2PKAA

Refined 2 angstroms x-ray crystal structure of porcine pancreatic kallikrein a, a specific trypsin-like serine proteinase. crystallization, structure determination, crystallographic refinement, structure and its comparison with bovine trypsin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
80
structure length
80
Chain Sequence
IIGGRECEKNSHPWQVAIYHYSSFQCGGVLVNPKWVLTAAHCKNDNYEVWLGRHNLFENENTAQFFGVTADFPHPGFNLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined 2 A X-ray crystal structure of porcine pancreatic kallikrein A, a specific trypsin-like serine proteinase. Crystallization, structure determination, crystallographic refinement, structure and its comparison with bovine trypsin.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Serine proteinase
molecule keywords KALLIKREIN A
total genus 12
structure length 80
sequence length 80
chains with identical sequence X
ec nomenclature ec 3.4.21.35: Tissue kallikrein.
pdb deposition date 1984-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2pkaA00
1GMHF 4DCDA 1BRBE 1IQIA 4FU7A 5GDSH 3E1XB 3FANA 5DJ7A 4B2CA 1WCZA 1QL7A 2PTCE 1UTLM 1XX9A 3E0PB 3TU7H 1O2PA 3UWJH 3VFEA 2ILNA 3EDXB 1QQ4A 3F6UH 2Z9KA 4UONA 4F4OC 2ZO3H 3KN2A 3SNCA 3T26A 2SGEE 3WY8A 4J1YA 1DDJA 4Y8YA 1XMNB 6CHAB 4FU9A 1BRAA 2BY5X 1GPZA 2BMGB 1EJNA 4B75A 5GXPA 1S6HA 1THRH 3F9HA 2A0QB 1NRPH 4LZ4B 1S0RA 1T4UH 2WV5A 1AQ7A 2O8TA 1O2YA 2KAIB 3T28A 4X6NA 1E37B 3Q76A 2WINI 1QY6A 5L2YH 1PQ5A 4A7IB 2ZGCA 4NSVA 1HAZB 1N6YA 2WPKS 3DUXH 1DM4B 5ESBA 2OUAA 1TGNA 1F7ZA 1QBOA 1LCYA 3MNSA 2JKHA 1BHXF 3SV7A 1FQ3A 1K1MA 3GCTG 1P9UA 4ABIA 1O39A 1O3OA 8LPRA 2VINA 2F83A 2BD8A 1GJ9B 4TY7A 1MTUA 3A89A 5EG4A 3BN9A 2SGAA 1Z6EA 3SJ8A 1AN1E 1RS0A 2FDAA 1O33A 1L4DA 4DGJA 1YPJH 1SB1H 1OWKA 1D4PB 1K1PA 1J16A 2XWBI 4D9RA 1B7XB 1S85A 2OLGA 1TMTH 1GJCB 3PB1E 1Z8RA 3U8OH 4CRBA 1EPTC 4D7GA 1DXPA 1NT1A 1WV7H 2WUBA 5HM9A 1PQ7A 3M3SA 1LVMA 1UCYE 3Q3YA 1P01A 2CF8H 1H1BA 1GJ4H 3HK3B 3KGPA 1H9LB 3MNCA 1Y3VA 5AF9H 2BM2A 3GY8A 2W26A 3F68H 4CHAB 4XBDA 1ELEE 4TYDA 1C1MA 1V2JT 3URDA 3RP2A 2QF0A 7ESTE 1ZTJA 4IN2A 3ZVCA 1FONA 3ZZ4A 4AGKA 1E0FD 4AORA 1RIWB 1SLWB 1AIXH 3W94A 1BTUA 2AH4X 1O5GH 3UY9A 4KTSA 2BZAA 1NRRH 1LHDH 3LGWA 3QLPH 1FY1A 1J14A 3S0NA 3D49H 4A1TA 4MTBA 2IPHA 1H4WA 1C2DA 3VGCC 1MU6B 3PTNA 5FBEA 1QA7A 1A5GH 1TAWA 3ZYEA 1WSSH 5I25A 3BTFE 1TMUH 1ZRBA 8ESTE 1O3FA 4ABFA 3LGVA 4ESTE 2PGBB 2VB0A 3ATMA 2RA0A 1MCVA 3SI3H 1AWFH 1TBZH 5FCKA 2FTLE 3S69A 1CBWC 1ESTA 4U2WA 1ESBA 2HOBA 2FX6A 2BDCA 2O8LA 1Z6JH 3V13A 2FPZA 1SGRE 1ZGIA 1LVOA 1YPEH 1P10A 3BTEE 1TQ0B 2VNTA 1C4Y2 3A7TA 1W13U 4Y0ZE 1OWIA 3M36A 5JBAS 2W3KA 3MH4A 1NC6A 4D7FA 3SGQE 1K9OE 4ISNA 3ZVGA 1SGQE 1LPZB 1OWEA 3GDUA 1EAWA 1TBRH 1BTWA 1C2LA 1G9IE 2F9OA 4B76A 3IWMA 3RU4T 2PR3A 2QC2A 2A4GA 1JMOH 1K22H 2QCYA 5E0HA 2BVRH 1QTFA 1UHBA 1O5CB 2BVXH 3UR6A 2WYJA 1TWXB 4DVAU 5JB9S 3K6ZA 2BLQA 2C8WB 3TJOA 3M35A 4WXVA 1FY8E 1P06A 3MMGA 1THSH 3A7YA 3RMMH 1GHZA 3QX5H 5JB8S 5G4BA 3M61U 2D1JA 2G4TA 3TNSA 3A7VA 1CA8B 1FPCH 1H8IH 4Q7XA 1GI3A 2H9EH 2ZFPH 3O8RA 3T5FH 3GICB 2FOFA 4ABAA 3SHCH 1BT7A 1VCWA 1XXFA 1VZQH 4IS5A 3GY7A 2VJ1A 2D2DA 3LJJA 2EI6A 4DOQA 1EB1H 4GPGA 3RXVA 3TK6A 1NS3A 4Q7ZA 2ULLA 3UNSA 4NIYA 1WTGH 3MI4A 1QIXB 3ZZ9A 3V7TA 3ODDA 2XWAA 4ZHMU 4XOJA 3A8CA 2WPLS 2YOLA 5F8TA 4IC6A 1YM0A 1K1NA 4BAQB 3RXFA 1ELVA 2ZCHP 4FUDA 1EP6A 3DHKH 3STJA 2EA3A 1HFDA 5HM2A 5T6GA 2BDIA 1BQYA 1CT4E 2BX4A 3RXRA 1HDTH 1C5QA 5EW1H 1NU9A 2P16A 2Y5HA 2ZHFH 4LXBH 5FX6A 1P04A 5JDUB 1CHGA 1EX3A 4BAOB 3RU4E 1KIGH 1NRSH 5EGMA 3BG8A 3EA8A 3BTHE 1GI2A 4MPWA 1HAVA 2H9TH 1G3BA 3ZZ5A 1LHGH 1O30A 1P8VC 5J4SA 5K0HA 1GI5A 4OS4A 2JETC 1VJ9U 3FP8E 1V6DA 3KQCA 2FYQA 4CBOA 3QTOH 3FFGA 3U1IB 4ZKSU 1QRZA 1EZSC 3SUGA 3A8BA 1N6XA 1GBEA 1YLDA 2C90B 4YLQH 2BDBA 4JK5A 1C2JA 2A7HA 1MD7A 1NFXA 1SSXA 3KNXA 1W7XH 1T8LA 3M3TA 3EA7A 1C1TA 1P2KA 1EOJA 1KY9A 3K9XB 2ZDVH 1SMFE 4WMFA 1EAUA 1ANEA 5EXLA 3B23B 3ZZBA 1O2NA 1O2UA 3ZVDA 1C5WB 1AWHB 4XFQA 4YOIA 2OBQA 1DLEA 4WXIA 1MKXH 1ANCA 4B2AA 1O2OA 3C1KA 1AVWA 3RXHA 1E38B 2ZI2H 4ZHLU 2B5TB 4E06H 1K1OA 1IQHA 1O31A 4GSOA 3E91A 2PKSB 1X7AC 2FS8A 2OC1A 2RG3A 3RUOA 3P95A 1TGCA 3QUMP 1LDTT 1QB6A 3MH7A 5TJXA 1QRWA 5EODA 1K2I1 3UNRA 4H6TA 1BTHH 3OYPA 3PM3A 3I29A 1YF4A 1O3PB 1AFEH 4JZEH 4BANB 3RXBA 3I77A 8GCHF 4MG3A 2UUYA 4KKDA 1TFXA 4SGBE 1O2KA 3PLPA 1F0UA 4FVDA 2BYAX 1HAHH 1TPAE 4DY7B 1BJUA 4CR5A 3PO1B 1JXPA 1Z8GA 3S7HB 2BLWA 1XM1A 1K1JA 4Z6AH 1FI8A 2SGQE 1P02A 1KDQB 4K1EA 2JH0D 3BIVH 3A82A 1GBLA 1GGDB 2PKSC 3NCLA 4BAHB 3PMHB 3P6ZB 4FUCA 2VWNA 3JZ2B 4LZ1H 1PPCE 3EQ0H 5J4QA 1O5FH 3VB6A 2BDGA 2V3HH 1D6WA 2XBXA 4I32A 2HGTH 2NU3E 3GY2A 1GBMA 1MUEB 2FWWA 1WOFA 1PYTC 3A8AA 2GDEH 2BTCE 2A31A 2C4FH 1UTMA 1MTNC 1ZHRA 2A32A 1O3HA 3M7QA 4NWLA 4NZLA 5L6NH 1CGIE 1BTXA 4DJZB 1O5BB 1P2NA 1V3XA 2V35A 1CQQA 3RXKA 1SGIB 2STAE 1HB0B 2FOMB 1KXEA 9ESTA 3O8BA 1ZTLA 1T32A 1CSOE 3ESTA 3SBKA 2IJOB 2FOCA 2W3IA 2VVVA 1G37A 3ZVAA 1GDQA 4RKOB 3GCHB 1TGTA 3RXGA 1SGDE 1TPOA 5FBIA 3GY4A 1P57B 1TBQH 1H9HE 4O97A 1HJAB 2ANMH 1K1IA 1DWDH 1UJ1A 3MU0A 5FPSA 4SGAE 1OYQA 2ODQA 2P93A 2A7JA 3TVJB 4ISLA 5T6FA 3AVZA 3PROA 4HI3A 