2PJTA

Crystal structure of the catalytic domain of mmp-13 complexed with way-344
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
165
structure length
162
Chain Sequence
YNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTHFMLPDDDVQGIQSLYGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Collagenase 3
publication title Structure-based design of TACE selective inhibitors: manipulations in the S1'-S3' pocket.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 45
structure length 162
sequence length 165
chains with identical sequence B, C, D
ec nomenclature ec 3.4.24.-:
pdb deposition date 2007-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2pjtA00
4PKVA 2JT6A 4I35A 4XCTA 1KUFA 2E3XA 3F16A 3DPEA 2X3BA 4GWNA 1KAPP 4DV8A 3KWVC 3LK8A 2KRJA 1AF0A 4L6TA 1KBCA 1I1IP 3KEKA 3VTGA 4H76A 5B5OA 1JAQA 2RJQA 3DL1A 2MLSA 3LE9A 1SLMA 4XM7A 1WNIA 1PWPA 1IAAA 2D1NA 830CA 3O64A 4QKZA 1SRPA 1GO7P 1A86A 1ZTQA 2OW2A 3OHLA 3F19A 3WV1A 5LABA 1L6JA 1G49A 5D1SA 1UMTA 3K7LA 1XURA 1C7KA 4GF1A 3LUMA 1XFYA 2OVXA 3HBUP 3G42A 3RTTA 4H30A 5CZMA 4WZVA 3USNA 2Z2DA 1K7GA 4H49A 2SRTA 1BQOA 1OM7A 2K2GA 4PKUA 1HOVA 1R1JA 4HX3A 1KUKA 1ASTA 2TCLA 1Q3AA 4Q1LA 2OXZA 3LILA 2YB9A 3LJZA 4AYKA 1XFXA 1BIWA 5CXAA 2O3EA 3LUNA 1XFUA 3EWJA 1BUVM 5I3MA 1D5JA 2RJPA 1G12A 1CAQA 2W13A 5B5PA 1D8MA 3DSLA 2L0RA 4WF6A 4H1QA 2FV5A 1GE7A 2OW0A 4GR0A 5D1TA 3NX7A 3OHOA 3AYKA 4FXYP 3KMCA 1ROSA 2JT5A 5L7FA 2OXUA 4WKIA 4HMAA 1BZSA 4EFSA 1ATLA 3P24A 1GXDA 1GKCA 1XUDA 1JAPA 2WOAA 1CIZA 1ZP5A 2X7MA 1IACA 2W14A 2DDFA 2A8HA 3Q2HA 3LEAA 4XM6A 1CGLA 3F17A 2ERQA 2OZRA 3HB2P 1RMZA 3LQBA 1FBLA 1PWVA 1HY7A 3Q2GA 1C8TA 1PWQA 1O0QA 1FLSA 3RTSA 2X3CA 5BOYA 2JSDA 4A7BA 1MMQA 5I2ZA 3ZUKA 1R1IA 4GWMA 1HTDA 1KUHA 3MA2A 4AUOA 3GBOA 5BPAA 1BKCE 3AIGA 2MLRA 3B92A 3LJTA 4G9LA 2OW1A 1PWUA 4GQLA 1BQQM 2XS4A 2AYKA 3VI1A 3K7NA 1Y93A 3KEJA 4FU4A 456CA 2D1OA 3KHIA 1JJ9A 5I0LA 1OM6A 1ZXCA 3HY7A 4H82A 5D7WA 1S4BP 1BKCI 2YIGA 1XFZA 4FVLA 1I76A 3KRYA 3DNGA 3TT4A 2OVZA 3F1AA 1GE6A 1OM8A 4WK7A 1Y0VA 2MZHA 1JK3A 3EHYA 4H3XA 1ZS0A 4ILWD 1UMSA 4JP4A 2O36A 2Y6CA 1CXVA 3LKAA 1MMPA 3KECA 1CGFA 4JA1A 1YQYA 1UEAA 3G5CA 1KUIA 1IABA 4IN9A 4H84A 1ND1A 2K9CA 3F18A 5H8XA 2AIGP 1HFSA 3ZVSA 4CTHA 5D2BA 1GO8P 3EHXA 3N2VA 2DW1A 3HYGA 2USNA 2CLTA 1H71P 4JQGA 3KMEA 2OY4A 1XFVA 2J0TA 3EDGA 3EDIA 3WV3A 3BA0A 1G4KA 1SLNA 1QUAA 1MMRA 1A85A 4J4MA 1UTZA 2X3AA 3HBVP 3ZXHA 3HDBA 1QIBA 1ZVXA 2DW0A 4JPAA 1R1HA 1D8FA 1OS9A 2XS3A 1K7IA 1B8YA 1KUGA 2OY2A 2DDYA 1I73A 1BSWA 5D1UA 3LMCA 1SU3A 1QJIA 1USNA 1J7NA 966CA 5JMYA 1IADA 1SATA 4FXQA 4L63A 1D7XA 2JIHA 3B8ZA 1JKYA 1FM1A 1QICA 3DPFA 3EDZA 1HV5A 1IAEA 4XBHA 2JNPA 1MNCA 1GKDA 4PKRA 3B2ZA 1PWWA 1C3IA 3CKIA 4AIGA 1MMBA 3UVCA 5BOTA 1BUDA 2OI0A 1QIAA 1ZXVA 3I7IA 1QJJA 2PJTA 1G9KA 4PKQA 2E2DA 