2PKSB

Thrombin in complex with inhibitor
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
147
structure length
147
Chain Sequence
IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thrombin light chain
publication title Design, synthesis and biological evaluation of thrombin inhibitors based on a pyridine scaffold.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 26
structure length 147
sequence length 147
ec nomenclature ec 3.4.21.5: Thrombin.
pdb deposition date 2007-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2pksB00
4HTCH 4YOJA 1GJ6A 1DY9A 4X1PU 4AZ2B 1O5GH 3GOVB 3RXDA 2ZFTA 4F4OC 1V2LT 2ILNA 3SZNA 3QDZB 1GMCF 1YM0A 3K2UA 5C5OA 1GBJA 1YLCA 1AE8H 5AFYH 5C1YA 1JRSA 1OKXA 1ZMNA 4FUIA 2J34A 3RLYH 3RXTA 1GMCG 4ZH8A 1HDTH 3M5NA 4FUCA 3PMHB 1O3CA 1YCPM 3A89A 1G32B 4AYVB 5CE1A 1P06A 3A82A 1TPOA 3KEEA 4FU8A 4ZHLU 1CT4E 2IOTA 1HIAA 1AFEH 3NXPA 2VGCB 1CGHA 1DITH 1EB1H 3MU5A 1XUGA 3P8GA 2QY0B 3ATWA 1FAKH 1MTWA 1GJAB 3N7OA 1GL1A 4ZMAH 1UO6A 2SGQE 1V2MT 3PO1B 4X1QU 4E7NA 5C20A 1O3NA 1P3CA 2FX6A 3F9GA 4WMEA 5L30H 2G00A 1SHHB 2EC9H 1SC8U 2RA0A 1IHTH 3KQDA 1OYTH 2C8XB 4ZROA 2BDYA 1F92A 1EPTB 1AFQC 2Z7FE 5FAHA 1XVOA 1KXAA 3VB3A 1VCWA 2PSXA 1AD8H 5JDUB 2XWAA 2ZDVH 1C5NH 1W0ZU 4OS7A 1A5IA 4NIYA 3LDXH 3HKIB 1TNGA 1A5HA 1K21H 3A7WA 1SR5C 1PPZA 3BG8A 3SV6A 1MU8B 4WVPE 1IQIA 4HFPB 2G8TA 2QGRA 3RXAA 3UPEA 2GCTB 1HNEE 3NCLA 1T8LA 4TY7A 1S85A 1PQ8A 2GV6A 5E2PA 1AWFH 2O9QA 1F0RA 3EA7A 4D7FA 1EP5A 4IC6A 1SOZA 2SGEE 4DW2U 5I46H 1X7AC 1MMJN 2Y5FA 3TLOA 5EU8A 4ABFA 1O39A 4CRBA 1JIMA 2AFQB 1V2PT 3E0NB 5CHAC 4MQAA 1MZDA 2BY7X 3EGKH 2PWXA 1MBQA 1IHSH 3GCNA 3BN9A 1BBRH 4AORA 1EQ9A 4CRDA 3SU2A 1P12E 2FP7B 1ZTLA 4U01A 3GDSA 2A5KA 4DJZB 4WJG2 2PUQH 3I78A 2BVSH 3RLWH 2RCEA 4NCYA 3LJOA 5LPEA 2QXJA 1P2KA 4MNXA 1HJ8A 1C1MA 1NFYA 1UHBB 1ZRKA 1LKAA 1O5AB 1NN6A 2AMPA 2AGGX 1OWJA 1E0FD 3A7YA 3KHVA 3RXVA 1UK3A 1Q3XA 1AZZA 1THPB 4NIXA 6CHAB 4E7RG 1OSSA 1TONA 2O8LA 1HAVB 3FP6E 1TGCA 3E8LA 5HYOA 2ZZUH 4A5TS 1O3IA 3E16B 2WPMS 1P3EA 2WPIS 1GVKB 4OS6A 1DWCH 2LNCA 3A87A 4JMYA 3NUMA 2R2MB 2ZNKH 1O2SA 4JZIA 1TX7A 2BD3A 4BAKB 2R2WU 1NTPA 2VVCA 1N6YA 2P3FH 4B74A 2ZKSA 2VIPA 1GBAA 2FLBH 1MTNC 1C5PA 4TPYA 4CBNA 3MU1A 3RM0H 2FPZA 1UTJA 5C2ZA 4D9QA 5ETXA 1MTUA 4I8KA 3RC4A 2OBQA 4I31A 2VIWA 1C2GA 1FLEE 4Z0KA 1AVGH 2FMJA 1Y5BT 4INKA 3KNXA 1A7SA 1C5MD 2OP9A 1SLXB 5DK1A 1RD3B 3LU9B 2WUCA 4WWYA 3VPKA 1C4U2 2BYAX 3SV2H 4A1XA 5GCHF 3LC3A 2XCFA 2FZZA 4K1TA 1FIZA 4JK5A 2R0LA 2GZ7A 1ANEA 3A7ZA 3FZZA 1CT0E 1O2TA 3GY2A 4B75A 2AEIH 1INCA 2ZP0H 1C5YB 3D49H 3W95A 1LTOA 1OP2A 4IMQA 2BMGB 3LPRA 1SQTA 3A88A 1WBGB 2OBOA 4BXWA 3B23B 3WY8A 4OS5A 4DURA 1E37B 1YGCH 2SGFE 4O97A 3SNDA 4QT8C 3SV8A 9LPRA 1THSH 2P59A 1W7XH 1GBLA 1Z8GA 2CN0H 3A86A 3ATKA 1JXPA 2ZGXH 3BTME 4YM9A 1O32A 4Y8XA 3FAOA 5FHTA 2PGQB 1C9TA 3TK5A 3AAUA 4A6LA 2GGVB 2HRVA 1SGFA 5C1UA 5HM9A 2HNTE 4AGKA 3EAJA 4AB8A 2NU4E 4MNVA 2J38A 1DSUA 3ZZ7A 4ZKSU 2FOEA 1HV7A 4K69A 1OX1A 4KELA 1EKBB 1MTSA 1A61H 1S0RA 1RRKA 5GPIB 3GYMA 2Z3CA 1EPTA 1HAZB 1J8AA 2G5VA 4VGCB 4K60A 3BV9B 1OS8A 1KLTA 1ZRBA 1QRXA 1GI2A 1DS2E 1P57B 4CBOA 3LGYA 3BTKE 3BTTE 3PV4A 3NZIA 2A5AA 2BLVA 1NROH 1QRZA 1IQNA 1L4ZA 3A7TA 1C9PA 4Y8YA 4Y11E 5DP7A 1VITF 1FY3A 1WTHD 1Y8TA 4XSKU 3SUDA 3CS0A 1UCYH 2J4IA 1O5BB 3DHKH 1HGTH 3S9CA 1P2JA 4CRFA 2Z9GA 1KY9A 5K7RA 3ZZ8A 1V2VT 2FX4A 2QXIA 4ABDA 1LVOA 4JZ1A 1BZXE 4Q2KA 3VGCB 4O3TA 2BOKA 1BRAA 3RC6A 3VB4A 4RSPA 2BB4A 4SGBE 1UVSH 2OC1A 2AYWA 1WU1A 3A8DA 1DWEH 2GP9B 4MG3A 1VJAU 4KP0A 1ETSH 1G3BA 4R8TB 3TJNA 4YO9A 3GCTF 1AVWA 1D4PB 1WTGH 5EW1H 2Z9KA 1A4WH 1AZ8A 2QN5T 4TWYA 1RGQA 3RXKA 1CQQA 1AUTC 3GDVA 3BTQE 2R0KA 4FXGH 1QJ1B 3GCTG 5DKMA 1GJ8B 4CHAB 1BRUP 1CA0B 1O38A 1O3GA 3NK8A 1ZPCA 4X2WA 2OQ5A 1DE7H 1V2WT 4X8VH 1KDQB 1OOKB 3AW1A 4WXVA 4BOHA 2ZU4A 2P3TB 1YPHC 3DUXH 2EA3A 4IN2A 4O03A 1UTQA 3FZDA 1DY8A 1B7XB 3LGIA 2FYRA 1GHBF 2ZU3A 1V6DA 4U2WA 4I8LA 1P09A 5G4BA 2W3KA 1FMGA 4ABGA 5E0HA 1FDPA 3ATMA 1HCGA 4ISNA 3TGJE 1UJ1A 3OY6U 1FUJA 1GHBG 3V13A 5BPEA 1MAYA 3URCA 2BY6X 1XUFA 2A7HA 2FM2A 4X8TH 2ZDLA 4ABAA 2F9OA 2CJIA 4NFEA 3UTUH 2AERH 1LQDB 1PPBH 1AWHB 2BM2A 1P0SH 1CE5A 3U9AH 1NFWA 2VINA 3I29A 1PQ7A 3GCHC 1TLDA 1Z71A 5DP6A 2JETB 1O5EH 2ALVA 1HAOH 4O3UA 4GHQA 1JOUB 2I6QA 1C2HA 1GJ7B 3GY7A 3BIVH 4DG4A 1ETRH 4XE4A 1BA8B 2BLWA 3SNCA 3GY6A 1W8BH 1SL3A 3HK6B 5ESTE 1GI6A 3UQOA 1A1RA 1EXFA 1SB1H 1AUJA 1YPHE 4FUHA 1NS3A 1C1OA 4UEHH 2ZGBH 2J9NA 1OXGA 2OC0A 1XKBC 1ZJKA 2BTCE 3DFLA 3M5OA 1AKSA 1K1OA 1N1LA 1BCUH 2EI7A 5JBCS 1L2EA 1ANDA 1HAXB 1VCPA 5DP3A 1SGRE 1AHTH 3V7TA 1DICA 5AFZH 1C1WH 1PPHE 2M5TA 2ZI2H 1IQJA 1QJ6B 3P6ZB 5HXFA 2J94A 1ZSJA 3SUFA 8ESTE 1GCDA 2ZQ1A 1NESE 1S5SA 3MH7A 3TNSA 2Y5HA 3MNXA 4XOJA 1D3PB 3UWJH 2RA3A 2PGBB 2ZG0H 4UFGH 1HB0B 2ZGCA 2ZWLH 1NM6A 2BD2A 3LIWA 7GCHF 4Y76A 5GXPA 1L1JA 1HJAC 1OYQA 1KSNA 2D26C 3RU4T 3MU8A 3U98H 1BQYA 4DCDA 1Q2WA 3SNBA 1FZZA 7GCHG 5JB9S 1C5UA 2ASUB 1CGIE 2BDGA 1RTFB 3ZZCA 5E0JA 1DVAH 1TMBH 1QNJA 1LO6A 1DXWA 1O3MA 2Q6FA 1GBEA 2DUCA 4BTIB 3P17H 2P8OB 1RS0A 1YCPK 5L6NH 2FOCA 1ABIH 4RKOB 3SU3A 4YZUA 2VWOA 1KLIH 3P92A 