4O03A 1W10U 1QL9A 2AS9A 3GCNA 1XKBC 3RXMA 1ZLRA 1SQOA 2PHBA 3A86A 3TJNA 1CGJE 5EPYA 4UD9H 1WTHD 1O2XA 1KXBA 1BRUP 5F03A 5HGGA 3TJUA 2OC8A 4KELA 1TNGA 1FN8A 2ZG0H 4ZROA 6GCHG 1KXCA 3LGYA 1O5AB 1Y59T 2PUQH 1TX8A 2ZU3A 1ZJDA 2EEKA 3P92A 2ZFFH 1FY3A 2ZF0H 4K69A 5CHAB 1VCPA 2QXHA 4DT7B 4U01A 3TITA 2GCTC 5C2ZA 3SORA 5C20A 2HNTE 1HAPH 2C8XB 1YCPK 1EZQA 2OTVA 1KLIH 4NGAH 1FIZA 2O8WA 3L6PA 4XBCA 4ISOA 4MNYA 2GTBA 2CXVA 1CHOG 3MYWA 1W12U 1C2HA 3K2UA 2H1UA 3RXJA 1CVWH 2H9HA 4AYVB 2QGRA 3QN7A 1PPHE 1ELGA 4X8TH 3SV8A 1O2WA 1TRMA 4FUFA 1EOLA 1O3DA 2EC9H 1AO5A 2WPJS 1ELDE 2G5NA 1P3CA 5EQSA 1BMAA 2XBWA 1P03A 4HFPB 3A81A 5HYOA 1D3DB 2UWPA 5T6DA 2ESTE 4RKJB 5BPEA 1EJAA 2A7CA 2ZHDA 4OS5A 1HAXB 1N1LA 2P3FH 1DUEA 1C5PA 1SGPE 2Z3DA 3EE0B 1C5UA 1YPKH 1YKTA 1Z8JB 4MNVA 1ARBA 1MD8A 1MTSA 1NZQH 2ZFTA 3SGBE 1VITG 2ZHEH 2W7UA 1V2RT 5IDKA 2OD3B 1JIRA 1THPB 1MKXK 3O8CA 3ZZDA 2K1QA 1UK3A 2GZ7A 4X1SU 2A4QA 4AZ2B 4X1QU 1RIWC 2AIQA 2ZPRA 2GCHG 4ASHA 1YBWA 2R0LA 1F0TA 2AMPA 4I8HA 3BF6H 1GHWH 4ZXYH 2ZDNA 2SGFE 1ANDA 1P05A 1OYTH 2VU8E 1G2MA 1VITH 2DE9A 1ACBE 1WU1A 3LGUA 4CH2B 1BJVA 1DVAH 4OGXA 3TK9A 2Y7ZA 2ANKH 2ZHWH 2QN5T 1ZMLA 2A5AA 1PPEE 4U30A 3SUDA 4NIXA 1G32B 3OY6U 1W11U 4A92A 2VGCC 1GI6A 1JIMA 3SQEE 1QBVH 2J9NA 4Y10E 1O5DH 2DE8A 2ZTXA 2HLCA 4Y71A 1C9TA 2ZHQH 1AVXA 1TPSA 4NFFA 1O2MA 2G52A 4CBNA 1O32A 4AFZA 1O37A 1HIAA 1RGQA 3UOUA 1Q3XA 3UFAA 4KP0A 1VR1H 1HUTH 5DPAA 3VGCB 1Y3YA 4GUXA 3GYMA 3ATWA 2TGAA 3GCOA 3ZVEA 1O2SA 3ATLA 1AFQC 1YPMH 3VB5A 2FOHA 4K8YA 1SQAA 3ZZ3A 1ABIH 1HPGA 1SHHB 1NFYA 3TJVA 3Q77A 3ELAH 1S5SA 1GBHA 4GVUA 3KQBA 3CS0A 2PW8H 1DWBH 1BTPA 4Y8ZA 1CT0E 1TONA 2XC5A 1S0QA 2ZQ1A 2ZEBA 1BHXB 3ATKA 4CRDA 1TLDA 3MNBA 2WV4A 1O2IA 1GBIA 3T25A 3KHVA 4YLUA 4JYUH 3S9BA 1SPJA 1PFXC 2STBE 4JMYA 4KGAA 3RXTA 4XSKU 1F5LA 1P12E 2J94A 1CA0B 3ATIA 1ANBA 1S6FA 1WUNH 4X2WA 1SOZA 3TK5A 3H7TA 3VXFH 3UNQA 3RM0H 1P2MA 3GCTF 4R0IA 1ELAA 2SGPE 4BTIB 3S9AA 2J2UA 3A7XA 1P09A 1A0HB 3MU8A 2P59A 4ISHH 4AG2A 1YCPH 3U8RH 3MO3A 3VXEH 2BQ6B 2CN0H 3OSYA 2Z9GA 2BXUH 1IQEA 3M3VA 2NU2E 4BXWA 2AFQB 1S82A 1C1SA 4TY6A 1ZPZA 4IC5A 3OTJE 1KYNA 1KLJH 1W2KH 5ESTE 4A5TS 5A2MH 1GHVH 1T8NA 5A8XA 3QDZB 2H5CA 4O9VA 5LGOA 7KMEH 1E35B 1OP8A 2CHAC 3LIWA 1PPGE 3PMBB 2NU4E 4XDEA 1M9UA 2V6NA 5L2ZH 4ZAEA 4D8NA 1TOCB 1TYNA 4FUIA 1FAKH 3MU4A 2GX4A 1QHRB 3ENSB 2BDAA 2C93B 2P95A 4UDWH 1DWCH 1TNHA 1O35A 1AZ8A 4INHA 3BTKE 4JK6A 3F9EA 2QV1A 5BRRE 3Q3KA 2YNAA 2Y7XA 1GI7B 1BMNH 1HNEE 1UTPA 2BLVA 2GDDA 2FYRA 4UFGH 1NTPA 5FHTA 1EATA 4X1NU 3E0NB 9LPRA 1GBCA 1FDPA 2F9NA 1G3DA 8GCHG 1AY6H 1C4U2 5DP8A 1DE7H 1DUAA 1OOKB 3PMAB 1Y3XA 2BD2A 1GL0E 2QXIA 4KTUA 2OINA 1A0LA 1BBRH 1TNIA 2AMDA 3BTGE 2F91A 2O8UA 3BTDE 1FJSA 2VH6A 3SI4H 1YLCA 1YCPM 4A1VA 4JYTA 1VITF 1F5RA 3E90B 1V2QT 1G3CA 3HK6B 5HMAA 3UTUH 1Z8IB 3KEEA 1ELCA 4AN7A 3SNBA 1GHAG 1OSSA 1ZTKA 1GVLA 1T8MA 2GCHF 3KF2A 2A2XH 5EXNA 2ZC9H 1ETRH 3QGNB 1GJAB 1MBQA 1QB9A 3CENA 1SGCA 1AE8H 2XTTB 1MQ5A 1ZSJA 3SU2A 1C9PA 2B7DH 1F2SE 3NZIA 1INCA 2FX4A 1HBTH 3MU1A 1XUHA 2TIOA 1KLTA 3URCA 2Y6TA 1JOUB 4GCHG 3SJOA 4ABEA 3SNAA 1QB1A 3RXSA 5B6OA 1GBKA 1EKBB 2AEIH 3LT3A 3T2NA 1MMJN 2BXTH 2VIVA 5A0BA 1GHBG 1P11E 1SHYA 2OXSA 2WYGA 3BTQE 2FZZA 3ZVBA 1MAXA 2PUXB 1O0DH 1RTFB 1HGTH 2A45B 4UFFH 2FP7B 4AG1A 2AGIX 1GJBB 1RJXB 7LPRA 1Z1IA 1G2LA 3LONA 3CS7A 3MFJA 4JZFH 2WPHS 4B71A 3GISB 1F92A 2FI4E 1EZUC 3RC4A 1CHOF 2O9QA 1K21H 3F9GA 2VIWA 1TPPA 4VGCC 1TNJA 4WVPE 1TNKA 3LH1A 1L0ZA 1IHSH 1A4WH 1LVYA 1GVKB 4ABBA 2PSXA 3RC5A 1UO6A 5GWZA 3AW0A 4FUBA 1O2QA 2FODA 4ZXXH 1FPHH 1UCYK 1GGDC 2ZU5A 1GHBF 1AKSA 4NA8A 2PV9B 3TH4H 1RXPA 4AFQA 3DD2H 2W7SA 3M5MA 3N7OA 1ZHMA 1C1OA 1MKWH 4NSYA 3RDZA 3ZVFA 3QTVH 1VGCB 5A0CA 1BTZA 5PTPA 1EJMA 1HJAC 5LPFA 4Y76A 3MHWU 2R9PA 3ZZAA 2R3YA 1HAVB 1QL8A 3EA9A 1GMDF 1QCPA 1RFNA 1UCYH 1GCTB 4MLFB 1VGCC 1TNLA 4BAMB 1DXWA 1V2OT 2G51A 1AHTH 1KXFA 3RLWH 4MVNA 2AGEX 1GBTA 1QJ7B 2A2QH 3U9AH 3TH3H 4B74A 1FZZA 1UVOA 5EOKA 2LPRA 4FUEA 3K6YA 1QURH 5TCCA 2FLRH 2ZNKH 1DS2E 4K60A 5FXLA 1G3EA 3VB4A 3R0FA 3ZV8A 2SGDE 2IN2A 3TNTA 1EP5A 3FZDA 4AFSA 2UUJB 3Q00A 4X8UH 2VWOA 3HKIB 1SC8U 2GV7A 2NWNA 1GDNA 3P8OA 2IOTA 1IQJA 2XNIA 3SOSA 2ZZUH 1EZXC 1KXDA 3U98H 3GDSA 3T27A 3L3TA 1MTVA 1O2GH 3AAUA 3B9FH 3UIRA 3SJIA 3LGTA 3D65E 4RN6A 2UWLA 1WYKA 5JBCS 3NWUA 1XUGA 1SBWA 1EAIA 1IQGA 1C5TA 1NESE 1PQ8A 1DFPA 4FUGA 3UOPA 4ZKNU 1C1WH 1GBFA 3RC6A 3UWIA 2GZ9A 1ELFA 2B8OH 1GHYH 1TALA 1NFUA 5SGAE 2Q1JA 1D3QB 3W95A 2FOGA 4O3TA 1C5VA 2VIOA 3RLYH 3GY5A 2QA9E 3Q3XA 1DLKB 5DO4H 1CBWB 5DG6A 1ELBA 2V3OH 4X8VH 1NM6A 2RA3A 4AB9A 2PKAA 1QJ1B 2R2MB 1O34A 4GLYA 1YPHE 2WPIS 1KXAA 1C1UH 4WWYA 3SNEA 3M5OA 4TPYA 2GT7A 2G5VA 1P9SA 2XXLA 3PWBA 1BA8B 2BD7A 3SU1A 1GI9B 1O3LA 3SJKA 1IAUA 1J15A 1DICA 1HAGE 2Z9LA 1YGCH 3SW2B 1KDQA 4UFDH 5F8ZA 2YNBA 2ZTYA 3SUFA 2M5TA 4ISIH 1G36A 1O3EA 4NZQA 1D6RA 3STIA 1W14U 4UE7H 1T7CA 2F3CE 1O3GA 2D26C 3U1JB 1B5GH 2QXJA 1ZHPA 1ZRKA 1DPOA 2FMJA 4NIVA 1C1PA 1EXFA 1NU7B 3RXQA 1EAXA 1AVGH 2ZTZA 3FP7E 1L1GA 3HGPA 4K5ZA 3SGAE 1GJ7B 1V2PT 4AOQA 1GI8B 5GPIB 1NROH 4ZMAH 5GJ4B 5L30H 2AIPA 1DY8A 2ZPQA 1ZSLA 5E2PA 2Z9JA 3MNXA 1H8DH 1C5NH 2XC4A 1OWDA 2BY8X 1A1RA 4PROA 1C5RA 1FNIA 