUM A;  3CMM A;  1W7P B;  1Z7L A;  4CSW A;  3SDB A;  3OSF A;  2GXA A;  2R7Q A;  3HIF A;  1JKO C;  3KZZ A;  2XHK A;  2WV1 A;  3OOP A;  4RAG A;  2NXN B;  4GXO A;  2ZCW A;  1AKH B;  3VEP A;  4R79 A;  5FGM A;  2IEK A;  1B72 A;  4LLN A;  1R71 A;  2WAQ A;  5HVQ C;  1HW1 A;  1ERD A;  2ICW G;  2R7F A;  4IF4 A;  2Q1Z B;  3RYR A;  3TW6 A;  4GDF A;  2HOS A;  5EJC A;  5D5W B;  4OMZ A;  5L3F A;  2IA2 A;  1YQA A;  4FE7 A;  3C3W A;  2KIS A;  3V7S A;  3S8P A;  2IRF G;  2M30 A;  3FK7 A;  2HZD A;  3WE3 A;  4L5E A;  1MBG A;  4FQG A;  4UV9 A;  4GGG A;  1WKM A;  2NS7 A;  5BMZ A;  3R0A A;  4XKB A;  4CCM A;  1WFX A;  2E1N A;  2KRH A;  1USS A;  4E7Z A;  3TO7 A;  1VND A;  1QU3 A;  2CQN A;  5TRD A;  5IY5 H;  1PYV A;  2MA3 A;  2DA2 A;  2XGD A;  2KDZ A;  1R7J A;  2KT0 A;  4BQQ A;  4I6Z A;  2LKX A;  3LSM A;  3D5S C;  5HNH A;  5FRO A;  1IN4 A;  3H0D A;  1OKR A;  3OR1 C;  2PI0 A;  1FOW A;  3JSP A;  2L54 A;  1O57 A;  1OQY A;  3GME A;  4RGS A;  1SVL A;  1MBF A;  4XIC A;  1Z3X A;  3CUQ C;  2YX4 A;  1Q1H A;  3OYI A;  2BXY A;  4L5I A;  2VB6 A;  2P81 A;  3S3O A;  5KK1 A;  1U2W A;  2FOK A;  5LHI A;  4FAS D;  2A6E F;  2HYF A;  2ZBK A;  3FM3 A;  2E2I J;  1DU0 A;  4U7D A;  4OIN F;  2D45 A;  2UZK A;  2CQ7 A;  3J81 Z;  4YEJ A;  2XB0 X;  1Z9C A;  2Y48 A;  4N9I A;  2WB1 A;  3HUG A;  2COM A;  3CCR I;  4KIC A;  1YW9 A;  3GFM A;  2EZI A;  5ICF A;  2IGK A;  1YS6 A;  5D8K B;  5BS6 A;  5J4Y A;  5EG0 B;  1F4K A;  3GTP J;  1MMA A;  1PP8 F;  1FYM A;  1ULY A;  3BR1 A;  3LSK A;  4BKX A;  4L18 B;  1ZRE A;  4KJZ A;  3OYN A;  2Z2S B;  3LWF A;  4HNU A;  5E18 F;  2W00 A;  1BL0 A;  5IT9 Z;  1Y1V J;  1WSU A;  4EJW A;  3DWL E;  2XAU A;  2NOJ B;  2YUS A;  2BZT A;  1P4W A;  4RB0 A;  4BNC A;  2JA8 J;  3I53 A;  2R7X A;  2CW0 F;  1BM9 A;  1B72 B;  2ID3 A;  2R92 J;  2JRT A;  4N9H A;  3PQJ A;  1EH6 A;  4A6E A;  5K5Q A;  4L0Z B;  2X1C A;  3I58 A;  4IQ4 A;  1D3Y A;  3SZT A;  3HL2 A;  3CJT B;  4CDG A;  3SZP A;  4KDP A;  2O3F A;  4DBR A;  1TWG J;  3GWZ A;  4HAM A;  2QEX I;  2L0K A;  5IT9 K;  1TTY A;  2PN6 A;  2JWT A;  4CA0 A;  4GCV A;  5FLX K;  3CLO A;  4XSX F;  3OS1 A;  4KT5 C;  1R00 A;  2L02 A;  3VYU B;  3S3M A;  1XCV A;  3DEE A;  5J3L A;  1Z1D A;  2FBK A;  4D1Q A;  3T8R A;  2RGV A;  3EQL F;  3Q0V A;  3OYA A;  3K70 D;  3GTG J;  2IT0 A;  2UWM A;  2QBY A;  3CMY A;  2QQ8 A;  1OCC H;  3QYF A;  1RC9 A;  1TC3 C;  1BR1 A;  4IJA A;  2XRN A;  2E2J J;  3CJN A;  5E1X A;  2HU9 A;  4B09 A;  2CV2 A;  2JRM A;  3GYH X;  3AL0 B;  3U2R A;  1CF7 A;  2VKD A;  1XGM A;  1UHM A;  5J8F A;  2F48 A;  2D5V A;  2KKO A;  5EEH A;  1E17 A;  2OQG A;  3RQI A;  1OYI A;  4ZYA A;  3ZMD A;  2XV4 S;  3SYT A;  1TW3 A;  1U5T B;  3NWS A;  2DJN A;  3F8B A;  4ZZL A;  4C30 A;  3OYL A;  2CQX A;  1RKT A;  3AG4 H;  3RIR A;  3VB2 A;  1TP4 A;  4AUX A;  3ZOB A;  1G3S A;  2VKE A;  3R6S A;  2M0M A;  4NDL A;  3J7A O;  4DGW B;  3ABM H;  3AKZ A;  1SFK A;  3ELK A;  4BJT A;  3DP7 A;  5FB2 A;  1YJ9 I;  3BCB A;  4XRF A;  1R4N B;  4HF0 A;  1DUX C;  2OQR A;  2Y31 A;  2EZH A;  2P4W A;  1FBS A;  3P5J A;  4E7H A;  3A2K A;  3H9G A;  2V7F A;  1Z7U A;  2HDW