2PK0A

Structure of the s. agalactiae serine/threonine phosphatase at 2.65 resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
247
structure length
247
Chain Sequence
b'ARKKYMEISLLTDIGQRRSNNQDFINQFENKAGVPLIILADGMGGHRAGNIASEMTVTDLGSDWAETDFSELSEIRDWMLVSIETENRKIYELGQSDDYKGMGTTIEAVAIVGDNIIFAHVGDSRIGIVRQGEYHLLTSDHSLVNELVKAGQLTEEEAASHPQKNIITQSIGQANPVEPDLGVHLLEEGDYLVVNSDGLTNMLSNADIATVLTQEKTLDDKNQDLITLANHRGGLDNITVALVYVES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine protein phosphatase Stp1
publication title Structure of Streptococcus agalactiae serine/threonine phosphatase. The subdomain conformation is coupled to the binding of a third metal ion
pubmed doi rcsb
source organism Streptococcus agalactiae
molecule tags Signaling protein
total genus 75
structure length 247
sequence length 247
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2007-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13672 PP2C_2 Protein phosphatase 2C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.40.10 Alpha Beta 4-Layer Sandwich Phosphatase 2c; domain 1 PPM-type phosphatase domain 2pk0A00
3KE6A 4YZHA 3W40A 3NMVB 2JFSA 4RA2A 3QN1B 4LG5B 4DS8B 5JO2B 2JFTA 5D2UA 2P8EA 3EQ2A 3KDJB 4YZGA 3W45A 2POPA 3T9QA 3JRQA 2IQ1A 2XZVA 4RAFA 2J86A 2ISNA 4RAGA 3W44A 4JNDA 3FXKA 3NMTB 4LA7B 2I44A 3W42A 4N0GA 3KB3B 2JFRA 2I0OA 5F1MA 4LGAB 3UJKA 3FXMA 3UJGB 3FXLA 3T91A 2Y09A 3W41A 1A6QA 3ZT9A 2POMA 2J82A 3FXOA 3RT0A 4DA1A 2PK0A 3ZVUB 2IRMA 4LGBB 5JO1B 1TXOA 2V06A 3PU9A 3N3CA 3F79A 3ES2A 3D8KA 3NMNB 4WVOB 2J4OA 4OICB 3MQ3A 3FXJA 2PNQA 3UJLB 5ITIA 3W43A 3RNRA 2CM1A
chains in the Genus database with same CATH superfamily
3KE6A 4YZHA 4IIPA 3W40A 3NMVB 2JFSA 4RA2A 3QN1B 4LG5B 4DS8B 5JO2B 2JFTA 5D2UA 2P8EA 3EQ2A 3KDJB 4YZGA 3W45A 2POPA 3T9QA 4IIKA 3JRQA 2IQ1A 2XZVA 4RAFA 2J86A 2ISNA 4RAGA 3W44A 4JNDA 3FXKA 3NMTB 4LA7B 2I44A 3W42A 4N0GA 3KB3B 2JFRA 2I0OA 5F1MA 4LGAB 3UJKA 3FXMA 3UJGB 3FXLA 3T91A 2Y09A 3W41A 1A6QA 3ZT9A 2POMA 2J82A 3FXOA 3RT0A 4DA1A 2PK0A 3ZVUB 2IRMA 4LGBB 5JO1B 1TXOA 2V06A 3PU9A 3N3CA 3F79A 3ES2A 3D8KA 3NMNB 4WVOB 2J4OA 4OICB 3MQ3A 3FXJA 2PNQA 3UJLB 5ITIA 3W43A 3RNRA 2CM1A
chains in the Genus database with same CATH topology