4CR9A 1ANBA 3ZVBA 4K8YA 2H1UA 4DIHH 1Z6JH 2VWNA 4ISHH 4IC5A 3OTJE 2ESTE 4Q7XA 4NGAH 4BXSA 1FNIA 1LQEA 4J1YA 2QF0A 1LHDH 3TH4H 2VH0A 1O2PA 5JBAS 1TBQH 4UFDH 5CMXH 3K65B 3MO9A 3D23A 4YOGA 4H6SB 2BDHA 1TRNA 3E6PH 3UFAA 1ABJH 1QBNA 2WINI 2H5CA 1EAWA 1ELEE 2Y81A 1DDJA 2XXLA 5EPYA 4UONA 2C93B 3T28A 3ZZAA 4ZHAA 2D1JA 3F9EA 1OWKA 5EPNA 1GHVH 1ZOMA 3RUOA 1RIWC 1NO9H 3M3VA 4XDEA 2R3UA 1XX9A 2BD5A 4NSYA 1ESTA 3PMAB 1SBWA 1TRMA 1QL9A 1TX8A 2B8OH 2KAIA 4YT6H 1QBVH 2XBYA 1SGTA 1BBRE 5JBTA 1DOJA 1EJMA 1QQ4A 5C67A 3URDA 2A2QH 1T31A 3FFGA 3K9XB 3LH3A 3NWUA 3ZZDA 4GVUA 3VEQB 3M7TA 2CV3A 2HPQH 2A32A 1EAUA 4Q7YA 1L1NA 5A0AE 3SU0A 4MVNA 3ZYEA 1GI7B 1FN6A 1MZAA 2J2UA 1ESAA 1PFXC 3RXSA 1TOCB 2BVRH 3QGJA 1P2IA 1MTVA 1F0TA 1OWIA 3ODDA 3EDXB 5I25A 3U8OH 4DIIH 4I8JA 1UMAH 1AFQB 2A2XH 1GG6C 4AG2A 2H5DA 2A31A 3GICB 4OS2A 4O9VA 1PPCE 3SW2B 1C5TA 2EEKA 1TGTA 1SGFG 1H1BA 1VITH 2GV7A 4B73A 1T32A 1ESBA 1PPFE 2UUJB 2UWLA 1GDUA 1Y59T 5EXLA 1HXFH 1K1IA 1SMFE 1W2KH 4AFQA 1V2TT 4Y6DA 1O0DH 1GI9B 5E2OA 1DUAA 1OWHA 5IDKA 3BEFB 1O3HA 3MH6A 3MOCA 2A5IA 2XNIA 1GI1A 3OYPA 3HK3B 4MNYA 2C4FH 3RXFA 3VXEH 3PWCA 1MUEB 3Q00A 5CHAB 2Y80A 1KYNA 5DP9A 3GISB 4X1NU 2JKHA 4OS4A 5FBIA 1GHXH 1ELTA 1HAGE 1C2FA 2Z9IA 1IQMA 1LHCH 2HNTF 2FLRH 1AU8A 5T3HA 1H8DH 1A3EH 3VXFH 2Z9JA 3ZVGA 3RMNH 3ENSB 3SJKA 1EASA 3EQ0H 1C2LA 1TGBA 2C3SA 3EA8A 1FV9A 2F9VA 4ZKOU 5LPFA 1C1UH 3BTGE 1QIXB 4YLUA 2AH4X 2ZPSA 3DFJA 4GSOA 1TMUH 1F0SA 1GBBA 4FUJA 1TNKA 3SNEA 5GDSH 3TH3H 4ABEA 3UIRA 5TJXA 1TB6H 1ZZZA 4ZXXH 1Y3YA 1ORFA 5JBBS 5FCKA 3MNSA 2HGTH 1UVTH 1W13U 3PO1C 2B5TB 3TVJB 3A7VA 4Y71A 3UREA 5LPRA 1O3JA 1B0FA 4E05H 1FI8A 1S82A 2YOLA 3SN8A 2BQWB 3C1KA 2V35A 1HUTH 1EPTC 1C1RA 1NPMA 1O36A 1GJDB 1IQKA 1XMNB 2HVXA 1O2KA 1ZTJA 1TMTH 2TGAA 3L3TA 1S81A 2VH6A 4XBCA 2UUKB 2H9EH 3QX5H 1GI4A 2A4GA 5EG4A 3SJ8A 2BZ6H 2OLGA 3E3TA 2BXUH 3RMOH 1NRPH 2Y7XA 1XUJA 1V2KT 1BMMH 2FDAA 1GDNA 4NZLA 3RMLH 1HFDA 3TGKE 3PB1E 2VVUA 1T4UH 5EGMA 3VB5A 5C3NA 3KF2A 4BANB 3KIDU 4FVBA 1TPSA 1D3TB 1JBUH 2OINA 1G2LA 1P8VC 2BXTH 3SHCH 3RXPA 1AVXA 3A85A 2GT8A 1BUIA 2ZU5A 2WPKS 2H2ZA 5K0HA 1P10A 3R3GB 1C5RA 4CRGA 1GVZA 3A81A 4DY7B 3U1JB 4CRAA 2HNTC 5F03A 1O2XA 1TOMH 3E91A 1P2NA 1G3DA 1GGDC 3GCOA 1TGSZ 2ZF0H 2ANKH 3SJ9A 3A7XA 1CSOE 2XWBI 3I77A 5E8EH 3ZV8A 2SNVA 2CHAB 1FQ3A 2FWWA 1GI5A 2GZ8A 1TQ7B 4K1SA 4Y0YE 3FVFB 3QZRA 1MKXK 2B9LA 2ZHEH 1DPOA 3A83A 3UNSA 2STAE 1P9SA 2V3HH 1E34B 4MPXA 4AX9H 1A0LA 4FU7A 3RXBA 3SI4H 4K1EA 2LPRA 4GPGA 1F5KU 1SLUB 4AYYB 4MPVA 3RM2H 1TPPA 6CHAC 5EODA 2AMDA 3AW0A 1TIOA 1VZQH 1QRWA 3T25A 3GDUA 3D62A 1VJ9U 2Y7ZA 1V2UT 4XFQA 1T8OA 1H4WA 3F6UH 1XVMA 1MD8A 2ODPA 3V0XA 2CGAA 8GCHF 3MO3A 1O2ZA 4LOYH 1V2ST 1WOFA 4BAHB 3LGTA 1DFPA 4OGYA 5FPYA 4CH2B 4H42U 1Z8IB 2SGAA 1RTKA 2ANYA 8GCHG 2F9BH 2QV1A 3F9HA 3RXGA 2GMTC 4ISIH 1QQUA 1MKWK 2PKAB 2NU1E 1S83A 5A0CA 1EAXA 1QGFA 3NPSA 5HM2A 3SOSA 4NSVA 1GJCB 4XBBA 2XTTB 3PM3A 4IGDA 1IOEA 2ZFRH 4IS5A 3ZVCA 2Y6TA 2PKSC 2ZFSA 3MH4A 5ESBA 2D8WA 2R9PA 1K22H 2ANMH 2VIOA 3ZVAA 4ZUHA 1O3EA 4LXBH 4Q7ZA 1TNIA 1UTPA 1ELCA 3QTVH 1TA6A 3ZV9A 1XUIA 2P16A 5EQRA 9ESTA 1CVWH 1O30A 2FS9A 3RU4E 1EZQA 1TQ0B 3M7UA 4UDWH 1G3CA 2VWMA 1GHYH 2WPLS 1A46H 1P01A 1P2MA 3ZZ6A 4MLFB 1SOTA 4TYDA 1Y3VA 1U6QA 3AAVA 1W10U 1C4Y2 3SUEA 1GBTA 4BNRA 2DE9A 4GCHG 1J17T 5GWZA 3UY9A 2ZDMA 3GY4A 1P2QA 1BTZA 5EW2H 1D3QB 4CH8B 1TNLA 1ZPBA 4Y10E 4JYVH 2BDIA 2GX4A 1ZLRA 2GZ9A 1PJPA 1WV7H 3FP7E 6LPRA 1T8NA 1BTHH 2Q1JA 2ZFPH 1VGCC 4WY3A 4AG1A 1LHGH 4K8BA 1C5OH 1CBWC 1SFQB 5FXLA 1O2GH 6GCHF 1F5LA 3LKWA 1BMLA 1JIRA 1C1VH 2GDDA 5C1XA 4AB9A 5F6MA 1ANCA 1UHBA 1LVBA 1LPKB 5J4QA 3UNQA 2FOGA 1BHXF 5B6OA 2XCNA 1DSTA 2HOBA 2O8TA 4K3JA 3KN2A 4D7GA 6GCHG 3BTFE 1BTUA 1QB6A 1C5SA 1HAVA 1SGYE 3EE0B 1NT1A 3P8FA 5F8XA 3UOPA 1PQ5A 5JB8S 1TABE 3KQCA 1PQAA 1OPHB 3PLKA 2C8YB 1MAXA 1Y5AT 3MI4A 3SU1A 4A7IB 1D6RA 4AN7A 4LZ1H 4X8UH 1TRYA 1UTMA 1TA2A 1NC6A 2OQUA 2ZQ2A 1BRBE 1AN1E 1NRRH 2ZHQH 4UFFH 1GMHF 5HMAA 4Y8ZA 3SJOA 3PROA 1GCTC 3LOXA 5FX5A 1O2LA 3GYLB 1EUFA 1AB9C 2XBXA 2TBSA 5T6DA 1PPGE 1K2I1 1GJ4H 2P94A 5C5NA 5EQSA 1BOQA 3TK9A 1GMHG 5PTPA 1XXFA 5ABWA 2AIQA 2R3YA 1ELGA 1N8OC 4YOIA 4NG9H 1RXPA 3L6PA 1Y5UT 2VJ1A 1C1PA 3Q3XA 3SNAA 2ZEBA 3ZZBA 3RXMA 3PLPA 3UNRA 1A0JA 1QTFA 1C2IA 4TWWA 3SV7A 1D6WA 3U69H 7LPRA 4SGAE 1BITA 1KXFA 3TJVA 4CHAC 3O8CA 6ESTA 1F0UA 1TAWA 1YCPH 2WV5A 2ULLA 2B7DH 2IJOB 3V3MA 4UE7H 2YNAA 2VNTA 4OS1A 1O2MA 2ZPQA 1C5QA 3LGWA 1DX5M 1M9UA 2A4QA 4KGAA 1BMNH 1SQAA 4HGCA 5TCAA 4ABJA 3SQEE 1TBZH 2TRMA 3ATLA 5DGJA 3ZZ9A 4AOQA 3HGNA 1C1QA 1WCZA 1HIAB 1SLVB 2BY9X 4TPIZ 4FUDA 2Y82A 1C2KA 4JZFH 1O2OA 3SHAH 3W94A 2VWLA 4INLA 2WV4A 3A80A 4NWKA 1MCVA 4KTSA 2FI5E 1C2JA 2QC2A 2FODA 4OGXA 3D65E 3M3SA 2JH6D 3U1IB 4H6TA 2C90B 1OWDA 4D8NA 1QJ7B 1TBRH 4JYUH 1VR1H 3GY5A 1HBTH 2HLCA 2F9PA 3E90B 1SVPA 5A09A 5EXMA 1YPLH 4X6MA 1V2RT 2H6MA 1ZR0A 1LHFH 1FY1A 1YPKH 4AFSA 3PMBB 1KIGH 1HYLA 3ITIA 1O3BA 3TITA 1EP6A 1Y3XA 8KME2 1YC0A 4NIVA 1MBMA 2XBVA 4F49A 1QA0A 1BJUA 4ABBA 1S6HA 8LPRA 5T6FA 5EQQA 4MNWA 1KXCA 1ARCA 3P95A 2IN2A 1YF4A 1BB0B 3SGBE 1QL7A 2K1QA 3OSYA 2ZTYA 5J4SA 1NFUA 2XC5A 1EATA 