A;  3V7R A;  3K4J A;  3HTS B;  1L0O C;  4E7J A;  3A02 A;  5EEG A;  5JLX A;  2FSW A;  1MSF C;  1D5Y A;  3I71 A;  2LKS A;  3WG9 A;  1I6X A;  2V4J C;  3DQV C;  1U78 A;  4V2F A;  5LD2 C;  3PM1 A;  2FF4 A;  1MBH A;  1BIA A;  3W3C A;  2HZT A;  1HF0 A;  2LF7 A;  2XAQ A;  3T1B A;  1O7F A;  5FKO A;  3H0G J;  4LLG F;  3G1M A;  3HJE A;  2HPM A;  4I02 A;  1QRY A;  3CCE I;  5JI6 A;  1SD5 A;  1QPM A;  2DCE A;  1LFB A;  5L3G A;  1CGP A;  2A6H F;  3BRO A;  1TLH B;  3DTK A;  1XDS A;  3TDZ C;  3V8K A;  4FHT A;  3ZMZ A;  4MFD A;  5J6X A;  5FRN A;  2HEO A;  2P7C B;  2E34 A;  5KAI C;  3WTW C;  4M73 A;  4MIM A;  4IRI A;  2IXS A;  2F5E A;  2Z99 A;  5FD5 A;  2MAB A;  3IKV A;  4UVB A;  1B8I A;  4B48 A;  3CUQ A;  3RKX A;  3SXY A;  4BBS J;  1ZH5 A;  4YEL A;  1MMG A;  4UUV A;  5GAH J;  1SD4 A;  4L5J A;  4HLX A;  4Y3O A;  2FXA A;  1OIS A;  2PMH A;  2LD5 A;  3GXO A;  5HOD A;  3KET A;  1Z6T A;  1IXR C;  1UST A;  4A0Z A;  3K2A A;  3WTZ A;  4BS9 A;  3CQZ J;  3CES A;  5GAE J;  4CXF A;  5LEJ A;  1WWX A;  1WVR A;  2VQG A;  3J7A Y;  3R4K A;  4A0X A;  2XGX A;  3FHN A;  2GM4 A;  1LPQ A;  2OZ6 A;  3WU2 C;  5IOY A;  2Z3Y A;  2PLY A;  2E1O A;  3HRU A;  3JW4 A;  5J8C A;  3JAM K;  2XKP A;  5IOZ A;  4NUB A;  4EJV A;  1WZ2 A;  1A6Q A;  2EIM H;  4AIJ A;  4JX4 A;  2O7O A;  4A69 C;  3FXU A;  4RDU A;  4HA8 A;  4LOC A;  2XAH A;  3KEY A;  3KP4 A;  3S16 J;  2KLO A;  3ESW B;  2R7W A;  5CLS A;  2M8E A;  2EZL A;  4U88 A;  3TP3 A;  3MCZ A;  2OA4 A;  4XRS A;  4M3F A;  4O3M A;  2M45 A;  2N8G A;  1K78 B;  4OIP F;  3JRI A;  1S8N A;  3CO7 C;  2DO7 A;  2HTS A;  2E36 A;  3KYL A;  1OYY A;  3E0J B;  2QQ9 A;  2NVU B;  3OIP A;  2PJP A;  3BJO A;  1WGX A;  1ZGJ A;  2E1M C;  2M34 A;  2ZJ2 A;  1NK3 P;  2KZG A;  4NC6 A;  4PK4 A;  3E5U A;  1JJ8 C;  2CFO A;  2HOE A;  3M3Y J;  3GLX A;  4O5V A;  1JT0 A;  5F27 A;  4DZP A;  5HLG A;  1GT0 C;  4A3G J;  3V4G A;  4XN0 A;  4HYE A;  5GPA A;  3ONQ A;  4HZF A;  1RES A;  2BVM A;  5K7Z A;  2L4A A;  2M1B A;  2DTZ A;  2R7Z J;  2GZW A;  2CQK A;  2EPF A;  5C3E J;  3BTL A;  2G7U A;  3L1P A;  3FIS A;  3H3Z A;  3DPL C;  3U9G A;  4UUS B;  3U1D A;  3EPZ A;  2OD5 A;  2CUF A;  3RTR A;  3DLA A;  1PUF B;  2Q2E B;  1W5T A;  2QSH X;  2XRO A;  1I5Z A;  4HQM A;  4YII A;  2QF7 A;  3BLY A;  2W84 A;  1U5T A;  3HOZ J;  4I99 C;  2YX7 A;  1YW7 A;  1H9T A;  2DQL A;  2X6O A;  1TWH J;  1D0Y A;  2GLO A;  3HSF A;  4KMU X;  1BC7 C;  3QPS A;  2NVT J;  3CC4 I;  3A0B C;  5DV5 A;  5GTI C;  2BV6 A;  3BG3 A;  3NWT A;  1HKT A;  1Y6I A;  1K61 A;  4LD5 A;  3G71 I;  1XC5 A;  5C4J J;  3LSJ A;  1D1A A;  2DYR H;  1WRJ A;  2ZME B;  2O5R A;  3WHC A;  3KPH A;  5BPD A;  4CYC A;  2BHZ A;  5M3M J;  3S2H J;  1WH7 A;  2DU9 A;  3WG7 H;  3J81 K;  3G4S I;  3SFZ A;  5A2Q K;  1G4D A;  4CHU A;  1Y56 A;  3A1Y A;  3K0L A;  4HNT A;  3BJ6 A;  4A93 J;  2NS8 A;  3HUG B;  3H5R A;  1HST A;  5HS7 A;  5FJ8 J;  2VBW A;  2D1V A;  1K6O A;  2LH9 A;  2R7O A;  3P9I A;  2F6C A;  2DMT A;  3K1N A;  2YU3 A;  1FMV A;  3BDD A;  2L5Q A;  3A0H C;  2ZKZ A;  3VOD A;  9ANT A;  2CS3 A;  4RS8 A;  4E7S A;  1NTC A;  3HHH A;  3C2G A;  2VQH A;  4IHS