2B0FA 5JYIA 5E0JA 3LGIA 4Q2KA 5I46H 3SU3A 1KSNA 4BNRA 5DP6A 2D8WA 2J34A 1EPTB 3RXIA 2ZKSA 1ESAA 3NPSA 6CHAC 3QWCH 4Y8XA 2FLBH 2HPQH 4IGDA 1SFIA 3SZNA 4NA7A 1GWAA 1O3NA 3TIUA 3A80A 1GL1A 5F6MA 1TOMH 3UQOA 2Y82A 2BVSH 1MAYA 2G4UA 1ZPCA 1MKWK 4Y79A 4OS6A 5A8YA 4LK4A 4ZHAA 3RMNH 2F9PA 1HRTH 3O8DA 3R3GB 1CGHA 1C5OH 1GCTC 2Z94A 5FPTA 1O2TA 2PSYA 5IYTA 3RXUA 1UVTH 1KTTB 2ZWLH 5K7RA 1Z71A 1UTQA 1BBRK 4D9QA 3SU4A 5A8ZA 3TGKE 1V2LT 2H2ZA 1SFQB 3SV9A 2UUKB 1DITH 1TMBH 2ZPSA 3P8GA 2ZU2A 1NRQH 2G81E 4VGCB 2Z3CA 4MQAA 5EPNA 1GBAA 1C2GA 2ZDLA 5H4IB 5DK1A 4JZIA 3UUZA 3P8FA 1BCUH 2I6QA 4LOYH 3H5CB 5JPMH 1Q31A 1YPHC 1UK2A 4Z0KA 1QRXA 4TPIZ 1E34B 4GAWA 2A5KA 1SGEE 1UTJA 1O2HA 1CO7E 3P8NA 1JBUH 4FXGH 4ABJA 2C8YB 4I8KA 1GMHG 3GYLB 2R3UA 3GCHC 1DSUA 3A85A 1UMAH 1P2QA 1XUIA 4OS2A 3U69H 3RXDA 1DX5M 1RTLA 1WBGB 2GMTB 1FAXA 2TGTA 2A5IA 4BAKB 3E8LA 2ZGBH 3LDXH 4BOHA 3UREA 4IMZA 2XRCA 1CU1A 6LPRA 3PLKA 3KQEA 1GG6B 2VWMA 2RCEA 3SU5A 5JBTA 4NCYA 1SVPA 1O3JA 2CJIA 1BDAA 2ALVA 2KAIA 2Y81A 3MU5A 1CA0C 1W8BH 2BY9X 5C1UA 1OKXA 2ZDMA 1RRKA 1O3AA 5HXFA 1GBJA 1FLEE 1LMWB 2CV3A 4QT8C 2PGQB 1PYTD 1PPZA 3D23A 3M5LA 1O3MA 4I31A 1ZMJA 2J95A 1UK4A 4NFEA 4DIIH 2EI8A 3M7UA 1O5EH 2BD9A 3A7ZA 5EU8A 5EW2H 1LQEA 1IQMA 2Y5GA 1D3PB 4BXSA 3SV6A 1RD3B 1C2IA 4B1TA 5EXMA 1C2KA 3FVFB 4Q7YA 1A7SA 4JCNA 4WH6A 3F9FA 1FN6A 2VIPA 3BSQA 3SN8A 1LKAA 4X2VA 3TLOA 2VGCB 3SNDA 1QBNA 5E0GA 4GCHF 1OX1A 1A46H 4X6PA 4FU8A 3MOCA 3B8JA 4MNXA 1W7GH 2Q6FA 5DP4A 2C8ZB 1ETTH 4TWYA 2FOAA 1U6QA 1GBBA 1VCQA 2HWLB 1IQFA 5AFYH 1BMLA 1AI8H 2ZCLP 1BOQA 4IW4E 2ODPA 1O2VA 5ABWA 1UTNA 4Y0YE 5C67A 2XW9A 1BIOA 2GT8A 1BITA 1TGBA 2BDYA 1SGFA 4X0WU 2G8TA 3DT0H 3SO3A 5C5NA 3ZV9A 1EASA 1C2MA 1HYLA 4NG9H 1UVPA 1HIAB 1XKAC 1V2TT 4E7NA 4UEHH 4YT6H 1S84A 3OU0A 1K28D 4CR9A 2J4IA 1H9IE 2FM2A 2Z9IA 4YTAA 4I33A 1XUFA 2C3SA 4K8BA 1OS8A 4HTCH 2DUCA 1C5LH 1TA2A 1RTKA 4KTCA 1GMCF 4I8LA 2OC0A 2GCTB 3GOVB 3RXEA 2XBYA 3V12A 1C5YB 2FS9A 4WF8A 3SU0A 3UPEA 5A09A 2TPIZ 3HKJB 3VB3A 4JYVH 2BD5A 4IBLH 4UFEH 3S9CA 1GVZA 2FO9A 3VEQB 2BQWB 3RMOH 2HNTF 1T31A 1BRCE 1XXDA 3E6PH 1MBMA 3LPRA 4XBBA 1BTYA 3TGJE 4ZH8A 1BMMH 4WJG2 1IHTH 3H7OA 1ZGVA 3PTBA 1ID5H 3M7TA 3C27B 1FUJA 4WMDA 1SI5H 1SOTA 1TABE 1L2EA 1KTSB 1DWEH 2B9LA 3BEUA 5C1YA 1HLTH 3LJOA 2HVXA 3MWIU 2TBSA 4CH8B 1UHBB 1SGNE 5FPYA 1HAIH 2VWLA 4Y6DA 4ZUHA 1HAOH 1SGYE 1W0ZU 4B2BA 2GZ8A 1V2KT 1N8OC 1FV9A 4AFUA 4CRGA 1TB6H 1BB0B 4YM9A 4XE4A 2BZ6H 1JRTA 2VIQA 1ZOMA 1GBDA 5JBBS 4BTUB 1P2JA 1O3IA 4X2YA 2CF9H 2GV6A 1D9IA 3RM2H 4I7YH 2Z6BD 2GMTC 3BG4C 2ODYB 3F1SB 1P0SH 2AYWA 1AFQB 5T3HA 2QIQA 2QYIA 1AMHA 3NK8A 2OQUA 1L1NA 1OWHA 1V2ST 2XBVA 3NXPA 4O3UA 3P70B 1WQVH 1QFKH 2FOBA 4NWKA 4YESB 2AMQA 2Y80A 1QNJA 3G01A 3BG4B 2H5DA 1UVSH 3A84A 4THNH 1Y5BT 1HXFH 2ZFSA 1O3CA 4AX9H 1GG6C 5DP9A 1HJ8A 1O2RA 3PMJA 3AASA 2RDLA 1DSTA 1C5SA 2GGVB 1Y5AT 2A4RA 2OBOA 2VVCA 3BTME 1C1VH 1N8OB 3M37A 1GJ8B 1W0YH 2XYAA 3KL6A 1YC0A 3A83A 3BTTE 3UQVA 3P17H 4OGYA 1HCGA 1XUJA 8KME2 4WH8A 1NN6A 2NU0E 1PPBH 1AB9C 1AE5A 2WPMS 2J92A 1C1QA 1FXYA 3RXOA 2AGGX 7GCHG 2HRVA 2JH5D 4FUJA 4MPVA 1A2CH 2UUFB 2ZGJA 1GHXH 5C3NA 3A88A 2P8OC 3JZ1B 2OC7A 5TCAA 1PJPA 2F9BH 1OP0A 1V2UT 1SQTA 2GKVE 5C5OA 1AB9B 1GJ5H 1MTNB 1QQUA 2SNVA 1ORFA 1OWJA 4X1PU 1BZXE 1QGFA 4IMQA 2FOEA 1A0JA 3TPIZ 2W5EA 2P8OB 2BOHB 1ZMNA 3DA9B 1IQNA 2G00A 1S81A 4Y7AA 4E7RG 4INLA 1ZYOA 1O3KA 3ZZ8A 2VIDA 1MZAA 1SLUB 2BY7X 2ZFRH 2UWOA 1S83A 3MO9A 3NKKA 3T62A 4JZDH 1AU8A 2BY6X 4FUHA 5A0AE 2EI7A 4K3JA 1AUTC 1XVMA 2J38A 4AGJA 4X1RU 7GCHF 3D62A 1EB2A 1F5KU 1IOEA 2Q6DA 2O8MA 1TRNA 4ABDA 5LH8A 5AFZH 2OCVB 1C4V2 1IQKA 2WUCA 1L1JA 1VJAU 5EQQA 2R0KA 1OPHB 4YT7H 2TRMA 1YYY1 1EUFA 1ZR0A 4MPUA 1Y3UA 3SU6A 4A6LA 1SL3A 5E8EH 2VVUA 4BTTB 2ZDAH 2CGAA 1AUJA 3PV4A 6ESTA 2ZDKA 4Y7BA 3TH2H 1A3EH 3DFJA 4GHQA 1BUIA 1HV7A 3QZRA 3QZQA 1GI4A 2BOKA 4H4FA 4CRCA 2FXRA 1Z1JA 2BQ7B 2FTMA 1T4VH 5DP5A 3SUEA 1UTOA 3LC5A 2GP9B 1QA0A 4A1XA 1GJ6A 4AB8A 5LPRA 1ZJKA 3GY6A 1WQSA 2XCNA 4MPXA 1A3BH 2P94A 1ZSKA 5EQRA 1G30B 1LO6A 4INKA 3QK1A 1HAYB 1L4ZA 1TGSZ 2ALPA 1Y5UT 4HZHA 3RXAA 2TGPZ 5CMXH 3EAJA 3OX7U 4OS1A 2R2WU 2BHGA 1AKSB 4K1TA 4RSPA 3BTWE 3V0XA 1HJ9A 3EGKH 2F9VA 4TWWA 4DG4A 1DY9A 2JH6D 1ETSH 1V2WT 1GCDA 2ZQ2A 1OXGA 1QR3E 1QJ6B 4ZKOU 3NUMA 5AVDA 1LTOA 2SNWA 4R8TB 1P2IA 3HATH 1ZPBA 1Y8TA 4Q80A 2OP9A 1EQ9A 1MTWA 1EPTA 1YP9A 3PYHA 1V2VT 1O36A 2ANWA 3ITIA 1J9CH 2XCFA 1SG8B 4J2YB 1Y3WA 2Z7FE 1WAYB 4AYYB 2JETB 1T8OA 3FZZA 3A8DA 4MDSA 2FI5E 2G55A 3CP7A 1Q2WA 1P2OA 3BEIB 1FY5A 3LOXA 1F0SA 4CRAA 1HXEH 3AAVA 1CT2E 3LU9B 1D3TB 2FESH 1NO9H 1JWTA 3RXLA 4K2YA 1FY4A 3IG6B 4NIWA 6GCHF 1A61H 1C5MD 1UTKA 4JZ1A 1GDUA 1B0EA 2BDHA 2LNCA 5ETXA 3SJ9A 5GIBA 2PLXA 1AD8H 2A1DB 2ZP0H 5LPEA 3ODFA 1LKBA 4X2XA 1J17T 2FIRH 1C1RA 1C2FA 1MCTA 2BX3A 2GVFA 3E16B 4B73A 2QXGA 2Y5FA 2ZCKP 5DKMA 1GI1A 1LHCH 2PTNA 4Y11E 1LPKB 1ELTA 2QF3A 4IN1A 3GDVA 3LC3A 1V2NT 2ZU4A 4ZKRU 2PWXA 3QO6A 3M5NA 3PLBA 1GMDG 1ABJH 3MTYA 2ZA5A 4DIHH 1GI0A 4U32A 3LKWA 2NU1E 2ASUB 2GD4B 1LVBA 1SR5C 1O3BA 3I78A 3L33A 2QY0B 1A5HA 2VH0A 1ARCA 1GMCG 2Z3EA 2HPPH 4YOGA 3IITA 3SHAH 4DURA 2ZFQH 3VB7A 1ZZZA 1O2ZA 3U8TH 2THFB 3K65B 3BV9B 2CMYA 2P3TB 3A87A 4MNWA 