2ZTXA 3VB6A 2BQ6B 3ESTA 2BDBA 2SFAA 2OD3B 1ELAA 1RIWB 5FX6A 3A8BA 2F83A 2QYIA 1JWTA 1UTNA 4JK6A 4JZDH 3RXUA 4X1RU 1TX6A 4ISOA 3JZ1B 2BDCA 1RFNA 4NA9H 1ZTKA 2W7SA 2OUAA 1BJVA 1V2QT 2WYJA 4M7GA 4A92A 3UWIA 1HAHH 3RXIA 1ZSLA 1XXDA 1TE0A 1AO5A 4DGJA 1IAUA 2ZCLP 1LCYA 1SGNE 4I8HA 1DT2A 4ZKRU 5DP4A 1KTSB 1LMWB 2RDLA 3SORA 5A8YA 2DE8A 3Q76A 4MTBA 1O3AA 4U30A 2P93A 3QN7A 3PYHA 1P11E 1GG6B 2ODYB 3PTBA 2F9NA 1KDQA 3RU4D 3TJUA 1B0EA 1JMOH 2C8ZB 3TPIZ 4KTCA 2A45B 3ZVDA 2UWPA 2ODQA 4BAOB 1C5XB 3UUZA 1RJXB 2PR3A 5DG6A 2FESH 3KCGH 4CRCA 1ZGIA 5SGAE 3A84A 3MWIU 3G01A 1BIOA 2A7JA 2NU2E 4YTAA 4GAWA 1AY6H 3ELAH 2FI3E 3QK1A 2GKVE 1P9UA 3SU4A 3BG4C 1O2UA 2FTLE 5H4IB 3T5FH 3ATIA 2ZU2A 1K1MA 1K1LA 3KQEA 4UD9H 3SQHE 1Z1JA 3BF6H 4MPWA 2FXRA 2ZCKP 1F5RA 1CT2E 3LONA 3SGQE 1SGDE 1T7CA 1UTOA 1FY5A 3QWCH 3ZZ4A 4ESTE 1WYKA 2WYGA 3UR6A 2A7CA 1NRNH 2QAAA 1TNHA 3IG6B 1UVPA 2Y5GA 1O2RA 1SSXA 3MNCA 2HALA 1FONA 3ZZ3A 3U8RH 4WH8A 4X2VA 1WSSH 3H7TA 3TGIE 3T27A 1ELVA 3QZQA 1DLEA 1IQLA 3TNTA 3SGAE 3SU5A 3R0FA 1D9IA 3TIUA 1NRSH 2FIRH 4B1TA 2A1DB 1YPJH 3V12A 2G51A 2AIPA 3F1SB 5A0BA 2PHBA 1RTLA 2CF8H 5A2MH 2GCHF 1W11U 3SJIA 1K9OE 2FOFA 2XRCA 1UVUH 3EA9A 1WQVH 1GJ9B 4HI3A 1SGIB 4Y79A 2GCHG 1GWAA 3M5LA 4LK4A 2VIVA 2FYQA 3RXOA 1UTLM 1CGJE 5FCRA 1O3PB 1BTYA 2ZGHA 1TALA 3ZVEA 5T6GA 4B76A 4YESB 2THFB 1VCQA 4ABHA 1O2JA 3SV9A 2UUFB 2NU3E 3C27B 3IITA 3M37A 3F68H 4B71A 1Y3UA 2GT7A 5GJ4B 1LPZB 3T26A 4Y7BA 1C1NA 1YBWA 3VFEA 3ZZ5A 3SBKA 5DJ7A 3M7QA 1AE5A 1LPGB 1QURH 2A4OA 2OCVB 5FBEA 3T62A 1L1GA 1HJ9A 2VGCC 1S6FA 2ZO3H 2QA9E 3BTHE 2FS8A 3O8DA 1GBCA 1O5DH 1MCTA 2FO9A 2QF3A 1G9IE 1J14A 1QBOA 4A1VA 4K2YA 3LC5A 3ODFA 3P8OA 4AFZA 2ZCHP 1H9LB 1UK2A 2CMYA 1MKXH 4R0IA 2QCYA 1PYTD 1SGCA 1W7GH 3PTNA 1E36B 3LH1A 1Z1IA 3EYDA 1O2YA 3M5MA 3RXHA 1EZUC 3Q3KA 1F2SE 3FP8E 2Z9LA 4HZHA 1A5GH 1MTNB 2BD7A 2Z3DA 1C1SA 2BQ7B 1BMAA 3MU4A 2FTMA 2ALPA 1AQ7A 1CU1A 1LVYA 2QXHA 2CXVA 1O34A 1GPZA 4I7YH 4A1TA 1ZPZA 3Q77A 1GGDB 1YPMH 4MPUA 4ZXYH 5L2ZH 2ZIQH 1F7ZA 2IPHA 1IQEA 2JH5D 1W0YH 3M61U 2Q6GA 1HPGA 4IW4E 5F8TA 1L0ZA 1ARBA 4NIWA 1DANH 1C2MA 1SGQE 5JPMH 5HGGA 2ZHDA 2BX3A 1FJSA 4UFEH 1AGJA 2GCTC 1P05A 2XC4A 3VB7A 1DXPA 1C1TA 4H4FA 1QFKH 1OP8A 3S7HB 2HPPH 4DT7B 1UCYE 4GHTA 2ZECA 1GJBB 1FPCH 1ZHPA 1J16A 1TGNA 3RXQA 4WMFA 2PW8H 3MO6A 1FPHH 1DWDH 1MKWH 4XBDA 1IQFA 1T8MA 1OP0A 2VU8E 1C5ZB 2ZHWH 2ZU1A 2ZTZA 2TPIZ 1NRQH 3QO6A 3T2NA 1O3KA 1W12U 4FUEA 1JRTA 2AMQA 2OXSA 4JZEH 1O3LA 1XUHA 1K1NA 4B2AA 3K6ZA 1G2MA 1K28D 1EB2A 1DLKB 1O3OA 2XW9A 4MDSA 4RKJB 2GMTB 1CHGA 1Z8JB 2OC7A 1QB1A 3B9FH 3RXLA 3MFJA 2ZPRA 2Z6BD 2W3IA 2A4RA 2NU0E 1SQOA 1BBRK 3RXEA 4NFFA 2BLOA 4NZQA 2J95A 1HLTH 3STJA 5A8ZA 2SGPE 2Z3EA 3RXRA 1TFXA 1Z6EA 2PFEA 1TWXB 1QB9A 2PUXB 2PKSB 2GVFA 1LDTT 2BD9A 4I33A 2C8WB 2PLXA 4KTUA 3P70B 1SPJA 1DUEA 1O31A 2FOHA 2Z94A 3QUMP 2F3CE 1NFXA 1LKBA 4ASHA 1AMHA 1EJAA 1WQSA 3MYWA 2VVVA 1O33A 3KGPA 3NKKA 4X6NA 5GCHG 4FU9A 1H9IE 1TPAE 1HAIH 1O2QA 2TGDA 1QR3E 3OY5U 1UK4A 4DOQA 2P95A 2BOHB 2CHAC 4INHA 1AI8H 1C2DA 3B8JA 2O8MA 1G36A 1FN8A 2QIQA 1FY8E 3RMMH 2SGDE 3M3TA 1GBIA 2BX4A 4B2CA 1G37A 1AKSB 1NY22 3AASA 1C5LH 3E0PB 1FIWA 1C2EA 1EOLA 1XM1A 4PROA 1O2NA 3TK6A 2CF9H 1VGCB 4BAQB 3UR9A 1MU6B 3E1XB 1CBWB 1SI5H 3TU7H 4GCHF 1J9CH 1YKTA 1O2WA 2GTBA 1QY6A 4YLQH 5BRRE 2STBE 1Z7KA 4GUXA 3SU6A 3DT0H 3HATH 3PLBA 4CR5A 1W14U 1MQ5A 3Q3YA 4D76A 4TY6A 1ZMLA 4IN1A 1C4V2 1NU9A 1Z8RA 1IQGA 5LH8A 2GDEH 1QHRB 3S7KB 1TYNA 3H5CB 3S9BA 3LJJA 1G3EA 1N6XA 2PV9B 2TGTA 3ZYDA 1GI3A 1A0HB 1ZJDA 1SFIA 4BTUB 3TH2H 2H9TH 1ZHRA 3F9FA 4ZKNU 2F91A 1VITG 2FOMB 2B0FA 4WF8A 1FXYA 2AGEX 3MHWU 1GCTB 4VGCC 3M35A 3BTWE 1SHYA 2G52A 4WH6A 5DP5A 1AB9B 2PTCE 2J92A 1T4VH 1IQHA 3O8RA 2O8UA 3PMJA 3HGPA 2ZA5A 1FAXA 4JYTA 4Z6AH 3MH5A 2RG3A 1J15A 1YP9A 2WUBA 2BDAA 1N8OB 1ZSKA 1HXEH 1Q31A 4Y0ZE 3SUGA 3CS7A 2BD4A 1ELFA 3H7OA 1Y3WA 1EOJA 1HRTH 1YPEH 2Q6DA 4D9RA 1PYTC 1ETTH 2GD4B 2I6SA 2G81E 3GY3A 4AGJA 4BTTB 3MNBA 1E35B 1KXBA 3GCHB 2W7UA 3QGNB 1GHZA 3UQVA 1E38B 3TJOA 3VGCC 4IBLH 3LGUA 4X2XA 1YYY1 2V3OH 3GY8A 7KMEH 1A3BH 2EI8A 4JCNA 1ACBE 1GVLA 2XYAA 2PTNA 1FY4A 1MQ6A 2VB0A 1SLWB 1GMDF 1K1PA 2VIQA 2ZDKA 2EI6A 1GI0A 3A8AA 1H8IH 1UTKA 1A2CH 2KAIB 4Q80A 1OWEA 4NA7A 1UCYK 1BHXB 2F9UA 2ZFFH 3BTEE 5IYTA 4B2BA 2FEQH 1EZXC 4LZ4B 1GBKA 1P04A 1ELBA 1GMDG 1QCPA 2FOAA 1LHEH 3T29A 2V0BA 1GDQA 1SGPE 1EJNA 2WPJS 5TCCA 1H9HE 1XUKA 2W5EA 1QA7A 2G55A 2OTVA 2P3UB 1GBMA 1SGEE 3LGVA 5DO4H 1GHAF 2TGPZ 1CA0C 3RXJA 1KTTB 1O5FH 1MD7A 2ZC9H 3PWBA 3S69A 3QTOH 3MTYA 4X1SU 3O8BA 4WMDA 1HJAB 1V2JT 2G4UA 5GIBA 3RXCA 1GHAG 5AHGH 5FPSA 1O2VA 5AF9H 4NWLA 4X6PA 5AVDA 3CENA 2AGIX 4YT7H 1CHOF 3BEUA 1WAYB 2O8WA 1HAYB 4FUFA 2VIDA 1V2OT 1WUNH 1BTPA 1NU7B 2AS9A 2ZHFH 3UOUA 1YPGH 1CHOG 1EAIA 1HAPH 2ZGJA 2PKAA 1MH0A 1YLDA 5F8ZA 2YNBA 1UVOA 3S9AA 4ZAEA 1C5VA 4K5ZA 2PSYA 3HPTB 1BTWA 2XBWA 3L33A 3SO3A 2OC8A 1XKAC 2BHGA 4GLYA 1GI8B 3AVZA 2V6NA 3FANA 1GBDA 1P03A 1S84A 5A8XA 7ESTE 4KKDA 4I8GA 1THRH 3RP2A 3KL6A 4NA8A 2G5NA 1EZSC 1GHWH 1O3DA 1W3CA 2BD8A 4X0WU 4ISLA 1GJ5H 3IWMA 4AFUA 1ZYOA 1V3XA 1BRCE 4IMZA 2JETC 3MU0A 2JH0D 1EX3A 3RC5A 1ZHMA 1ZGVA 3HKJB 4RN6A 3OX7U 1D3DB 4FVDA 3QLPH 1KXEA 3STIA 1P2OA 1BDAA 2BLQA 5DP8A 4THNH 1SG8B 4BAMB 1LVMA 2WPHS 1PPEE 2UUYA 1ZMJA 3A8CA 3P8NA 4J2YB 3K6YA 4E06H 4X8SH 1NZQH 3U8TH 3RDZA 1L4DA 3LT3A 2BY8X 1V2NT 2ZDNA 4U32A 4X6OA 1G30B 2HWLB 2A0QB 1GBFA 2FOBA 1S0QA 3BTDE 1B5GH 1C5WB 3BIUH 2BVXH 1ELDE 4DVAU 1O3FA 1O35A 2XC0A 1GL0E 2BY5X 2ZDAH 4ABIA 1K1JA 3ZVFA 2NWNA 2W26A 3BEIB 3BG4B 1DWBH 2ZFQH 4Y7AA 3JZ2B 2FI4E 1BT7A 1CO7E 5JYIA 1O5CB 2D2DA 5FPTA 3CP7A 1KXDA 1DM4B 2QXGA 3DD2H 2UWOA 2TIOA 3KQBA 1QL8A 1O37A 3MMGA 1AIXH 2P8OC 4CREA 2ANWA 3M36A 1KLJH 4ZHMU 4I32A 3OU0A 1O2IA 3SI3H 1P02A 4X2YA 2G4TA 1ID5H 5EXNA 5LGOA 3S0NA 2SNWA 3BSQA 1TNJA 4FUBA 1CA8B 5E0GA 3DA9B 4FUGA 2H9HA 1BTXA 5DPAA 1GBHA 1O2HA 2BZAA 5EOKA 4WXIA 5L2YH