1OS2A 2FV9A 1EUBA 1CK7A 4IJOA 4WKEA 1GE5A 1K7QA 1DTHA 2WO9A 1O0TA 3LGPA 1OMJA 4ON1A 3O2XA 4A3WA 3F15A 4GR3A 1EAKA 2MZIA 2POJA 1AKLA 2OXWA 3TVCA 5I4OA 5L79A 3LIRA 3AYUA 1SMPA 4L19A 3TS4A 1XFWA 4PKWA 1G05A 1JIWP 2OW9A 1CGEA 2WO8A 4AXQA 1R54A 2I47A 2J83A 4IUWA 4DF9A 1JH1A 3LJGA 4DPEA 2ERPA 2Y6DA 3N2UA 2CKIA 1DMTA 2V4BA 1RM8A 3HDAP 1BM6A 4PKTA 3L0VA 1B3DA 1JAOA 2W12A 4XM8A 3I7GA 5D3CA 3V96B 1YOUA 3P1VA 3LQ0A 3WV2A 5I43A 2DW2A 4DD8A 1EB6A 1YP1A 3EDHA 4GR8A 4PKSA 4GUYA 1OO9A 1IAGA 1YCMA 1Y8JA 2N8RA 1UTTA 1CQRA 2EROA 3DWBA 2W0DA 1AYKA 1Z3JA 2HU6A 4I03A 3TSKA 4JIJA 4G0DA 5CUHA 1BKCA 4ZR5A 1JANA 3LIKA 1JIZA 1R55A 3ELMA 3E8RA 2MZEA 5I12A 3U1RA 2QPJA 3L0TA 1XUCA 3HY9A 1HFCA 4R3VA 2W15A 4H2EA 3SHIA
chains in the Genus database with same CATH superfamily
4PKVA 2JT6A 4I35A 4XCTA 1KUFA 2E3XA 3F16A 3DPEA 2X3BA 4GWNA 1KAPP 4DV8A 3KWVC 3LK8A 2KRJA 1AF0A 4L6TA 1KBCA 1I1IP 3KEKA 3VTGA 4H76A 5B5OA 1JAQA 2RJQA 3DL1A 2MLSA 3LE9A 1SLMA 4XM7A 1WNIA 1PWPA 1IAAA 2D1NA 830CA 3O64A 4QKZA 1SRPA 1GO7P 1A86A 1ZTQA 2OW2A 3OHLA 3F19A 3WV1A 5LABA 1L6JA 1G49A 5D1SA 1UMTA 3K7LA 1XURA 1C7KA 4GF1A 3LUMA 1XFYA 2OVXA 3HBUP 3G42A 3RTTA 4H30A 5CZMA 4WZVA 3USNA 2Z2DA 1K7GA 4H49A 2SRTA 1BQOA 1OM7A 2K2GA 4PKUA 1HOVA 1R1JA 4HX3A 1KUKA 1ASTA 2TCLA 1Q3AA 4Q1LA 2OXZA 3LILA 2YB9A 3LJZA 4AYKA 1XFXA 1BIWA 5CXAA 2O3EA 3LUNA 1XFUA 3EWJA 1BUVM 5I3MA 1D5JA 2RJPA 1G12A 1CAQA 2W13A 5B5PA 1D8MA 3DSLA 2L0RA 4WF6A 4H1QA 2FV5A 1GE7A 2OW0A 4GR0A 5D1TA 3NX7A 3OHOA 3AYKA 4FXYP 3KMCA 1ROSA 2JT5A 5L7FA 2OXUA 4WKIA 4HMAA 1BZSA 4EFSA 1ATLA 3P24A 1GXDA 1GKCA 1XUDA 1JAPA 2WOAA 1CIZA 1ZP5A 2X7MA 1IACA 2W14A 2DDFA 2A8HA 3Q2HA 3LEAA 4XM6A 1CGLA 3F17A 2ERQA 2OZRA 3HB2P 1RMZA 3LQBA 1FBLA 1PWVA 3DTKA 1HY7A 3Q2GA 1C8TA 1PWQA 1O0QA 1FLSA 3RTSA 2X3CA 5BOYA 2JSDA 1XM5A 4A7BA 1MMQA 5I2ZA 3ZUKA 1R1IA 4GWMA 1HTDA 1KUHA 3MA2A 4AUOA 3GBOA 5BPAA 1BKCE 3AIGA 2MLRA 3B92A 3LJTA 4G9LA 2OW1A 1PWUA 4GQLA 1BQQM 2XS4A 2AYKA 3VI1A 3K7NA 1Y93A 3KEJA 4FU4A 456CA 2D1OA 3KHIA 1JJ9A 5I0LA 1OM6A 1ZXCA 3HY7A 4H82A 5D7WA 1S4BP 1BKCI 2YIGA 1XFZA 4FVLA 1I76A 3KRYA 3DNGA 3TT4A 2OVZA 3F1AA 1GE6A 1OM8A 4WK7A 1Y0VA 2MZHA 1JK3A 3EHYA 4H3XA 1ZS0A 4ILWD 1UMSA 4JP4A 2O36A 4L7AA 2Y6CA 1CXVA 3LKAA 1MMPA 3KECA 1CGFA 4JA1A 1YQYA 1UEAA 3G5CA 1KUIA 1IABA 4IN9A 4H84A 1ND1A 2K9CA 3F18A 5H8XA 2AIGP 1HFSA 3ZVSA 4CTHA 5D2BA 1GO8P 3EHXA 3N2VA 2DW1A 3HYGA 2USNA 2CLTA 1H71P 4JQGA 3KMEA 2OY4A 1XFVA 2J0TA 3EDGA 3EDIA 3WV3A 3BA0A 3DTIA 1G4KA 1SLNA 1QUAA 1MMRA 2YUFA 1A85A 4J4MA 1UTZA 2X3AA 3HBVP 3ZXHA 3HDBA 1QIBA 1ZVXA 2DW0A 4JPAA 1R1HA 1D8FA 1TVIA 1OS9A 2XS3A 1K7IA 1B8YA 1KUGA 1OZ9A 2OY2A 2DDYA 1I73A 1BSWA 5D1UA 3LMCA 1SU3A 1QJIA 1USNA 1J7NA 1XAXA 966CA 5JMYA 1IADA 1SATA 4FXQA 4L63A 1D7XA 2JIHA 3B8ZA 1JKYA 1FM1A 1QICA 3DPFA 3EDZA 1HV5A 1IAEA 4XBHA 2JNPA 1MNCA 