2PK9B

Structure of the pho85-pho80 cdk-cyclin complex of the phosphate-responsive signal transduction pathway
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
232
structure length
214
Chain Sequence
b'GIPKVILPADFNKCSRTDLVVLISRMLVSLIAINENSITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTAHRFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQKKFVIDKNSYVNRPKSGYNVLDKYYRRIVQLVGSFNASPDKSRKVDYVLPPN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclin-dependent protein kinase PHO85
publication title Structure of the Pho85-Pho80 CDK-Cyclin Complex of the Phosphate-Responsive Signal Transduction Pathway
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein,transferase/cell cycle
total genus 64
structure length 214
sequence length 232
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08613 Cyclin Cyclin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2pk9B00
1QMZB 2C6TB 4CFUD 2F2CA 1GY3B 2JGZB 2C5OB 3BHVB 1P5EB 2C4GB 1GUXA 2UZEB 1URCB 4KRDB 1JKWA 2WEVB 1OKVB 2W9ZA 1N4MA 5L2WB 4BCKB 3QHRB 5LMKB 2R7GA 4BCIB 3TN8B 1PKDB 3BLRB 4YOOA 4BCGB 4ROCA 2PMIB 2W9FA 1OL1B 3MI9B 2I40B 1E9HB 1ZP2A 1UNHD 2CCHB 4F70B 3MY1B 3DDPB 3TNIB 4F6SB 4OGRB 1OGUB 5FGKB 3TNWB 4F7SB 1H1RB 4CFMB 3LQ5B 4Y72B 5HQ0B 1H1PB 1H4LD 1C9BA 3BHTB 3H4CA 4FX3B 4F7LB 2G9XB 1O9KA 4BCQB 2IW9B 5LQFB 3K7AM 2UZBB 4EOOB 1AISB 3F5XB 4BCQD 1VINA 1H1QB 2I53A 2WMAB 4TTHA 5HVYB 5IDPB 2W2HA 2PK9B 5ACBA 1OKWB 1OL2B 1OI9B 5HBHB 2C5XB 2WPAB 3O0GD 4F6UB 4EC9B 4BCOB 4ELJA 4RODA 5HBEB 3EIDB 4EOPB 2IW8B 1H27B 1GUXB 1JOWA 1W98B 5HBJB 1JSUB 4YOSA 4EOSB 1JSTB 2WIPB 4ROEA 1VYWB 4EOIB 5IF1B 2UZDB 2W99A 1AD6A 2PK2A 4BCMB 2C5VB 4YC3B 2WMBB 4EORB 4EOLB 3M03A 2EUFA 4BCMD 4CRLB 2W96A 4CFXB 2B9RA 4BCNB 4EONB 4G6LB 4CFNB 3EOCB 3MY5B 4F7NB 1GH6B 2C5NB 2CJMB 4BCFB 4BCND 4BCJB 3MIAB 5EFQB 2WHBB 4F6WB 4CXAB 2BPMB 1H28B 2IW6B 4F7JB 1H26B 4OR5B 5BNJB 5I5ZB 1D3UB 1O9KB 2X1NB 3RGFB 4IMYB 4BCPB 