chains in the Genus database with same CATH superfamily
4HTCH 4YOJA 1GJ6A 1DY9A 4X1PU 4AZ2B 1O5GH 3GOVB 3GS9A 3RXDA 2ZFTA 4F4OC 1V2LT 2ILNA 3SZNA 3QDZB 1GMCF 1YM0A 3K2UA 5C5OA 1GBJA 1YLCA 3OAAD 1AE8H 5AFYH 5C1YA 1JRSA 1OKXA 1ZMNA 4FUIA 2J34A 4ASUD 3RLYH 3RXTA 1GMCG 4ZH8A 1HDTH 3M5NA 4FUCA 3PMHB 1O3CA 1YCPM 3A89A 1G32B 3U28C 4AYVB 5CE1A 1P06A 3A82A 1TPOA 3KEEA 4FU8A 4ZHLU 1CT4E 2IOTA 1HIAA 1AFEH 3NXPA 2VGCB 1CGHA 1DITH 1EB1H 3MU5A 1XUGA 3P8GA 2QY0B 3ATWA 1FAKH 1MTWA 1GJAB 3N7OA 1GL1A 2KX4A 2KCOA 4ZMAH 1UO6A 2SGQE 1V2MT 3PO1B 4X1QU 4E7NA 5C20A 1O3NA 1P3CA 2FX6A 3F9GA 4WMEA 5L30H 2G00A 1SHHB 2EC9H 1SC8U 2RA0A 1IHTH 3KQDA 1OYTH 2C8XB 4ZROA 2BDYA 1F92A 1EPTB 1AFQC 2Z7FE 5FAHA 1XVOA 1KXAA 3VB3A 1VCWA 2PSXA 1AD8H 5JDUB 2XWAA 2ZDVH 1C5NH 1W0ZU 4OS7A 1A5IA 4NIYA 3LDXH 3HKIB 1TNGA 1A5HA 1K21H 4I86A 3A7WA 1SR5C 1PPZA 3BG8A 5F53A 3SV6A 1MU8B 4WVPE 5DN6D 1IQIA 4HFPB 2G8TA 2QGRA 3RXAA 3UPEA 2GCTB 1HNEE 3NCLA 1T8LA 4TY7A 1S85A 1PQ8A 2GV6A 5E2PA 1AWFH 2O9QA 1E1RD 1F0RA 3EA7A 4D7FA 1EP5A 4IC6A 1SOZA 2SGEE 4DW2U 5I46H 1X7AC 1MMJN 2Y5FA 3TLOA 5EU8A 3F2HA 4ABFA 1O39A 4CRBA 1JIMA 2AFQB 1V2PT 3E0NB 5CHAC 4MQAA 1MZDA 2BY7X 1FX0B 2PWXA 1MBQA 3EGKH 1IHSH 3GCNA 3BN9A 1BBRH 4AORA 1EQ9A 4CRDA 3SU2A 1P12E 2FP7B 1ZTLA 4U01A 3GDSA 2A5KA 3W1EA 4DJZB 4WJG2 2PUQH 3I78A 2BVSH 2EQNA 3RLWH 2RCEA 4NCYA 3LJOA 5LPEA 2QXJA 1P2KA 4MNXA 1HJ8A 1C1MA 2KCPA 1NFYA 1UHBB 1ZRKA 1LKAA 1O5AB 1NN6A 2AMPA 2AGGX 1OWJA 1E0FD 3A7YA 3KHVA 3RXVA 1UK3A 1Q3XA 1AZZA 2HVYB 1THPB 4NIXA 6CHAB 4E7RG 1OSSA 1TONA 2O8LA 1HAVB 3FP6E 1TGCA 3E8LA 5HYOA 2ZZUH 4A5TS 1O3IA 3E16B 2WPMS 1P3EA 2WPIS 1GVKB 4OS6A 1DWCH 2LNCA 3A87A 4JMYA 3NUMA 2R2MB 2ZNKH 1O2SA 4JZIA 5HIZA 1TX7A 2BD3A 4TSFD 2R2WU 4BAKB 1NTPA 2VVCA 1N6YA 2P3FH 4B74A 2ZKSA 2VIPA 1GBAA 2FLBH 1MTNC 1C5PA 4TPYA 4CBNA 3MU1A 2K8IA 3RM0H 2FPZA 1UTJA 5C2ZA 4D9QA 5ETXA 1MTUA 4I8KA 3RC4A 2OBQA 4I31A 2VIWA 1C2GA 1FLEE 2QF5A 4Z0KA 1H8ED 4DT4A 1AVGH 2FMJA 1Y5BT 4INKA 3KNXA 1A7SA 1C5MD 2OP9A 1SLXB 1YLNA 5DK1A 1RD3B 3LU9B 2WUCA 4WWYA 3VPKA 1C4U2 2BYAX 3SV2H 4A1XA 5GCHF 3LC3A 2XCFA 2YMSB 2FZZA 4K1TA 1FIZA 4JK5A 2R0LA 2GZ7A 1ANEA 3A7ZA 3FZZA 1CT0E 1O2TA 3GY2A 4B75A 2AEIH 4ZCNA 1INCA 2ZP0H 1C5YB 3D49H 3W95A 1LTOA 1OP2A 4IMQA 2BMGB 3LPRA 1SQTA 3A88A 1WBGB 2OBOA 4BXWA 3B23B 3WY8A 4OS5A 4DURA 1E37B 1YGCH 2SGFE 4O97A 3SNDA 4QT8C 3SV8A 9LPRA 1THSH 2P59A 1W7XH 1GBLA 1Z8GA 2CN0H 3A86A 3ATKA 1JXPA 2ZGXH 3BTME 4YM9A 1O32A 4Y8XA 3FAOA 5FHTA 2PGQB 1C9TA 3TK5A 3AAUA 4A6LA 2GGVB 2HRVA 1SGFA 5C1UA 5HM9A 2HNTE 4AGKA 3EAJA 4AB8A 2NU4E 4MNVA 2J38A 1DSUA 3ZZ7A 4ZKSU 1K0HA 2FOEA 1HV7A 4K69A 1OX1A 4KELA 2IPQX 1EKBB 1MTSA 1A61H 1S0RA 1RRKA 5GPIB 3GYMA 2Z3CA 1EPTA 1HAZB 1J8AA 2G5VA 4VGCB 4K60A 3BV9B 1OS8A 1KLTA 1ZRBA 1QRXA 1GI2A 1DS2E 1P57B 4CBOA 3LGYA 3BTKE 3BTTE 3PV4A 3NZIA 2A5AA 2BLVA 1NROH 1QRZA 1IQNA 1L4ZA 4Q63A 3A7TA 1C9PA 4Y8YA 4Y11E 5DP7A 1VITF 1FY3A 1WTHD 1Y8TA 4XSKU 5IK2D 3SUDA 3CS0A 1UCYH 2J4IA 1O5BB 3DHKH 1HGTH 3S9CA 1P2JA 4CRFA 2Z9GA 1KY9A 5K7RA 5DSFA 3ZZ8A 1V2VT 2FX4A 2QXIA 4ABDA 1LVOA 4JZ1A 1BZXE 4Q2KA 3VGCB 4O3TA 2BOKA 3N7EA 1BRAA 3RC6A 3VB4A 4RSPA 2BB4A 4SGBE 1UVSH 2OC1A 2AYWA 1WU1A 3A8DA 1DWEH 2GP9B 4MG3A 1VJAU 4KP0A 1ETSH 1G3BA 2KM0A 4R8TB 3TJNA 4YO9A 3GCTF 1AVWA 1D4PB 1WTGH 5EW1H 2Z9KA 1A4WH 2LP6A 2J98B 1AZ8A 2QN5T 4TWYA 1RGQA 3RXKA 1CQQA 1AUTC 3GDVA 3BTQE 2R0KA 4FXGH 2WPDD 1QJ1B 3GCTG 2L74A 5DKMA 1GJ8B 4CHAB 2QE7D 1BRUP 1CA0B 1O38A 1O3GA 3NK8A 3FOAA 1ZPCA 4X2WA 2OQ5A 1DE7H 1V2WT 4X8VH 1KDQB 1OOKB 3AW1A 4WXVA 4BOHA 2XOKD 2ZU4A 2P3TB 1YPHC 3DUXH 2EA3A 4IN2A 4O03A 1UTQA 3PV2A 3FZDA 1DY8A 1B7XB 3LGIA 2FYRA 1GHBF 2ZU3A 1V6DA 4U2WA 4I8LA 1P09A 5G4BA 2W3KA 1FMGA 4ABGA 5E0HA 1FDPA 3F2FA 3ATMA 1HCGA 4ISNA 3TGJE 1UJ1A 3OY6U 1FUJA 1GHBG 3V13A 2J5UA 5B6LA 5BPEA 1MAYA 3URCA 2BY6X 2HLDD 1XUFA 2A7HA 2FM2A 4X8TH 2ZDLA 4ABAA 2F9OA 2CJIA 1WXRA 4NFEA 3UTUH 2AERH 1LQDB 3OFND 1PPBH 1AWHB 2BM2A 1P0SH 1CE5A 3U9AH 1NFWA 2VINA 3I29A 5C0UA 1PQ7A 3GCHC 1TLDA 1Z71A 5DP6A 2JETB 1O5EH 2ALVA 1HAOH 4O3UA 4GHQA 1JOUB 2I6QA 1C2HA 1GJ7B 3GY7A 3BIVH 4DG4A 1ETRH 4XE4A 1BA8B 2BLWA 3SNCA 3GY6A 1W8BH 1SL3A 3HK6B 5ESTE 1GI6A 2EY4C 3UQOA 1A1RA 1EXFA 1SB1H 1AUJA 1YPHE 4FUHA 1NS3A 1C1OA 4UEHH 2ZGBH 2J9NA 1OXGA 2OC0A 3ZIAD 1XKBC 1ZJKA 2BTCE 3DFLA 3M5OA 1AKSA 1K1OA 1N1LA 1BCUH 2EI7A 5JBCS 1L2EA 1ANDA 1HAXB 5C94A 1VCPA 5DP3A 1SGRE 1AHTH 3V7TA 1DICA 5AFZH 1C1WH 4B6FA 1PPHE 2M5TA 2ZI2H 1IQJA 1QJ6B 3P6ZB 5HXFA 2J94A 1ZSJA 3SUFA 8ESTE 1GCDA 2ZQ1A 1NESE 1S5SA 3MH7A 3TNSA 2Y5HA 3MNXA 4YXWD 4P00A 4XOJA 1D3PB 3UWJH 2RA3A 2PGBB 5C0TA 2ZG0H 4UFGH 1HB0B 2ZGCA 2ZWLH 1NM6A 2BD2A 3LIWA 7GCHF 4Y76A 5GXPA 1L1JA 1HJAC 1OYQA 1KSNA 2D26C 3RU4T 3MU8A 5KECA 3U98H 1BQYA 4DCDA 1Q2WA 3OEED 3SNBA 1FZZA 7GCHG 5JB9S 1C5UA 2ASUB 1CGIE 2BDGA 1RTFB 3ZZCA 5E0JA 1DVAH 1TMBH 1QNJA 1LO6A 1DXWA 1O3MA 2Q6FA 1GBEA 2DUCA 4BTIB 3P17H 2P8OB 1RS0A 1YCPK 5L6NH 2FOCA 1ABIH 4RKOB 3SU3A 4YZUA 2VWOA 1KLIH 3P92A 4CR9A 1ANBA 3ZVBA 4K8YA 2H1UA 4DIHH 1Z6JH 2VWNA 4ISHH 4AC9A 4IC5A 3OTJE 2ESTE 4Q7XA 4NGAH 4BXSA 1FNIA 4ACAA 1LQEA 4J1YA 2QF0A 1LHDH 3TH4H 2VH0A 1O2PA 5JBAS 1TBQH 4UFDH 5CMXH 3K65B 3MO9A 3D23A 4YOGA 4H6SB 2BDHA 1TRNA 3E6PH 3UFAA 1ABJH 1QBNA 2WINI 2H5CA 1EAWA 1ELEE 2Y81A 1DDJA 2XXLA 5EPYA 4UONA 2C93B 3T28A 3ZZAA 4ZHAA 2D1JA 3F9EA 1OWKA 5EPNA 1GHVH 1ZOMA 3RUOA 1RIWC 1NO9H 3M3VA 4XDEA 2R3UA 1XX9A 2GJGA 2BD5A 4NSYA 1ESTA 3PMAB 1SBWA 1TRMA 1QL9A 1TX8A 2B8OH 2KAIA 4YT6H 1QBVH 2XBYA 1SGTA 1BBRE 5JBTA 1DOJA 1EJMA 1QQ4A 5C67A 3URDA 2A2QH 1T31A 3FFGA 3K9XB 3LH3A 3NWUA 1W0KD 3ZZDA 3FN8A 4GVUA 3VEQB 3M7TA 2CV3A 2HPQH 3F2GA 2A32A 1EAUA 4Q7YA 1L1NA 5A0AE 3SU0A 4MVNA 3ZYEA 1GI7B 1FN6A 1MZAA 2J2UA 1ESAA 1PFXC 3RXSA 1TOCB 2BVRH 3QGJA 1P2IA 1MTVA 1F0TA 1OWIA 3ODDA 3EDXB 5I25A 4P02A 3U8OH 4DIIH 4I8JA 1UMAH 1AFQB 2A2XH 1GG6C 4AG2A 2H5DA 2A31A 3GICB 4OS2A 4O9VA 1PPCE 3SW2B 1C5TA 3WW7A 2EEKA 2RFKC 1TGTA 1SGFG 1H1BA 1VITH 2GV7A 4B73A 1T32A 1ESBA 1PPFE 2UUJB 2UWLA 1GDUA 2YMSD 1Y59T 3DSGA 5EXLA 1HXFH 1K1IA 1SMFE 1W2KH 4AFQA 1V2TT 4Y6DA 1O0DH 1GI9B 5E2OA 1DUAA 1OWHA 5IDKA 3BEFB 1O3HA 3MH6A 3MOCA 2A5IA 2XNIA 1GI1A 3OYPA 3HK3B 4RT1A 4MNYA 2C4FH 3RXFA 3VXEH 3PWCA 1MUEB 3Q00A 5CHAB 2Y80A 1KYNA 5DP9A 3GISB 4X1NU 2JKHA 4OS4A 5FBIA 1GHXH 1ELTA 1HAGE 1C2FA 2Z9IA 1IQMA 1LHCH 2HNTF 2FLRH 1AU8A 5T3HA 1H8DH 1A3EH 3VXFH 2Z9JA 3ZVGA 3OEHD 3RMNH 3ENSB 3SJKA 1EASA 3EQ0H 1C2LA 1TGBA 2C3SA 3EA8A 1FV9A 3KYFA 2F9VA 4ZKOU 5LPFA 1C1UH 2JJ1D 3BTGE 1QIXB 4YLUA 2AH4X 5KGOA 2ZPSA 3DFJA 4GSOA 1TMUH 1F0SA 1GBBA 4FUJA 1TNKA 3SNEA 5GDSH 3TH3H 4ABEA 3UIRA 5TJXA 1TB6H 1ZZZA 4ZXXH 1Y3YA 1ORFA 1YWUA 5JBBS 5FCKA 3MNSA 2HGTH 1UVTH 1W13U 3PO1C 2B5TB 3TVJB 3A7VA 4FETA 4Y71A 3UREA 5LPRA 1O3JA 2K0QA 1B0FA 4E05H 1FI8A 1S82A 2YOLA 3SN8A 2BQWB 1S6LA 3C1KA 2V35A 1HUTH 1EPTC 1C1RA 1NPMA 1O36A 1GJDB 1IQKA 1XMNB 2HVXA 1O2KA 1ZTJA 1TMTH 2TGAA 3L3TA 1S81A 2VH6A 4XBCA 2UUKB 2H9EH 3QX5H 1GI4A 2A4GA 5EG4A 3SJ8A 2BZ6H 2OLGA 3E3TA 2BXUH 3RMOH 1NRPH 2Y7XA 1XUJA 1V2KT 1BMMH 2FDAA 1GDNA 4NZLA 4TT3D 3RMLH 1HFDA 3TGKE 3PB1E 2VVUA 2WV9A 1T4UH 5EGMA 3VB5A 5C3NA 3KF2A 4BANB 3KIDU 4FVBA 1TPSA 1D3TB 1JBUH 2OINA 1G2LA 1P8VC 2BXTH 3SHCH 3RXPA 1AVXA 3A85A 2GT8A 1BUIA 2ZU5A 2WPKS 2H2ZA 5K0HA 1P10A 3R3GB 1C5RA 4CRGA 1GVZA 3A81A 4DY7B 3U1JB 4CRAA 2HNTC 5F03A 1O2XA 1TOMH 3E91A 1P2NA 1G3DA 1GGDC 3GCOA 1TGSZ 2ZF0H 2ANKH 3SJ9A 3A7XA 1CSOE 2XWBI 3I77A 5E8EH 3ZV8A 3F0OA 2SNVA 2CHAB 1FQ3A 2FWWA 1GI5A 2GZ8A 1TQ7B 4K1SA 4Y0YE 3FVFB 3QZRA 1MKXK 2VBCA 2B9LA 2ZHEH 1DPOA 3A83A 3UNSA 4HG6A 2STAE 1P9SA 2V3HH 1E34B 4MPXA 4AX9H 1A0LA 4FU7A 3RXBA 3SI4H 4K1EA 2LPRA 4GPGA 1F5KU 1SLUB 4AYYB 4MPVA 3RM2H 1TPPA 6CHAC 2M2AA 5EODA 2AMDA 3AW0A 1TIOA 1VZQH 1QRWA 3T25A 3GDUA 3D62A 1VJ9U 2Y7ZA 2W6JD 1V2UT 4XFQA 1T8OA 1H4WA 5EJ1A 3F6UH 1XVMA 1MD8A 2ODPA 3V0XA 2CGAA 8GCHF 3MO3A 1O2ZA 4LOYH 1V2ST 1WOFA 4BAHB 3LGTA 3VG8A 1DFPA 4OGYA 5FPYA 4CH2B 4H42U 1Z8IB 2SGAA 1RTKA 2ANYA 8GCHG 2F9BH 2QV1A 3F9HA 3RXGA 2GMTC 4ISIH 1QQUA 1MKWK 2PKAB 2NU1E 1S83A 5A0CA 1EAXA 1QGFA 1W0JD 3NPSA 5HM2A 3SOSA 4NSVA 1GJCB 4XBBA 2XTTB 3PM3A 4IGDA 1IOEA 2ZFRH 4IS5A 3ZVCA 2Y6TA 2PKSC 2ZFSA 4M9FA 3MH4A 5ESBA 2D8WA 2R9PA 3UB0A 1K22H 2YMSC 2ANMH 2VIOA 3ZVAA 4ZUHA 1O3EA 4LXBH 4Q7ZA 1TNIA 1UTPA 1ELCA 3QTVH 1TA6A 3ZV9A 1XUIA 2P16A 5EQRA 9ESTA 1CVWH 1O30A 2FS9A 3RU4E 1EZQA 1TQ0B 3M7UA 4UDWH 1G3CA 2VWMA 1GHYH 2WPLS 1A46H 1P01A 1P2MA 3ZZ6A 4MLFB 1SOTA 2LELA 3CNRA 4TYDA 1Y3VA 1U6QA 3AAVA 1W10U 1C4Y2 3SUEA 1GBTA 4BNRA 2DE9A 4GCHG 1J17T 5GWZA 3UY9A 2ZDMA 3GY4A 1P2QA 1BTZA 5EW2H 1D3QB 4CH8B 1TNLA 1ZPBA 4Y10E 4JYVH 2BDIA 2GX4A 1ZLRA 2GZ9A 1PJPA 1WV7H 3FP7E 6LPRA 1T8NA 1BTHH 2Q1JA 2ZFPH 1VGCC 4WY3A 4AG1A 1LHGH 4K8BA 1C5OH 1CBWC 1SFQB 5FXLA 1O2GH 6GCHF 1F5LA 3LKWA 1BMLA 1JIRA 1C1VH 2GDDA 5C1XA 4AB9A 5F6MA 1ANCA 1UHBA 1LVBA 1LPKB 5J4QA 3UNQA 2FOGA 1BHXF 5B6OA 2XCNA 1DSTA 3PRDA 2HOBA 2O8TA 4K3JA 3KN2A 4D7GA 6GCHG 3BTFE 1BTUA 1QB6A 1C5SA 1HAVA 1SGYE 3EE0B 1NT1A 3P8FA 5F8XA 3UOPA 1PQ5A 5JB8S 1TABE 3KQCA 1PQAA 1OPHB 3PLKA 2C8YB 1MAXA 1Y5AT 3MI4A 3SU1A 4A7IB 1D6RA 4AN7A 5HIYA 4LZ1H 4X8UH 1TRYA 1UTMA 1TA2A 1NC6A 2OQUA 1WDIA 2ZQ2A 1BRBE 1AN1E 1NRRH 2ZHQH 4UFFH 1GMHF 5HMAA 4Y8ZA 3SJOA 3PROA 1GCTC 3LOXA 5FX5A 1O2LA 3GYLB 1EUFA 1AB9C 2XBXA 3KQ5A 2TBSA 3FO8D 5T6DA 1PPGE 1K2I1 1GJ4H 2P94A 5C5NA 5EQSA 1BOQA 3TK9A 1GMHG 5PTPA 1XXFA 5ABWA 2AIQA 2R3YA 1ELGA 1N8OC 4YOIA 4NG9H 1RXPA 3L6PA 1Y5UT 2VJ1A 1C1PA 3Q3XA 3SNAA 2ZEBA 3ZZBA 3RXMA 3PLPA 3UNRA 1A0JA 1QTFA 1C2IA 4TWWA 3SV7A 1D6WA 