1GKDA 4PKRA 3B2ZA 1PWWA 1C3IA 3CKIA 4AIGA 1MMBA 3UVCA 5BOTA 1BUDA 2OI0A 1QIAA 1ZXVA 3I7IA 1QJJA 2PJTA 1G9KA 4PKQA 2E2DA 1OS2A 2FV9A 1EUBA 1CK7A 4IJOA 4WKEA 1GE5A 1K7QA 1DTHA 2WO9A 1O0TA 3LGPA 1OMJA 4ON1A 3O2XA 4A3WA 3F15A 4GR3A 1EAKA 2MZIA 2POJA 1AKLA 2OXWA 3TVCA 5I4OA 5L79A 3LIRA 3AYUA 1SMPA 4L19A 3TS4A 1XFWA 4PKWA 1G05A 1JIWP 2OW9A 1CGEA 2WO8A 4AXQA 1R54A 2I47A 2J83A 4IUWA 4DF9A 1JH1A 3LJGA 4DPEA 2ERPA 2Y6DA 3N2UA 2CKIA 1DMTA 2V4BA 1RM8A 3HDAP 1BM6A 4PKTA 3L0VA 1B3DA 1JAOA 2W12A 4XM8A 3I7GA 5D3CA 3V96B 1YOUA 3P1VA 3DTEA 3LQ0A 3WV2A 5I43A 2DW2A 4DD8A 1EB6A 1YP1A 3EDHA 4GR8A 4PKSA 4GUYA 1OO9A 1IAGA 1YCMA 1Y8JA 2N8RA 1UTTA 1CQRA 2EROA 3DWBA 2W0DA 1AYKA 1Z3JA 2HU6A 4I03A 3TSKA 4JIJA 4G0DA 5CUHA 1BKCA 4ZR5A 1JANA 3LIKA 1JIZA 1R55A 3ELMA 3E8RA 2MZEA 5I12A 3U1RA 2QPJA 3L0TA 1XUCA 3HY9A 1HFCA 4R3VA 2W15A 4H2EA 3SHIA
chains in the Genus database with same CATH topology
4PKVA 2JT6A 4I35A 4XCTA 1KUFA 2E3XA 3F16A 3DPEA 2X3BA 4GWNA 1KAPP 4DV8A 3KWVC 3LK8A 2KRJA 1AF0A 4L6TA 1KBCA 1I1IP 3KEKA 3VTGA 4H76A 5B5OA 1JAQA 2RJQA 3DL1A 2MLSA 3LE9A 1SLMA 4XM7A 1WNIA 1PWPA 1IAAA 2D1NA 830CA 3O64A 4QKZA 1SRPA 1GO7P 1A86A 1ZTQA 2OW2A 3OHLA 3F19A 3WV1A 5LABA 1L6JA 1G49A 5D1SA 1UMTA 3K7LA 1XURA 1C7KA 4GF1A 3LUMA 1XFYA 2OVXA 3HBUP 3G42A 3RTTA 4H30A 5CZMA 4WZVA 3USNA 2Z2DA 1K7GA 4H49A 2SRTA 1BQOA 1OM7A 2K2GA 4PKUA 1HOVA 1R1JA 4HX3A 1KUKA 1ASTA 2TCLA 1Q3AA 4Q1LA 2OXZA 3LILA 2YB9A 3LJZA 4AYKA 1XFXA 1BIWA 5CXAA 2O3EA 3LUNA 1XFUA 3EWJA 1BUVM 5I3MA 1D5JA 2RJPA 1G12A 1CAQA 2W13A 5B5PA 1D8MA 3DSLA 2L0RA 4WF6A 4H1QA 2FV5A 1GE7A 2OW0A 4GR0A 5D1TA 3NX7A 3OHOA 3AYKA 4FXYP 3KMCA 1ROSA 2JT5A 5L7FA 2OXUA 4WKIA 4HMAA 1BZSA 4EFSA 1ATLA 3P24A 1GXDA 1GKCA 1XUDA 1JAPA 2WOAA 1CIZA 1ZP5A 2X7MA 1IACA 2W14A 2DDFA 2A8HA 3Q2HA 3LEAA 4XM6A 1CGLA 3F17A 2ERQA 2OZRA 3HB2P 1RMZA 3LQBA 1FBLA 1PWVA 3DTKA 1HY7A 3Q2GA 1C8TA 1PWQA 1O0QA 1FLSA 3RTSA 2X3CA 5BOYA 2JSDA 4A7BA 1MMQA 5I2ZA 3ZUKA 1R1IA 4GWMA 1HTDA 1KUHA 3MA2A 4AUOA 3GBOA 5BPAA 1BKCE 3AIGA 2MLRA 3B92A 3LJTA 4G9LA 2OW1A 1PWUA 4GQLA 1BQQM 2XS4A 2AYKA 3VI1A 3K7NA 1Y93A 3KEJA 4FU4A 456CA 2D1OA 3KHIA 1JJ9A 5I0LA 1OM6A 1ZXCA 3HY7A 4H82A 5D7WA 1S4BP 1BKCI 2YIGA 1XFZA 4FVLA 1I76A 3KRYA 3DNGA 3TT4A 2OVZA 3F1AA 1GE6A 1OM8A 4WK7A 1Y0VA 2MZHA 1JK3A 3EHYA 4H3XA 1ZS0A 4ILWD 1UMSA 4JP4A 2O36A 4L7AA 2Y6CA 1CXVA 3LKAA 1MMPA 3KECA 1CGFA 4JA1A 1YQYA 1UEAA 3G5CA 1KUIA 1IABA 4IN9A 4H84A 1ND1A 2K9CA 3F18A 5H8XA 2AIGP 1HFSA 3ZVSA 4CTHA 5D2BA 1GO8P 3EHXA 3N2VA 2DW1A 3HYGA 2USNA 2CLTA 1H71P 4JQGA 3KMEA 2OY4A 1XFVA 2J0TA 3EDGA 3EDIA 3WV3A 3BA0A 3DTIA 1G4KA 1SLNA 1QUAA 1MMRA 2YUFA 1A85A 4J4MA 1UTZA 2X3AA 3HBVP 3ZXHA 3HDBA 1QIBA 1ZVXA 2DW0A 4JPAA 1R1HA 1D8FA 1OS9A 2XS3A 1K7IA 1B8YA 1KUGA 2OY2A 2DDYA 1I73A 1BSWA 5D1UA 3LMCA 1SU3A 1QJIA 1USNA 1J7NA 966CA 5JMYA 