A;  2XUB A;  5D5X B;  1XS9 A;  2Z5U A;  1V54 H;  1ZGW A;  4P9U A;  4JP0 A;  1XPX A;  4F55 A;  1YIJ I;  3G2B A;  1UEL B;  2FBI A;  5LRR A;  2LF8 A;  1HW5 A;  3BG7 A;  2P8T A;  2M5W A;  1OPC A;  2TRT A;  2ZFW A;  4ZTJ A;  3ZP5 A;  1YIO A;  2DPU A;  4LIU A;  2V26 A;  3MN2 A;  3SJM A;  1K79 A;  3TGN A;  1J0R A;  5ICG A;  4EEF G;  5HDN A;  5DYM A;  2EA2 A;  1GV2 A;  2QGU A;  3L2U A;  4K2E A;  1I39 A;  2JK3 A;  4M9S A;  3WTV C;  2NNN A;  2BOL A;  3ECH A;  3M8F A;  2ZSI B;  1D8K A;  1W36 D;  1JGS A;  1S3J A;  3FMR A;  1XB4 A;  3CDL A;  2E1M B;  3HSE A;  3U1K A;  3Q5F A;  3CCU I;  3FMQ A;  2IW5 A;  2EQR A;  2P7V B;  3ECO A;  2WTE A;  1R4M B;  3PNY A;  2R7S A;  3QYE A;  4LG3 A;  2KJC A;  2R7T A;  1HOM A;  3LOC A;  3BP8 A;  2E7W A;  4M9X A;  1R5H A;  2H8R A;  3HTU A;  1MD0 A;  2NVX J;  1MW7 A;  4PFP A;  3DKX A;  2B0L A;  3VYS B;  1JTX A;  3K9T A;  1MDM A;  4NC8 A;  1YTY A;  3MMY B;  2MFZ A;  3HSR A;  1IDY A;  3HOT A;  3ZXS A;  1YE9 A;  4BE0 A;  1IRZ A;  3VWB A;  5H6Q A;  5JLW A;  3KZY A;  3G6E I;  1GLN A;  4M71 A;  3K4N A;  2LDU A;  4C3J J;  1NH3 A;  1O3R A;  2H1L A;  1KYZ A;  3N05 A;  1YI2 I;  4G6D A;  1T95 A;  5AON A;  1LFU P;  3GTM J;  3DTI A;  1QGP A;  2JVG A;  2VC0 A;  2OPT A;  3QOE A;  1D0X A;  1IAW A;  1EV7 A;  2D2W A;  4F92 B;  3HRM A;  1HLV A;  1LNW A;  3PUF A;  2XIG A;  1R1U A;  5KVR A;  2PEX A;  2L9N A;  3TQN A;  4BAC A;  4FIS A;  1FSE A;  3F21 A;  5JVT A;  2DMQ A;  1I6H J;  1SFO J;  3LL7 A;  3V42 A;  1YHQ I;  4XLA A;  4B44 A;  2YU9 J;  4M3G A;  2DMP A;  1QA6 A;  1JKP C;  4EM2 A;  2K3F A;  2OAZ A;  2IBD A;  3ERM A;  1Y1W J;  2HKO A;  2FQ3 A;  3IHU A;  2O9L A;  2I10 A;  3CJR B;  2DOA A;  3E6C C;  2MG4 A;  1AKH A;  3LA2 A;  3T0Y A;  4DOZ A;  4C2U A;  4XBF A;  4XNF A;  4Y33 A;  3F8C A;  2E19 A;  1UFM A;  3DEW A;  3GEZ A;  2R3S A;  4EGZ A;  2RNJ A;  4KMF A;  1REP C;  1XMX A;  2FJ1 A;  5CVI A;  3QPH A;  1I3A A;  1ENH A;  3BZC A;  4PUS A;  1TNT A;  2STW A;  3CCY A;  1A36 A;  2X1E A;  2F5C A;  3W2W A;  3OS2 A;  5D4S A;  3BOQ A;  3HEF A;  3ISP A;  2KJB A;  2H6B A;  2PG4 A;  1YS7 A;  3H92 A;  4EJT A;  3JTG A;  4RB1 A;  2F5F A;  3S1N J;  5KAF C;  2ZB9 A;  1U5T C;  2M0C A;  3D1N I;  3Q0W A;  2DBB A;  1ETX A;  2XKO A;  3K4C A;  2DDB A;  5LHH A;  3J7Y J;  3PNV A;  1N25 A;  3AG1 H;  2HS5 A;  4Q47 A;  1O3S A;  4ZYH A;  1UZC A;  4UUS A;  5DDG A;  4P5O A;  2L4M A;  1W5S A;  5GP9 A;  5HLI A;  2K85 A;  2WY7 Q;  1AOY A;  2MYS A;  2X4H A;  4YFN F;  2EFQ A;  4LIT A;  5HDK A;  5LGN A;  2Z33 A;  2CV0 A;  1TZL A;  1NHA A;  3V7C A;  1SFX A;  4D9J A;  4I01 A;  4BY1 J;  3L09 A;  2VT2 A;  3ASO H;  3I64 A;  1WJF A;  2J5O A;  2V1X A;  3E7L A;  4J01 A;  4BQA A;  2JPC A;  3K4L A;  2X1D A;  2LBF A;  1N75 A;  2H09 A;  2LRD A;  1GV5 A;  1JJ6 C;  4HBL A;  3TO9 A;  4IKF A;  1XTA A;  3GTQ J;  3IH2 A;  5FKL A;  1LEB A;  2PMU A;  3E6D A;  4II2 A;  2XAS A;  3HB9 A;  3HKZ N;  1F1Z A;  3OYG A;  3L2R A;  2EJR A;  2YR2 A;  2R7D A;  5FLX Z;  1X1A A;  2A05 A;  4I7H A;  2R7U A;  1YG2 A;  2IJL A;  4QPQ A;  5LRS A;  5FKK A;  3PIO F;  2HYG D;  3HGG A;  3M8J A;  4XLC A;  