3U69H 7LPRA 3N7DA 1MABB 4SGAE 1BITA 1KXFA 3TJVA 4CHAC 3O8CA 6ESTA 1F0UA 1TAWA 1YCPH 2WSSD 2ULLA 2B7DH 2WV5A 2IJOB 3V3MA 2JJ2D 2YNAA 2VNTA 4OS1A 4UE7H 1O2MA 2ZPQA 1C5QA 3LGWA 1DX5M 1M9UA 2A4QA 4KGAA 1BMNH 1NBME 1SQAA 4HGCA 5TCAA 4ABJA 3SQEE 2V3MA 1TBZH 2TRMA 3ATLA 5DGJA 3ZZ9A 2XNDD 4AOQA 3HGNA 1C1QA 1WCZA 1HIAB 1SLVB 2BY9X 4TPIZ 4FUDA 2Y82A 1C2KA 1H8HD 4JZFH 1O2OA 3SHAH 3W94A 2VWLA 4INLA 2WV4A 2QF4A 3A80A 4NWKA 1MCVA 4KTSA 2FI5E 3PV5A 1C2JA 2QC2A 2FODA 4OGXA 3D65E 3M3SA 2JH6D 3U1IB 4H6TA 2C90B 1OWDA 4D8NA 1QJ7B 1TBRH 4JYUH 1VR1H 3GY5A 1HBTH 2HLCA 2F9PA 4RT0A 3E90B 1SVPA 5A09A 5EXMA 1YPLH 4X6MA 1V2RT 2H6MA 1ZR0A 5GNDA 1LHFH 1FY1A 1YPKH 4AFSA 3PMBB 1KIGH 1HYLA 3ITIA 1O3BA 3TITA 1EP6A 1Y3XA 8KME2 1YC0A 4NIVA 1MBMA 2XBVA 4F49A 1QA0A 1BJUA 4ABBA 1S6HA 8LPRA 5T6FA 2CK3D 5EQQA 4MNWA 1KXCA 1ARCA 3P95A 2IN2A 2JIZD 1YF4A 1BB0B 3SGBE 1QL7A 2K1QA 3OSYA 2ZTYA 5J4SA 1NFUA 2XC5A 1EATA 2ZTXA 3VB6A 2BQ6B 3ESTA 2BDBA 2SFAA 2OD3B 1ELAA 1RIWB 5FX6A 3A8BA 5C17A 2F83A 2QYIA 1JWTA 1UTNA 4JK6A 4JZDH 3RXUA 4X1RU 1TX6A 4ISOA 3JZ1B 2WZQA 2BDCA 1RFNA 4NA9H 1ZTKA 2J98A 2W7SA 2OUAA 1BJVA 1V2QT 2WYJA 4M7GA 4A92A 3UWIA 1HAHH 3RXIA 1ZSLA 1XXDA 1TE0A 1AO5A 4DGJA 1IAUA 2ZCLP 1LCYA 1SGNE 4I8HA 1DT2A 4ZKRU 5DP4A 1KTSB 1LMWB 2RDLA 3SORA 5A8YA 2DE8A 3Q76A 3N99A 4MTBA 1O3AA 4U30A 2P93A 3QN7A 3PYHA 1P11E 1GG6B 2ODYB 3PTBA 2F9NA 1KDQA 3RU4D 3TJUA 4RI0A 1B0EA 1JMOH 2C8ZB 3TPIZ 4KTCA 2A45B 3ZVDA 2UWPA 2ODQA 4BAOB 1C5XB 3UUZA 1RJXB 2PR3A 5DG6A 2FESH 3KCGH 4CRCA 1ZGIA 5SGAE 3A84A 3MWIU 3G01A 1BIOA 2A7JA 2NU2E 4YTAA 4GAWA 1AY6H 3ELAH 2FI3E 3QK1A 2GKVE 1P9UA 3SU4A 3BG4C 1O2UA 2FTLE 5H4IB 3T5FH 3ATIA 2ZU2A 1K1MA 1K1LA 3KQEA 4UD9H 3SQHE 1Z1JA 3BF6H 4MPWA 2FXRA 2ZCKP 1F5RA 1CT2E 4F55A 3LONA 4XD7D 3SGQE 1SGDE 1T7CA 1UTOA 1FY5A 3QWCH 3ZZ4A 4ESTE 1WYKA 2WYGA 3UR6A 5CDFE 2A7CA 1NRNH 2QAAA 1TNHA 3IG6B 1UVPA 2Y5GA 1BMFD 1O2RA 1SSXA 3MNCA 2HALA 1FONA 3ZZ3A 3U8RH 4WH8A 4X2VA 1WSSH 1E1QD 3H7TA 3TGIE 3T27A 5HKKD 1ELVA 3QZQA 1DLEA 1IQLA 3TNTA 3SGAE 3SU5A 3F3BA 3R0FA 5EJLA 1D9IA 3TIUA 1NRSH 2FIRH 1EFRD 4B1TA 2A1DB 1YPJH 3V12A 2G51A 2AIPA 3F1SB 5A0BA 2PHBA 1RTLA 2CF8H 5A2MH 2GCHF 1W11U 3SJIA 1K9OE 2FOFA 2XRCA 1UVUH 3EA9A 1WQVH 1GJ9B 4HI3A 2W6ID 1SGIB 4Y79A 1UW7A 2GCHG 1GWAA 3M5LA 4LK4A 2VIVA 5T1VA 2FYQA 2KR7A 3RXOA 2JDID 5KEDA 1UTLM 1CGJE 5FCRA 1O3PB 1BTYA 2ZGHA 1TALA 5FL7D 2AHME 3ZVEA 5T6GA 4B76A 4YESB 2THFB 1VCQA 4ABHA 1O2JA 3SV9A 2UUFB 2NU3E 3C27B 3IITA 3M37A 3F68H 4B71A 1Y3UA 2GT7A 5GJ4B 1LPZB 3T26A 4Y7BA 3SZEA 1C1NA 1YBWA 3VFEA 3ZZ5A 3SBKA 5DJ7A 3M7QA 1AE5A 1LPGB 1QURH 2A4OA 2OCVB 5FBEA 3T62A 1L1GA 1HJ9A 2VGCC 1S6FA 2ZO3H 2QA9E 3BTHE 2FS8A 3O8DA 1GBCA 1O5DH 1MCTA 2FO9A 2QF3A 1G9IE 1J14A 1QBOA 4A1VA 4K2YA 3F0PA 3LC5A 3ODFA 3P8OA 4AFZA 2ZCHP 1H9LB 1UK2A 2CMYA 3WWFA 1NBMD 1MKXH 4R0IA 2QCYA 1PYTD 1SGCA 1W7GH 3PTNA 1E36B 3LH1A 1Z1IA 3EYDA 1O2YA 3M5MA 4OM9A 1YY3A 1EZUC 3RXHA 3Q3KA 2V7QD 1F2SE 3FP8E 3DSOA 2Z9LA 4HZHA 1A5GH 1MTNB 2BD7A 2Z3DA 1C1SA 2BQ7B 1BMAA 3MU4A 2FTMA 2ALPA 1AQ7A 1CU1A 1LVYA 2QXHA 4Z1MD 2CXVA 1O34A 1GPZA 4I7YH 4A1TA 1ZPZA 3Q77A 1GGDB 1YPMH 4MPUA 4ZXYH 5L2ZH 1KMHB 2ZIQH 1F7ZA 2IPHA 1IQEA 2JH5D 1W0YH 3M61U 2Q6GA 1HPGA 4IW4E 5F8TA 1L0ZA 1ARBA 4NIWA 1DANH 1C2MA 1SGQE 5JPMH 5HGGA 2ZHDA 2BX3A 1FJSA 2KZ4A 1AGJA 2GCTC 4UFEH 1P05A 2XC4A 3VB7A 1DXPA 1C1TA 4H4FA 1QFKH 1OP8A 3S7HB 2HPPH 4DT7B 1UCYE 4GHTA 2ZECA 5CHBA 5EIYA 1GJBB 1FPCH 1ZHPA 3DCLA 1J16A 1TGNA 3RXQA 4WMFA 2PW8H 3MO6A 1FPHH 1DWDH 1MKWH 4XBDA 2KFWA 1IQFA 1T8MA 1OP0A 2VU8E 1C5ZB 2ZHWH 2ZU1A 2ZTZA 2TPIZ 1NRQH 3QO6A 3T2NA 1O3KA 1W12U 4FUEA 1JRTA 2AMQA 2OXSA 4JZEH 4B6EA 1O3LA 1XUHA 1K1NA 4B2AA 3K6ZA 1G2MA 1K28D 1EB2A 1DLKB 1O3OA 2XW9A 4MDSA 4RKJB 2GMTB 1CHGA 1Z8JB 3SYJA 2OC7A 1QB1A 3B9FH 3RXLA 3MFJA 2ZPRA 2Z6BD 2W3IA 2A4RA 2NU0E 1SQOA 1BBRK 3RXEA 2PP6A 4NFFA 2BLOA 4NZQA 2J95A 1HLTH 3STJA 5A8ZA 2SGPE 2Z3EA 3RXRA 1TFXA 1Z6EA 2L6OA 2PFEA 1TWXB 1QB9A 2PUXB 2PKSB 2GVFA 1LDTT 2BD9A 4I33A 2C8WB 2PLXA 4KTUA 3P70B 1SPJA 1DUEA 1O31A 2FOHA 2Z94A 3QUMP 2F3CE 1NFXA 1LKBA 4ASHA 1AMHA 1EJAA 1WQSA 3MYWA 2VVVA 1O33A 3KGPA 3NKKA 4X6NA 5GCHG 4FU9A 1H9IE 1TPAE 1HAIH 1O2QA 2TGDA 1QR3E 3OY5U 1UK4A 3H09A 4DOQA 2P95A 3OE7D 2BOHB 2CHAC 4INHA 2IJD1 2OK5A 1AI8H 1C2DA 3B8JA 2O8MA 1G36A 1FN8A 2QIQA 1FY8E 3RMMH 2SGDE 3M3TA 1GBIA 2BX4A 4B2CA 1G37A 1AKSB 1NY22 3AASA 1C5LH 3E0PB 1FIWA 1C2EA 1EOLA 3EE7A 3PRBA 1XM1A 3FKSD 4PROA 1O2NA 3TK6A 2CF9H 1VGCB 4BAQB 3UR9A 1MU6B 3E1XB 1CBWB 1SI5H 3TU7H 4GCHF 1J9CH 1YKTA 1O2WA 2GTBA 1QY6A 4YLQH 5BRRE 2KCAA 2STBE 1Z7KA 4GUXA 4FOUC 3SU6A 3DT0H 3HATH 3PLBA 4CR5A 1W14U 1MQ5A 3Q3YA 4D76A 4TY6A 1ZMLA 4IN1A 1C4V2 1NU9A 1Z8RA 1IQGA 5LH8A 2GDEH 1QHRB 3S7KB 1TYNA 3H5CB 3S9BA 3LJJA 1G3EA 1N6XA 2PV9B 2TGTA 3ZYDA 1GI3A 1A0HB 1ZJDA 1SFIA 2F4LA 4BTUB 3TH2H 2H9TH 1ZHRA 3F9FA 4ZKNU 2F91A 1VITG 2FOMB 2B0FA 4WF8A 1FXYA 2AGEX 3MHWU 1GCTB 4VGCC 3M35A 3BTWE 1SHYA 2G52A 4WH6A 5DP5A 1AB9B 2PTCE 2J92A 1T4VH 1IQHA 3O8RA 2O8UA 3PMJA 3HGPA 2ZA5A 1FAXA 4JYTA 4Z6AH 3MH5A 2RG3A 1J15A 1YP9A 2WUBA 2BDAA 1N8OB 1ZSKA 1HXEH 1Q31A 4Y0ZE 3SUGA 2F43B 3CS7A 2BD4A 1ELFA 3H7OA 