1IADA 1SATA 4FXQA 4L63A 1D7XA 2JIHA 3B8ZA 1JKYA 1FM1A 1QICA 3DPFA 3EDZA 1HV5A 1IAEA 4XBHA 2JNPA 1MNCA 1GKDA 4PKRA 3B2ZA 1PWWA 1C3IA 3CKIA 4AIGA 1MMBA 3UVCA 5BOTA 1BUDA 2OI0A 1QIAA 1ZXVA 3I7IA 1QJJA 2PJTA 1G9KA 4PKQA 2E2DA 1OS2A 2FV9A 1EUBA 1CK7A 4IJOA 4WKEA 1GE5A 1K7QA 1DTHA 2WO9A 1O0TA 3LGPA 1OMJA 4ON1A 3O2XA 4A3WA 3F15A 4GR3A 1EAKA 2MZIA 2POJA 1AKLA 2OXWA 3TVCA 5I4OA 5L79A 3LIRA 3AYUA 1SMPA 4L19A 3TS4A 1XFWA 4PKWA 1G05A 1JIWP 2OW9A 1CGEA 2WO8A 4AXQA 1R54A 2I47A 2J83A 4IUWA 4DF9A 1JH1A 3LJGA 4DPEA 2ERPA 2Y6DA 3N2UA 2CKIA 1DMTA 2V4BA 1RM8A 3HDAP 1BM6A 4PKTA 3L0VA 1B3DA 1JAOA 2W12A 4XM8A 3I7GA 5D3CA 3V96B 1YOUA 3P1VA 3DTEA 3LQ0A 3WV2A 5I43A 2DW2A 4DD8A 1EB6A 1YP1A 3EDHA 4GR8A 4PKSA 4GUYA 1OO9A 1IAGA 1YCMA 1Y8JA 2N8RA 1UTTA 1CQRA 2EROA 3DWBA 2W0DA 1AYKA 1Z3JA 2HU6A 4I03A 3TSKA 4JIJA 4G0DA 5CUHA 1BKCA 4ZR5A 1JANA 3LIKA 1JIZA 1R55A 3ELMA 3E8RA 2MZEA 5I12A 3U1RA 2QPJA 3L0TA 1XUCA 3HY9A 1HFCA 4R3VA 2W15A 4H2EA 3SHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PKV A;  2JT6 A;  4I35 A;  4XCT A;  1KUF A;  2E3X A;  3F16 A;  3DPE A;  2X3B A;  4GWN A;  1KAP P;  4DV8 A;  3KWV C;  3LK8 A;  2KRJ A;  1AF0 A;  4L6T A;  1KBC A;  1I1I P;  3KEK A;  3VTG A;  4H76 A;  5B5O A;  1JAQ A;  2RJQ A;  3DL1 A;  2MLS A;  3LE9 A;  1SLM A;  4XM7 A;  1WNI A;  1PWP A;  1IAA A;  2D1N A;  830C A;  3O64 A;  4QKZ A;  1SRP A;  1GO7 P;  1A86 A;  1ZTQ A;  2OW2 A;  3OHL A;  3F19 A;  3WV1 A;  5LAB A;  1L6J A;  1G49 A;  5D1S A;  1UMT A;  3K7L A;  1XUR A;  1C7K A;  4GF1 A;  3LUM A;  1XFY A;  2OVX A;  3HBU P;  3G42 A;  3RTT A;  4H30 A;  5CZM A;  4WZV A;  3USN A;  2Z2D A;  1K7G A;  4H49 A;  2SRT A;  1BQO A;  1OM7 A;  2K2G A;  4PKU A;  1HOV A;  1R1J A;  4HX3 A;  1KUK A;  1AST A;  2TCL A;  1Q3A A;  4Q1L A;  2OXZ A;  3LIL A;  2YB9 A;  3LJZ A;  4AYK A;  1XFX A;  1BIW A;  5CXA A;  2O3E A;  3LUN A;  1XFU A;  3EWJ A;  1BUV M;  5I3M A;  1D5J A;  2RJP A;  1G12 A;  1CAQ A;  2W13 A;  5B5P A;  1D8M A;  3DSL A;  2L0R A;  4WF6 A;  4H1Q A;  2FV5 A;  1GE7 A;  2OW0 A;  4GR0 A;  5D1T A;  3NX7 A;  3OHO A;  3AYK A;  4FXY P;  3KMC A;  1ROS A;  2JT5 A;  5L7F A;  2OXU A;  4WKI A;  4HMA A;  1BZS A;  4EFS A;  1ATL A;  3P24 A;  1GXD A;  1GKC A;  1XUD A;  1JAP A;  2WOA A;  1CIZ A;  1ZP5 A;  2X7M A;  1IAC A;  2W14 A;  2DDF A;  2A8H A;  3Q2H A;  3LEA A;  4XM6 A;  1CGL A;  3F17 A;  2ERQ A;  2OZR A;  3HB2 P;  1RMZ A;  3LQB A;  1FBL A;  1PWV A;  1HY7 A;  3Q2G A;  1C8T A;  1PWQ A;  1O0Q A;  1FLS A;  3RTS A;  2X3C A;  5BOY A;  2JSD A;  4A7B A;  1MMQ A;  5I2Z A;  3ZUK A;  1R1I A;  4GWM A;  1HTD A;  1KUH A;  3MA2 A;  4AUO A;  3GBO A;  5BPA A;  1BKC E;  3AIG A;  2MLR A;  3B92 A;  3LJT A;  4G9L A;  2OW1 A;  1PWU A;  4GQL A;  1BQQ M;  2XS4 A;  2AYK A;  3VI1 A;  3K7N A;  1Y93 A;  3KEJ A;  4FU4 A;  456C A;  2D1O