2PKTA

Crystal structure of the human clp-36 (pdlim1) bound to the c-terminal peptide of human alpha-actinin-1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
91
structure length
91
Chain Sequence
SMTTQQIDLQGPGPWGFRLVGGKDFEQPLAISRVTPGSKAALANLCIGDVITAIDGENTSNMTHLEAQNRIKGCTDNLTLTVARSEHESDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PDZ and LIM domain protein 1
publication title The crystal structure of the human CLP-36 (PDLIM1) bound to the C-terminal peptide of human alpha-actinin-1.
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 21
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2007-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2pktA00
4H11A 4E3BA 2DKRA 2OCSA 3E17A 5E22A 3O5NA 1UJUA 2KJDA 1W9EA 1OBXA 4NMPA 4REYA 1X5RA 2KOMA 2ZPMA 2LUIA 2YT8A 2HE4A 2Z9IA 3EGHC 1UEZA 2HE2A 1Z87A 3HPMA 1WI2A 1BFEA 1ZOKA 5H3JA 2DB5A 3GCNA 1WG6A 2KPKA 1WHDA 4NMVA 5F67A 2EEHA 2FCFA 3QE1A 1QAUA 1KY9A 1UHPA 2KRGA 4NMOA 3DIWA 2JIKA 2R3YA 3GDSA 2M3MA 5HFCA 4Z8JA 2AWUA 3RL8A 4YDPA 4NXRA 3O46A 2KYLA 3JXTA 3CS0A 2IWNA 4NXQA 3I18A 2IWPA 1FC6A 2LOBA 3L4FD 2G2LA 4Q2QA 2PKUA 2K20A 4NNLA 2OGPA 2CSJA 3QJMA 3R69A 1IU0A 1QLCA 4RI0A 2KA9A 2QKVA 3CH8A 1RZXA 4JOPA 1R6JA 4XHVA 2KQFA 1X5QA 1K32A 4NMQA 1UF1A 2QKTA 2FNEA 2VRFA 4E35A 2EHRA 4Q2NA 1N6DA 2PNTA 1U39A 4GVDA 1V6BA 2EAQA 3NFKA 4WYTA 2RRMA 5EZ0A 1WFGA 2JOAA 3EGGC 2R4HA 2Z17A 1M5ZA 2JWEA 2OMJA 2KL1A 2M10A 3CBYA 1X8SA 5G1DA 1MFGA 2YT7A 3MH7A 2OPGA 1UEQA 3TSWA 5E1YA 2M0ZA 1KEFA 2AWXA 3FY5A 1T2MA 3KHFA 1U3BA 2D92A 1U37A 4JL7A 4Q2PA 2I6VA 4K76A 1V5LA 3GSLA 1B8QA 2PZDA 2KOJA 4PQWA 2KV8A 4N6XA 1X6DA 1Q3OA 2UZCA 3K50A 2JXOA 2IWQA 3ID1A 2E7KA 5JXBA 4F8KA 2EDZA 1Z86A 2EEGA 2QBWA 1FC7A 1MC7A 1QAVB 1RGRA 3ID4A 5FHTA 2ZPLA 1UEPA 2EEJA 2Q9VA 2M0TA 5HF4A 3RLEA 2EXGA 4K72A 1FC9A 4NMSA 4K78A 3GDUA 4GVCA 2F0AA 2CS5A 1Q7XA 5HEBA 5E21A 4MPAA 4UU6A 1WJLA 3KZDA 1I16A 3PV4A 2OSGA 3OTPA 2QT5A 2YUBA 5GLJA 3HPKA 1WFVA 2FE5A 2YTWA 3OU0A 2EDPA 3GDVA 1UM7A 3SUZA 1KWAA 2I1NA 1IU2A 5HETA 2KPLA 4K6YA 3VQGA 5HJ1A 3KZEA 4JOGA 4E34A 2L4SA 3R0HA 2VZ5A 3TSVA 4Q2OA 2DMZA 4Q3HA 1W9QA 5HFBA 2WL7A 4NXPA 1N7TA 2VWRA 3CYYA 3TMHA 2W4FA 2FN5A 3TSZA 1TP3A 3AXAA 2QKUA 4O06A 2IWOA 3GGEA 3BPUA 5HEDA 3DJ1A 2JINA 1L6OA 2O2TA 1WH1A 2DLUA 2KG2A 4FGMA 2G5MB 1VJ6A 1MFLA 5HFFA 2LC7A 2ENOA 4P2AB 1LCYA 1NF3C 1GQ4A 4G69A 5F3XA 2V90A 2M0UA 2H3LA 3WKMA 1V1TA 4KFWA 4OEOA 1YBOA 4JOJA 1BE9A 1Y7NA 4GHNA 2DLSA 1UEWA 5A2PA 2QG1A 4LMMA 2I04A 1P1DA 2AINA 1WF7A 1TE0A 2DAZA 1UFXA 1UM1A 2LC6A 1UITA 1Y8TA 1OBYA 2KOHA 2YUYA 1I92A 3PS4A 1WI4A 1PDRA 1TP5A 2DC2A 3PV5A 1X5NA 2P3WA 3RL7A 2K1ZA 1IHJA 1RGWA 1VA8A 1W9OA 2PA1A 4Q6SA 2KJKA 3QO6A 1WF8A 3GJ9A 3NGHA 4Q6HA 2M0VA 1RY4A 1FCFA 2X7ZA 2D90A 1G9OA 3DORA 1ZUBA 4Z33A 3I1EA 2GZVA 2HGAA 3DJ3A 3PDZA 2OZFA 2PKTA 2H2CA 2KBSA 3CBXA 4L8NA 1SOZA 1U38A 2W7RA 3HVQC 1GQ5A 4OEPA 2Q3GA 3WKLA 4UU5A 4NNMA 2JILA 3B76A 2EJYA 3NFLA 1V62A 1VAEA 1OBZA 5E11A 3R68A 2VSPA 5HEYA 4JOHA 