4CFWB 1KXUA 5HNBB 2WXVB 1TFBA 3BLHB 2IVXA 4YOZA 4EOKB 4NSTB 2UZLB 3QHWB 4EOQB 5CEIB 1BU2A 2WFYB 4EC8B 1OIYB 1OIUB 3DOGB 4BCHB 5IDNB 1H1SB 5CYIB 1H25B 3EJ1B 4I3ZB 2UUEB 2V22B 3BHUB 3BLQB 1F5QB 1UNGD 2BKZB 4CFVB 2WIHB 1XO2A 1H24B 4EOJB 4II5B 5ICPB 2QDJA 4EOMB 1UNLD 4ELLA 1FINB 3G33B 3TNHB 1FVVB 2CCIB 4CFUB 1G3NC 4KRCB 2PHGA 4UN0A 1VOLA 3POMA 3DDQB
chains in the Genus database with same CATH superfamily
1QMZB 2CZ7B 2F2CA 2JGZB 3HB9A 1GUXA 1OKVB 1UGSB 5L2WB 3TN8B 4ROCA 1OL1B 2I40B 1E9HB 3MY1B 4F6SB 1H1RB 4FM4B 1H1PB 1H4LD 1TD6A 3BHTB 4BCQB 4ZGDB 2IW9B 4EOOB 2UZBB 4BCQD 2WMAB 3HZJA 1OI9B 3O0GD 4BCOB 1FKMA 3EIDB 4EOPB 2QFZA 1JOWA 2KR6A 2DMEA 4EOSB 1ENWA 2CZ0B 5IF1B 1AD6A 3DTOA 4BCMB 4EORB 4EOLB 3M03A 2IN3A 4BCMD 2B9RA 4Z6YA 4CFNB 2QGSA 4F7NB 3DL1A 4BCFB 2BS3A 5EFQB 4F7JB 5I5ZB 4BCPB 4BY7X 2IVXA 4ZGJB 4YOZA 4NSTB 2UZLB 1BU2A 3QYGB 3X26B 5CYIB 3EJ1B 2DD5B 2DD4B 3BLQB 3A8HB 2BS2A 5ICPB 3A8GB 1UGRB 3QWLA 3TW6A 2WJ9A 4UN0A 1VOLA 3POMA 4II5B 3BHVB 2C5OB 1P5EB 4OB3B 2C4GB 1URCB 1JKWA 4OB2B 3QHRB 1E7PA 4NC6A 1V29B 4BCGB 3DJBA 1ZP2A 1UNHD 2CCHB 3QZ9B 2AHJB 3TNIB 5FGKB 3TNWB 3VKHA 3LQ5B 4Y72B 1O9KA 4JX4A 5LQFB 1H1QB 4TTHA 2W2HA 5ACBA 1OKWB 2G77A 2C5XB 2QDYB 4EC9B 4ELJA 3KHIA 2IW8B 3HBLA 1GUXB 1JSUB 1JSTB 3WVDB 2WMBB 3PO3S 5EJCA 2C5NB 4BCJB 3QYHB 2WHBB 1H28B 1D3UB 1H26B 2X1NB 2BS4A 4IMYB 3RGFB 2LW4A 3A8LB 4EOKB 4MIMA 5CEIB 3X25B 2WFYB 3QZ5B 4QSHA 4HL4A 1H25B 2UUEB 3BHUB 2ZPFB 2WIHB 1H24B 4EOJB 4EOMB 1UNLD 3BG9A 4ZGEB 1G3NC 4KRCB 2PHGA 3BG3A 4LOCA 1GY3B 2UZEB 2WEVB 2ZCFB 3QYBA 4BCKB 3TW7A 2QF7A 4M6VA 5LMKB 2R7GA 1PKDB 2PMIB 4HNTA 4F70B 2ZZDB 3DDPB 2PJQA 3GTMS 4HLQA 4CFMB 5HQ0B 3WVEB 4BBSM 3H4CA 4FX3B 3QXEB 3HO8A 3A8MB 3K7AM 3X28B 1VINA 5HVYB 5IDPB 2PK9B 1OL2B 5HBHB 2WPAB 5HBEB 4MFDA 1H27B 4YOSA 2WIPB 4BBRM 2UZDB 2C5VB 1IREB 4BCNB 4AKIA 4EONB 4G6LB 3EOCB 1GH6B 2DPPB 2CJMB 4BCND 2QQ8A 4CXAB 2BPMB 5BNJB 4OR5B 1O9KB 2DXBB 2ZPGB 4CFWB 1KXUA 5HNBB 