1MBK A;  1AHD P;  5BQT A;  1R22 A;  2CH0 A;  2P0W A;  1U9O A;  4UHT A;  2RKH A;  4CH7 A;  2E7X A;  3ZPL A;  2L7Z A;  2L7F P;  3JTH A;  5J1R A;  1T6S A;  1G3W A;  4F3Q A;  5E8G A;  1IGN A;  1P9Q C;  1V5G A;  1ZLK A;  4CZC A;  4MTD A;  4P9F A;  3T8T A;  3FWE A;  4A3B J;  4L9N A;  4XRM A;  4Y52 J;  5H20 A;  4AD9 A;  4AVZ A;  3LQR A;  1IN7 A;  3KZI C;  3OOU A;  4R1H A;  4WF2 A;  3EDP A;  3RKY A;  1J75 A;  2ADU A;  3K1M A;  2BW3 B;  1RUN A;  5IP6 A;  2KFD A;  2EIK H;  5EF6 A;  1VQ5 I;  3K1P A;  3WTY C;  4C3H J;  4GYI A;  2DK8 A;  5CJ9 A;  1E0E A;  2EIJ H;  4BJ6 C;  5FLM J;  2UUZ A;  3DFG A;  3FXQ A;  4IHV A;  2O61 A;  5D6E A;  1JE8 A;  1OCZ H;  1WI3 A;  1XGO A;  1X1P A;  3CC7 I;  3KP5 A;  2NYX A;  1T2K A;  5DD4 A;  2M9H A;  2A6T A;  2HOA A;  3CDH A;  1YX3 A;  4J19 A;  4ZDP A;  3QP6 A;  2P6S A;  4X6A J;  4XOP A;  1DGW Y;  3RPQ A;  1QQI A;  3VFZ A;  5DD8 A;  2Z9O A;  2ACJ A;  1B4A A;  2VPL A;  1T08 B;  2LRE A;  1W7P D;  3ABU A;  3JR9 A;  2XF5 A;  4EM1 A;  4PGH A;  1LE8 A;  1MNE A;  3E6B A;  4RLQ A;  2XRL A;  4TV7 A;  3CP8 A;  2OUM A;  1QVT A;  5E8I A;  1EJ9 A;  1GUU A;  3J7Z I;  1QZZ A;  3GTO J;  3KIO A;  4NQW B;  3BT9 A;  2ME6 A;  5FKN A;  5K1Y A;  2E2H J;  1JUP A;  3L2Q A;  3TOB A;  2HQA A;  3C1D A;  2L7M P;  3JRC A;  4XQF A;  2LG4 A;  2IGN A;  1W0U A;  5F0H A;  3S14 J;  2PQ8 A;  4EAT A;  5BPI A;  2P5L C;  1SC7 A;  1SAU A;  1XD7 A;  2DYS H;  2M8G X;  4E7I A;  2BY1 A;  2EIN H;  3BQY A;  3ZMT A;  2PMZ N;  4BQO A;  4FE4 A;  4XL9 A;  1BOB A;  2OBP A;  1XSX A;  2WAQ N;  3I4M J;  1KQ8 A;  1B6A A;  1QHG A;  1XMA A;  2JUC A;  2FML A;  3DPT A;  5FO5 A;  3G3Z A;  4CYD A;  3GVA A;  3WU0 A;  4BH9 A;  1DDN A;  3GUD A;  3ULQ B;  3E97 A;  4EVI A;  4A5N A;  3AL0 C;  2HVS A;  3LSG A;  5F64 A;  1IV6 A;  2WWY A;  2JSC A;  2ECC A;  3ABL H;  1VQP I;  4M6X A;  1MMS A;  1FOX A;  2VBX A;  4B4C A;  5HS8 A;  3QRF F;  2VBY A;  1KU7 A;  1IDZ A;  1FLI A;  2DI3 A;  3BR0 A;  2G7H A;  2JSP A;  2QKL B;  3RZO J;  1X19 A;  1Y8R B;  2FEZ A;  2G9W A;  2ZNZ A;  4HX8 A;  3Q9S A;  4EJO A;  4HF2 A;  1O7L A;  1ZRD A;  4YRV A;  3ZQG A;  2DFE A;  4LIV A;  4U87 A;  3T5X A;  3F8M A;  3S32 A;  3IWF A;  4WX9 A;  1KQ9 A;  3F22 A;  1F9N A;  3EUH A;  4EJU A;  1ZQ3 P;  2E1C A;  3BCA A;  4GYG A; 
#chains in the Genus database with same CATH homology
 1FYK A;  1B9N A;  2BE5 F;  2QQB A;  4BHP A;  5CVU A;  1S29 A;  4KIB A;  3O2P E;  4HX7 A;  2J5P A;  2EV5 A;  2K4J A;  4MGR A;  3IRR A;  2ISZ A;  1JXS A;  5LGU A;  5HDG A;  3HYI A;  4HV6 A;  3I5U A;  4CZZ A;  3K69 A;  2UXX A;  1TBX A;  2CO5 A;  1LDK B;  2FE3 A;  1ZYR F;  4IPA A;  2A3S A;  1KYW A;  3IWZ A;  4KNY A;  1P4X A;  2TDX A;  3GF2 A;  4WXH A;  1Y0U A;  2V1U A;  2WV0 A;  5DCF A;  4H0E A;  1WQ2 A;  2Q0O A;  1G3T A;  1DP7 P;  2ELH A;  1A04 A;  4UVA A;  3DV8 A;  1B59 A;  2FMY A;  4U0Y A;  4FX4 A;  1J9I A;  3V8L A;  3IL2 A;  1FNN A;  4S05 A;  1S7A A;  3ROU A;  3MZY A;  4A5M A;  3GFI A;  4ETS A;  2H6C A;  1ZAR A;  2GIV A;  2A61 A;  1IUY A;  3DF8 A;  3EET A;  3I0T A;  4MEX F;  1YW8 A;  4HOB A;  1BOA A;  2O8X A;  4FT8 A;  1XGN A;  2QWW