1OZIA 2MX6A 1Q3PA 2OQSA 1XZ9A 3MH4A 4NMTA 2RCZA 5DTHA 2I0IA 2LA8A 3QIKA 1QAVA 2REYA 3VQFA 2EEIA 3K1RA 3K82A 3I4WA 3QGLA 2VSVA 2CSSA 1N6EA 5B6LA 4HOPB 4JORA 3SOEA 3CBZA 3SHUA 1VCWA 1P1EA 4KFVA 4JOKA 4JOFA 2KJPA 1N6FA 2JREA 5FB8C 1D5GA 1N7EA 2EGOA 3ZRTA 3QJNA 2V1WA 4EDJA 4WYUA 4YYXA 2BYGA 3ID2A 1NTEA 5HF1A 4OAJA 5I7ZA 1UJVA 5GNDA 4R2ZA 4IC6A 2L4TA 2AWWA 2DJTA 2H2BA 2F5YA 5HFEA 2EGKA 3GCOA 2H3MA 5E6PB 1SOTA 3QDOA 1N99A 1TQ3A 2I0LA 4NMRA 3SHWA 4AMHA 1GM1A 2PDZA 5HDYA 2D8IA 2OS6A 2MHOA 3MH6A 2DM8A 2L97A 2EV8A 3LNYA 3PDVA 4P0CA 5G1EA 5HFDA 2I4SA 1N7FA 3CC0A 3ID3A 3PV2A 2EGNA 4HOPA 3STJA 4K75A 1WHAA 5EYZA 3SFJA 1V5QA 2KAWA 1VB7A 2EDVA 3LNXA 2VPHA 1UJDA 3DJAA 4JOEA 1X45A 5D13A 1WIFA
chains in the Genus database with same CATH superfamily
4H11A 4E3BA 4JJ0A 2DKRA 2OCSA 3E17A 5E22A 3O5NA 1UJUA 2KJDA 1W9EA 1OBXA 4NMPA 4REYA 1X5RA 2KOMA 2ZPMA 2LUIA 2YT8A 2HE4A 2Z9IA 3EGHC 1UEZA 2HE2A 1Z87A 3HPMA 1WI2A 1BFEA 1ZOKA 5H3JA 2DB5A 3GCNA 1WG6A 2KPKA 1WHDA 4NMVA 5F67A 3NCVA 2EEHA 2FCFA 3QE1A 5ILBA 1QAUA 1KY9A 1UHPA 2KRGA 4NMOA 3DIWA 2JIKA 2R3YA 3GDSA 2M3MA 5HFCA 4Z8JA 2AWUA 3RL8A 4YDPA 4NXRA 3O46A 2KYLA 3JXTA 3CS0A 2IWNA 4NXQA 3I18A 2IWPA 1FC6A 2LOBA 3L4FD 2G2LA 4Q2QA 2PKUA 2K20A 4NNLA 2OGPA 2CSJA 3QJMA 3R69A 1IU0A 1QLCA 4RI0A 2KA9A 2QKVA 3CH8A 1RZXA 4JOPA 1R6JA 4XHVA 2KQFA 5IL9A 2JSNA 1X5QA 1K32A 4NMQA 1UF1A 2QKTA 2FNEA 2VRFA 4E35A 2EHRA 4Q2NA 1N6DA 2PNTA 1U39A 4GVDA 1V6BA 2EAQA 3NFKA 4WYTA 2RRMA 5EZ0A 1WFGA 2JOAA 3EGGC 2R4HA 2Z17A 1M5ZA 2JWEA 1X9ZA 4FLNA 2OMJA 2KL1A 2M10A 3CBYA 1X8SA 5G1DA 1MFGA 2YT7A 3MH7A 2OPGA 1UEQA 3TSWA 5E1YA 2M0ZA 3GABA 1KEFA 2AWXA 3FY5A 1T2MA 3KHFA 1U3BA 2D92A 1U37A 4JL7A 4Q2PA 2I6VA 4K76A 1V5LA 3GSLA 1B8QA 2PZDA 2KOJA 4PQWA 2KV8A 4N6XA 1X6DA 1Q3OA 2UZCA 3K50A 2JXOA 2IWQA 3ID1A 2E7KA 5JXBA 4F8KA 2EDZA 1Z86A 2EEGA 2QBWA 1FC7A 1MC7A 1QAVB 1RGRA 3ID4A 5FHTA 2ZPLA 1UEPA 2EEJA 2Q9VA 2M0TA 5HF4A 3RLEA 2EXGA 4K72A 1FC9A 4NMSA 4K78A 3GDUA 4GVCA 2F0AA 2CS5A 1Q7XA 5HEBA 5E21A 4MPAA 4UU6A 1WJLA 3KZDA 1I16A 3PV4A 2OSGA 3OTPA 2QT5A 2YUBA 5GLJA 3HPKA 1WFVA 2FE5A 2YTWA 3OU0A 2EDPA 3GDVA 1UM7A 3SUZA 1KWAA 2I1NA 1IU2A 5HETA 2KPLA 4K6YA 3VQGA 5HJ1A 3KZEA 4JOGA 4JJ3A 4E34A 2L4SA 3R0HA 2VZ5A 3TSVA 4Q2OA 2DMZA 4Q3HA 1W9QA 5HFBA 2WL7A 4NXPA 1N7TA 2VWRA 3CYYA 3TMHA 2W4FA 2FN5A 3TSZA 1TP3A 3AXAA 2QKUA 4O06A 2IWOA 3GGEA 3BPUA 5HEDA 3DJ1A 2JINA 1L6OA 2O2TA 1WH1A 2DLUA 2KG2A 4FGMA 2G5MB 1VJ6A 1MFLA 5HFFA 2LC7A 2ENOA 4P2AB 1LCYA 1NF3C 1GQ4A 4G69A 5F3XA 2V90A 2M0UA 2H3LA 3WKMA 1V1TA 4KFWA 4OEOA 1YBOA 4JOJA 1BE9A 1Y7NA 4GHNA 2DLSA 1UEWA 5A2PA 2QG1A 4LMMA 3KDKA 2I04A 1P1DA 2AINA 1WF7A 1TE0A 2DAZA 1UFXA 1UM1A 2LC6A 1UITA 1Y8TA 1OBYA 2KOHA 2YUYA 1I92A 3PS4A 1WI4A 1PDRA 1TP5A 2DC2A 3PV5A 1X5NA 2P3WA 3RL7A 2K1ZA 1IHJA 1RGWA 1VA8A 1W9OA 2PA1A 4Q6SA 2KJKA 3QO6A 1WF8A 3GJ9A 3NGHA 4Q6HA 2M0VA 1RY4A 1FCFA 2X7ZA 2D90A 1G9OA 3DORA 1ZUBA 4Z33A 3I1EA 2GZVA 2HGAA 3DJ3A 3PDZA 2OZFA 2PKTA 2H2CA 2KBSA 3CBXA 4L8NA 1SOZA 1U38A 