2WXVB 3BLHB 2CZ1B 2CYZB 4EOQB 4JX6A 4BXXX 3X24B 4EC8B 1OIUB 2V22B 1F5QB 1UNGD 2ZPBB 4CFVB 1XO2A 2KMGA 3B57A 4ELLA 2ZPHB 1FINB 1FVVB 1UGQB 2D0QB 4CFUB 2C6TB 4CFUD 4KRDB 2W9ZA 4AI6A 1N4MA 2ZPEB 4BCIB 1UGPB 3BLRB 4YOOA 2W9FA 3MI9B 4BY1X 4HNVA 4OB1B 4OGRB 3VYHB 1OGUB 4MFEA 2ZPIB 4F7SB 1C9BA 4F7LB 2G9XB 3QYEA 1AISB 3F5XB 2I53A 4OB0B 3VKGA 4F6UB 4RODA 3HHTB 1W98B 5HBJB 4ROEA 1VYWB 4EOIB 2W99A 2PK2A 4YC3B 4AKGA 4AKHA 5DQWA 2EUFA 1AHJB 3A8OB 4CRLB 2W96A 4CFXB 3MY5B 5DQVA 1QLBA 3MIAB 4F6WB 2IW6B 2DXCB 1TFBA 4JX5A 3BG5A 3QHWB 2CZ6B 3NDQA 1OIYB 3DOGB 4BCHB 5IDNB 1H1SB 4I3ZB 5IHYA 3VYGB 2BKZB 4HNUA 2QDJA 3G33B 3TNHB 3X20B 2CCIB 3DDQB
chains in the Genus database with same CATH topology
1QMZB 2C6TB 4CFUD 2F2CA 1GY3B 2JGZB 2C5OB 3BHVB 1P5EB 2C4GB 1GUXA 2UZEB 1URCB 4KRDB 1JKWA 2WEVB 1OKVB 2W9ZA 1N4MA 5L2WB 4BCKB 3QHRB 5LMKB 2R7GA 4BCIB 3TN8B 1PKDB 3BLRB 4YOOA 4BCGB 4ROCA 2PMIB 2W9FA 1OL1B 3MI9B 2I40B 1E9HB 1ZP2A 1UNHD 2CCHB 4F70B 3MY1B 3DDPB 3TNIB 4F6SB 4OGRB 1OGUB 5FGKB 3TNWB 4F7SB 1H1RB 4CFMB 3LQ5B 4Y72B 5HQ0B 1H1PB 1H4LD 1C9BA 3BHTB 3H4CA 4FX3B 4F7LB 2G9XB 1O9KA 4BCQB 2IW9B 5LQFB 3K7AM 2UZBB 4EOOB 1AISB 3F5XB 4BCQD 1VINA 1H1QB 2I53A 2WMAB 4TTHA 5HVYB 5IDPB 2W2HA 2PK9B 5ACBA 1OKWB 1OL2B 1OI9B 5HBHB 2C5XB 2WPAB 3O0GD 4F6UB 4EC9B 4BCOB 4ELJA 4RODA 5HBEB 3EIDB 4EOPB 2IW8B 1H27B 1GUXB 1JOWA 1W98B 5HBJB 1JSUB 4YOSA 4EOSB 1JSTB 2WIPB 4ROEA 1VYWB 4EOIB 5IF1B 2UZDB 2W99A 1AD6A 2PK2A 4BCMB 2C5VB 4YC3B 2WMBB 4EORB 4EOLB 3M03A 2EUFA 4BCMD 4CRLB 2W96A 4CFXB 2B9RA 4BCNB 4EONB 4G6LB 4CFNB 3EOCB 3MY5B 4F7NB 1GH6B 2C5NB 2CJMB 4BCFB 4BCND 4BCJB 3MIAB 5EFQB 2WHBB 4F6WB 4CXAB 2BPMB 1H28B 2IW6B 4F7JB 1H26B 4OR5B 5BNJB 5I5ZB 1D3UB 1O9KB 2X1NB 3RGFB 4IMYB 4BCPB 4CFWB 1KXUA 5HNBB 2WXVB 1TFBA 3BLHB 2IVXA 4YOZA 4EOKB 4NSTB 2UZLB 3QHWB 4EOQB 5CEIB 1BU2A 2WFYB 4EC8B 1OIYB 1OIUB 3DOGB 4BCHB 5IDNB 1H1SB 5CYIB 1H25B 3EJ1B 4I3ZB 2UUEB 2V22B 3BHUB 3BLQB 1F5QB 1UNGD 2BKZB 