A;  3GZ5 A;  1YFH A;  1G6N A;  4BAY A;  1J59 A;  2A07 F;  2X0L A;  3J80 K;  2FNP A;  3ZMU A;  5LEK A;  1K7A A;  3GX4 X;  3CUQ B;  1ON1 A;  3LAJ A;  3O3K A;  2PFB A;  4U7B A;  1UHW A;  2QQA A;  2A69 F;  1HW2 A;  1QZY A;  2M87 A;  3IKT A;  4MTE A;  2A68 F;  4I2O A;  4MHG A;  1QBJ A;  3LA7 A;  5CVJ A;  1P6R A;  1MZB A;  4Q48 A;  1R1T A;  3P7N A;  2CWE A;  4ENN A;  1OR7 A;  3DEU A;  2AS5 F;  3HOS A;  2STT A;  1DPU A;  4JQF A;  3M9A A;  1T98 A;  4M72 A;  4IXA A;  3ABT A;  3TO6 A;  3MQ0 A;  3OV8 A;  3FF5 A;  2O6G E;  5DUI A;  3KEO A;  2CSO A;  1O3Q A;  1T39 A;  2NAZ A;  5DCM B;  3SHF A;  4OIQ F;  1WI9 A;  2EB7 A;  1GXQ A;  3L9F A;  4A2U A;  4ENJ A;  4Q5S F;  1BN5 A;  1I1G A;  2GXG A;  3F72 A;  3L00 A;  1PP7 U;  3KP6 A;  5LHG A;  2NNY A;  1HBX G;  3W6K B;  4G7H F;  4L9V A;  4KA4 A;  4OMY A;  3GZ6 A;  5D6F A;  3E6M A;  3HRS A;  4U0V A;  2KIM A;  4E70 A;  1ZG5 A;  1BBY A;  2MC3 A;  5FD6 A;  5CVV A;  3F3X A;  3SQN A;  4D0P A;  3E3V A;  1X3U A;  3I59 B;  5E20 A;  4O6J A;  1H0M A;  2FBH A;  4CGZ A;  3W6J B;  5F1R A;  2QVO A;  2MH2 A;  4BHB A;  1YYV A;  3MZH A;  2MLK A;  4WK8 F;  3WTU C;  2EA4 A;  5IT3 A;  1FY7 A;  5H6R A;  3RI4 A;  3MFK A;  2HWV A;  2FU4 A;  5D8L B;  2DQR A;  4RB2 C;  2EFW A;  1FBU A;  3LAP A;  4CO8 A;  2K4B A;  4RB3 C;  5TJJ A;  5AIQ A;  4HDU A;  1GXP A;  5HOO A;  5D5V B;  5E17 F;  1FZP B;  1E2X A;  1MJ9 A;  1YLF A;  1LDD A;  4AIK A;  5ERI A;  5JR3 A;  1TQI A;  3QU3 A;  3S2W A;  1IZ1 A;  2DLL A;  2EV0 A;  2JT1 A;  3F6O A;  3RYP A;  3ZN0 A;  1R58 A;  3EYI A;  3IC7 A;  1XSV A;  3V8J A;  1T0F A;  5L3E A;  2VN2 A;  4MQ9 F;  3LFK A;  2RV8 A;  3NQO A;  1FT9 A;  4LMY A;  2BEO A;  3BWG A;  4M9Z A;  3FX3 A;  5LLQ A;  2NS0 A;  3KLN A;  4XLP F;  2KIU A;  2QZ8 A;  4EQQ A;  5E1Z B;  4L9J A;  4RAY A;  1R5G A;  4G9Y A;  1LEA A;  5ICE A;  3ERE D;  3BJA A;  2IP2 A;  2K02 A;  3D0S A;  5JHU A;  4ESJ A;  1I27 A;  1B9M A;  3O6B B;  2MH9 A;  5JFR A;  2VT3 A;  4DQ2 A;  1ZG1 A;  2RC4 A;  2EFO A;  2V9V A;  1ZRC A;  4ESB A;  4RGU A;  2IA1 A;  2QYO A;  2VBZ A;  4HDV A;  2QBY B;  2VE9 A;  4I0A A;  2VC1 A;  1KU9 A;  1SMY F;  4AVP A;  1Z05 A;  3WU1 B;  1U6G A;  4LFU A;  4HQE A;  2HQN A;  3NEU A;  2HQR A;  2ESH A;  4RGX A;  3TOA A;  3G73 A;  2WC2 A;  2FNA A;  4PGG A;  3WGI A;  4LG0 A;  1CF7 B;  3N4M A;  4L0Y B;  3CO6 C;  2VOD A;  1W7P A;  2F5D A;  2K7L A;  3WTT C;  4L9T A;  1FOK A;  1GVJ A;  4YIF A;  1FWZ A;  3I54 A;  3RDI A;  1ZAO A;  1SFU A;  4ENM A;  1Z91 A;  1SAX A;  3FM5 A;  1ZN2 A;  2RN7 A;  2XAG A;  1IW7 F;  4OU0 A;  1V4R A;  2VOO A;  2RVC A;  1TQM A;  1PUE E;  1SD7 A;  5FFZ A;  4WWC A;  2YSR A;  4EV0 A;  2IPQ X;  1G3Y A;  2GQQ A;  2CYY A;  2YPR A;  1YO5 C;  1DPR A;  2DT5 A;  1P2F A;  3FMS A;  3LST A;  5CYV A;  3K2Z A;  4A6D A;  1U8R A;  1T38 A;  4XLN F;  3P9C A;  4M74 A;  4HV5 A;  4QWQ A;  4I09 A;  2GXB A;  1BIB A;  3R61 A;  1BI2 A;  3GFL A;  3RJP A;  2F2E A;  3B73 A;  4YFK F;  2NRA C;  4G7Z F;  2EFP A;  1BI0 A;  1LB2 A;  1LJ9 A;  3CTA A;  1GHC A;  4IRG A;  3WE2 A;  2EV6 A;  4KFC A;  2QLZ A;  2GA1 A;  5DCM A;  4EMS A;  3QOP A;  4CIC A;  