2W7RA 3HVQC 1GQ5A 4OEPA 2Q3GA 3WKLA 4UU5A 4NNMA 2JILA 3B76A 2EJYA 3NFLA 1V62A 1VAEA 1OBZA 5E11A 3R68A 2VSPA 5HEYA 4JOHA 1OZIA 2MX6A 1Q3PA 2OQSA 1XZ9A 3MH4A 4NMTA 2RCZA 5DTHA 2I0IA 2LA8A 3QIKA 1QAVA 2REYA 3VQFA 2EEIA 3K1RA 3K82A 3I4WA 3QGLA 2VSVA 5B42A 2CSSA 1N6EA 5B6LA 4HOPB 4JORA 3SOEA 3CBZA 3SHUA 1VCWA 1P1EA 2GEFA 4KFVA 4JOKA 4JOFA 2KJPA 1N6FA 2JREA 5FB8C 1D5GA 1N7EA 2EGOA 3ZRTA 3QJNA 2V1WA 4EDJA 4WYUA 4YYXA 2BYGA 3ID2A 1NTEA 5HF1A 4OAJA 5I7ZA 1UJVA 5GNDA 4R2ZA 4IC6A 2L4TA 2AWWA 2DJTA 2H2BA 2F5YA 5HFEA 2EGKA 3GCOA 2H3MA 5E6PB 1SOTA 3QDOA 1N99A 1TQ3A 2I0LA 4NMRA 3SHWA 4AMHA 1GM1A 2PDZA 5HDYA 2D8IA 2OS6A 2MHOA 3MH6A 2DM8A 2L97A 2EV8A 3LNYA 3PDVA 4P0CA 5G1EA 5HFDA 2I4SA 1N7FA 3CC0A 3ID3A 3PV2A 2EGNA 4HOPA 3STJA 4K75A 1WHAA 5EYZA 3SFJA 1V5QA 2KAWA 1VB7A 2EDVA 3LNXA 2VPHA 1UJDA 3DJAA 4JOEA 3KDGA 1X45A 5D13A 1WIFA
chains in the Genus database with same CATH topology
4H11A 4E3BA 4JJ0A 2DKRA 2OCSA 3E17A 5E22A 3O5NA 1UJUA 2KJDA 1W9EA 1OBXA 4NMPA 4REYA 1X5RA 2KOMA 2ZPMA 2LUIA 2YT8A 2HE4A 2Z9IA 3EGHC 1UEZA 2HE2A 1Z87A 3HPMA 1WI2A 1BFEA 1ZOKA 5H3JA 2DB5A 3GCNA 1WG6A 2KPKA 1WHDA 4NMVA 5F67A 3NCVA 2EEHA 2FCFA 3QE1A 5ILBA 1QAUA 1KY9A 1UHPA 2KRGA 4NMOA 3DIWA 2JIKA 2R3YA 3GDSA 2M3MA 5HFCA 4Z8JA 2AWUA 3RL8A 4YDPA 4NXRA 3O46A 2KYLA 3JXTA 3CS0A 2IWNA 4NXQA 3I18A 2IWPA 1FC6A 2LOBA 3L4FD 2G2LA 4Q2QA 2PKUA 2K20A 4NNLA 2OGPA 2CSJA 3QJMA 3R69A 1IU0A 1QLCA 4RI0A 2KA9A 2QKVA 3CH8A 1RZXA 4JOPA 1R6JA 4XHVA 2KQFA 5IL9A 2JSNA 1X5QA 1K32A 4NMQA 1UF1A 2QKTA 2FNEA 2VRFA 4E35A 2EHRA 4Q2NA 1N6DA 2PNTA 1U39A 4GVDA 1V6BA 2EAQA 3NFKA 4WYTA 2RRMA 5EZ0A 1WFGA 2JOAA 3EGGC 2R4HA 2Z17A 1M5ZA 2JWEA 1X9ZA 4FLNA 2OMJA 2KL1A 2M10A 3CBYA 1X8SA 5G1DA 1MFGA 2YT7A 3MH7A 2OPGA 1UEQA 3TSWA 5E1YA 2M0ZA 3GABA 1KEFA 2AWXA 3FY5A 1T2MA 3KHFA 1U3BA 2D92A 1U37A 4JL7A 4Q2PA 2I6VA 4K76A 1V5LA 3GSLA 1B8QA 2PZDA 2KOJA 4PQWA 2KV8A 4N6XA 1X6DA 1Q3OA 2UZCA 3K50A 2JXOA 2IWQA 3ID1A 2E7KA 5JXBA 4F8KA 2EDZA 1Z86A 2EEGA 2QBWA 1FC7A 1MC7A 1QAVB 1RGRA 3ID4A 5FHTA 2ZPLA 1UEPA 2EEJA 2Q9VA 2M0TA 5HF4A 3RLEA 2EXGA 4K72A 1FC9A 4NMSA 4K78A 3GDUA 4GVCA 2F0AA 2CS5A 1Q7XA 5HEBA 5E21A 4MPAA 4UU6A 1WJLA 3KZDA 1I16A 3PV4A 2OSGA 3OTPA 2QT5A 2YUBA 5GLJA 3HPKA 1WFVA 2FE5A 2YTWA 3OU0A 2EDPA 3GDVA 1UM7A 3SUZA 1KWAA 2I1NA 1IU2A 5HETA 2KPLA 4K6YA 3VQGA 5HJ1A 3KZEA 4JOGA 4JJ3A 4E34A 2L4SA 3R0HA 2VZ5A 3TSVA 4Q2OA 2DMZA 4Q3HA 1W9QA 5HFBA 2WL7A 4NXPA 1N7TA 2VWRA 3CYYA 3TMHA 2W4FA 2FN5A 3TSZA 1TP3A 3AXAA 2QKUA 4O06A 2IWOA 3GGEA 3BPUA 5HEDA 3DJ1A 2JINA 1L6OA 2O2TA 1WH1A 2DLUA 2KG2A 4FGMA 2G5MB 1VJ6A 1MFLA 5HFFA 2LC7A 2ENOA 4P2AB 1LCYA 1NF3C 1GQ4A 4G69A 5F3XA 2V90A 2M0UA 2H3LA 3WKMA 1V1TA 4KFWA 4OEOA 1YBOA 4JOJA 1BE9A 1Y7NA 4GHNA 2DLSA 1UEWA 5A2PA 2QG1A 4LMMA 3KDKA 2I04A 1P1DA 2AINA 1WF7A 1TE0A 2DAZA 1UFXA 1UM1A 2LC6A 1UITA 1Y8TA 1OBYA 2KOHA 2YUYA 1I92A 3PS4A 1WI4A 1PDRA 1TP5A 2DC2A 3PV5A 1X5NA 2P3WA 3RL7A 2K1ZA 1IHJA 1RGWA 1VA8A 1W9OA 2PA1A 4Q6SA 2KJKA 3QO6A 1WF8A 3GJ9A 3NGHA 4Q6HA 