4CFVB 2WIHB 1XO2A 1H24B 4EOJB 4II5B 5ICPB 2QDJA 4EOMB 1UNLD 4ELLA 1FINB 3G33B 3TNHB 1FVVB 2CCIB 4CFUB 1G3NC 4KRCB 2PHGA 4UN0A 1VOLA 3POMA 3DDQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QMZ B;  2C6T B;  4CFU D;  2F2C A;  1GY3 B;  2JGZ B;  2C5O B;  3BHV B;  1P5E B;  2C4G B;  1GUX A;  2UZE B;  1URC B;  4KRD B;  1JKW A;  2WEV B;  1OKV B;  2W9Z A;  1N4M A;  5L2W B;  4BCK B;  3QHR B;  5LMK B;  2R7G A;  4BCI B;  3TN8 B;  1PKD B;  3BLR B;  4YOO A;  4BCG B;  4ROC A;  2PMI B;  2W9F A;  1OL1 B;  3MI9 B;  2I40 B;  1E9H B;  1ZP2 A;  1UNH D;  2CCH B;  4F70 B;  3MY1 B;  3DDP B;  3TNI B;  4F6S B;  4OGR B;  1OGU B;  5FGK B;  3TNW B;  4F7S B;  1H1R B;  4CFM B;  3LQ5 B;  4Y72 B;  5HQ0 B;  1H1P B;  1H4L D;  1C9B A;  3BHT B;  3H4C A;  4FX3 B;  4F7L B;  2G9X B;  1O9K A;  4BCQ B;  2IW9 B;  5LQF B;  3K7A M;  2UZB B;  4EOO B;  1AIS B;  3F5X B;  4BCQ D;  1VIN A;  1H1Q B;  2I53 A;  2WMA B;  4TTH A;  5HVY B;  5IDP B;  2W2H A;  2PK9 B;  5ACB A;  1OKW B;  1OL2 B;  1OI9 B;  5HBH B;  2C5X B;  2WPA B;  3O0G D;  4F6U B;  4EC9 B;  4BCO B;  4ELJ A;  4ROD A;  5HBE B;  3EID B;  4EOP B;  2IW8 B;  1H27 B;  1GUX B;  1JOW A;  1W98 B;  5HBJ B;  1JSU B;  4YOS A;  4EOS B;  1JST B;  2WIP B;  4ROE A;  1VYW B;  4EOI B;  5IF1 B;  2UZD B;  2W99 A;  1AD6 A;  2PK2 A;  4BCM B;  2C5V B;  4YC3 B;  2WMB B;  4EOR B;  4EOL B;  3M03 A;  2EUF A;  4BCM D;  4CRL B;  2W96 A;  4CFX B;  2B9R A;  4BCN B;  4EON B;  4G6L B;  4CFN B;  3EOC B;  3MY5 B;  4F7N B;  1GH6 B;  2C5N B;  2CJM B;  4BCF B;  4BCN D;  4BCJ B;  3MIA B;  5EFQ B;  2WHB B;  4F6W B;  4CXA B;  2BPM B;  1H28 B;  2IW6 B;  4F7J B;  1H26 B;  4OR5 B;  5BNJ B;  5I5Z B;  1D3U B;  1O9K B;  2X1N B;  3RGF B;  4IMY B;  4BCP B;  4CFW B;  1KXU A;  5HNB B;  2WXV B;  1TFB A;  3BLH B;  2IVX A;  4YOZ A;  4EOK B;  4NST B;  2UZL B;  3QHW B;  4EOQ B;  5CEI B;  1BU2 A;  2WFY B;  4EC8 B;  1OIY B;  1OIU B;  3DOG B;  4BCH B;  5IDN B;  1H1S B;  