4BXU A;  4UV8 A;  3KEQ A;  4KN4 X;  3VOE A;  2K27 A;  4P96 A;  4ON0 A;  4PZJ A;  3REO A;  4EM0 B;  2ZME A;  1UCR A;  4ASN A;  3RKW A;  3D5L A;  4HX4 A;  1QNT A;  4ZYD A;  4YFX F;  3KP2 A;  1R23 A;  2DTR A;  3LQQ A;  3F23 A;  3RPU A;  1LQ1 A;  2BBY A;  4MQV A;  5F6F A;  3KP7 A;  4ENK A;  3MEX A;  2EWN A;  1IXS B;  2HDC A;  4ESF A;  2DW4 A;  3I4P A;  2MLG A;  2H27 A;  4UXN A;  4WCG A;  1ZLJ A;  2DPD A;  2V79 A;  2XAF A;  2JTV A;  2W85 A;  1EH8 A;  1BI3 A;  3Q9V A;  1V3F A;  2L3D A;  1Z6R A;  2GWR A;  3L2C A;  1C0W A;  5ED4 A;  2Y75 A;  3WOD F;  2HKX A;  4Z2Y A;  1F5T A;  3R0J A;  1S6L A;  2O03 A;  3BPV A;  2BGC A;  1J2X A;  1ZG3 A;  2FRH A;  1MDM B;  4Y13 A;  1FPQ A;  2HGC A;  5DUK A;  1JHF A;  1R1V A;  3HRT A;  1IRF A;  2VXZ A;  1U3E M;  5ILS A;  1FP1 D;  3MWM A;  2VON A;  3KFW X;  3JAM Z;  3WTS C;  1FX7 A;  3MAJ A;  2Q8K A;  1FBQ A;  4ZYG A;  4LK0 F;  5FFX A;  4GO1 A;  3TKY A;  2IA0 A;  1J5Y A;  4G94 A;  2AXL A;  1IN5 A;  1IXC A;  3P9K A;  1SMT A;  1IRG A;  2BYV E;  6PAX A;  4QLC U;  3FZV A;  4OIO F;  2P6T A;  2XAJ A;  3CUO A;  3FHZ A;  4UNO A;  3BY6 A;  3FXR A;  1B1B A;  1BI1 A;  2MBF A;  3WGG A;  4B8X A;  2W57 A;  2VE8 A;  3KCC A;  1XCB A;  3L7W A;  4YG2 F;  5CVR A;  1OMI A;  4R8H A;  1IF1 A;  5HLH A;  2QUF A;  2QEN A;  2RDP A;  4AWX B;  2EFN A;  2MD5 A;  2V1D A;  1OYW A;  3F8N A;  1PDN C;  2A5Y B;  5ICC A;  1HQC A;  1HKQ A;  2FA5 A;  1IN6 A;  2HR3 A;  1KQ0 A;  3J80 Z;  1S7O A;  4LB6 B;  3M8E A;  3COA C;  5L3C A;  2QM3 A;  5ILV A;  2ETH A;  3TDU C;  3E5Q A;  4IRH A;  3DXJ F;  3ZQ7 A;  3WTX C;  5HS9 A;  1EH7 A;  1QO0 D;  4LK1 F;  4PCQ A;  3DKW A;  4HLY A;  1IN8 A;  5D5U B;  1XSD A;  1H9G A;  5LBQ A;  4G8X A;  2ISY A;  4JK1 X;  1L3L A;  3E5X A;  1R36 A;  4Y15 A;  3GO5 A;  5L3B A;  2V6C A;  3H3U A;  2GAU A;  2W25 A;  1AWC A;  5BOX A;  4Q4Z F;  1D5V A;  2RQP A;  1STZ A;  1ODD A;  2OZU A;  1VTN C;  1FC3 A;  2ZNY A;  1RUO A;  4N0B A;  1MJB A;  2KRF A;  4LGW A;  3QU6 A;  1W4M A;  1XGS A;  2L01 A;  1JHH A;  4NQW A;  3BPX A;  1RI7 A;  2LSO A;  3QP5 A;  4KN7 X;  4PDK A;  4NB5 A;  4HW0 A;  2CFX A;  3C7J A;  3WGH A;  5K5O A;  4IVN A;  2KIF A;  2O0Y A;  1KGS A;  3R60 A;  2LKP A;  4DNC A;  3GW2 A;  3NRV A;  3KLO A;  3GFJ A;  1KA8 A;  2K86 A;  5E1W A;  4P55 A;  3ML6 A;  3F8F A;  3KP3 A;  4MNU A;  1P4A A;  2CGP A;  4Y17 A;  4WXD A;  4OIR F;  1J7K A;  2CG4 A;  2C6Y A;  3KE2 A;  4XSZ F;  1MJA A;  4M6Y A;  4LLL A;  1BJA A;  4KIG A;  3N97 A;  3BZ6 A;  1XN7 A;  1KU2 A;  2Q2E A;  3LA3 A;  4MEY F;  3JSO A;  4FX0 A;  1TNS A;  4ZZD A;  4KIF A;  5AIP A;  3ZMS A;  1P92 A;  1RIO H;  4ZH4 F;  2D1H A;  1MKM A;  1FP2 A;  3ZMV A;  5LGT A;  4OOI A;  4KYW A;  2GA2 A;  4JBA A;  4A0Y A;  1HKS A;  1D8J A;  3QAH A;  1ZRF A;  2H94 A;  3M7G A;  2ZXJ A;  4A12 A;  2P5V A;  4G7O F;  5D4R A;  1BC8 C;  4UVC A;  4AIH A;  3EYY A;  1FSH A;  2VOP A;  1MGT A;  1XMK A;  1K78 A;  4U0W A;  1TQP A;  4F7Z A;  4G6Q A;  1O3T A;  2UXN A;  4WXC A;  2DK5 A;  2ESN A;  1ZHF A;  2LNB A;  4ZYE A;  1LDJ A;  1SD6 A;  4I0B A;  4HF1 A;  1ONV A;  1XDU A;  2HTJ A;  1KU3 A;  2PBI A;  3I59 