2M0VA 1RY4A 1FCFA 2X7ZA 2D90A 1G9OA 3DORA 1ZUBA 4Z33A 3I1EA 2GZVA 2HGAA 3DJ3A 3PDZA 2OZFA 2PKTA 2H2CA 2KBSA 3CBXA 4L8NA 1SOZA 1U38A 2W7RA 3HVQC 1GQ5A 4OEPA 2Q3GA 3WKLA 4UU5A 4NNMA 2JILA 3B76A 2EJYA 3NFLA 1V62A 1VAEA 1OBZA 5E11A 3R68A 2VSPA 5HEYA 4JOHA 1OZIA 2MX6A 1Q3PA 2OQSA 1XZ9A 3MH4A 4NMTA 2RCZA 5DTHA 2I0IA 2LA8A 3QIKA 1QAVA 2REYA 3VQFA 2EEIA 3K1RA 3K82A 3I4WA 3QGLA 2VSVA 5B42A 2CSSA 1N6EA 5B6LA 4HOPB 4JORA 3SOEA 3CBZA 3SHUA 1VCWA 1P1EA 2GEFA 4KFVA 4JOKA 4JOFA 2KJPA 1N6FA 2JREA 5FB8C 1D5GA 1N7EA 2EGOA 3ZRTA 3QJNA 2V1WA 4EDJA 4WYUA 4YYXA 2BYGA 3ID2A 1NTEA 5HF1A 4OAJA 5I7ZA 1UJVA 5GNDA 4R2ZA 4IC6A 2L4TA 2AWWA 2DJTA 2H2BA 2F5YA 5HFEA 2EGKA 3GCOA 2H3MA 5E6PB 1SOTA 3QDOA 1N99A 1TQ3A 2I0LA 4NMRA 3SHWA 4AMHA 1GM1A 2PDZA 5HDYA 2D8IA 2OS6A 2MHOA 3MH6A 2DM8A 2L97A 2EV8A 3LNYA 3PDVA 4P0CA 5G1EA 5HFDA 2I4SA 1N7FA 3CC0A 3ID3A 3PV2A 2EGNA 4HOPA 3STJA 4K75A 1WHAA 5EYZA 3SFJA 1V5QA 2KAWA 1VB7A 2EDVA 3LNXA 2VPHA 1UJDA 3DJAA 4JOEA 3KDGA 1X45A 5D13A 1WIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H11 A;  4E3B A;  2DKR A;  2OCS A;  3E17 A;  5E22 A;  3O5N A;  1UJU A;  2KJD A;  1W9E A;  1OBX A;  4NMP A;  4REY A;  1X5R A;  2KOM A;  2ZPM A;  2LUI A;  2YT8 A;  2HE4 A;  2Z9I A;  3EGH C;  1UEZ A;  2HE2 A;  1Z87 A;  3HPM A;  1WI2 A;  1BFE A;  1ZOK A;  5H3J A;  2DB5 A;  3GCN A;  1WG6 A;  2KPK A;  1WHD A;  4NMV A;  5F67 A;  2EEH A;  2FCF A;  3QE1 A;  1QAU A;  1KY9 A;  1UHP A;  2KRG A;  4NMO A;  3DIW A;  2JIK A;  2R3Y A;  3GDS A;  2M3M A;  5HFC A;  4Z8J A;  2AWU A;  3RL8 A;  4YDP A;  4NXR A;  3O46 A;  2KYL A;  3JXT A;  3CS0 A;  2IWN A;  4NXQ A;  3I18 A;  2IWP A;  1FC6 A;  2LOB A;  3L4F D;  2G2L A;  4Q2Q A;  2PKU A;  2K20 A;  4NNL A;  2OGP A;  2CSJ A;  3QJM A;  3R69 A;  1IU0 A;  1QLC A;  4RI0 A;  2KA9 A;  2QKV A;  3CH8 A;  1RZX A;  4JOP A;  1R6J A;  4XHV A;  2KQF A;  1X5Q A;  1K32 A;  4NMQ A;  1UF1 A;  2QKT A;  2FNE A;  2VRF A;  4E35 A;  2EHR A;  4Q2N A;  1N6D A;  2PNT A;  1U39 A;  4GVD A;  1V6B A;  2EAQ A;  3NFK A;  4WYT A;  2RRM A;  5EZ0 A;  1WFG A;  2JOA A;  3EGG C;  2R4H A;  2Z17 A;  1M5Z A;  2JWE A;  2OMJ A;  2KL1 A;  2M10 A;  3CBY A;  1X8S A;  5G1D A;  1MFG A;  2YT7 A;  3MH7 A;  2OPG A;  1UEQ A;  3TSW A;  5E1Y A;  2M0Z A;  1KEF A;  2AWX A;  3FY5 A;  1T2M A;  3KHF A;  1U3B A;  2D92 A;  1U37 A;  4JL7 A;  4Q2P A;  2I6V A;  4K76 A;  1V5L A;  3GSL A;  1B8Q A;  2PZD A;  2KOJ A;  4PQW A;  2KV8 A;  4N6X A;  1X6D A;  1Q3O A;  2UZC A;  3K50 A;  2JXO A;  2IWQ A;  3ID1 A;  2E7K A;  5JXB A;  4F8K A;  2EDZ A;  1Z86 A;  2EEG A;  2QBW A;  1FC7 A;  1MC7 A;  1QAV B;  1RGR A;  3ID4 A;  5FHT A;  2ZPL A;  1UEP A;  2EEJ A;  2Q9V A;  2M0T A;  5HF4 A;  3RLE A;  2EXG A;  4K72 A;  1FC9 A;  4NMS A;  4K78 A;  3GDU A;  4GVC A;  2F0A A;  2CS5 A;  1Q7X A;  5HEB A;  5E21 A;  4MPA A;  4UU6 A;  1WJL A;  3KZD A;  1I16 A;  3PV4 A;  2OSG A;  3OTP A;  2QT5 A;  2YUB A;  5GLJ A;  3HPK A;  1WFV A;  2FE5 A;  2YTW A;  3OU0 A;  2EDP A;  3GDV