5CYI B;  1H25 B;  3EJ1 B;  4I3Z B;  2UUE B;  2V22 B;  3BHU B;  3BLQ B;  1F5Q B;  1UNG D;  2BKZ B;  4CFV B;  2WIH B;  1XO2 A;  1H24 B;  4EOJ B;  4II5 B;  5ICP B;  2QDJ A;  4EOM B;  1UNL D;  4ELL A;  1FIN B;  3G33 B;  3TNH B;  1FVV B;  2CCI B;  4CFU B;  1G3N C;  4KRC B;  2PHG A;  4UN0 A;  1VOL A;  3POM A;  3DDQ B; 
#chains in the Genus database with same CATH topology
 1QMZ B;  2CZ7 B;  2F2C A;  2JGZ B;  3HB9 A;  1GUX A;  1OKV B;  1UGS B;  5L2W B;  3TN8 B;  4ROC A;  1OL1 B;  2I40 B;  1E9H B;  3MY1 B;  4F6S B;  1H1R B;  4FM4 B;  1H1P B;  1H4L D;  1TD6 A;  3BHT B;  4BCQ B;  4ZGD B;  2IW9 B;  4EOO B;  2UZB B;  4BCQ D;  2WMA B;  3HZJ A;  1OI9 B;  3O0G D;  4BCO B;  1FKM A;  3EID B;  4EOP B;  2QFZ A;  1JOW A;  2KR6 A;  2DME A;  4EOS B;  1ENW A;  2CZ0 B;  5IF1 B;  1AD6 A;  3DTO A;  4BCM B;  4EOR B;  4EOL B;  3M03 A;  2IN3 A;  4BCM D;  2B9R A;  4Z6Y A;  4CFN B;  2QGS A;  4F7N B;  3DL1 A;  4BCF B;  2BS3 A;  5EFQ B;  4F7J B;  5I5Z B;  4BCP B;  4BY7 X;  2IVX A;  4ZGJ B;  4YOZ A;  4NST B;  2UZL B;  1BU2 A;  3QYG B;  3X26 B;  5CYI B;  3EJ1 B;  2DD5 B;  2DD4 B;  3BLQ B;  3A8H B;  2BS2 A;  5ICP B;  3A8G B;  1UGR B;  3QWL A;  3TW6 A;  2WJ9 A;  4UN0 A;  1VOL A;  3POM A;  4II5 B;  3BHV B;  2C5O B;  1P5E B;  4OB3 B;  2C4G B;  1URC B;  1JKW A;  4OB2 B;  3QHR B;  1E7P A;  4NC6 A;  1V29 B;  4BCG B;  3DJB A;  1ZP2 A;  1UNH D;  2CCH B;  3QZ9 B;  2AHJ B;  3TNI B;  5FGK B;  3TNW B;  3VKH A;  3LQ5 B;  4Y72 B;  1O9K A;  4JX4 A;  5LQF B;  1H1Q B;  4TTH A;  2W2H A;  5ACB A;  1OKW B;  2G77 A;  2C5X B;  2QDY B;  4EC9 B;  4ELJ A;  3KHI A;  2IW8 B;  3HBL A;  1GUX B;  1JSU B;  1JST B;  3WVD B;  2WMB B;  3PO3 S;  5EJC A;  2C5N B;  4BCJ B;  3QYH B;  2WHB B;  1H28 B;  1D3U B;  1H26 B;  2X1N B;  2BS4 A;  4IMY B;  3RGF B;  2LW4 A;  3A8L B;  4EOK B;  4MIM A;  5CEI B;  3X25 B;  2WFY B;  3QZ5 B;  4QSH A;  4HL4 A;  1H25 B;  2UUE B;  3BHU B;  2ZPF B;  2WIH B;  1H24 B;  4EOJ B;  4EOM B;  1UNL D;  3BG9 A;  4ZGE B;  1G3N C;  4KRC B;  2PHG A;  3BG3 A;  4LOC A;  1GY3 B;  2UZE B;  2WEV B;  2ZCF B;  3QYB A;  4BCK B;  3TW7 A;  2QF7 A;  4M6V A;  5LMK B;  2R7G A;  1PKD B;  2PMI B;  4HNT A;  4F70 B;  2ZZD B;  3DDP B;  2PJQ A;  3GTM S;  4HLQ A;  4CFM B;  5HQ0 B;  3WVE B;  4BBS M;  3H4C A;  4FX3 B;  3QXE B;  3HO8 A;  3A8M B;  3K7A M;  3X28 B;  1VIN A;  5HVY B;  5IDP B;  2PK9 B;  1OL2 B;  5HBH B;  2WPA B;  5HBE B;  4MFD A;  1H27 B;  4YOS A;  2WIP B;  4BBR M;  2UZD B;  2C5V B;  1IRE B;  4BCN B;  4AKI A;  4EON B;  4G6L B;  3EOC B;  1GH6 B;  2DPP B;  2CJM B;  4BCN D;  2QQ8 A;  4CXA B;  2BPM B;  5BNJ B;  4OR5 B;  1O9K B;  2DXB B;  2ZPG B;  4CFW B;  1KXU A;  5HNB B;  2WXV B;  3BLH B;  2CZ1 B;  2CYZ B;  4EOQ B;  4JX6 A;  4BXX X;  3X24 B;  4EC8 B;  1OIU B;  2V22 B;  1F5Q B;  1UNG D;  2ZPB B;  4CFV B;  1XO2 A;  2KMG A;  3B57 A;  4ELL A;  2ZPH B;  1FIN B;  1FVV B;  1UGQ B;  2D0Q B;  4CFU B;  2C6T B;  4CFU D;  4KRD B;  2W9Z A;  4AI6 A;  1N4M A;  2ZPE B;  4BCI B;  1UGP B;  3BLR B;  4YOO A;  2W9F A;  3MI9 B;  4BY1 X;  4HNV A;  4OB1 B;  4OGR B;  3VYH B;  1OGU B;  4MFE A;  2ZPI B;  4F7S B;  1C9B A;  4F7L B;  2G9X B;  3QYE A;  1AIS B;  3F5X B;  2I53 A;  4OB0 B;  3VKG A;  4F6U B;  4ROD A;  3HHT B;  1W98 B;  5HBJ B;  4ROE A;  1VYW B;  4EOI B;  2W99 A;  2PK2 A;  4YC3 B;  4AKG A;  4AKH A;  5DQW A;  2EUF A;  1AHJ B;  3A8O B;  4CRL B;  2W96 A;  4CFX B;  3MY5 B;  5DQV A;  1QLB A;  3MIA B;  4F6W B;  2IW6 B;  2DXC B;  1TFB A;  4JX5 A;  3BG5 A;  3QHW B;  2CZ6 B;  3NDQ A;  1OIY B;  3DOG B;  4BCH B;  5IDN B;  1H1S B;  4I3Z B;  5IHY A;  3VYG B;  2BKZ B;  4HNU A;  2QDJ A;  3G33 B;  3TNH B;  3X20 B;  2CCI B;  3DDQ B; 
#chains in the Genus database with same CATH homology