A;  1ZGA A;  3F6V A;  2DFI A;  1RZ4 A;  3QPT A;  2XVC A;  5K5R A;  4LJZ F;  4RAZ A;  2Y0M A;  3IRQ A;  2W24 A;  2IVM A;  5L3D A;  1HXD A;  1TW2 A;  4LB5 A;  4BYY A;  2JZY A;  4RGR A;  2DAO A;  4IHT A;  3ZN1 A;  1SFE A;  4EGY A;  4NHJ A;  1UB9 A;  2OU2 A;  3PQK A;  2JPB A;  4BHC A;  1HSJ A;  3M1E A;  4S04 A;  2EK5 A;  2P5K A;  1FYL A;  1I1S A;  2HFH A;  4I98 B;  3AAF A;  1RNL A;  5DEQ A;  5A2Q Z;  1LVA A;  1ON2 A;  3B02 A;  5ILU A;  2ZO4 A;  3C18 A;  4LG0 B;  3HHG A;  3PFI A;  4KUM A;  1W7P B;  3HIF A;  3KZZ A;  2XHK A;  3OOP A;  4GXO A;  2ZCW A;  3VEP A;  4R79 A;  5FGM A;  4LLN A;  5HVQ C;  1HW1 A;  2R7F A;  4IF4 A;  3RYR A;  5D5W B;  4OMZ A;  5L3F A;  2IA2 A;  1YQA A;  3C3W A;  3V7S A;  2IRF G;  2M30 A;  3WE3 A;  4UV9 A;  4GGG A;  1WKM A;  5BMZ A;  3R0A A;  2E1N A;  1USS A;  3TO7 A;  5TRD A;  2MA3 A;  1R7J A;  1IN4 A;  1OKR A;  2PI0 A;  3JSP A;  2L54 A;  1O57 A;  4RGS A;  3CUQ C;  2YX4 A;  1Q1H A;  4L5I A;  5KK1 A;  1U2W A;  2FOK A;  5LHI A;  2A6E F;  2HYF A;  2ZBK A;  3FM3 A;  4U7D A;  2D45 A;  2UZK A;  3J81 Z;  1Z9C A;  2Y48 A;  4N9I A;  3HUG A;  2COM A;  4KIC A;  1YW9 A;  3GFM A;  5ICF A;  1YS6 A;  5D8K B;  5BS6 A;  1F4K A;  1PP8 F;  1FYM A;  1ULY A;  4L18 B;  1ZRE A;  3LWF A;  5E18 F;  5IT9 Z;  1WSU A;  4EJW A;  1P4W A;  4RB0 A;  4BNC A;  3I53 A;  2CW0 F;  1BM9 A;  2JRT A;  4N9H A;  3PQJ A;  1EH6 A;  4A6E A;  5K5Q A;  4L0Z B;  3I58 A;  1D3Y A;  3SZT A;  4CDG A;  3SZP A;  4KDP A;  2O3F A;  3GWZ A;  4HAM A;  5IT9 K;  1TTY A;  2PN6 A;  4GCV A;  5FLX K;  3CLO A;  4XSX F;  4KT5 C;  1R00 A;  2L02 A;  1XCV A;  1Z1D A;  2FBK A;  3T8R A;  2RGV A;  3EQL F;  2IT0 A;  2UWM A;  2QBY A;  4IJA A;  2XRN A;  3CJN A;  5E1X A;  4B09 A;  3GYH X;  3U2R A;  1CF7 A;  1XGM A;  1UHM A;  5J8F A;  2KKO A;  5EEH A;  1E17 A;  2OQG A;  1OYI A;  3ZMD A;  2XV4 S;  1TW3 A;  1U5T B;  3F8B A;  4ZZL A;  3RIR A;  3VB2 A;  1G3S A;  3R6S A;  3J7A O;  3ELK A;  3DP7 A;  5FB2 A;  4XRF A;  4HF0 A;  1DUX C;  2OQR A;  2P4W A;  1FBS A;  1Z7U A;  3V7R A;  3HTS B;  1L0O C;  5EEG A;  2FSW A;  3I71 A;  3WG9 A;  1I6X A;  3DQV C;  1U78 A;  2FF4 A;  1BIA A;  2HZT A;  2LF7 A;  2XAQ A;  3T1B A;  1O7F A;  4LLG F;  4I02 A;  5JI6 A;  1SD5 A;  1QPM A;  5L3G A;  1CGP A;  2A6H F;  3BRO A;  1TLH B;  3TDZ C;  1XDS A;  3V8K A;  4FHT A;  3ZMZ A;  5J6X A;  2HEO A;  2P7C B;  3WTW C;  4M73 A;  4IRI A;  2F5E A;  2Z99 A;  5FD5 A;  3IKV A;  4UVB A;  3CUQ A;  3RKX A;  3SXY A;  1ZH5 A;  4UUV A;  1SD4 A;  4L5J A;  4HLX A;  2FXA A;  2PMH A;  3GXO A;  3KET A;  1Z6T A;  1IXR C;  1UST A;  4A0Z A;  3WTZ A;  4CXF A;  5LEJ A;  1WWX A;  3R4K A;  4A0X A;  2XGX A;  2OZ6 A;  2Z3Y A;  2PLY A;  3HRU A;  3JW4 A;  5J8C A;  3JAM K;  2XKP A;  4EJV A;  4AIJ A;  3FXU A;  4HA8 A;  2XAH A;  3KP4 A;  5CLS A;  2M8E A;  4U88 A;  3MCZ A;  2OA4 A;  4O3M A;  2M45 A;  1K78 B;  4OIP F;  3CO7 C;  1S8N A;  2DO7 A;  2HTS A;  1OYY A;  2QQ9 A;  2PJP A;  3BJO A;  1ZGJ A;  2ZJ2 A;  3E5U A;  2HOE A;  3GLX A;  4O5V A;  5HLG A;  3V4G A;  4HYE A;  4HZF A;  2L4A A;  2M1B A;  2GZW A;  2CQK A;  2G7U A;  3H3Z A;  3U9G A;  3DPL C;  