A;  1UM7 A;  3SUZ A;  1KWA A;  2I1N A;  1IU2 A;  5HET A;  2KPL A;  4K6Y A;  3VQG A;  5HJ1 A;  3KZE A;  4JOG A;  4E34 A;  2L4S A;  3R0H A;  2VZ5 A;  3TSV A;  4Q2O A;  2DMZ A;  4Q3H A;  1W9Q A;  5HFB A;  2WL7 A;  4NXP A;  1N7T A;  2VWR A;  3CYY A;  3TMH A;  2W4F A;  2FN5 A;  3TSZ A;  1TP3 A;  3AXA A;  2QKU A;  4O06 A;  2IWO A;  3GGE A;  3BPU A;  5HED A;  3DJ1 A;  2JIN A;  1L6O A;  2O2T A;  1WH1 A;  2DLU A;  2KG2 A;  4FGM A;  2G5M B;  1VJ6 A;  1MFL A;  5HFF A;  2LC7 A;  2ENO A;  4P2A B;  1LCY A;  1NF3 C;  1GQ4 A;  4G69 A;  5F3X A;  2V90 A;  2M0U A;  2H3L A;  3WKM A;  1V1T A;  4KFW A;  4OEO A;  1YBO A;  4JOJ A;  1BE9 A;  1Y7N A;  4GHN A;  2DLS A;  1UEW A;  5A2P A;  2QG1 A;  4LMM A;  2I04 A;  1P1D A;  2AIN A;  1WF7 A;  1TE0 A;  2DAZ A;  1UFX A;  1UM1 A;  2LC6 A;  1UIT A;  1Y8T A;  1OBY A;  2KOH A;  2YUY A;  1I92 A;  3PS4 A;  1WI4 A;  1PDR A;  1TP5 A;  2DC2 A;  3PV5 A;  1X5N A;  2P3W A;  3RL7 A;  2K1Z A;  1IHJ A;  1RGW A;  1VA8 A;  1W9O A;  2PA1 A;  4Q6S A;  2KJK A;  3QO6 A;  1WF8 A;  3GJ9 A;  3NGH A;  4Q6H A;  2M0V A;  1RY4 A;  1FCF A;  2X7Z A;  2D90 A;  1G9O A;  3DOR A;  1ZUB A;  4Z33 A;  3I1E A;  2GZV A;  2HGA A;  3DJ3 A;  3PDZ A;  2OZF A;  2PKT A;  2H2C A;  2KBS A;  3CBX A;  4L8N A;  1SOZ A;  1U38 A;  2W7R A;  3HVQ C;  1GQ5 A;  4OEP A;  2Q3G A;  3WKL A;  4UU5 A;  4NNM A;  2JIL A;  3B76 A;  2EJY A;  3NFL A;  1V62 A;  1VAE A;  1OBZ A;  5E11 A;  3R68 A;  2VSP A;  5HEY A;  4JOH A;  1OZI A;  2MX6 A;  1Q3P A;  2OQS A;  1XZ9 A;  3MH4 A;  4NMT A;  2RCZ A;  5DTH A;  2I0I A;  2LA8 A;  3QIK A;  1QAV A;  2REY A;  3VQF A;  2EEI A;  3K1R A;  3K82 A;  3I4W A;  3QGL A;  2VSV A;  2CSS A;  1N6E A;  5B6L A;  4HOP B;  4JOR A;  3SOE A;  3CBZ A;  3SHU A;  1VCW A;  1P1E A;  4KFV A;  4JOK A;  4JOF A;  2KJP A;  1N6F A;  2JRE A;  5FB8 C;  1D5G A;  1N7E A;  2EGO A;  3ZRT A;  3QJN A;  2V1W A;  4EDJ A;  4WYU A;  4YYX A;  2BYG A;  3ID2 A;  1NTE A;  5HF1 A;  4OAJ A;  5I7Z A;  1UJV A;  5GND A;  4R2Z A;  4IC6 A;  2L4T A;  2AWW A;  2DJT A;  2H2B A;  2F5Y A;  5HFE A;  2EGK A;  3GCO A;  2H3M A;  5E6P B;  1SOT A;  3QDO A;  1N99 A;  1TQ3 A;  2I0L A;  4NMR A;  3SHW A;  4AMH A;  1GM1 A;  2PDZ A;  5HDY A;  2D8I A;  2OS6 A;  2MHO A;  3MH6 A;  2DM8 A;  2L97 A;  2EV8 A;  3LNY A;  3PDV A;  4P0C A;  5G1E A;  5HFD A;  2I4S A;  1N7F A;  3CC0 A;  3ID3 A;  3PV2 A;  2EGN A;  4HOP A;  3STJ A;  4K75 A;  1WHA A;  5EYZ A;  3SFJ A;  1V5Q A;  2KAW A;  1VB7 A;  2EDV A;  3LNX A;  2VPH A;  1UJD A;  3DJA A;  4JOE A;  1X45 A;  5D13 A;  1WIF A; 
#chains in the Genus database with same CATH topology