 1QMZ B;  2C6T B;  4CFU D;  2F2C A;  1GY3 B;  2JGZ B;  2C5O B;  3BHV B;  1P5E B;  2C4G B;  1GUX A;  2UZE B;  1URC B;  4KRD B;  1JKW A;  2WEV B;  1OKV B;  2W9Z A;  1N4M A;  5L2W B;  4BCK B;  3QHR B;  5LMK B;  2R7G A;  4BCI B;  3TN8 B;  1PKD B;  3BLR B;  4YOO A;  4BCG B;  4ROC A;  2PMI B;  2W9F A;  1OL1 B;  3MI9 B;  2I40 B;  1E9H B;  1ZP2 A;  1UNH D;  2CCH B;  4F70 B;  3MY1 B;  3DDP B;  3TNI B;  4F6S B;  4OGR B;  1OGU B;  5FGK B;  3TNW B;  4F7S B;  1H1R B;  4CFM B;  3LQ5 B;  4Y72 B;  5HQ0 B;  1H1P B;  1H4L D;  1C9B A;  3BHT B;  3H4C A;  4FX3 B;  4F7L B;  2G9X B;  1O9K A;  4BCQ B;  2IW9 B;  5LQF B;  3K7A M;  2UZB B;  4EOO B;  1AIS B;  3F5X B;  4BCQ D;  1VIN A;  1H1Q B;  2I53 A;  2WMA B;  4TTH A;  5HVY B;  5IDP B;  2W2H A;  2PK9 B;  5ACB A;  1OKW B;  1OL2 B;  1OI9 B;  5HBH B;  2C5X B;  2WPA B;  3O0G D;  4F6U B;  4EC9 B;  4BCO B;  4ELJ A;  4ROD A;  5HBE B;  3EID B;  4EOP B;  2IW8 B;  1H27 B;  1GUX B;  1JOW A;  1W98 B;  5HBJ B;  1JSU B;  4YOS A;  4EOS B;  1JST B;  2WIP B;  4ROE A;  1VYW B;  4EOI B;  5IF1 B;  2UZD B;  2W99 A;  1AD6 A;  2PK2 A;  4BCM B;  2C5V B;  4YC3 B;  2WMB B;  4EOR B;  4EOL B;  3M03 A;  2EUF A;  4BCM D;  4CRL B;  2W96 A;  4CFX B;  2B9R A;  4BCN B;  4EON B;  4G6L B;  4CFN B;  3EOC B;  3MY5 B;  4F7N B;  1GH6 B;  2C5N B;  2CJM B;  4BCF B;  4BCN D;  4BCJ B;  3MIA B;  5EFQ B;  2WHB B;  4F6W B;  4CXA B;  2BPM B;  1H28 B;  2IW6 B;  4F7J B;  1H26 B;  4OR5 B;  5BNJ B;  5I5Z B;  1D3U B;  1O9K B;  2X1N B;  3RGF B;  4IMY B;  4BCP B;  4CFW B;  1KXU A;  5HNB B;  2WXV B;  1TFB A;  3BLH B;  2IVX A;  4YOZ A;  4EOK B;  4NST B;  2UZL B;  3QHW B;  4EOQ B;  5CEI B;  1BU2 A;  2WFY B;  4EC8 B;  1OIY B;  1OIU B;  3DOG B;  4BCH B;  5IDN B;  1H1S B;  5CYI B;  1H25 B;  3EJ1 B;  4I3Z B;  2UUE B;  2V22 B;  3BHU B;  3BLQ B;  1F5Q B;  1UNG D;  2BKZ B;  4CFV B;  2WIH B;  1XO2 A;  1H24 B;  4EOJ B;  4II5 B;  5ICP B;  2QDJ A;  4EOM B;  1UNL D;  4ELL A;  1FIN B;  3G33 B;  3TNH B;  1FVV B;  2CCI B;  4CFU B;  1G3N C;  4KRC B;  2PHG A;  4UN0 A;  1VOL A;  3POM A;  3DDQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...