The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
29
|
sequence length |
94
|
structure length |
94
|
Chain Sequence |
STRGDLIRILGEIEEKMNELKMDGFNPDIILFGREAYNFLSNLLKKEMEEEGPFTHVSNIKIEILEELGGDAVVIDSKVLGLVPGAAKRIKIIK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Structural genomics, unknown function
|
molecule keywords |
Uncharacterized protein PF0899
|
publication title |
Structure of the hypothetical protein PF0899 from Pyrococcus furiosus at 1.85 A resolution.
pubmed doi rcsb |
source organism |
Pyrococcus furiosus dsm 3638
|
total genus |
29
|
structure length |
94
|
sequence length |
94
|
ec nomenclature | |
pdb deposition date | 2007-04-17 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF08967 | DUF1884 | Domain of unknown function (DUF1884) |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | hypothetical protein PF0899 fold | hypothetical protein PF0899 domain |
#chains in the Genus database with same CATH superfamily 3E8K A; 2PK8 A; 3DKT A; 2FSY A; 1OHG A; 2FT1 A; 2E0Z A; #chains in the Genus database with same CATH topology 1WZ2 A; 3DKT A; 3A43 A; 5AUN A; 4DT0 A; 5AUO A; 3A44 A; 3E8K A; 2FT1 A; 2E0Z A; 2DM9 A; 2KDX A; 5AUP A; 2LC0 A; 2PK8 A; 4EFA E; 1YUE A; 4DL0 E; 2DMA A; 1OHG A; 2FSY A; 3V6I A; 1QU3 A; 3K5B A; #chains in the Genus database with same CATH homology 3E8K A; 2PK8 A; 3DKT A; 2FSY A; 1OHG A; 2FT1 A; 2E0Z A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...