 4H11 A;  4E3B A;  4JJ0 A;  2DKR A;  2OCS A;  3E17 A;  5E22 A;  3O5N A;  1UJU A;  2KJD A;  1W9E A;  1OBX A;  4NMP A;  4REY A;  1X5R A;  2KOM A;  2ZPM A;  2LUI A;  2YT8 A;  2HE4 A;  2Z9I A;  3EGH C;  1UEZ A;  2HE2 A;  1Z87 A;  3HPM A;  1WI2 A;  1BFE A;  1ZOK A;  5H3J A;  2DB5 A;  3GCN A;  1WG6 A;  2KPK A;  1WHD A;  4NMV A;  5F67 A;  3NCV A;  2EEH A;  2FCF A;  3QE1 A;  5ILB A;  1QAU A;  1KY9 A;  1UHP A;  2KRG A;  4NMO A;  3DIW A;  2JIK A;  2R3Y A;  3GDS A;  2M3M A;  5HFC A;  4Z8J A;  2AWU A;  3RL8 A;  4YDP A;  4NXR A;  3O46 A;  2KYL A;  3JXT A;  3CS0 A;  2IWN A;  4NXQ A;  3I18 A;  2IWP A;  1FC6 A;  2LOB A;  3L4F D;  2G2L A;  4Q2Q A;  2PKU A;  2K20 A;  4NNL A;  2OGP A;  2CSJ A;  3QJM A;  3R69 A;  1IU0 A;  1QLC A;  4RI0 A;  2KA9 A;  2QKV A;  3CH8 A;  1RZX A;  4JOP A;  1R6J A;  4XHV A;  2KQF A;  5IL9 A;  2JSN A;  1X5Q A;  1K32 A;  4NMQ A;  1UF1 A;  2QKT A;  2FNE A;  2VRF A;  4E35 A;  2EHR A;  4Q2N A;  1N6D A;  2PNT A;  1U39 A;  4GVD A;  1V6B A;  2EAQ A;  3NFK A;  4WYT A;  2RRM A;  5EZ0 A;  1WFG A;  2JOA A;  3EGG C;  2R4H A;  2Z17 A;  1M5Z A;  2JWE A;  1X9Z A;  4FLN A;  2OMJ A;  2KL1 A;  2M10 A;  3CBY A;  1X8S A;  5G1D A;  1MFG A;  2YT7 A;  3MH7 A;  2OPG A;  1UEQ A;  3TSW A;  5E1Y A;  2M0Z A;  3GAB A;  1KEF A;  2AWX A;  3FY5 A;  1T2M A;  3KHF A;  1U3B A;  2D92 A;  1U37 A;  4JL7 A;  4Q2P A;  2I6V A;  4K76 A;  1V5L A;  3GSL A;  1B8Q A;  2PZD A;  2KOJ A;  4PQW A;  2KV8 A;  4N6X A;  1X6D A;  1Q3O A;  2UZC A;  3K50 A;  2JXO A;  2IWQ A;  3ID1 A;  2E7K A;  5JXB A;  4F8K A;  2EDZ A;  1Z86 A;  2EEG A;  2QBW A;  1FC7 A;  1MC7 A;  1QAV B;  1RGR A;  3ID4 A;  5FHT A;  2ZPL A;  1UEP A;  2EEJ A;  2Q9V A;  2M0T A;  5HF4 A;  3RLE A;  2EXG A;  4K72 A;  1FC9 A;  4NMS A;  4K78 A;  3GDU A;  4GVC A;  2F0A A;  2CS5 A;  1Q7X A;  5HEB A;  5E21 A;  4MPA A;  4UU6 A;  1WJL A;  3KZD A;  1I16 A;  3PV4 A;  2OSG A;  3OTP A;  2QT5 A;  2YUB A;  5GLJ A;  3HPK A;  1WFV A;  2FE5 A;  2YTW A;  3OU0 A;  2EDP A;  3GDV A;  1UM7 A;  3SUZ A;  1KWA A;  2I1N A;  1IU2 A;  5HET A;  2KPL A;  4K6Y A;  3VQG A;  5HJ1 A;  3KZE A;  4JOG A;  4JJ3 A;  4E34 A;  2L4S A;  3R0H A;  2VZ5 A;  3TSV A;  4Q2O A;  2DMZ A;  4Q3H A;  1W9Q A;  5HFB A;  2WL7 A;  4NXP A;  1N7T A;  2VWR A;  3CYY A;  3TMH A;  2W4F A;  2FN5 A;  3TSZ A;  1TP3 A;  3AXA A;  2QKU A;  4O06 A;  2IWO A;  3GGE A;  3BPU A;  5HED A;  3DJ1 A;  2JIN A;  1L6O A;  2O2T A;  1WH1 A;  2DLU A;  2KG2 A;  4FGM A;  2G5M B;  1VJ6 A;  1MFL A;  5HFF A;  2LC7 A;  2ENO A;  4P2A B;  1LCY A;  1NF3 C;  1GQ4 A;  4G69 A;  5F3X A;  2V90 A;  2M0U A;  2H3L A;  3WKM A;  1V1T A;  4KFW A;  4OEO A;  1YBO A;  4JOJ A;  1BE9 A;  1Y7N A;  4GHN A;  2DLS A;  1UEW A;  5A2P A;  2QG1 A;  4LMM A;  3KDK A;  2I04 A;  1P1D A;  2AIN A;  1WF7 A;  1TE0 A;  2DAZ A;  1UFX A;  1UM1 A;  2LC6 A;  1UIT A;  1Y8T A;  1OBY A;  2KOH A;  2YUY A;  1I92 A;  3PS4 A;  1WI4 A;  1PDR A;  1TP5 A;  2DC2 A;  3PV5 A;  1X5N A;  2P3W A;  3RL7 A;  2K1Z A;  1IHJ A;  1RGW A;  1VA8 A;  1W9O A;  2PA1 A;  4Q6S A;  2KJK A;  3QO6 A;  1WF8 A;  3GJ9 A;  3NGH A;  4Q6H A;  2M0V A;  1RY4 A;  1FCF A;  2X7Z A;  2D90 A;  1G9O A;  3DOR A;  1ZUB A;  4Z33 A;  3I1E A;  2GZV A;  2HGA A;  3DJ3 A;  3PDZ A;  2OZF A;  2PKT A;  2H2C A;  2KBS A;  3CBX A;  4L8N A;  1SOZ A;  1U38 A;  2W7R A;  3HVQ C;  1GQ5 A;  4OEP A;  2Q3G A;  