A;  3KHI A;  1JJ9 A;  5I0L A;  1OM6 A;  1ZXC A;  3HY7 A;  4H82 A;  5D7W A;  1S4B P;  1BKC I;  2YIG A;  1XFZ A;  4FVL A;  1I76 A;  3KRY A;  3DNG A;  3TT4 A;  2OVZ A;  3F1A A;  1GE6 A;  1OM8 A;  4WK7 A;  1Y0V A;  2MZH A;  1JK3 A;  3EHY A;  4H3X A;  1ZS0 A;  4ILW D;  1UMS A;  4JP4 A;  2O36 A;  2Y6C A;  1CXV A;  3LKA A;  1MMP A;  3KEC A;  1CGF A;  4JA1 A;  1YQY A;  1UEA A;  3G5C A;  1KUI A;  1IAB A;  4IN9 A;  4H84 A;  1ND1 A;  2K9C A;  3F18 A;  5H8X A;  2AIG P;  1HFS A;  3ZVS A;  4CTH A;  5D2B A;  1GO8 P;  3EHX A;  3N2V A;  2DW1 A;  3HYG A;  2USN A;  2CLT A;  1H71 P;  4JQG A;  3KME A;  2OY4 A;  1XFV A;  2J0T A;  3EDG A;  3EDI A;  3WV3 A;  3BA0 A;  1G4K A;  1SLN A;  1QUA A;  1MMR A;  1A85 A;  4J4M A;  1UTZ A;  2X3A A;  3HBV P;  3ZXH A;  3HDB A;  1QIB A;  1ZVX A;  2DW0 A;  4JPA A;  1R1H A;  1D8F A;  1OS9 A;  2XS3 A;  1K7I A;  1B8Y A;  1KUG A;  2OY2 A;  2DDY A;  1I73 A;  1BSW A;  5D1U A;  3LMC A;  1SU3 A;  1QJI A;  1USN A;  1J7N A;  966C A;  5JMY A;  1IAD A;  1SAT A;  4FXQ A;  4L63 A;  1D7X A;  2JIH A;  3B8Z A;  1JKY A;  1FM1 A;  1QIC A;  3DPF A;  3EDZ A;  1HV5 A;  1IAE A;  4XBH A;  2JNP A;  1MNC A;  1GKD A;  4PKR A;  3B2Z A;  1PWW A;  1C3I A;  3CKI A;  4AIG A;  1MMB A;  3UVC A;  5BOT A;  1BUD A;  2OI0 A;  1QIA A;  1ZXV A;  3I7I A;  1QJJ A;  2PJT A;  1G9K A;  4PKQ A;  2E2D A;  1OS2 A;  2FV9 A;  1EUB A;  1CK7 A;  4IJO A;  4WKE A;  1GE5 A;  1K7Q A;  1DTH A;  2WO9 A;  1O0T A;  3LGP A;  1OMJ A;  4ON1 A;  3O2X A;  4A3W A;  3F15 A;  4GR3 A;  1EAK A;  2MZI A;  2POJ A;  1AKL A;  2OXW A;  3TVC A;  5I4O A;  5L79 A;  3LIR A;  3AYU A;  1SMP A;  4L19 A;  3TS4 A;  1XFW A;  4PKW A;  1G05 A;  1JIW P;  2OW9 A;  1CGE A;  2WO8 A;  4AXQ A;  1R54 A;  2I47 A;  2J83 A;  4IUW A;  4DF9 A;  1JH1 A;  3LJG A;  4DPE A;  2ERP A;  2Y6D A;  3N2U A;  2CKI A;  1DMT A;  2V4B A;  1RM8 A;  3HDA P;  1BM6 A;  4PKT A;  3L0V A;  1B3D A;  1JAO A;  2W12 A;  4XM8 A;  3I7G A;  5D3C A;  3V96 B;  1YOU A;  3P1V A;  3LQ0 A;  3WV2 A;  5I43 A;  2DW2 A;  4DD8 A;  1EB6 A;  1YP1 A;  3EDH A;  4GR8 A;  4PKS A;  4GUY A;  1OO9 A;  1IAG A;  1YCM A;  1Y8J A;  2N8R A;  1UTT A;  1CQR A;  2ERO A;  3DWB A;  2W0D A;  1AYK A;  1Z3J A;  2HU6 A;  4I03 A;  3TSK A;  4JIJ A;  4G0D A;  5CUH A;  1BKC A;  4ZR5 A;  1JAN A;  3LIK A;  1JIZ A;  1R55 A;  3ELM A;  3E8R A;  2MZE A;  5I12 A;  3U1R A;  2QPJ A;  3L0T A;  1XUC A;  3HY9 A;  1HFC A;  4R3V A;  2W15 A;  4H2E A;  3SHI A; 
#chains in the Genus database with same CATH topology