3KE6A 4YZHA 3W40A 3NMVB 2JFSA 4RA2A 3QN1B 4LG5B 4DS8B 5JO2B 2JFTA 5D2UA 2P8EA 3EQ2A 3KDJB 4YZGA 3W45A 2POPA 3T9QA 3JRQA 2IQ1A 2XZVA 4RAFA 2J86A 2ISNA 4RAGA 3W44A 4JNDA 3FXKA 3NMTB 4LA7B 2I44A 3W42A 4N0GA 3KB3B 2JFRA 2I0OA 5F1MA 4LGAB 3UJKA 3FXMA 3UJGB 3FXLA 3T91A 2Y09A 3W41A 1A6QA 3ZT9A 2POMA 2J82A 3FXOA 3RT0A 4DA1A 2PK0A 3ZVUB 2IRMA 4LGBB 5JO1B 1TXOA 2V06A 3PU9A 3N3CA 3F79A 3ES2A 3D8KA 3NMNB 4WVOB 2J4OA 4OICB 3MQ3A 3FXJA 2PNQA 3UJLB 5ITIA 3W43A 3RNRA 2CM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KE6 A;  4YZH A;  3W40 A;  3NMV B;  2JFS A;  4RA2 A;  3QN1 B;  4LG5 B;  4DS8 B;  5JO2 B;  2JFT A;  5D2U A;  2P8E A;  3EQ2 A;  3KDJ B;  4YZG A;  3W45 A;  2POP A;  3T9Q A;  3JRQ A;  2IQ1 A;  2XZV A;  4RAF A;  2J86 A;  2ISN A;  4RAG A;  3W44 A;  4JND A;  3FXK A;  3NMT B;  4LA7 B;  2I44 A;  3W42 A;  4N0G A;  3KB3 B;  2JFR A;  2I0O A;  5F1M A;  4LGA B;  3UJK A;  3FXM A;  3UJG B;  3FXL A;  3T91 A;  2Y09 A;  3W41 A;  1A6Q A;  3ZT9 A;  2POM A;  2J82 A;  3FXO A;  3RT0 A;  4DA1 A;  2PK0 A;  3ZVU B;  2IRM A;  4LGB B;  5JO1 B;  1TXO A;  2V06 A;  3PU9 A;  3N3C A;  3F79 A;  3ES2 A;  3D8K A;  3NMN B;  4WVO B;  2J4O A;  4OIC B;  3MQ3 A;  3FXJ A;  2PNQ A;  3UJL B;  5ITI A;  3W43 A;  3RNR A;  2CM1 A; 
#chains in the Genus database with same CATH topology
 3KE6 A;  4YZH A;  4IIP A;  3W40 A;  3NMV B;  2JFS A;  4RA2 A;  3QN1 B;  4LG5 B;  4DS8 B;  5JO2 B;  2JFT A;  5D2U A;  2P8E A;  3EQ2 A;  3KDJ B;  4YZG A;  3W45 A;  2POP A;  3T9Q A;  4IIK A;  3JRQ A;  2IQ1 A;  2XZV A;  4RAF A;  2J86 A;  2ISN A;  4RAG A;  3W44 A;  4JND A;  3FXK A;  3NMT B;  4LA7 B;  2I44 A;  3W42 A;  4N0G A;  3KB3 B;  2JFR A;  2I0O A;  5F1M A;  4LGA B;  3UJK A;  3FXM A;  3UJG B;  3FXL A;  3T91 A;  2Y09 A;  3W41 A;  1A6Q A;  3ZT9 A;  2POM A;  2J82 A;  3FXO A;  3RT0 A;  4DA1 A;  2PK0 A;  3ZVU B;  2IRM A;  4LGB B;  5JO1 B;  1TXO A;  2V06 A;  3PU9 A;  3N3C A;  3F79 A;  3ES2 A;  3D8K A;  3NMN B;  4WVO B;  2J4O A;  4OIC B;  3MQ3 A;  3FXJ A;  2PNQ A;  3UJL B;  5ITI A;  3W43 A;  3RNR A;  2CM1 A; 
#chains in the Genus database with same CATH homology
 3KE6 A;  4YZH A;  3W40 A;  3NMV B;  2JFS A;  4RA2 A;  3QN1 B;  4LG5 B;  4DS8 B;  5JO2 B;  2JFT A;  5D2U A;  2P8E A;  3EQ2 A;  3KDJ B;  4YZG A;  3W45 A;  2POP A;  3T9Q A;  3JRQ A;  2IQ1 A;  2XZV A;  4RAF A;  2J86 A;  2ISN A;  4RAG A;  3W44 A;  4JND A;  3FXK A;  3NMT B;  4LA7 B;  2I44 A;  3W42 A;  4N0G A;  3KB3 B;  2JFR A;  2I0O A;  5F1M A;  4LGA B;  3UJK A;  3FXM A;  3UJG B;  3FXL A;  3T91 A;  2Y09 A;  3W41 A;  1A6Q A;  3ZT9 A;  2POM A;  2J82 A;  3FXO A;  3RT0 A;  4DA1 A;  2PK0 A;  3ZVU B;  2IRM A;  4LGB B;  5JO1 B;  1TXO A;  2V06 A;  3PU9 A;  3N3C A;  3F79 A;  3ES2 A;  3D8K A;  3NMN B;  4WVO B;  2J4O A;  4OIC B;  3MQ3 A;  3FXJ A;  2PNQ A;  3UJL B;  5ITI A;  3W43 A;  3RNR A;  2CM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...