3WKL A;  4UU5 A;  4NNM A;  2JIL A;  3B76 A;  2EJY A;  3NFL A;  1V62 A;  1VAE A;  1OBZ A;  5E11 A;  3R68 A;  2VSP A;  5HEY A;  4JOH A;  1OZI A;  2MX6 A;  1Q3P A;  2OQS A;  1XZ9 A;  3MH4 A;  4NMT A;  2RCZ A;  5DTH A;  2I0I A;  2LA8 A;  3QIK A;  1QAV A;  2REY A;  3VQF A;  2EEI A;  3K1R A;  3K82 A;  3I4W A;  3QGL A;  2VSV A;  5B42 A;  2CSS A;  1N6E A;  5B6L A;  4HOP B;  4JOR A;  3SOE A;  3CBZ A;  3SHU A;  1VCW A;  1P1E A;  2GEF A;  4KFV A;  4JOK A;  4JOF A;  2KJP A;  1N6F A;  2JRE A;  5FB8 C;  1D5G A;  1N7E A;  2EGO A;  3ZRT A;  3QJN A;  2V1W A;  4EDJ A;  4WYU A;  4YYX A;  2BYG A;  3ID2 A;  1NTE A;  5HF1 A;  4OAJ A;  5I7Z A;  1UJV A;  5GND A;  4R2Z A;  4IC6 A;  2L4T A;  2AWW A;  2DJT A;  2H2B A;  2F5Y A;  5HFE A;  2EGK A;  3GCO A;  2H3M A;  5E6P B;  1SOT A;  3QDO A;  1N99 A;  1TQ3 A;  2I0L A;  4NMR A;  3SHW A;  4AMH A;  1GM1 A;  2PDZ A;  5HDY A;  2D8I A;  2OS6 A;  2MHO A;  3MH6 A;  2DM8 A;  2L97 A;  2EV8 A;  3LNY A;  3PDV A;  4P0C A;  5G1E A;  5HFD A;  2I4S A;  1N7F A;  3CC0 A;  3ID3 A;  3PV2 A;  2EGN A;  4HOP A;  3STJ A;  4K75 A;  1WHA A;  5EYZ A;  3SFJ A;  1V5Q A;  2KAW A;  1VB7 A;  2EDV A;  3LNX A;  2VPH A;  1UJD A;  3DJA A;  4JOE A;  3KDG A;  1X45 A;  5D13 A;  1WIF A; 
#chains in the Genus database with same CATH homology
 4H11 A;  4E3B A;  4JJ0 A;  2DKR A;  2OCS A;  3E17 A;  5E22 A;  3O5N A;  1UJU A;  2KJD A;  1W9E A;  1OBX A;  4NMP A;  4REY A;  1X5R A;  2KOM A;  2ZPM A;  2LUI A;  2YT8 A;  2HE4 A;  2Z9I A;  3EGH C;  1UEZ A;  2HE2 A;  1Z87 A;  3HPM A;  1WI2 A;  1BFE A;  1ZOK A;  5H3J A;  2DB5 A;  3GCN A;  1WG6 A;  2KPK A;  1WHD A;  4NMV A;  5F67 A;  3NCV A;  2EEH A;  2FCF A;  3QE1 A;  5ILB A;  1QAU A;  1KY9 A;  1UHP A;  2KRG A;  4NMO A;  3DIW A;  2JIK A;  2R3Y A;  3GDS A;  2M3M A;  5HFC A;  4Z8J A;  2AWU A;  3RL8 A;  4YDP A;  4NXR A;  3O46 A;  2KYL A;  3JXT A;  3CS0 A;  2IWN A;  4NXQ A;  3I18 A;  2IWP A;  1FC6 A;  2LOB A;  3L4F D;  2G2L A;  4Q2Q A;  2PKU A;  2K20 A;  4NNL A;  2OGP A;  2CSJ A;  3QJM A;  3R69 A;  1IU0 A;  1QLC A;  4RI0 A;  2KA9 A;  2QKV A;  3CH8 A;  1RZX A;  4JOP A;  1R6J A;  4XHV A;  2KQF A;  5IL9 A;  2JSN A;  1X5Q A;  1K32 A;  4NMQ A;  1UF1 A;  2QKT A;  2FNE A;  2VRF A;  4E35 A;  2EHR A;  4Q2N A;  1N6D A;  2PNT A;  1U39 A;  4GVD A;  1V6B A;  2EAQ A;  3NFK A;  4WYT A;  2RRM A;  5EZ0 A;  1WFG A;  2JOA A;  3EGG C;  2R4H A;  2Z17 A;  1M5Z A;  2JWE A;  1X9Z A;  4FLN A;  2OMJ A;  2KL1 A;  2M10 A;  3CBY A;  1X8S A;  5G1D A;  1MFG A;  2YT7 A;  3MH7 A;  2OPG A;  1UEQ A;  3TSW A;  5E1Y A;  2M0Z A;  3GAB A;  1KEF A;  2AWX A;  3FY5 A;  1T2M A;  3KHF A;  1U3B A;  2D92 A;  1U37 A;  4JL7 A;  4Q2P A;  2I6V A;  4K76 A;  1V5L A;  3GSL A;  1B8Q A;  2PZD A;  2KOJ A;  4PQW A;  2KV8 A;  4N6X A;  1X6D A;  1Q3O A;  2UZC A;  3K50 A;  2JXO A;  2IWQ A;  3ID1 A;  2E7K A;  5JXB A;  4F8K A;  2EDZ A;  1Z86 A;  2EEG A;  2QBW A;  1FC7 A;  1MC7 A;  1QAV B;  1RGR A;  3ID4 A;  5FHT A;  2ZPL A;  1UEP