1Y3WA 1EOJA 1HRTH 1YPEH 2Q6DA 4D9RA 1PYTC 1ETTH 4F48B 2GD4B 2I6SA 2G81E 3GY3A 4AGJA 4BTTB 3MNBA 1E35B 1KXBA 3GCHB 2W7UA 3QGNB 1GHZA 3UQVA 1E38B 4XRNA 1QZ8A 3TJOA 3VGCC 4IBLH 3LGUA 4X2XA 1YYY1 2KCYA 2V3OH 3GY8A 7KMEH 1A3BH 2EI8A 4JCNA 1ACBE 1GVLA 2XYAA 2PTNA 1FY4A 1MQ6A 2VB0A 1SLWB 1GMDF 1K1PA 2VIQA 2ZDKA 2EI6A 1GI0A 3A8AA 1H8IH 1UTKA 1A2CH 2KAIB 1E79D 4Q80A 1OWEA 4NA7A 1UCYK 1BHXB 2F9UA 2ZFFH 3BTEE 5IYTA 4B2BA 2FEQH 1EZXC 4LZ4B 1GBKA 1P04A 1ELBA 1GMDG 1QCPA 2FOAA 1LHEH 3T29A 2V0BA 1GDQA 1SGPE 1EJNA 2WPJS 5TCCA 1H9HE 1XUKA 2W5EA 1QA7A 2G55A 2OTVA 2P3UB 2WHXA 1GBMA 1SGEE 3LGVA 5DO4H 1GHAF 2TGPZ 1CA0C 3RXJA 1KTTB 1O5FH 1MD7A 2J97A 2ZC9H 3PWBA 3S69A 3QTOH 3MTYA 4X1SU 3O8BA 4WMDA 1HJAB 1V2JT 2G4UA 5GIBA 3RXCA 1GHAG 2RDEA 5AHGH 5FPSA 1VKYA 1O2VA 5AF9H 1OHHD 4NWLA 4X6PA 5AVDA 3CENA 2AGIX 4YT7H 1CHOF 3BEUA 1WAYB 2O8WA 1HAYB 4FUFA 2VIDA 1V2OT 1WUNH 1BTPA 1NU7B 2AS9A 2ZHFH 3UOUA 1YPGH 1CHOG 1EAIA 1HAPH 2ZGJA 2PKAA 1MH0A 1YLDA 5F8ZA 2YNBA 1UVOA 3S9AA 4ZAEA 3WWBA 1C5VA 4K5ZA 2PSYA 3HPTB 1BTWA 2XBWA 3L33A 3SO3A 2OC8A 1XKAC 2BHGA 4GLYA 1GI8B 1COWD 3AVZA 2V6NA 3FANA 1GBDA 1P03A 1S84A 5A8XA 7ESTE 4KKDA 4I8GA 1THRH 3RP2A 3KL6A 3NRLA 2G5NA 4NA8A 1EZSC 1GHWH 1O3DA 1W3CA 2BD8A 4X0WU 4ISLA 1GJ5H 3IWMA 4AFUA 1ZYOA 1V3XA 1BRCE 4IMZA 2JETC 3MU0A 2JH0D 1EX3A 3RC5A 1ZHMA 1ZGVA 3HKJB 4RN6A 5EJZA 3OX7U 1D3DB 4FVDA 3QLPH 1KXEA 3STIA 1P2OA 1BDAA 2BLQA 5DP8A 4THNH 1SG8B 4BAMB 1LVMA 2WPHS 1PPEE 2UUYA 1ZMJA 3A8CA 3P8NA 4J2YB 3K6YA 3MQKC 4E06H 4X8SH 1NZQH 3U8TH 3RDZA 1L4DA 3LT3A 2BY8X 3DSPA 1V2NT 2ZDNA 3KYGA 4U32A 4X6OA 1G30B 2HWLB 2A0QB 1GBFA 2FOBA 1S0QA 3BTDE 1B5GH 1C5WB 3BIUH 2BVXH 1ELDE 4DVAU 1O3FA 1O35A 2XC0A 1GL0E 2BY5X 2ZDAH 4ABIA 3UAIC 3OTPA 1K1JA 3ZVFA 2NWNA 2W26A 3BEIB 3BG4B 1DWBH 2ZFQH 4Y7AA 4Q4LA 3JZ2B 2FI4E 1BT7A 1CO7E 3AK5A 1SQRA 5JYIA 1O5CB 2D2DA 5FPTA 3CP7A 1KXDA 1DM4B 2QXGA 3DD2H 2UWOA 2TIOA 3KQBA 1QL8A 1O37A 3MMGA 1AIXH 2P8OC 4CREA 2ANWA 3M36A 1KLJH 4ZHMU 4I32A 3OU0A 1O2IA 3SI3H 1P02A 4X2YA 2G4TA 1ID5H 5EXNA 5LGOA 3S0NA 2SNWA 3BSQA 1TNJA 4FUBA 1CA8B 5E0GA 3DA9B 4ACBA 4FUGA 2H9HA 1SKYE 1BTXA 5DPAA 1GBHA 1O2HA 2BZAA 5EOKA 4WXIA 5L2YH
chains in the Genus database with same CATH topology
4HTCH 4YOJA 1GJ6A 1DY9A 4X1PU 4AZ2B 1O5GH 3GOVB 3RXDA 2ZFTA 4F4OC 1V2LT 2ILNA 3SZNA 3QDZB 1GMCF 1YM0A 3K2UA 5C5OA 1GBJA 1YLCA 1AE8H 5AFYH 5C1YA 1JRSA 1OKXA 1ZMNA 4FUIA 2J34A 3RLYH 3RXTA 1GMCG 4ZH8A 1HDTH 3M5NA 4FUCA 3PMHB 1O3CA 1YCPM 3A89A 1G32B 4AYVB 5CE1A 1P06A 3A82A 1TPOA 3KEEA 4FU8A 4ZHLU 1CT4E 2IOTA 1HIAA 1AFEH 3NXPA 2VGCB 1CGHA 1DITH 1EB1H 3MU5A 1XUGA 3P8GA 2QY0B 3ATWA 1FAKH 1MTWA 1GJAB 3N7OA 1GL1A 4ZMAH 1UO6A 2SGQE 1V2MT 3PO1B 4X1QU 4E7NA 5C20A 1O3NA 1P3CA 2FX6A 3F9GA 4WMEA 5L30H 2G00A 1SHHB 2EC9H 1SC8U 2RA0A 1IHTH 3KQDA 1OYTH 2C8XB 4ZROA 2BDYA 1F92A 1EPTB 1AFQC 2Z7FE 5FAHA 1XVOA 1KXAA 3VB3A 1VCWA 2PSXA 1AD8H 5JDUB 2XWAA 2ZDVH 1C5NH 1W0ZU 4OS7A 1A5IA 4NIYA 3LDXH 3HKIB 1TNGA 1A5HA 1K21H 3A7WA 1SR5C 1PPZA 3BG8A 3SV6A 1MU8B 4WVPE 1IQIA 4HFPB 2G8TA 2QGRA 3RXAA 3UPEA 2GCTB 1HNEE 3NCLA 1T8LA 4TY7A 1S85A 1PQ8A 2GV6A 5E2PA 1AWFH 2O9QA 1F0RA 3EA7A 4D7FA 1EP5A 4IC6A 1SOZA 2SGEE 4DW2U 5I46H 1X7AC 1MMJN 2Y5FA 3TLOA 5EU8A 4ABFA 1O39A 4CRBA 1JIMA 2AFQB 1V2PT 3E0NB 5CHAC 4MQAA 1MZDA 2BY7X 3EGKH 2PWXA 1MBQA 1IHSH 3GCNA 3BN9A 1BBRH 4AORA 1EQ9A 4CRDA 3SU2A 1P12E 2FP7B 1ZTLA 4U01A 3GDSA 2A5KA 4DJZB 4WJG2 2PUQH 3I78A 2BVSH 3RLWH 2RCEA 4NCYA 3LJOA 5LPEA 2QXJA 1P2KA 4MNXA 1HJ8A 1C1MA 1NFYA 1UHBB 1ZRKA 1LKAA 1O5AB 1NN6A 2AMPA 2AGGX 1OWJA 1E0FD 3A7YA 3KHVA 3RXVA 1UK3A 1Q3XA 1AZZA 1THPB 4NIXA 6CHAB 4E7RG 1OSSA 1TONA 2O8LA 1HAVB 3FP6E 1TGCA 3E8LA 5HYOA 2ZZUH 4A5TS 1O3IA 3E16B 2WPMS 1P3EA 2WPIS 1GVKB 4OS6A 1DWCH 2LNCA 3A87A 4JMYA 3NUMA 2R2MB 2ZNKH 1O2SA 4JZIA 1TX7A 2BD3A 4BAKB 2R2WU 1NTPA 2VVCA 1N6YA 2P3FH 4B74A 2ZKSA 2VIPA 1GBAA 2FLBH 1MTNC 1C5PA 4TPYA 4CBNA 3MU1A 3RM0H 2FPZA 1UTJA 5C2ZA 4D9QA 5ETXA 1MTUA 4I8KA 3RC4A 2OBQA 4I31A 2VIWA 1C2GA 1FLEE 4Z0KA 1AVGH 2FMJA 1Y5BT 4INKA 3KNXA 1A7SA 1C5MD 2OP9A 1SLXB 5DK1A 1RD3B 3LU9B 2WUCA 4WWYA 3VPKA 1C4U2 2BYAX 3SV2H 4A1XA 5GCHF 3LC3A 2XCFA 2FZZA 4K1TA 1FIZA 4JK5A 2R0LA 2GZ7A 1ANEA 3A7ZA 3FZZA 1CT0E 1O2TA 3GY2A 4B75A 2AEIH 1INCA 2ZP0H 1C5YB 3D49H 3W95A 1LTOA 1OP2A 4IMQA 2BMGB 3LPRA 1SQTA 3A88A 1WBGB 2OBOA 4BXWA 3B23B 3WY8A 4OS5A 4DURA 1E37B 1YGCH 2SGFE 4O97A 3SNDA 4QT8C 3SV8A 9LPRA 1THSH 2P59A 1W7XH 1GBLA 1Z8GA 2CN0H 3A86A 3ATKA 1JXPA 2ZGXH 3BTME 4YM9A 1O32A 4Y8XA 3FAOA 5FHTA 2PGQB 1C9TA 3TK5A 3AAUA 4A6LA 2GGVB 2HRVA 1SGFA 5C1UA 5HM9A 2HNTE 4AGKA 3EAJA 4AB8A 2NU4E 4MNVA 2J38A 1DSUA 3ZZ7A 4ZKSU 2FOEA 1HV7A 4K69A 1OX1A 4KELA 1EKBB 1MTSA 1A61H 1S0RA 1RRKA 5GPIB 3GYMA 2Z3CA 1EPTA 1HAZB 1J8AA 2G5VA 4VGCB 4K60A 3BV9B 1OS8A 1KLTA 1ZRBA 1QRXA 1GI2A 1DS2E 1P57B 4CBOA 3LGYA 3BTKE 3BTTE 3PV4A 3NZIA 2A5AA 2BLVA 1NROH 1QRZA 1IQNA 1L4ZA 3A7TA 1C9PA 4Y8YA 4Y11E 5DP7A 1VITF 1FY3A 1WTHD 1Y8TA 4XSKU 3SUDA 3CS0A 1UCYH 2J4IA 1O5BB 3DHKH 1HGTH 3S9CA 1P2JA 4CRFA 2Z9GA 1KY9A 5K7RA 3ZZ8A 1V2VT 2FX4A 2QXIA 4ABDA 1LVOA 4JZ1A 1BZXE 4Q2KA 3VGCB 4O3TA 2BOKA 1BRAA 3RC6A 3VB4A 4RSPA 2BB4A 