 4PKV A;  2JT6 A;  4I35 A;  4XCT A;  1KUF A;  2E3X A;  3F16 A;  3DPE A;  2X3B A;  4GWN A;  1KAP P;  4DV8 A;  3KWV C;  3LK8 A;  2KRJ A;  1AF0 A;  4L6T A;  1KBC A;  1I1I P;  3KEK A;  3VTG A;  4H76 A;  5B5O A;  1JAQ A;  2RJQ A;  3DL1 A;  2MLS A;  3LE9 A;  1SLM A;  4XM7 A;  1WNI A;  1PWP A;  1IAA A;  2D1N A;  830C A;  3O64 A;  4QKZ A;  1SRP A;  1GO7 P;  1A86 A;  1ZTQ A;  2OW2 A;  3OHL A;  3F19 A;  3WV1 A;  5LAB A;  1L6J A;  1G49 A;  5D1S A;  1UMT A;  3K7L A;  1XUR A;  1C7K A;  4GF1 A;  3LUM A;  1XFY A;  2OVX A;  3HBU P;  3G42 A;  3RTT A;  4H30 A;  5CZM A;  4WZV A;  3USN A;  2Z2D A;  1K7G A;  4H49 A;  2SRT A;  1BQO A;  1OM7 A;  2K2G A;  4PKU A;  1HOV A;  1R1J A;  4HX3 A;  1KUK A;  1AST A;  2TCL A;  1Q3A A;  4Q1L A;  2OXZ A;  3LIL A;  2YB9 A;  3LJZ A;  4AYK A;  1XFX A;  1BIW A;  5CXA A;  2O3E A;  3LUN A;  1XFU A;  3EWJ A;  1BUV M;  5I3M A;  1D5J A;  2RJP A;  1G12 A;  1CAQ A;  2W13 A;  5B5P A;  1D8M A;  3DSL A;  2L0R A;  4WF6 A;  4H1Q A;  2FV5 A;  1GE7 A;  2OW0 A;  4GR0 A;  5D1T A;  3NX7 A;  3OHO A;  3AYK A;  4FXY P;  3KMC A;  1ROS A;  2JT5 A;  5L7F A;  2OXU A;  4WKI A;  4HMA A;  1BZS A;  4EFS A;  1ATL A;  3P24 A;  1GXD A;  1GKC A;  1XUD A;  1JAP A;  2WOA A;  1CIZ A;  1ZP5 A;  2X7M A;  1IAC A;  2W14 A;  2DDF A;  2A8H A;  3Q2H A;  3LEA A;  4XM6 A;  1CGL A;  3F17 A;  2ERQ A;  2OZR A;  3HB2 P;  1RMZ A;  3LQB A;  1FBL A;  1PWV A;  3DTK A;  1HY7 A;  3Q2G A;  1C8T A;  1PWQ A;  1O0Q A;  1FLS A;  3RTS A;  2X3C A;  5BOY A;  2JSD A;  1XM5 A;  4A7B A;  1MMQ A;  5I2Z A;  3ZUK A;  1R1I A;  4GWM A;  1HTD A;  1KUH A;  3MA2 A;  4AUO A;  3GBO A;  5BPA A;  1BKC E;  3AIG A;  2MLR A;  3B92 A;  3LJT A;  4G9L A;  2OW1 A;  1PWU A;  4GQL A;  1BQQ M;  2XS4 A;  2AYK A;  3VI1 A;  3K7N A;  1Y93 A;  3KEJ A;  4FU4 A;  456C A;  2D1O A;  3KHI A;  1JJ9 A;  5I0L A;  1OM6 A;  1ZXC A;  3HY7 A;  4H82 A;  5D7W A;  1S4B P;  1BKC I;  2YIG A;  1XFZ A;  4FVL A;  1I76 A;  3KRY A;  3DNG A;  3TT4 A;  2OVZ A;  3F1A A;  1GE6 A;  1OM8 A;  4WK7 A;  1Y0V A;  2MZH A;  1JK3 A;  3EHY A;  4H3X A;  1ZS0 A;  4ILW D;  1UMS A;  4JP4 A;  2O36 A;  4L7A A;  2Y6C A;  1CXV A;  3LKA A;  1MMP A;  3KEC A;  1CGF A;  4JA1 A;  1YQY A;  1UEA A;  3G5C A;  1KUI A;  1IAB A;  4IN9 A;  4H84 A;  1ND1 A;  2K9C A;  3F18 A;  5H8X A;  2AIG P;  1HFS A;  3ZVS A;  4CTH A;  5D2B A;  1GO8 P;  3EHX A;  3N2V A;  2DW1 A;  3HYG A;  2USN A;  2CLT A;  1H71 P;  4JQG A;  3KME A;  2OY4 A;  1XFV A;  2J0T A;  3EDG A;  3EDI A;  3WV3 A;  3BA0 A;  3DTI A;  1G4K A;  1SLN A;  1QUA A;  1MMR A;  2YUF A;  1A85 A;  4J4M A;  1UTZ A;  2X3A A;  3HBV P;  3ZXH A;  3HDB A;  1QIB A;  1ZVX A;  2DW0 A;  4JPA A;  1R1H A;  1D8F A;  1TVI A;  1OS9 A;  2XS3 A;  1K7I A;  1B8Y A;  1KUG A;  1OZ9 A;  2OY2 A;  2DDY A;  1I73 A;  1BSW A;  5D1U A;  3LMC A;  1SU3 A;  1QJI A;  1USN A;  1J7N A;  1XAX A;  966C A;  5JMY A;  1IAD A;  1SAT A;  4FXQ A;  4L63 A;  1D7X A;  2JIH A;  3B8Z A;  1JKY A;  1FM1 A;  1QIC A;  3DPF A;  3EDZ A;  1HV5 A;  1IAE A;  4XBH A;  2JNP A;  1MNC A;  1GKD A;  4PKR A;  3B2Z A;  1PWW A;  1C3I A;  3CKI A;  4AIG A;  1MMB A;  