A;  2EEJ A;  2Q9V A;  2M0T A;  5HF4 A;  3RLE A;  2EXG A;  4K72 A;  1FC9 A;  4NMS A;  4K78 A;  3GDU A;  4GVC A;  2F0A A;  2CS5 A;  1Q7X A;  5HEB A;  5E21 A;  4MPA A;  4UU6 A;  1WJL A;  3KZD A;  1I16 A;  3PV4 A;  2OSG A;  3OTP A;  2QT5 A;  2YUB A;  5GLJ A;  3HPK A;  1WFV A;  2FE5 A;  2YTW A;  3OU0 A;  2EDP A;  3GDV A;  1UM7 A;  3SUZ A;  1KWA A;  2I1N A;  1IU2 A;  5HET A;  2KPL A;  4K6Y A;  3VQG A;  5HJ1 A;  3KZE A;  4JOG A;  4JJ3 A;  4E34 A;  2L4S A;  3R0H A;  2VZ5 A;  3TSV A;  4Q2O A;  2DMZ A;  4Q3H A;  1W9Q A;  5HFB A;  2WL7 A;  4NXP A;  1N7T A;  2VWR A;  3CYY A;  3TMH A;  2W4F A;  2FN5 A;  3TSZ A;  1TP3 A;  3AXA A;  2QKU A;  4O06 A;  2IWO A;  3GGE A;  3BPU A;  5HED A;  3DJ1 A;  2JIN A;  1L6O A;  2O2T A;  1WH1 A;  2DLU A;  2KG2 A;  4FGM A;  2G5M B;  1VJ6 A;  1MFL A;  5HFF A;  2LC7 A;  2ENO A;  4P2A B;  1LCY A;  1NF3 C;  1GQ4 A;  4G69 A;  5F3X A;  2V90 A;  2M0U A;  2H3L A;  3WKM A;  1V1T A;  4KFW A;  4OEO A;  1YBO A;  4JOJ A;  1BE9 A;  1Y7N A;  4GHN A;  2DLS A;  1UEW A;  5A2P A;  2QG1 A;  4LMM A;  3KDK A;  2I04 A;  1P1D A;  2AIN A;  1WF7 A;  1TE0 A;  2DAZ A;  1UFX A;  1UM1 A;  2LC6 A;  1UIT A;  1Y8T A;  1OBY A;  2KOH A;  2YUY A;  1I92 A;  3PS4 A;  1WI4 A;  1PDR A;  1TP5 A;  2DC2 A;  3PV5 A;  1X5N A;  2P3W A;  3RL7 A;  2K1Z A;  1IHJ A;  1RGW A;  1VA8 A;  1W9O A;  2PA1 A;  4Q6S A;  2KJK A;  3QO6 A;  1WF8 A;  3GJ9 A;  3NGH A;  4Q6H A;  2M0V A;  1RY4 A;  1FCF A;  2X7Z A;  2D90 A;  1G9O A;  3DOR A;  1ZUB A;  4Z33 A;  3I1E A;  2GZV A;  2HGA A;  3DJ3 A;  3PDZ A;  2OZF A;  2PKT A;  2H2C A;  2KBS A;  3CBX A;  4L8N A;  1SOZ A;  1U38 A;  2W7R A;  3HVQ C;  1GQ5 A;  4OEP A;  2Q3G A;  3WKL A;  4UU5 A;  4NNM A;  2JIL A;  3B76 A;  2EJY A;  3NFL A;  1V62 A;  1VAE A;  1OBZ A;  5E11 A;  3R68 A;  2VSP A;  5HEY A;  4JOH A;  1OZI A;  2MX6 A;  1Q3P A;  2OQS A;  1XZ9 A;  3MH4 A;  4NMT A;  2RCZ A;  5DTH A;  2I0I A;  2LA8 A;  3QIK A;  1QAV A;  2REY A;  3VQF A;  2EEI A;  3K1R A;  3K82 A;  3I4W A;  3QGL A;  2VSV A;  5B42 A;  2CSS A;  1N6E A;  5B6L A;  4HOP B;  4JOR A;  3SOE A;  3CBZ A;  3SHU A;  1VCW A;  1P1E A;  2GEF A;  4KFV A;  4JOK A;  4JOF A;  2KJP A;  1N6F A;  2JRE A;  5FB8 C;  1D5G A;  1N7E A;  2EGO A;  3ZRT A;  3QJN A;  2V1W A;  4EDJ A;  4WYU A;  4YYX A;  2BYG A;  3ID2 A;  1NTE A;  5HF1 A;  4OAJ A;  5I7Z A;  1UJV A;  5GND A;  4R2Z A;  4IC6 A;  2L4T A;  2AWW A;  2DJT A;  2H2B A;  2F5Y A;  5HFE A;  2EGK A;  3GCO A;  2H3M A;  5E6P B;  1SOT A;  3QDO A;  1N99 A;  1TQ3 A;  2I0L A;  4NMR A;  3SHW A;  4AMH A;  1GM1 A;  2PDZ A;  5HDY A;  2D8I A;  2OS6 A;  2MHO A;  3MH6 A;  2DM8 A;  2L97 A;  2EV8 A;  3LNY A;  3PDV A;  4P0C A;  5G1E A;  5HFD A;  2I4S A;  1N7F A;  3CC0 A;  3ID3 A;  3PV2 A;  2EGN A;  4HOP A;  3STJ A;  4K75 A;  1WHA A;  5EYZ A;  3SFJ A;  1V5Q A;  2KAW A;  1VB7 A;  2EDV A;  3LNX A;  2VPH A;  1UJD A;  3DJA A;  4JOE A;  3KDG A;  1X45 A;  5D13 A;  1WIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...