2BD3A 1Z7KA 3BIUH 2CHAB 2PKAB 5CHAC 3RXPA 3A7WA 1IQLA 4YOJA 3E3TA 1C2EA 4K1SA 1TRYA 2A4OA 4I8GA 1E36B 2HNTC 2ZECA 2ZU1A 3ZZCA 4CREA 4E05H 1O2JA 3KQDA 1DOJA 2P3UB 4X6OA 1A5IA 1P3EA 3PWCA 2XC0A 2PFEA 1FIWA 3HPTB 1MH0A 2ANYA 3AW1A 1O38A 1C5ZB 3GY3A 4GHTA 3DFLA 1NRNH 3QGJA 5DGJA 3BEFB 1SLVB 1TA6A 1K1LA 3PO1C 2BLOA 3TGIE 1TE0A 3KIDU 4CRFA 3MH5A 5C1XA 2SFAA 1B0FA 3MH6A 2F9UA 4F49A 4H42U 4D76A 4CHAC 1FMGA 4FVBA 1PQAA 1C1NA 1TIOA 3EYDA 2TGDA 5GCHG 1YPGH 1SGTA 1OP2A 3VPKA 1XUKA 1W3CA 1TX7A 4ABHA 5DP7A 4OS7A 4YO9A 1PPFE 5E2OA 1J8AA 2FEQH 1LPGB 1DT2A 3HGNA 3RMLH 2AERH 4ABGA 4H6SB 1MU8B 1MQ6A 1MZDA 3FP6E 2V0BA 3FAOA 2Q6GA 2FI3E 2QAAA 3UR9A 2H6MA 2ZGXH 5DP3A 1SGFG 3ZZ7A 1NPMA 3MO6A 1DANH 5AHGH 5F8XA 4DW2U 3ZYDA 1LHEH 3KCGH 5FX5A 1CE5A 2ZIQH 2OQ5A 4HGCA 1NFWA 1O2LA 5GCHF 4WMEA 3V3MA 1AZZA 3SV2H 1TX6A 1UVUH 3RXCA 5FAHA 1NY22 1GJDB 4M7GA 3SQHE 1LHFH 3S7KB 3LH3A 1TQ7B 3RU4D 4X8SH 4YZUA 1AGJA 1LQDB 4WY3A 4X6MA 1JRSA 2ZGHA 3OY5U 1XVOA 2I6SA 1F0RA 1C5XB 1V2MT 2HALA 4I8JA 3T29A 5CE1A 2BB4A 5FCRA 1BBRE 3ZZ6A 1GHAF 1YPLH 1SLXB 2BD4A 4NA9H
chains in the Genus database with same CATH superfamily
1GMHF 4DCDA 1BRBE 1IQIA 4FU7A 5GDSH 3E1XB 3FANA 5DJ7A 4B2CA 1WCZA 1QL7A 2PTCE 1UTLM 1XX9A 3E0PB 3TU7H 1O2PA 3UWJH 3VFEA 2ILNA 4B6FA 3EDXB 1QQ4A 3F6UH 2Z9KA 4UONA 4F4OC 2ZO3H 3KN2A 3SNCA 3T26A 2SGEE 3WY8A 4J1YA 1DDJA 2VBCA 1XMNB 4Y8YA 4FU9A 6CHAB 1BRAA 2BY5X 1GPZA 2BMGB 1EJNA 4RT0A 4B75A 5GXPA 1S6HA 1THRH 3F9HA 2A0QB 4RT1A 1NRPH 4LZ4B 1S0RA 1T4UH 2WV5A 1AQ7A 2O8TA 1O2YA 2KAIB 3T28A 4X6NA 1E37B 3Q76A 2WINI 1QY6A 5L2YH 1PQ5A 4A7IB 2ZGCA 4NSVA 1HAZB 1N6YA 2WPKS 3DUXH 1DM4B 5ESBA 2OUAA 1TGNA 1F7ZA 1QBOA 1LCYA 2J98A 2JKHA 3MNSA 1BHXF 3N7DA 3SV7A 1FQ3A 1K1MA 3GCTG 1P9UA 4ABIA 1O39A 1O3OA 8LPRA 2VINA 2F83A 2BD8A 4RI0A 1GJ9B 4TY7A 1MTUA 3A89A 5EG4A 3BN9A 3DSOA 2SGAA 1Z6EA 3SJ8A 1AN1E 1RS0A 2FDAA 1O33A 1L4DA 4DGJA 1YPJH 1SB1H 1OWKA 1D4PB 1K1PA 1J16A 2XWBI 4D9RA 1B7XB 1S85A 2OLGA 1TMTH 1GJCB 3PB1E 2RDEA 1Z8RA 3U8OH 4CRBA 1EPTC 3OEED 4D7GA 1DXPA 1NT1A 1WV7H 2WUBA 5HM9A 1PQ7A 3M3SA 1LVMA 1UCYE 3Q3YA 1P01A 2CF8H 1H1BA 1GJ4H 3HK3B 3KGPA 1H9LB 3MNCA 1Y3VA 5CDFE 5AF9H 1QZ8A 2BM2A 3GY8A 2W26A 3F68H 4CHAB 4XBDA 1ELEE 4TYDA 4TT3D 1C1MA 1V2JT 3URDA 3RP2A 2QF0A 7ESTE 1ZTJA 4IN2A 3ZVCA 1FONA 3ZZ4A 4AGKA 1WXRA 1E0FD 4AORA 1RIWB 1SLWB 1AIXH 3W94A 1BTUA 2AH4X 1O5GH 3UY9A 4KTSA 2BZAA 1NRRH 4P02A 1LHDH 3LGWA 3QLPH 1FY1A 1J14A 3S0NA 3D49H 4A1TA 4MTBA 2IPHA 1H4WA 1C2DA 3VGCC 1MU6B 3PTNA 5FBEA 1QA7A 1A5GH 1TAWA 2AHME 3ZYEA 1WSSH 5I25A 3BTFE 1TMUH 1ZRBA 8ESTE 1O3FA 4ABFA 3LGVA 4ESTE 2PGBB 2VB0A 3ATMA 2RA0A 1MCVA 3SI3H 1AWFH 1TBZH 5FCKA 2FTLE 3S69A 1CBWC 1ESTA 4U2WA 1ESBA 2HOBA 2FX6A 2BDCA 2O8LA 1Z6JH 3V13A 2FPZA 1SGRE 1ZGIA 1LVOA 1YPEH 1P10A 3BTEE 1TQ0B 2QF5A 2VNTA 1C4Y2 1K0HA 3A7TA 1W13U 4Y0ZE 1OWIA 3M36A 5JBAS 2W3KA 3MH4A 1NC6A 4D7FA 3SGQE 1K9OE 4ISNA 3ZVGA 1SGQE 1LPZB 3N7EA 1OWEA 3GDUA 1EAWA 1TBRH 1BTWA 1C2LA 1G9IE 2F9OA 4B76A 3IWMA 3RU4T 2PR3A 2QC2A 2A4GA 1JMOH 1K22H 2QCYA 5E0HA 2BVRH 1QTFA 1UHBA 1O5CB 2BVXH 3UR6A 2WYJA 1TWXB 4DVAU 5JB9S 3K6ZA 2BLQA 2C8WB 3TJOA 3M35A 4OM9A 4WXVA 1FY8E 1P06A 3MMGA 1THSH 3A7YA 3RMMH 1GHZA 3QX5H 5JB8S 3PV5A 5G4BA 4AC9A 3M61U 2D1JA 2G4TA 3TNSA 3A7VA 1CA8B 1FPCH 1H8IH 4Q7XA 1GI3A 2H9EH 2ZFPH 3O8RA 3T5FH 3GICB 2FOFA 4ABAA 3SHCH 1BT7A 1VCWA 3FN8A 1XXFA 1VZQH 4IS5A 3GY7A 2VJ1A 2D2DA 3LJJA 2EI6A 2WZQA 4DOQA 1EB1H 4GPGA 3RXVA 3TK6A 1NS3A 4Q7ZA 2ULLA 3UNSA 3KYFA 4NIYA 1WTGH 3MI4A 1QIXB 3ZZ9A 3V7TA 3ODDA 2XWAA 4ZHMU 4XOJA 3A8CA 2WPLS 2YOLA 5F8TA 4IC6A 1YM0A 1K1NA 4BAQB 3RXFA 1ELVA 2ZCHP 4FUDA 1EP6A 3DHKH 3STJA 2EA3A 1HFDA 5HM2A 5T6GA 2BDIA 1BQYA 2KX4A 1CT4E 2BX4A 3RXRA 1HDTH 1C5QA 5EW1H 1NU9A 2P16A 2Y5HA 2ZHFH 4LXBH 5FX6A 1P04A 5JDUB 1CHGA 1EX3A 4BAOB 1W0KD 3RU4E 1KIGH 1NRSH 5EGMA 3BG8A 3EA8A 3BTHE 1GI2A 4MPWA 1HAVA 2H9TH 1G3BA 3ZZ5A 1LHGH 1O30A 1P8VC 5J4SA 5K0HA 1GI5A 4OS4A 2JETC 1VJ9U 3FP8E 1V6DA 3KQCA 2FYQA 4CBOA 3QTOH 1YY3A 3FFGA 3U1IB 4ZKSU 1QRZA 2KM0A 1EZSC 3SUGA 3A8BA 1N6XA 1GBEA 1YLDA 2C90B 4YLQH 2BDBA 4JK5A 1C2JA 2A7HA 1MD7A 1NFXA 1SSXA 3KNXA 1W7XH 1T8LA 3M3TA 3EA7A 1C1TA 1P2KA 1EOJA 4Q4LA 1KY9A 3K9XB 2ZDVH 1SMFE 4WMFA 1EAUA 1ANEA 5EXLA 3B23B 3ZZBA 1O2NA 1O2UA 3ZVDA 1C5WB 1AWHB 4XFQA 4YOIA 2OBQA 1DLEA 4WXIA 1MKXH 1ANCA 4B2AA 1O2OA 3C1KA 1AVWA 3RXHA 2CK3D 1E38B 2ZI2H 4ZHLU 2B5TB 4E06H 1K1OA 1NBMD 1IQHA 1O31A 4GSOA 3E91A 2PKSB 1X7AC 2FS8A 2OC1A 2RG3A 3RUOA 3P95A 1TGCA 3QUMP 1LDTT 1QB6A 3MH7A 5TJXA 1QRWA 5EODA 1K2I1 5KECA 3UNRA 4H6TA 1BTHH 3OYPA 3PM3A 3I29A 1YF4A 1O3PB 1AFEH 4JZEH 4BANB 3RXBA 3I77A 8GCHF 4MG3A 2UUYA 4KKDA 1TFXA 4SGBE 1O2KA 3PLPA 1F0UA 4FVDA 2BYAX 4ACAA 1HAHH 1TPAE 4DY7B 1BJUA 4CR5A 3PO1B 1JXPA 1Z8GA 3S7HB 2BLWA 1XM1A 1K1JA 4Z6AH 2SGQE 1FI8A 1P02A 1KDQB 4K1EA 2JH0D 3BIVH 3A82A 3OE7D 1GBLA 1GGDB 2PKSC 3NCLA 4BAHB 3PMHB 3P6ZB 4FUCA 2VWNA 3JZ2B 4LZ1H 1PPCE 3EQ0H 5J4QA 1O5FH 3VB6A 2BDGA 2V3HH 1D6WA 2XBXA 4I32A 2HGTH 2NU3E 3GY2A 1GBMA 1MUEB 2FWWA 1WOFA 1PYTC 3A8AA 2GDEH 2BTCE 2A31A 2C4FH 1UTMA 1MTNC 1ZHRA 2A32A 1O3HA 3M7QA 4NWLA 4NZLA 5L6NH 1CGIE 1BTXA 4DJZB 1O5BB 1P2NA 1V3XA 2V35A 2K8IA 1CQQA 3RXKA 1SGIB 2STAE 1HB0B 