3UVC A;  5BOT A;  1BUD A;  2OI0 A;  1QIA A;  1ZXV A;  3I7I A;  1QJJ A;  2PJT A;  1G9K A;  4PKQ A;  2E2D A;  1OS2 A;  2FV9 A;  1EUB A;  1CK7 A;  4IJO A;  4WKE A;  1GE5 A;  1K7Q A;  1DTH A;  2WO9 A;  1O0T A;  3LGP A;  1OMJ A;  4ON1 A;  3O2X A;  4A3W A;  3F15 A;  4GR3 A;  1EAK A;  2MZI A;  2POJ A;  1AKL A;  2OXW A;  3TVC A;  5I4O A;  5L79 A;  3LIR A;  3AYU A;  1SMP A;  4L19 A;  3TS4 A;  1XFW A;  4PKW A;  1G05 A;  1JIW P;  2OW9 A;  1CGE A;  2WO8 A;  4AXQ A;  1R54 A;  2I47 A;  2J83 A;  4IUW A;  4DF9 A;  1JH1 A;  3LJG A;  4DPE A;  2ERP A;  2Y6D A;  3N2U A;  2CKI A;  1DMT A;  2V4B A;  1RM8 A;  3HDA P;  1BM6 A;  4PKT A;  3L0V A;  1B3D A;  1JAO A;  2W12 A;  4XM8 A;  3I7G A;  5D3C A;  3V96 B;  1YOU A;  3P1V A;  3DTE A;  3LQ0 A;  3WV2 A;  5I43 A;  2DW2 A;  4DD8 A;  1EB6 A;  1YP1 A;  3EDH A;  4GR8 A;  4PKS A;  4GUY A;  1OO9 A;  1IAG A;  1YCM A;  1Y8J A;  2N8R A;  1UTT A;  1CQR A;  2ERO A;  3DWB A;  2W0D A;  1AYK A;  1Z3J A;  2HU6 A;  4I03 A;  3TSK A;  4JIJ A;  4G0D A;  5CUH A;  1BKC A;  4ZR5 A;  1JAN A;  3LIK A;  1JIZ A;  1R55 A;  3ELM A;  3E8R A;  2MZE A;  5I12 A;  3U1R A;  2QPJ A;  3L0T A;  1XUC A;  3HY9 A;  1HFC A;  4R3V A;  2W15 A;  4H2E A;  3SHI A; 
#chains in the Genus database with same CATH homology
 4PKV A;  2JT6 A;  4I35 A;  4XCT A;  1KUF A;  2E3X A;  3F16 A;  3DPE A;  2X3B A;  4GWN A;  1KAP P;  4DV8 A;  3KWV C;  3LK8 A;  2KRJ A;  1AF0 A;  4L6T A;  1KBC A;  1I1I P;  3KEK A;  3VTG A;  4H76 A;  5B5O A;  1JAQ A;  2RJQ A;  3DL1 A;  2MLS A;  3LE9 A;  1SLM A;  4XM7 A;  1WNI A;  1PWP A;  1IAA A;  2D1N A;  830C A;  3O64 A;  4QKZ A;  1SRP A;  1GO7 P;  1A86 A;  1ZTQ A;  2OW2 A;  3OHL A;  3F19 A;  3WV1 A;  5LAB A;  1L6J A;  1G49 A;  5D1S A;  1UMT A;  3K7L A;  1XUR A;  1C7K A;  4GF1 A;  3LUM A;  1XFY A;  2OVX A;  3HBU P;  3G42 A;  3RTT A;  4H30 A;  5CZM A;  4WZV A;  3USN A;  2Z2D A;  1K7G A;  4H49 A;  2SRT A;  1BQO A;  1OM7 A;  2K2G A;  4PKU A;  1HOV A;  1R1J A;  4HX3 A;  1KUK A;  1AST A;  2TCL A;  1Q3A A;  4Q1L A;  2OXZ A;  3LIL A;  2YB9 A;  3LJZ A;  4AYK A;  1XFX A;  1BIW A;  5CXA A;  2O3E A;  3LUN A;  1XFU A;  3EWJ A;  1BUV M;  5I3M A;  1D5J A;  2RJP A;  1G12 A;  1CAQ A;  2W13 A;  5B5P A;  1D8M A;  3DSL A;  2L0R A;  4WF6 A;  4H1Q A;  2FV5 A;  1GE7 A;  2OW0 A;  4GR0 A;  5D1T A;  3NX7 A;  3OHO A;  3AYK A;  4FXY P;  3KMC A;  1ROS A;  2JT5 A;  5L7F A;  2OXU A;  4WKI A;  4HMA A;  1BZS A;  4EFS A;  1ATL A;  3P24 A;  1GXD A;  1GKC A;  1XUD A;  1JAP A;  2WOA A;  1CIZ A;  1ZP5 A;  2X7M A;  1IAC A;  2W14 A;  2DDF A;  2A8H A;  3Q2H A;  3LEA A;  4XM6 A;  1CGL A;  3F17 A;  2ERQ A;  2OZR A;  3HB2 P;  1RMZ A;  3LQB A;  1FBL A;  1PWV A;  3DTK A;  1HY7 A;  3Q2G A;  1C8T A;  1PWQ A;  1O0Q A;  1FLS A;  3RTS A;  2X3C A;  5BOY A;  2JSD A;  4A7B A;  1MMQ A;  