4SGBE 1UVSH 2OC1A 2AYWA 1WU1A 3A8DA 1DWEH 2GP9B 4MG3A 1VJAU 4KP0A 1ETSH 1G3BA 4R8TB 3TJNA 4YO9A 3GCTF 1AVWA 1D4PB 1WTGH 5EW1H 2Z9KA 1A4WH 1AZ8A 2QN5T 4TWYA 1RGQA 3RXKA 1CQQA 1AUTC 3GDVA 3BTQE 2R0KA 4FXGH 1QJ1B 3GCTG 5DKMA 1GJ8B 4CHAB 1BRUP 1CA0B 1O38A 1O3GA 3NK8A 1ZPCA 4X2WA 2OQ5A 1DE7H 1V2WT 4X8VH 1KDQB 1OOKB 3AW1A 4WXVA 4BOHA 2ZU4A 2P3TB 1YPHC 3DUXH 2EA3A 4IN2A 4O03A 1UTQA 3FZDA 1DY8A 1B7XB 3LGIA 2FYRA 1GHBF 2ZU3A 1V6DA 4U2WA 4I8LA 1P09A 5G4BA 2W3KA 1FMGA 4ABGA 5E0HA 1FDPA 3ATMA 1HCGA 4ISNA 3TGJE 1UJ1A 3OY6U 1FUJA 1GHBG 3V13A 5BPEA 1MAYA 3URCA 2BY6X 1XUFA 2A7HA 2FM2A 4X8TH 2ZDLA 4ABAA 2F9OA 2CJIA 4NFEA 3UTUH 2AERH 1LQDB 1PPBH 1AWHB 2BM2A 1P0SH 1CE5A 3U9AH 1NFWA 2VINA 3I29A 1PQ7A 3GCHC 1TLDA 1Z71A 5DP6A 2JETB 1O5EH 2ALVA 1HAOH 4O3UA 4GHQA 1JOUB 2I6QA 1C2HA 1GJ7B 3GY7A 3BIVH 4DG4A 1ETRH 4XE4A 1BA8B 2BLWA 3SNCA 3GY6A 1W8BH 1SL3A 3HK6B 5ESTE 1GI6A 3UQOA 1A1RA 1EXFA 1SB1H 1AUJA 1YPHE 4FUHA 1NS3A 1C1OA 4UEHH 2ZGBH 2J9NA 1OXGA 2OC0A 1XKBC 1ZJKA 2BTCE 3DFLA 3M5OA 1AKSA 1K1OA 1N1LA 1BCUH 2EI7A 5JBCS 1L2EA 1ANDA 1HAXB 1VCPA 5DP3A 1SGRE 1AHTH 3V7TA 1DICA 5AFZH 1C1WH 1PPHE 2M5TA 2ZI2H 1IQJA 1QJ6B 3P6ZB 5HXFA 2J94A 1ZSJA 3SUFA 8ESTE 1GCDA 2ZQ1A 1NESE 1S5SA 3MH7A 3TNSA 2Y5HA 3MNXA 4XOJA 1D3PB 3UWJH 2RA3A 2PGBB 2ZG0H 4UFGH 1HB0B 2ZGCA 2ZWLH 1NM6A 2BD2A 3LIWA 7GCHF 4Y76A 5GXPA 1L1JA 1HJAC 1OYQA 1KSNA 2D26C 3RU4T 3MU8A 3U98H 1BQYA 4DCDA 1Q2WA 3SNBA 1FZZA 7GCHG 5JB9S 1C5UA 2ASUB 1CGIE 2BDGA 1RTFB 3ZZCA 5E0JA 1DVAH 1TMBH 1QNJA 1LO6A 1DXWA 1O3MA 2Q6FA 1GBEA 2DUCA 4BTIB 3P17H 2P8OB 1RS0A 1YCPK 5L6NH 2FOCA 1ABIH 4RKOB 3SU3A 4YZUA 2VWOA 1KLIH 3P92A 4CR9A 1ANBA 3ZVBA 4K8YA 2H1UA 4DIHH 1Z6JH 2VWNA 4ISHH 4IC5A 3OTJE 2ESTE 4Q7XA 4NGAH 4BXSA 1FNIA 1LQEA 4J1YA 2QF0A 1LHDH 3TH4H 2VH0A 1O2PA 5JBAS 1TBQH 4UFDH 5CMXH 3K65B 3MO9A 3D23A 4YOGA 4H6SB 2BDHA 1TRNA 3E6PH 3UFAA 1ABJH 1QBNA 2WINI 2H5CA 1EAWA 1ELEE 2Y81A 1DDJA 2XXLA 5EPYA 4UONA 2C93B 3T28A 3ZZAA 4ZHAA 2D1JA 3F9EA 1OWKA 5EPNA 1GHVH 1ZOMA 3RUOA 1RIWC 1NO9H 3M3VA 4XDEA 2R3UA 1XX9A 2BD5A 4NSYA 1ESTA 3PMAB 1SBWA 1TRMA 1QL9A 1TX8A 2B8OH 2KAIA 4YT6H 1QBVH 2XBYA 1SGTA 1BBRE 5JBTA 1DOJA 1EJMA 1QQ4A 5C67A 3URDA 2A2QH 1T31A 3FFGA 3K9XB 3LH3A 3NWUA 3ZZDA 4GVUA 3VEQB 3M7TA 2CV3A 2HPQH 2A32A 1EAUA 4Q7YA 1L1NA 5A0AE 3SU0A 4MVNA 3ZYEA 1GI7B 1FN6A 1MZAA 2J2UA 1ESAA 1PFXC 3RXSA 1TOCB 2BVRH 3QGJA 1P2IA 1MTVA 1F0TA 1OWIA 3ODDA 3EDXB 5I25A 3U8OH 4DIIH 4I8JA 1UMAH 1AFQB 2A2XH 1GG6C 4AG2A 2H5DA 2A31A 3GICB 4OS2A 4O9VA 1PPCE 3SW2B 1C5TA 2EEKA 1TGTA 1SGFG 1H1BA 1VITH 2GV7A 4B73A 1T32A 1ESBA 1PPFE 2UUJB 2UWLA 1GDUA 1Y59T 5EXLA 1HXFH 1K1IA 1SMFE 1W2KH 4AFQA 1V2TT 4Y6DA 1O0DH 1GI9B 5E2OA 1DUAA 1OWHA 5IDKA 3BEFB 1O3HA 3MH6A 3MOCA 2A5IA 2XNIA 1GI1A 3OYPA 3HK3B 4MNYA 2C4FH 3RXFA 3VXEH 3PWCA 1MUEB 3Q00A 5CHAB 2Y80A 1KYNA 5DP9A 3GISB 4X1NU 2JKHA 4OS4A 5FBIA 1GHXH 1ELTA 1HAGE 1C2FA 2Z9IA 1IQMA 1LHCH 2HNTF 2FLRH 1AU8A 5T3HA 1H8DH 1A3EH 3VXFH 2Z9JA 3ZVGA 3RMNH 3ENSB 3SJKA 1EASA 3EQ0H 1C2LA 1TGBA 2C3SA 3EA8A 1FV9A 2F9VA 4ZKOU 5LPFA 1C1UH 3BTGE 1QIXB 4YLUA 2AH4X 2ZPSA 3DFJA 4GSOA 1TMUH 1F0SA 1GBBA 4FUJA 1TNKA 3SNEA 5GDSH 3TH3H 4ABEA 3UIRA 5TJXA 1TB6H 1ZZZA 4ZXXH 1Y3YA 1ORFA 5JBBS 5FCKA 3MNSA 2HGTH 1UVTH 1W13U 3PO1C 2B5TB 3TVJB 3A7VA 4Y71A 3UREA 5LPRA 1O3JA 1B0FA 4E05H 1FI8A 1S82A 2YOLA 3SN8A 2BQWB 3C1KA 2V35A 1HUTH 1EPTC 1C1RA 1NPMA 1O36A 1GJDB 1IQKA 1XMNB 2HVXA 1O2KA 1ZTJA 1TMTH 2TGAA 3L3TA 1S81A 2VH6A 4XBCA 2UUKB 2H9EH 3QX5H 1GI4A 2A4GA 5EG4A 3SJ8A 2BZ6H 2OLGA 3E3TA 2BXUH 3RMOH 1NRPH 2Y7XA 1XUJA 1V2KT 1BMMH 2FDAA 1GDNA 4NZLA 3RMLH 1HFDA 3TGKE 3PB1E 2VVUA 1T4UH 5EGMA 3VB5A 5C3NA 3KF2A 4BANB 3KIDU 4FVBA 1TPSA 1D3TB 1JBUH 2OINA 1G2LA 1P8VC 2BXTH 3SHCH 3RXPA 1AVXA 3A85A 2GT8A 1BUIA 2ZU5A 2WPKS 2H2ZA 5K0HA 1P10A 3R3GB 1C5RA 4CRGA 1GVZA 3A81A 4DY7B 3U1JB 4CRAA 2HNTC 5F03A 1O2XA 1TOMH 3E91A 1P2NA 1G3DA 1GGDC 3GCOA 1TGSZ 2ZF0H 2ANKH 3SJ9A 3A7XA 1CSOE 2XWBI 3I77A 5E8EH 3ZV8A 2SNVA 2CHAB 1FQ3A 2FWWA 1GI5A 2GZ8A 1TQ7B 4K1SA 4Y0YE 3FVFB 3QZRA 1MKXK 2B9LA 2ZHEH 1DPOA 3A83A 3UNSA 2STAE 1P9SA 2V3HH 1E34B 4MPXA 4AX9H 1A0LA 4FU7A 3RXBA 3SI4H 4K1EA 2LPRA 4GPGA 1F5KU 1SLUB 4AYYB 4MPVA 3RM2H 1TPPA 6CHAC 5EODA 2AMDA 3AW0A 1TIOA 1VZQH 1QRWA 3T25A 3GDUA 3D62A 1VJ9U 2Y7ZA 1V2UT 4XFQA 1T8OA 1H4WA 3F6UH 1XVMA 1MD8A 2ODPA 3V0XA 2CGAA 8GCHF 3MO3A 1O2ZA 4LOYH 1V2ST 1WOFA 4BAHB 3LGTA 1DFPA 4OGYA 5FPYA 4CH2B 4H42U 1Z8IB 2SGAA 1RTKA 2ANYA 8GCHG 2F9BH 2QV1A 3F9HA 3RXGA 2GMTC 4ISIH 1QQUA 1MKWK 2PKAB 2NU1E 1S83A 5A0CA 1EAXA 1QGFA 3NPSA 5HM2A 3SOSA 4NSVA 1GJCB 4XBBA 2XTTB 3PM3A 4IGDA 1IOEA 2ZFRH 4IS5A 3ZVCA 2Y6TA 2PKSC 2ZFSA 3MH4A 5ESBA 2D8WA 2R9PA 1K22H 2ANMH 2VIOA 3ZVAA 4ZUHA 1O3EA 4LXBH 4Q7ZA 1TNIA 1UTPA 1ELCA 3QTVH 1TA6A 3ZV9A 1XUIA 2P16A 5EQRA 9ESTA 1CVWH 1O30A 2FS9A 3RU4E 1EZQA 1TQ0B 3M7UA 4UDWH 1G3CA 2VWMA 1GHYH 2WPLS 1A46H 1P01A 1P2MA 3ZZ6A 4MLFB 1SOTA 4TYDA 1Y3VA 1U6QA 3AAVA 1W10U 1C4Y2 3SUEA 1GBTA 4BNRA 2DE9A 4GCHG 1J17T 5GWZA 3UY9A 2ZDMA 3GY4A 1P2QA 1BTZA 5EW2H 1D3QB 4CH8B 1TNLA 1ZPBA 4Y10E 4JYVH 2BDIA 2GX4A 1ZLRA 2GZ9A 1PJPA 1WV7H 3FP7E 6LPRA 1T8NA 1BTHH 2Q1JA 2ZFPH 1VGCC