2FOMB 1KXEA 9ESTA 3O8BA 1ZTLA 1T32A 1CSOE 3ESTA 3SBKA 3WWBA 2IJOB 2FOCA 2W3IA 2VVVA 1G37A 3ZVAA 1GDQA 1H8ED 4RKOB 3WW7A 5HKKD 3GCHB 1TGTA 3RXGA 1SGDE 1TPOA 5FBIA 3GY4A 1P57B 1TBQH 1H9HE 4O97A 1HJAB 2ANMH 1K1IA 1DWDH 1UJ1A 3MU0A 5FPSA 4SGAE 1OYQA 2ODQA 2P93A 2A7JA 3TVJB 4ISLA 5T6FA 3AVZA 3PROA 4HI3A 4O03A 1W10U 1QL9A 2AS9A 3GCNA 1XKBC 3RXMA 1ZLRA 1SQOA 2PHBA 3A86A 3TJNA 1CGJE 5EPYA 4UD9H 1WTHD 1O2XA 1KXBA 1BRUP 5F03A 5HGGA 3TJUA 2OC8A 4KELA 1TNGA 1FN8A 2ZG0H 4ZROA 6GCHG 1KXCA 3LGYA 1O5AB 1Y59T 2PUQH 1TX8A 2ZU3A 1ZJDA 2EEKA 3P92A 2ZFFH 1FY3A 2ZF0H 4K69A 5CHAB 1VCPA 2QXHA 4DT7B 4U01A 3TITA 2GCTC 5C2ZA 3SORA 5C20A 4I86A 2HNTE 1HAPH 2C8XB 1YCPK 1EZQA 2OTVA 1KLIH 4NGAH 1FIZA 2O8WA 3L6PA 2M2AA 3GS9A 4XBCA 4ISOA 4MNYA 2GTBA 2CXVA 1CHOG 3MYWA 3F2HA 1W12U 1C2HA 3K2UA 2H1UA 3RXJA 1CVWH 2H9HA 4AYVB 2QGRA 3QN7A 1PPHE 1ELGA 4X8TH 3SV8A 1O2WA 1TRMA 4FUFA 1EOLA 1O3DA 2EC9H 1AO5A 2WPJS 1ELDE 2G5NA 1P3CA 5EQSA 1BMAA 2XBWA 1P03A 4HFPB 3A81A 5HYOA 1D3DB 2UWPA 5T6DA 2ESTE 4RKJB 5BPEA 1EJAA 2A7CA 2ZHDA 4OS5A 1HAXB 1N1LA 2P3FH 1DUEA 1C5PA 1SGPE 2Z3DA 3EE0B 1C5UA 5FL7D 1YPKH 1YKTA 1Z8JB 4MNVA 1ARBA 1MD8A 2F4LA 1MTSA 1NZQH 2ZFTA 3SGBE 2EQNA 3N99A 1VITG 2ZHEH 2W7UA 1V2RT 5IDKA 2OD3B 1JIRA 1THPB 1MKXK 3O8CA 3ZZDA 2K1QA 2WV9A 1UK3A 2GZ7A 4X1SU 2A4QA 2KCAA 4AZ2B 4X1QU 1RIWC 2AIQA 2JJ2D 2ZPRA 2GCHG 4ASHA 1YBWA 2R0LA 4F48B 1F0TA 2AMPA 4I8HA 3BF6H 1GHWH 4ZXYH 2ZDNA 2SGFE 1ANDA 1P05A 1OYTH 1G2MA 1VITH 2VU8E 2DE9A 2JJ1D 1ACBE 1WU1A 3LGUA 4CH2B 1BJVA 1DVAH 4OGXA 3TK9A 2Y7ZA 2ANKH 2ZHWH 2QN5T 1ZMLA 2A5AA 1PPEE 4U30A 2IPQX 3SUDA 4NIXA 1G32B 3OY6U 1W11U 4A92A 2VGCC 3PRBA 1GI6A 1JIMA 3SQEE 1QBVH 2J9NA 4Y10E 1O5DH 2DE8A 2ZTXA 2HLCA 4Y71A 1C9TA 2ZHQH 2KCOA 1AVXA 1TPSA 4NFFA 1O2MA 2G52A 4CBNA 1O32A 4AFZA 1O37A 1HIAA 1RGQA 3UOUA 1Q3XA 3UFAA 4KP0A 1VR1H 1HUTH 5DPAA 3VGCB 1Y3YA 4GUXA 3GYMA 3ATWA 2TGAA 3GCOA 3ZVEA 3DCLA 1O2SA 3ATLA 1AFQC 1YPMH 3VB5A 2FOHA 4K8YA 1SQAA 3ZZ3A 1ABIH 1HPGA 1SHHB 1NFYA 3TJVA 3SYJA 3Q77A 3ELAH 1S5SA 1GBHA 4GVUA 3KQBA 3CS0A 2PW8H 1DWBH 1BTPA 4Y8ZA 1CT0E 1TONA 2XC5A 1S0QA 2ZQ1A 2ZEBA 1BHXB 3ATKA 4CRDA 1TLDA 3MNBA 2WV4A 1O2IA 2LELA 2JDID 1GBIA 3T25A 3KHVA 4YLUA 4JYUH 3S9BA 1SPJA 1E79D 1PFXC 2STBE 4JMYA 4KGAA 3RXTA 4XSKU 1F5LA 1P12E 2J94A 2WPDD 1CA0B 3ATIA 1ANBA 1S6FA 1WUNH 4X2WA 1SOZA 3TK5A 3H7TA 3VXFH 3UNQA 3RM0H 1P2MA 3GCTF 4R0IA 1ELAA 2SGPE 4BTIB 3S9AA 2J2UA 2J98B 3A7XA 1P09A 1A0HB 3MU8A 2P59A 4ISHH 4AG2A 1YCPH 3U8RH 3MO3A 3VXEH 2BQ6B 2CN0H 3OSYA 2Z9GA 3FO8D 2BXUH 2K0QA 1IQEA 3M3VA 2NU2E 4BXWA 2AFQB 1S82A 1C1SA 4TY6A 1ZPZA 4IC5A 3OTJE 1KYNA 1KLJH 1W2KH 5ESTE 4A5TS 5A2MH 1GHVH 1T8NA 5A8XA 5T1VA 3QDZB 2H5CA 1FX0B 2W6ID 4O9VA 5LGOA 7KMEH 1E35B 1OP8A 2CHAC 3LIWA 1PPGE 3PMBB 2NU4E 4XDEA 1M9UA 2V6NA 5L2ZH 4ZAEA 4D8NA 1TOCB 1TYNA 4FUIA 1FAKH 3MU4A 2GX4A 1QHRB 3ENSB 2BDAA 5EJLA 1E1RD 2C93B 2P95A 4UDWH 1DWCH 1TNHA 2WHXA 1O35A 1AZ8A 4INHA 3BTKE 4JK6A 3F9EA 2QV1A 5BRRE 3Q3KA 2YNAA 2Y7XA 5EJZA 1GI7B 1BMNH 1HNEE 1UTPA 2BLVA 2GDDA 2FYRA 4UFGH 1NTPA 5FHTA 1EATA 4X1NU 3E0NB 9LPRA 1GBCA 1FDPA 2F9NA 1G3DA 8GCHG 1AY6H 1C4U2 5DP8A 1DE7H 1DUAA 1OOKB 3PMAB 1Y3XA 2BD2A 1GL0E 2QXIA 4KTUA 2OINA 1A0LA 1BBRH 1TNIA 2AMDA 3BTGE 5DN6D 3F3BA 2F91A 2O8UA 3BTDE 1FJSA 2VH6A 3SI4H 1YLCA 1YCPM 4A1VA 4JYTA 4XD7D 1VITF 1F5RA 5EIYA 3E90B 1V2QT 1G3CA 3HK6B 5HMAA 3UTUH 1Z8IB 4F55A 3KEEA 1ELCA 4AN7A 3SNBA 1GHAG 1OSSA 1ZTKA 1GVLA 1T8MA 2GCHF 3KF2A 2A2XH 5EXNA 2ZC9H 1ETRH 3QGNB 1GJAB 1MBQA 1QB9A 3CENA 1SGCA 2KZ4A 1AE8H 2XTTB 1MQ5A 1ZSJA 3SU2A 1C9PA 2B7DH 1F2SE 3NZIA 1INCA 2FX4A 1HBTH 3MU1A 1XUHA 2TIOA 1KLTA 3URCA 2Y6TA 1JOUB 4GCHG 3SJOA 4ABEA 3SNAA 1QB1A 3RXSA 5B6OA 1GBKA 1EKBB 2AEIH 3LT3A 3T2NA 1MMJN 2BXTH 2VIVA 5A0BA 1GHBG 1P11E 1SHYA 2OXSA 2WYGA 3BTQE 2FZZA 3ZVBA 3UB0A 1MAXA 2PUXB 1O0DH 1RTFB 1HGTH 2L74A 2A45B 2J97A 4UFFH 2FP7B 4AG1A 2AGIX 1GJBB 1RJXB 7LPRA 1Z1IA 1G2LA 3LONA 3CS7A 3MFJA 4JZFH 2WPHS 4B71A 3GISB 1F92A 2FI4E 5HIZA 1EZUC 3RC4A 1CHOF 2O9QA 1K21H 3F9GA 2VIWA 1TPPA 4VGCC 1TNJA 4WVPE 1TNKA 3LH1A 3PV2A 1L0ZA 1IHSH 1A4WH 1LVYA 1GVKB 4ABBA 2PSXA 3RC5A 1UO6A 5GWZA 2V3MA 3AW0A 4FUBA 1O2QA 2FODA 4ZXXH 1FPHH 1UCYK 1SQRA 1GGDC 2ZU5A 1NBME 1GHBF 1AKSA 4NA8A 2PV9B 3TH4H 1RXPA 4AFQA 3DD2H 2W7SA 3M5MA 3N7OA 1ZHMA 1C1OA 1MKWH 4NSYA 3RDZA 3ZVFA 3QTVH 1VGCB 5A0CA 1BTZA 5PTPA 1EJMA 1EFRD 1HJAC 5LPFA 1UW7A 4Y76A 3MHWU 2R9PA 3ZZAA 2R3YA 1HAVB 1QL8A 3EA9A 1GMDF 1QCPA 1RFNA 1UCYH 1GCTB 4MLFB 1VGCC 1TNLA 2YMSC 2RFKC 4BAMB 1DXWA 1V2OT 2G51A 1AHTH 1KXFA 3RLWH 4MVNA 4FOUC 2AGEX 1GBTA 1KMHB 1QJ7B 2A2QH 1S6LA 3U9AH 3TH3H 4B74A 1FZZA 1UVOA 5EOKA 2LPRA 4FUEA 3K6YA 1QURH 5TCCA 2FLRH 2ZNKH 1DS2E 4K60A 5FXLA 1G3EA 3VB4A 3R0FA 3ZV8A 2SGDE 2IN2A 3TNTA 1EP5A 3FZDA 4AFSA 2UUJB 3Q00A 4X8UH 2VWOA 3HKIB 1SC8U 2GV7A 2NWNA 1GDNA 3P8OA 2IOTA 1IQJA 2XNIA 3SOSA 2ZZUH 1EZXC 1KXDA 3U98H 3GDSA 3T27A 3L3TA 1MTVA 1O2GH 3AAUA 3B9FH 3UIRA 3SJIA 3LGTA 3D65E 4RN6A 2UWLA 1WYKA 5JBCS 3NWUA 1XUGA 1SBWA 1EAIA 1IQGA 1C5TA 1NESE 1PQ8A 1DFPA 4FUGA 3UOPA 4ZKNU 1C1WH 1GBFA 3RC6A 3UWIA 2GZ9A 1ELFA 2B8OH 1GHYH 1TALA 1NFUA 5SGAE 2Q1JA 1D3QB 3W95A 2FOGA 4O3TA 1C5VA 2VIOA 3RLYH 3GY5A 2QA9E 3Q3XA 1DLKB 5DO4H 1CBWB 