3U1D A;  2OD5 A;  3RTR A;  1W5T A;  2XRO A;  1I5Z A;  4HQM A;  4YII A;  2W84 A;  1U5T A;  2YX7 A;  1YW7 A;  1H9T A;  2DQL A;  3HSF A;  4KMU X;  1BC7 C;  5DV5 A;  2BV6 A;  1HKT A;  4LD5 A;  1WRJ A;  2ZME B;  5BPD A;  2DU9 A;  3J81 K;  1G4D A;  3SFZ A;  5A2Q K;  4CHU A;  3K0L A;  3BJ6 A;  1HST A;  5HS7 A;  2VBW A;  2D1V A;  1K6O A;  3P9I A;  3K1N A;  2YU3 A;  3BDD A;  2ZKZ A;  3VOD A;  4RS8 A;  3HHH A;  4IHS A;  2XUB A;  5D5X B;  2Z5U A;  4P9U A;  2FBI A;  5LRR A;  2LF8 A;  1HW5 A;  2P8T A;  2M5W A;  1OPC A;  2ZFW A;  3ZP5 A;  1YIO A;  2DPU A;  1K79 A;  3TGN A;  1J0R A;  5ICG A;  5HDN A;  5DYM A;  2EA2 A;  4K2E A;  4M9S A;  3WTV C;  2NNN A;  3ECH A;  3M8F A;  1D8K A;  1JGS A;  1S3J A;  3FMR A;  1XB4 A;  3HSE A;  3Q5F A;  3FMQ A;  2IW5 A;  2P7V B;  3ECO A;  2WTE A;  2KJC A;  3BP8 A;  2E7W A;  4M9X A;  1R5H A;  3HTU A;  1MD0 A;  2B0L A;  3K9T A;  1MDM A;  1YTY A;  3HSR A;  3HOT A;  5H6Q A;  3KZY A;  4M71 A;  2LDU A;  1O3R A;  1KYZ A;  4G6D A;  5AON A;  1QGP A;  2VC0 A;  1IAW A;  1EV7 A;  2D2W A;  3HRM A;  1LNW A;  2XIG A;  1R1U A;  5KVR A;  2PEX A;  3TQN A;  1FSE A;  3F21 A;  5JVT A;  4EM2 A;  2OAZ A;  2HKO A;  2FQ3 A;  3IHU A;  3E6C C;  3LA2 A;  3T0Y A;  4XBF A;  3F8C A;  1UFM A;  3GEZ A;  2R3S A;  4EGZ A;  2RNJ A;  4KMF A;  1REP C;  5CVI A;  3QPH A;  1TNT A;  2STW A;  2F5C A;  5D4S A;  3BOQ A;  3ISP A;  2KJB A;  2H6B A;  2PG4 A;  1YS7 A;  3H92 A;  4EJT A;  3JTG A;  4RB1 A;  2F5F A;  1U5T C;  2DBB A;  2XKO A;  5LHH A;  2HS5 A;  4Q47 A;  1O3S A;  4ZYH A;  5DDG A;  4P5O A;  2L4M A;  1W5S A;  5HLI A;  1AOY A;  2X4H A;  4YFN F;  2EFQ A;  5HDK A;  5LGN A;  2Z33 A;  1NHA A;  3V7C A;  1SFX A;  4I01 A;  3L09 A;  2VT2 A;  3I64 A;  2J5O A;  2V1X A;  4BQA A;  2JPC A;  2H09 A;  4HBL A;  3TO9 A;  1LEB A;  2PMU A;  3E6D A;  2XAS A;  1F1Z A;  2EJR A;  2YR2 A;  2R7D A;  5FLX Z;  4I7H A;  1YG2 A;  2IJL A;  5LRS A;  2HYG D;  5BQT A;  1R22 A;  4UHT A;  2RKH A;  3ZPL A;  2E7X A;  3JTH A;  1T6S A;  1G3W A;  5E8G A;  1ZLK A;  4MTD A;  4P9F A;  3T8T A;  3FWE A;  4L9N A;  5H20 A;  4AD9 A;  3LQR A;  1IN7 A;  4R1H A;  4WF2 A;  3EDP A;  3RKY A;  1J75 A;  2ADU A;  3K1M A;  1RUN A;  3K1P A;  3WTY C;  4GYI A;  2DK8 A;  5CJ9 A;  3DFG A;  3FXQ A;  2O61 A;  5D6E A;  1JE8 A;  1XGO A;  3KP5 A;  2NYX A;  1T2K A;  5DD4 A;  3CDH A;  3QP6 A;  2P6S A;  3RPQ A;  1QQI A;  3VFZ A;  5DD8 A;  2Z9O A;  2ACJ A;  1B4A A;  1W7P D;  3ABU A;  4EM1 A;  4PGH A;  3E6B A;  4TV7 A;  5E8I A;  1QZZ A;  5K1Y A;  3TOB A;  3C1D A;  2PQ8 A;  5BPI A;  2P5L C;  1XD7 A;  3ZMT A;  2OBP A;  1XSX A;  1KQ8 A;  1B6A A;  1XMA A;  2FML A;  3DPT A;  5FO5 A;  3G3Z A;  4CYD A;  3GVA A;  3WU0 A;  4BH9 A;  1DDN A;  3GUD A;  3ULQ B;  3E97 A;  4EVI A;  4A5N A;  5F64 A;  2WWY A;  2JSC A;  4M6X A;  2VBX A;  5HS8 A;  3QRF F;  2VBY A;  1KU7 A;  1FLI A;  2DI3 A;  2G7H A;  2FEZ A;  2G9W A;  2ZNZ A;  4HX8 A;  3Q9S A;  4EJO A;  4HF2 A;  1O7L A;  1ZRD A;  3T5X A;  3F8M A;  3IWF A;  4WX9 A;  1KQ9 A;  2E1C A;  1F9N A;  3EUH A;  4EJU A;  3F22 A;  4OIN F;  4GYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...