5I2Z A;  3ZUK A;  1R1I A;  4GWM A;  1HTD A;  1KUH A;  3MA2 A;  4AUO A;  3GBO A;  5BPA A;  1BKC E;  3AIG A;  2MLR A;  3B92 A;  3LJT A;  4G9L A;  2OW1 A;  1PWU A;  4GQL A;  1BQQ M;  2XS4 A;  2AYK A;  3VI1 A;  3K7N A;  1Y93 A;  3KEJ A;  4FU4 A;  456C A;  2D1O A;  3KHI A;  1JJ9 A;  5I0L A;  1OM6 A;  1ZXC A;  3HY7 A;  4H82 A;  5D7W A;  1S4B P;  1BKC I;  2YIG A;  1XFZ A;  4FVL A;  1I76 A;  3KRY A;  3DNG A;  3TT4 A;  2OVZ A;  3F1A A;  1GE6 A;  1OM8 A;  4WK7 A;  1Y0V A;  2MZH A;  1JK3 A;  3EHY A;  4H3X A;  1ZS0 A;  4ILW D;  1UMS A;  4JP4 A;  2O36 A;  4L7A A;  2Y6C A;  1CXV A;  3LKA A;  1MMP A;  3KEC A;  1CGF A;  4JA1 A;  1YQY A;  1UEA A;  3G5C A;  1KUI A;  1IAB A;  4IN9 A;  4H84 A;  1ND1 A;  2K9C A;  3F18 A;  5H8X A;  2AIG P;  1HFS A;  3ZVS A;  4CTH A;  5D2B A;  1GO8 P;  3EHX A;  3N2V A;  2DW1 A;  3HYG A;  2USN A;  2CLT A;  1H71 P;  4JQG A;  3KME A;  2OY4 A;  1XFV A;  2J0T A;  3EDG A;  3EDI A;  3WV3 A;  3BA0 A;  3DTI A;  1G4K A;  1SLN A;  1QUA A;  1MMR A;  2YUF A;  1A85 A;  4J4M A;  1UTZ A;  2X3A A;  3HBV P;  3ZXH A;  3HDB A;  1QIB A;  1ZVX A;  2DW0 A;  4JPA A;  1R1H A;  1D8F A;  1OS9 A;  2XS3 A;  1K7I A;  1B8Y A;  1KUG A;  2OY2 A;  2DDY A;  1I73 A;  1BSW A;  5D1U A;  3LMC A;  1SU3 A;  1QJI A;  1USN A;  1J7N A;  966C A;  5JMY A;  1IAD A;  1SAT A;  4FXQ A;  4L63 A;  1D7X A;  2JIH A;  3B8Z A;  1JKY A;  1FM1 A;  1QIC A;  3DPF A;  3EDZ A;  1HV5 A;  1IAE A;  4XBH A;  2JNP A;  1MNC A;  1GKD A;  4PKR A;  3B2Z A;  1PWW A;  1C3I A;  3CKI A;  4AIG A;  1MMB A;  3UVC A;  5BOT A;  1BUD A;  2OI0 A;  1QIA A;  1ZXV A;  3I7I A;  1QJJ A;  2PJT A;  1G9K A;  4PKQ A;  2E2D A;  1OS2 A;  2FV9 A;  1EUB A;  1CK7 A;  4IJO A;  4WKE A;  1GE5 A;  1K7Q A;  1DTH A;  2WO9 A;  1O0T A;  3LGP A;  1OMJ A;  4ON1 A;  3O2X A;  4A3W A;  3F15 A;  4GR3 A;  1EAK A;  2MZI A;  2POJ A;  1AKL A;  2OXW A;  3TVC A;  5I4O A;  5L79 A;  3LIR A;  3AYU A;  1SMP A;  4L19 A;  3TS4 A;  1XFW A;  4PKW A;  1G05 A;  1JIW P;  2OW9 A;  1CGE A;  2WO8 A;  4AXQ A;  1R54 A;  2I47 A;  2J83 A;  4IUW A;  4DF9 A;  1JH1 A;  3LJG A;  4DPE A;  2ERP A;  2Y6D A;  3N2U A;  2CKI A;  1DMT A;  2V4B A;  1RM8 A;  3HDA P;  1BM6 A;  4PKT A;  3L0V A;  1B3D A;  1JAO A;  2W12 A;  4XM8 A;  3I7G A;  5D3C A;  3V96 B;  1YOU A;  3P1V A;  3DTE A;  3LQ0 A;  3WV2 A;  5I43 A;  2DW2 A;  4DD8 A;  1EB6 A;  1YP1 A;  3EDH A;  4GR8 A;  4PKS A;  4GUY A;  1OO9 A;  1IAG A;  1YCM A;  1Y8J A;  2N8R A;  1UTT A;  1CQR A;  2ERO A;  3DWB A;  2W0D A;  1AYK A;  1Z3J A;  2HU6 A;  4I03 A;  3TSK A;  4JIJ A;  4G0D A;  5CUH A;  1BKC A;  4ZR5 A;  1JAN A;  3LIK A;  1JIZ A;  1R55 A;  3ELM A;  3E8R A;  2MZE A;  5I12 A;  3U1R A;  2QPJ A;  3L0T A;  1XUC A;  3HY9 A;  1HFC A;  4R3V A;  2W15 A;  4H2E A;  3SHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...