5DSFA 5DG6A 1ELBA 3F2GA 2V3OH 4X8VH 1NM6A 2RA3A 4AB9A 2PKAA 1QJ1B 2R2MB 1O34A 4GLYA 1YPHE 2WPIS 1KXAA 1C1UH 4WWYA 3SNEA 3M5OA 4TPYA 2GT7A 2G5VA 1P9SA 2XXLA 3PWBA 1BA8B 2BD7A 3SU1A 1GI9B 1O3LA 3SJKA 1IAUA 1J15A 1DICA 1HAGE 2KCYA 2Z9LA 1YGCH 3SW2B 1KDQA 4UFDH 5F8ZA 2YNBA 2ZTYA 3SUFA 2M5TA 4ISIH 1G36A 1O3EA 4NZQA 1D6RA 3STIA 1W14U 4UE7H 1T7CA 2F3CE 1O3GA 2D26C 3U1JB 1B5GH 2QXJA 1ZHPA 3NRLA 2QF4A 1ZRKA 1DPOA 2FMJA 4NIVA 1C1PA 4ASUD 1EXFA 1NU7B 3RXQA 1EAXA 1AVGH 2ZTZA 3FP7E 2LP6A 1L1GA 3HGPA 4K5ZA 3SGAE 1GJ7B 1V2PT 4AOQA 1GI8B 5GPIB 1NROH 4ZMAH 1W0JD 5GJ4B 5L30H 2AIPA 1DY8A 2ZPQA 1ZSLA 5E2PA 2Z9JA 3MNXA 2W6JD 1H8DH 1C5NH 2XC4A 1OWDA 2BY8X 1A1RA 4PROA 1C5RA 1FNIA 2B0FA 5JYIA 5E0JA 3LGIA 4Q2KA 5I46H 3SU3A 1KSNA 4BNRA 5DP6A 3OEHD 2D8WA 2J34A 1EPTB 3RXIA 2ZKSA 1ESAA 3NPSA 6CHAC 3QWCH 4Y8XA 2FLBH 2HPQH 4IGDA 1SFIA 3SZNA 4NA7A 1GWAA 1O3NA 2EY4C 3TIUA 3A80A 1GL1A 5F6MA 1TOMH 3UQOA 5C0UA 2Y82A 2BVSH 1MAYA 2G4UA 1ZPCA 1MKWK 4Y79A 4OS6A 4Q63A 5A8YA 4LK4A 4ZHAA 3RMNH 2F9PA 1HRTH 3O8DA 3R3GB 5KGOA 1CGHA 1C5OH 1GCTC 2Z94A 3ZIAD 3H09A 5FPTA 1O2TA 2PSYA 5IYTA 3RXUA 1UVTH 1KTTB 2ZWLH 5K7RA 1Z71A 1UTQA 2YMSD 1BBRK 4D9QA 3SU4A 5A8ZA 3TGKE 1V2LT 2H2ZA 1SFQB 3SV9A 2UUKB 1DITH 1TMBH 2ZPSA 3P8GA 2ZU2A 1NRQH 2G81E 4VGCB 2Z3CA 4MQAA 5EPNA 1GBAA 1C2GA 2ZDLA 5H4IB 5DK1A 4JZIA 3UUZA 3P8FA 1BCUH 2I6QA 4LOYH 3H5CB 5JPMH 1Q31A 1YPHC 1UK2A 4Z0KA 1WDIA 1QRXA 4TPIZ 1E34B 4GAWA 2A5KA 1SGEE 1UTJA 1O2HA 1CO7E 3P8NA 1JBUH 4FXGH 4ABJA 2C8YB 4I8KA 1GMHG 3GYLB 2R3UA 3GCHC 1DSUA 3A85A 1UMAH 1P2QA 1XUIA 4FETA 1YWUA 2F43B 4OS2A 3U69H 3RXDA 1DX5M 5EJ1A 1RTLA 1WBGB 2GMTB 1FAXA 2TGTA 2L6OA 2A5IA 4BAKB 3E8LA 2ZGBH 3LDXH 4BOHA 3UREA 4IMZA 2XRCA 1CU1A 6LPRA 3PLKA 3KQEA 1GG6B 2VWMA 2RCEA 3SU5A 5JBTA 4NCYA 1SVPA 1O3JA 2CJIA 1BDAA 2ALVA 2KAIA 2Y81A 3MU5A 1CA0C 1W8BH 2BY9X 5C1UA 1OKXA 2ZDMA 1RRKA 1O3AA 5HXFA 1GBJA 1FLEE 1LMWB 2CV3A 4QT8C 2PGQB 1PYTD 1PPZA 3D23A 3M5LA 1O3MA 4I31A 1ZMJA 2J95A 1UK4A 4NFEA 4DIIH 2EI8A 3M7UA 1O5EH 2BD9A 3A7ZA 5EU8A 5EW2H 1LQEA 1IQMA 2Y5GA 1D3PB 4BXSA 3SV6A 1RD3B 1C2IA 2KCPA 5F53A 4B1TA 5EXMA 3PRDA 1C2KA 3FVFB 4Q7YA 1A7SA 4JCNA 4WH6A 3F9FA 1FN6A 2VIPA 3BSQA 3SN8A 1LKAA 3WWFA 4X2VA 3TLOA 2VGCB 3SNDA 1QBNA 5E0GA 4GCHF 1OX1A 1A46H 4X6PA 4FU8A 3MOCA 3B8JA 4MNXA 1W7GH 2Q6FA 5DP4A 2C8ZB 1ETTH 4TWYA 2FOAA 2IJD1 1U6QA 1GBBA 1VCQA 2HWLB 5HIYA 1IQFA 5AFYH 1BMLA 4DT4A 1AI8H 2ZCLP 1BOQA 4IW4E 2ODPA 1O2VA 5ABWA 1UTNA 4Y0YE 5C67A 2XW9A 1BIOA 2GT8A 1BITA 1TGBA 2BDYA 1SGFA 4X0WU 2G8TA 3DT0H 3SO3A 5C5NA 3ZV9A 1EASA 1C2MA 1HYLA 3EE7A 1UVPA 4NG9H 1HIAB 1XKAC 1V2TT 4E7NA 4UEHH 4YT6H 1S84A 3OU0A 1K28D 3DSGA 2J4IA 4CR9A 1H9IE 2FM2A 2Z9IA 4YTAA 2YMSB 4I33A 1XUFA 2C3SA 2GJGA 4K8BA 1OS8A 4HTCH 2DUCA 1C5LH 1TA2A 1RTKA 4KTCA 1GMCF 2QE7D 4I8LA 2OC0A 2GCTB 3GOVB 3RXEA 2XBYA 3V12A 1C5YB 2FS9A 4WF8A 3SU0A 3UPEA 5A09A 2TPIZ 3HKJB 3VB3A 4JYVH 2BD5A 4IBLH 4UFEH 3S9CA 1GVZA 2FO9A 3VEQB 2BQWB 3RMOH 2HNTF 5IK2D 1T31A 1BRCE 1XXDA 3E6PH 1MBMA 3OTPA 3LPRA 4XBBA 1BTYA 3TGJE 4ZH8A 1BMMH 4WJG2 1IHTH 3H7OA 1ZGVA 3PTBA 1ID5H 3M7TA 3C27B 1FUJA 4WMDA 1SI5H 1SOTA 1TABE 1L2EA 1KTSB 1DWEH 2B9LA 3BEUA 5C1YA 1HLTH 3FKSD 3LJOA 2HVXA 3MWIU 2TBSA 4CH8B 1UHBB 1SGNE 5FPYA 1HAIH 2VWLA 4Y6DA 4ZUHA 1HAOH 3KQ5A 1SGYE 1W0ZU 4B2BA 2GZ8A 1V2KT 1N8OC 1FV9A 4AFUA 4CRGA 1TB6H 1BB0B 4YM9A 4XE4A 2BZ6H 1JRTA 2VIQA 1ZOMA 1GBDA 5JBBS 4BTUB 1P2JA 1O3IA 4X2YA 2CF9H 2GV6A 1D9IA 3RM2H 4I7YH 2Z6BD 2GMTC 3BG4C 3VG8A 2ODYB 3F1SB 1P0SH 2AYWA 1AFQB 5T3HA 2QIQA 2QYIA 1AMHA 3NK8A 2OQUA 1L1NA 1OWHA 1V2ST 2KR7A 2XBVA 3NXPA 4O3UA 3P70B 1WQVH 1QFKH 2FOBA 4NWKA 4YESB 2AMQA 2Y80A 1QNJA 3G01A 3BG4B 2H5DA 1UVSH 3A84A 4THNH 1Y5BT 1HXFH 2ZFSA 1O3CA 4AX9H 1GG6C 5DP9A 1HJ8A 1O2RA 3PMJA 3AASA 2RDLA 1DSTA 1YLNA 1C5SA 2GGVB 1Y5AT 2A4RA 2OBOA 2VVCA 3BTME 1C1VH 1N8OB 3M37A 1GJ8B 1W0YH 2XYAA 3KL6A 1YC0A 3A83A 3BTTE 3UQVA 3P17H 4OGYA 1HCGA 1XUJA 8KME2 4WH8A 1NN6A 2NU0E 1PPBH 1AB9C 1AE5A 2WPMS 2J92A 1C1QA 1FXYA 3RXOA 2AGGX 7GCHG 5CHBA 2HRVA 3W1EA 2JH5D 5C94A 4FUJA 1MABB 4MPVA 1A2CH 2UUFB 2ZGJA 1GHXH 5C0TA 3A88A 5C3NA 2P8OC 3JZ1B 2OC7A 5TCAA 1PJPA 2F9BH 1OP0A 1V2UT 1SQTA 2GKVE 5C5OA 1AB9B 1GJ5H 1MTNB 1QQUA 2SNVA 1ORFA 1OWJA 4X1PU 1BZXE 1QGFA 4IMQA 2FOEA 1A0JA 3TPIZ 2W5EA 2P8OB 2BOHB 1ZMNA 3DA9B 1IQNA 2G00A 1S81A 4Y7AA 4E7RG 4INLA 1ZYOA 1O3KA 3ZZ8A 2VIDA 1MZAA 1SLUB 1SKYE 2BY7X 2ZFRH 2UWOA 5B6LA 1S83A 3MO9A 3NKKA 3T62A 4JZDH 1AU8A 2BY6X 4FUHA 5A0AE 2EI7A 4K3JA 1AUTC 1XVMA 2J38A 4AGJA 4X1RU 7GCHF 3D62A 1EB2A 1F5KU 1IOEA 2Q6DA 2O8MA 1TRNA 4ABDA 5LH8A 5AFZH 2OCVB 1C4V2 1IQKA 2WUCA 1L1JA 1VJAU 1H8HD 5EQQA 2R0KA 2HLDD 1OPHB 4YT7H 2TRMA 1YYY1 1EUFA 1ZR0A 4MPUA 1Y3UA 3SU6A 4A6LA 1SL3A 5E8EH 2VVUA 4BTTB 2ZDAH 2CGAA 1AUJA 3PV4A 6ESTA 2PP6A 2ZDKA 4Y7BA 3TH2H 1A3EH 3DFJA 4GHQA 1BUIA 1HV7A 3QZRA 3QZQA 1GI4A 2BOKA 4H4FA 2JIZD 4CRCA 2FXRA 1Z1JA 2BQ7B 2FTMA 2J5UA 1T4VH 5DP5A 3SUEA 1UTOA 3LC5A 4P00A 2GP9B 1QA0A 4A1XA 1GJ6A 4AB8A 5LPRA 1ZJKA 3GY6A 1WQSA 3KYGA 2XCNA 4MPXA 1A3BH 2P94A 1ZSKA 5EQRA 1G30B 1LO6A 4INKA 3QK1A 1HAYB 1L4ZA 1TGSZ 2ALPA 1Y5UT 4HZHA 3RXAA 5KEDA 2TGPZ 5CMXH 3EAJA 3OX7U 4OS1A 2R2WU 2BHGA 1AKSB 4K1TA 4RSPA 3BTWE 3V0XA 1HJ9A 3EGKH 2F9VA 4TWWA 4DG4A 1DY9A 2JH6D 1ETSH 1V2WT 1GCDA 2ZQ2A 1OXGA 1QR3E 1QJ6B 4ZKOU 3NUMA 5AVDA 2SNWA 1LTOA 4R8TB 1P2IA 3HATH 1ZPBA 1Y8TA 3F0OA 4B6EA 4Q80A 2OP9A 1EQ9A 1MTWA 1EPTA 1YP9A 3PYHA 1V2VT 1O36A 2ANWA 3ITIA 3MQKC 1J9CH 2XCFA 1SG8B 3OFND 4J2YB 1Y3WA 2Z7FE 1WAYB 4AYYB 2JETB 1T8OA 3FZZA 3A8DA 4MDSA 2FI5E 2G55A 3CP7A 1Q2WA 1P2OA 3BEIB 1FY5A 3LOXA 1F0SA 4CRAA 1HXEH 3AAVA 1CT2E 3LU9B 1D3TB 2FESH 1NO9H 1JWTA 3RXLA 4K2YA 1FY4A 2KFWA 3IG6B 4NIWA 6GCHF 1A61H 1C5MD 1UTKA 4JZ1A 1GDUA 1B0EA 2BDHA 2LNCA 5ETXA 3SJ9A 5GIBA 2PLXA 1AD8H 3AK5A 2A1DB 2ZP0H 5LPEA 4HG6A 3ODFA 4Z1MD 1LKBA 4X2XA 1J17T 2FIRH 1C1RA 1C2FA 1MCTA 2BX3A 2GVFA 3E16B 4B73A 2QXGA 2Y5FA 2ZCKP 5DKMA 1GI1A 1LHCH 2PTNA 4Y11E 1LPKB 1ELTA 2HVYB 2QF3A 4IN1A 3GDVA 3LC3A 2XNDD 1V2NT 3DSPA 2ZU4A 4ZKRU 2PWXA 3F0PA 3QO6A 2V7QD 3M5NA 3PLBA 1GMDG 1ABJH 3MTYA 2ZA5A 4DIHH 1GI0A 4U32A 3LKWA 2NU1E 2ASUB 2GD4B 1LVBA 1SR5C 1O3BA 3I78A 3L33A 2QY0B 1A5HA 2VH0A 1ARCA 1GMCG 2Z3EA 2HPPH 4XRNA 4YOGA 3IITA 3SHAH 4DURA 2ZFQH 3VB7A 1ZZZA 1O2ZA 3U8TH 2THFB 3F2FA 3K65B 3BV9B 2CMYA 2P3TB 3A87A 1BMFD 4MNWA 2BD3A 1Z7KA 3CNRA 3BIUH 2CHAB 2PKAB 5CHAC 3RXPA 3A7WA 1IQLA 4YOJA 1VKYA 3E3TA 1C2EA 4K1SA 5C17A 1TRYA 2A4OA 4I8GA 1E36B 2HNTC 2ZECA 2ZU1A 4ZCNA 3ZZCA 4CREA 4E05H 1O2JA 3KQDA 1DOJA 2P3UB 4X6OA 1A5IA 1P3EA 3PWCA 2XC0A 2PFEA 1FIWA 3HPTB 1E1QD 1MH0A 2ANYA 3AW1A 1O38A 1C5ZB 3GY3A 4GHTA 3DFLA 1NRNH 3QGJA 5DGJA 3BEFB 2WSSD 1SLVB 1TA6A 1K1LA 4ACBA 3PO1C 2BLOA 3TGIE 1TE0A 3OAAD 3KIDU 4CRFA 3MH5A 5C1XA 2SFAA 1B0FA 3MH6A 3U28C 2F9UA 4F49A 4H42U 4D76A 4CHAC 1FMGA 4FVBA 1PQAA 1C1NA 4M9FA 1TIOA 3EYDA 2TGDA 5GCHG 1YPGH 1SGTA 1OP2A 3VPKA 1XUKA 1W3CA 1TX7A 4ABHA 5DP7A 2XOKD 4OS7A 4YO9A 1PPFE 3FOAA 5E2OA 4TSFD 1J8AA 2FEQH 1LPGB 1DT2A 3HGNA 3RMLH 2AERH 4ABGA 4H6SB 1MU8B 1MQ6A 1MZDA 3FP6E 2V0BA 3FAOA 2Q6GA 2FI3E 2QAAA 4YXWD 3UR9A 2H6MA 2ZGXH 5DP3A 1SGFG 3ZZ7A 1NPMA 3MO6A 1DANH 5AHGH 5F8XA 4DW2U 5GNDA 3ZYDA 1LHEH 3UAIC 3KCGH 5FX5A 1CE5A 2ZIQH 2OQ5A 4HGCA 1NFWA 1O2LA 3SZEA 5GCHF 4WMEA 3V3MA 1AZZA 3SV2H 1OHHD 1TX6A 1UVUH 3RXCA 5FAHA 2OK5A 1NY22 1GJDB 4M7GA 3SQHE 1LHFH 1COWD 3S7KB 3LH3A 1TQ7B 3RU4D 4X8SH 4YZUA 1AGJA 1LQDB 4WY3A 4X6MA 1JRSA 2ZGHA 3OY5U 1XVOA 2I6SA 1F0RA 1C5XB 1V2MT 2HALA 4I8JA 3T29A 5CE1A 2BB4A 5FCRA 1BBRE 3ZZ6A 1GHAF 1YPLH 1SLXB 2BD4A 4NA9H
chains in the Genus database with same CATH topology
1GMHF 4DCDA 1BRBE 1IQIA 4FU7A 5GDSH 3E1XB 3FANA 5DJ7A 4B2CA 1WCZA 1QL7A 2PTCE 1UTLM 1XX9A 3E0PB 3TU7H 1O2PA 3UWJH 3VFEA 2ILNA 3EDXB 1QQ4A 3F6UH 2Z9KA 4UONA 4F4OC 2ZO3H 3KN2A 3SNCA 3T26A 2SGEE 3WY8A 4J1YA 1DDJA 4Y8YA 1XMNB 6CHAB 4FU9A 1BRAA 2BY5X 1GPZA 2BMGB 1EJNA 4B75A 5GXPA 1S6HA 1THRH 3F9HA 2A0QB 1NRPH 4LZ4B 1S0RA 1T4UH 2WV5A 1AQ7A 2O8TA 1O2YA 2KAIB 3T28A 4X6NA 1E37B 3Q76A 2WINI 1QY6A 5L2YH 1PQ5A 4A7IB 2ZGCA 4NSVA 1HAZB 1N6YA 2WPKS 3DUXH 1DM4B 5ESBA 2OUAA 1TGNA 1F7ZA 1QBOA 1LCYA 3MNSA 2JKHA 1BHXF 3SV7A 1FQ3A 1K1MA 3GCTG 1P9UA 4ABIA 1O39A 1O3OA 8LPRA 2VINA 2F83A 2BD8A 1GJ9B 4TY7A 1MTUA 3A89A 5EG4A 3BN9A 2SGAA 1Z6EA 3SJ8A 1AN1E 1RS0A 2FDAA 1O33A 1L4DA 4DGJA 1YPJH 1SB1H 1OWKA 1D4PB 1K1PA 1J16A 2XWBI 4D9RA 1B7XB 1S85A 2OLGA 1TMTH 1GJCB 3PB1E 1Z8RA 3U8OH 4CRBA 1EPTC 4D7GA 1DXPA 1NT1A 1WV7H 2WUBA 5HM9A 1PQ7A 3M3SA 1LVMA 1UCYE 3Q3YA 1P01A 2CF8H 1H1BA 1GJ4H 3HK3B 3KGPA 1H9LB 3MNCA 1Y3VA 5AF9H 2BM2A 3GY8A 2W26A 3F68H 4CHAB 4XBDA 1ELEE 4TYDA 1C1MA 1V2JT 3URDA 3RP2A 2QF0A 7ESTE 1ZTJA 4IN2A 3ZVCA 1FONA 3ZZ4A 4AGKA 1E0FD 4AORA 1RIWB 1SLWB 1AIXH 3W94A 1BTUA 2AH4X 1O5GH 3UY9A 4KTSA 2BZAA 1NRRH 1LHDH 3LGWA 3QLPH 1FY1A 1J14A 3S0NA 3D49H 4A1TA 4MTBA 2IPHA 1H4WA 1C2DA 3VGCC 1MU6B 3PTNA 5FBEA 1QA7A 1A5GH 1TAWA 3ZYEA 1WSSH 5I25A 3BTFE 1TMUH 1ZRBA 8ESTE 1O3FA 4ABFA 3LGVA 4ESTE 2PGBB 2VB0A 3ATMA 2RA0A 1MCVA 3SI3H 1AWFH 1TBZH 5FCKA 2FTLE 3S69A 1CBWC 1ESTA 4U2WA 1ESBA 2HOBA 2FX6A 2BDCA 2O8LA 1Z6JH 3V13A 2FPZA 1SGRE 1ZGIA 1LVOA 1YPEH 1P10A 3BTEE 1TQ0B 2VNTA 1C4Y2 3A7TA 1W13U 4Y0ZE 1OWIA 3M36A 5JBAS 2W3KA 3MH4A 1NC6A 4D7FA 3SGQE 1K9OE 4ISNA 3ZVGA 1SGQE 1LPZB 1OWEA 3GDUA 1EAWA 1TBRH 1BTWA 1C2LA 1G9IE 2F9OA 4B76A 3IWMA 3RU4T 2PR3A 2QC2A 2A4GA 1JMOH 1K22H 2QCYA 5E0HA 2BVRH 1QTFA 1UHBA 1O5CB 2BVXH 3UR6A 2WYJA 1TWXB 4DVAU 5JB9S 3K6ZA 2BLQA 2C8WB 3TJOA 3M35A 4WXVA 1FY8E 1P06A 3MMGA 1THSH 3A7YA 3RMMH 1GHZA 3QX5H 5JB8S 5G4BA 3M61U 2D1JA 2G4TA 3TNSA 3A7VA 1CA8B 1FPCH 1H8IH 4Q7XA 1GI3A 2H9EH 2ZFPH 3O8RA 3T5FH 3GICB 2FOFA 4ABAA 3SHCH 1BT7A 1VCWA 1XXFA 1VZQH 4IS5A 3GY7A 2VJ1A 2D2DA 3LJJA 2EI6A 4DOQA 1EB1H 4GPGA 3RXVA 3TK6A 1NS3A 4Q7ZA 2ULLA 3UNSA 4NIYA 1WTGH 3MI4A 1QIXB 3ZZ9A 3V7TA 3ODDA 2XWAA 4ZHMU 4XOJA 3A8CA 2WPLS 2YOLA 5F8TA 4IC6A 1YM0A 1K1NA 4BAQB 3RXFA 1ELVA 2ZCHP 4FUDA 1EP6A 3DHKH 3STJA 2EA3A 1HFDA 5HM2A 5T6GA 2BDIA 1BQYA 1CT4E 2BX4A 3RXRA 1HDTH 1C5QA 5EW1H 1NU9A 2P16A 2Y5HA 2ZHFH 4LXBH 5FX6A 1P04A 5JDUB 1CHGA 1EX3A 4BAOB 3RU4E 1KIGH 1NRSH 5EGMA 3BG8A 3EA8A 3BTHE 1GI2A 4MPWA 1HAVA 2H9TH 1G3BA 3ZZ5A 1LHGH 1O30A 1P8VC 5J4SA 5K0HA 1GI5A 4OS4A 2JETC 1VJ9U 3FP8E 1V6DA 3KQCA 2FYQA 4CBOA 3QTOH 3FFGA 3U1IB 4ZKSU 1QRZA 1EZSC 3SUGA 3A8BA 1N6XA 1GBEA 1YLDA 2C90B 4YLQH 2BDBA 4JK5A 1C2JA 2A7HA 1MD7A 1NFXA 1SSXA 3KNXA 1W7XH 1T8LA 3M3TA 3EA7A 1C1TA 1P2KA 1EOJA 1KY9A 3K9XB 2ZDVH 1SMFE 4WMFA 1EAUA 1ANEA 5EXLA 3B23B 3ZZBA 1O2NA 1O2UA 3ZVDA 1C5WB 1AWHB 4XFQA 4YOIA 2OBQA 1DLEA 4WXIA 1MKXH 1ANCA 4B2AA 1O2OA 3C1KA 1AVWA 3RXHA 1E38B 2ZI2H 4ZHLU 2B5TB 4E06H 1K1OA 1IQHA 1O31A 4GSOA 3E91A 2PKSB 1X7AC 2FS8A 2OC1A 2RG3A 3RUOA 3P95A 1TGCA 3QUMP 1LDTT 1QB6A 3MH7A 5TJXA 1QRWA 5EODA 1K2I1 3UNRA 4H6TA 1BTHH 3OYPA 3PM3A 3I29A 1YF4A 1O3PB 1AFEH 4JZEH 4BANB 3RXBA 3I77A 8GCHF 4MG3A 2UUYA 4KKDA 1TFXA 4SGBE 1O2KA 3PLPA 1F0UA 4FVDA 2BYAX 1HAHH 1TPAE 4DY7B 1BJUA 4CR5A 3PO1B 1JXPA 1Z8GA 3S7HB 2BLWA 1XM1A 1K1JA 4Z6AH 1FI8A 2SGQE 1P02A 1KDQB 4K1EA 2JH0D 3BIVH 3A82A 1GBLA 1GGDB 2PKSC 3NCLA 4BAHB 3PMHB 3P6ZB 4FUCA 2VWNA 3JZ2B 4LZ1H 1PPCE 3EQ0H 5J4QA 1O5FH 3VB6A 2BDGA 2V3HH 1D6WA 2XBXA 4I32A 2HGTH 2NU3E 3GY2A 1GBMA 1MUEB 2FWWA 1WOFA 1PYTC 3A8AA 2GDEH 2BTCE 2A31A 2C4FH 1UTMA 1MTNC 1ZHRA 2A32A 1O3HA 3M7QA 4NWLA 4NZLA 5L6NH 1CGIE 1BTXA 4DJZB 1O5BB 1P2NA 1V3XA 2V35A 1CQQA 3RXKA 1SGIB 2STAE 1HB0B 2FOMB 1KXEA 9ESTA 3O8BA 1ZTLA 1T32A 1CSOE 3ESTA 3SBKA 2IJOB 2FOCA 2W3IA 2VVVA 1G37A 3ZVAA 1GDQA 4RKOB 3GCHB 1TGTA 3RXGA 1SGDE 1TPOA 5FBIA 3GY4A 1P57B 1TBQH 1H9HE 4O97A 1HJAB 2ANMH 1K1IA 1DWDH 1UJ1A 3MU0A 5FPSA 4SGAE 1OYQA 2ODQA 2P93A 2A7JA 3TVJB 4ISLA 5T6FA 3AVZA 3PROA 4HI3A 4O03A 1W10U 1QL9A 2AS9A 3GCNA 1XKBC 3RXMA 1ZLRA 1SQOA 2PHBA 3A86A 3TJNA 1CGJE 5EPYA 4UD9H 1WTHD 1O2XA 1KXBA 1BRUP 5F03A 5HGGA 3TJUA 2OC8A 4KELA 1TNGA 1FN8A 2ZG0H 4ZROA 6GCHG 1KXCA 3LGYA 1O5AB 1Y59T 2PUQH 1TX8A 2ZU3A 1ZJDA 2EEKA 3P92A 2ZFFH 1FY3A 2ZF0H 4K69A 5CHAB 1VCPA 2QXHA 4DT7B 4U01A 3TITA 2GCTC 5C2ZA 3SORA 5C20A 2HNTE 1HAPH 2C8XB 1YCPK 1EZQA 2OTVA 1KLIH 4NGAH 1FIZA 2O8WA 3L6PA 4XBCA 4ISOA 4MNYA 2GTBA 2CXVA 1CHOG 3MYWA 1W12U 1C2HA 3K2UA 2H1UA 3RXJA 1CVWH 2H9HA 4AYVB 2QGRA 3QN7A 1PPHE 1ELGA 4X8TH 3SV8A 1O2WA 1TRMA 4FUFA 1EOLA 1O3DA 2EC9H 1AO5A 2WPJS 1ELDE 2G5NA 1P3CA 5EQSA 1BMAA 2XBWA 1P03A 4HFPB 3A81A 5HYOA 1D3DB 2UWPA 5T6DA 2ESTE 4RKJB 5BPEA 1EJAA 2A7CA 2ZHDA 4OS5A 1HAXB 1N1LA 2P3FH 1DUEA 1C5PA 1SGPE 2Z3DA 3EE0B 1C5UA 1YPKH 1YKTA 1Z8JB 4MNVA 1ARBA 1MD8A 1MTSA 1NZQH 2ZFTA 3SGBE 1VITG 2ZHEH 2W7UA 1V2RT 5IDKA 2OD3B 1JIRA 1THPB 1MKXK 3O8CA 3ZZDA 2K1QA 1UK3A 2GZ7A 4X1SU 2A4QA 4AZ2B 4X1QU 1RIWC 2AIQA 2ZPRA 2GCHG 4ASHA 1YBWA 2R0LA 1F0TA 2AMPA 4I8HA 3BF6H 1GHWH 4ZXYH 2ZDNA 2SGFE 1ANDA 1P05A 1OYTH 2VU8E 1G2MA 1VITH 2DE9A 1ACBE 1WU1A 3LGUA 4CH2B 1BJVA 1DVAH 4OGXA 3TK9A 2Y7ZA 2ANKH 2ZHWH 2QN5T 1ZMLA 2A5AA 1PPEE 4U30A 3SUDA 4NIXA 1G32B 3OY6U 1W11U 4A92A 2VGCC 1GI6A 1JIMA 3SQEE 1QBVH 2J9NA 4Y10E 1O5DH 2DE8A 2ZTXA 2HLCA 4Y71A 1C9TA 2ZHQH 1AVXA 1TPSA 4NFFA 1O2MA 2G52A 4CBNA 1O32A 4AFZA 1O37A 1HIAA 1RGQA 3UOUA 1Q3XA 3UFAA 4KP0A 1VR1H 1HUTH 5DPAA 3VGCB 1Y3YA 4GUXA 3GYMA 3ATWA 2TGAA 3GCOA 3ZVEA 1O2SA 3ATLA 1AFQC 1YPMH 3VB5A 2FOHA 4K8YA 1SQAA 3ZZ3A 1ABIH 1HPGA 1SHHB 1NFYA 3TJVA 3Q77A 3ELAH 1S5SA 1GBHA 4GVUA 3KQBA 3CS0A 2PW8H 1DWBH 1BTPA 4Y8ZA 1CT0E 1TONA 2XC5A 1S0QA 2ZQ1A 2ZEBA 1BHXB 3ATKA 4CRDA 1TLDA 3MNBA 2WV4A 1O2IA 1GBIA 3T25A 3KHVA 4YLUA 4JYUH 3S9BA 1SPJA 1PFXC 2STBE 4JMYA 4KGAA 3RXTA 4XSKU 1F5LA 1P12E 2J94A 1CA0B 3ATIA 1ANBA 1S6FA 1WUNH 4X2WA 1SOZA 3TK5A 3H7TA 3VXFH 3UNQA 3RM0H 1P2MA 3GCTF 4R0IA 1ELAA 2SGPE 4BTIB 3S9AA 2J2UA 3A7XA 1P09A 1A0HB 3MU8A 2P59A 4ISHH 4AG2A 1YCPH 3U8RH 3MO3A 3VXEH 2BQ6B 2CN0H 3OSYA 2Z9GA 2BXUH 1IQEA 3M3VA 2NU2E 4BXWA 2AFQB 1S82A 1C1SA 4TY6A 1ZPZA 4IC5A 3OTJE 1KYNA 1KLJH 1W2KH 5ESTE 4A5TS 5A2MH 1GHVH 1T8NA 5A8XA 3QDZB 2H5CA 4O9VA 5LGOA 7KMEH 1E35B 1OP8A 2CHAC 3LIWA 1PPGE 3PMBB 2NU4E 4XDEA 1M9UA 2V6NA 5L2ZH 4ZAEA 4D8NA 1TOCB 1TYNA 4FUIA 1FAKH 3MU4A 2GX4A 1QHRB 3ENSB 2BDAA 2C93B 2P95A 4UDWH 1DWCH 1TNHA 1O35A 1AZ8A 4INHA 3BTKE 4JK6A 3F9EA 2QV1A 5BRRE 3Q3KA 2YNAA 2Y7XA 1GI7B 1BMNH 1HNEE 1UTPA 2BLVA 2GDDA 2FYRA 4UFGH 1NTPA 5FHTA 1EATA 4X1NU 3E0NB 9LPRA 1GBCA 1FDPA 2F9NA 1G3DA 8GCHG 1AY6H 1C4U2 5DP8A 1DE7H 1DUAA 1OOKB 3PMAB 1Y3XA 2BD2A 1GL0E 2QXIA 4KTUA 2OINA 1A0LA 1BBRH 1TNIA 2AMDA 3BTGE 2F91A 2O8UA 3BTDE 1FJSA 2VH6A 3SI4H 1YLCA 1YCPM 4A1VA 4JYTA 1VITF 1F5RA 3E90B 1V2QT 1G3CA 3HK6B 5HMAA 3UTUH 1Z8IB 3KEEA 1ELCA 4AN7A 3SNBA 1GHAG 1OSSA 1ZTKA 1GVLA 1T8MA 2GCHF 3KF2A 2A2XH 5EXNA 2ZC9H 1ETRH 3QGNB 1GJAB 1MBQA 1QB9A 3CENA 1SGCA 1AE8H 2XTTB 1MQ5A 1ZSJA 3SU2A 1C9PA 2B7DH 1F2SE 3NZIA 1INCA 2FX4A 1HBTH 3MU1A 1XUHA 2TIOA 1KLTA 3URCA 2Y6TA 1JOUB 4GCHG 3SJOA 4ABEA 3SNAA 1QB1A 3RXSA 5B6OA 1GBKA 1EKBB 2AEIH 3LT3A 3T2NA 1MMJN 2BXTH 2VIVA 5A0BA 1GHBG 1P11E 1SHYA 2OXSA 2WYGA 3BTQE 2FZZA 3ZVBA 1MAXA 2PUXB 1O0DH 1RTFB 1HGTH 2A45B 4UFFH 2FP7B 4AG1A 2AGIX 1GJBB 1RJXB 7LPRA 1Z1IA 1G2LA 3LONA 3CS7A 3MFJA 4JZFH 2WPHS 4B71A 3GISB 1F92A 2FI4E 1EZUC 3RC4A 1CHOF 2O9QA 1K21H 3F9GA 2VIWA 1TPPA 4VGCC 1TNJA 4WVPE 1TNKA 3LH1A 1L0ZA 1IHSH 1A4WH 1LVYA 1GVKB 4ABBA 2PSXA 3RC5A 1UO6A 5GWZA 3AW0A 4FUBA 1O2QA 2FODA 4ZXXH 1FPHH 1UCYK 1GGDC 2ZU5A 1GHBF 1AKSA 4NA8A 2PV9B 3TH4H 1RXPA 4AFQA 3DD2H 2W7SA 3M5MA 3N7OA 1ZHMA 1C1OA 1MKWH 4NSYA 3RDZA 3ZVFA 3QTVH 1VGCB 5A0CA 1BTZA 5PTPA 1EJMA 1HJAC 5LPFA 4Y76A 3MHWU 2R9PA 3ZZAA 2R3YA 1HAVB 1QL8A 3EA9A 1GMDF 1QCPA 1RFNA 1UCYH 1GCTB 4MLFB 1VGCC 1TNLA 4BAMB 1DXWA 1V2OT 2G51A 1AHTH 1KXFA