2PLPA

Ultra high resolution backbone conformation of protein gb1 from residual dipolar couplings alone
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
54
structure length
54
Chain Sequence
TYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G-binding protein G
publication title Ultrahigh-resolution backbone structure of perdeuterated protein GB1 using residual dipolar couplings from two alignment media
pubmed doi rcsb
source organism Streptococcus sp. 'group g'
molecule tags Immune system/protein binding
total genus 11
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2007-04-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2plpA00
2RPVA 1FCCC 2I2YA 2IGGA 2IGHA 2KWDA 1F2RC 2LGIA 1HZ6A 1IGDA 4OZBA 1XCQL 2KN4A 2LHDA 1MI0A 4OZCA 2JSVX 4HJGE 3GB1A 1ZXHA 1PGAA 1MHHE 2KDMA 2ON8A 1PGBA 1UWXA 2IGDA 2GB1A 2PTLA 2PW9A 1XCTL 5HFYA 1HZ5A 2RMMA 1IGCA 2KACA 4KGSA 2NMQA 4IKGA 4WH4A 5JXVA 2GI9A 3V3XA 4HKZE 1QKZA 1JMLA 1IBXA 2JXTA 1K53A 1EM7A 1XF5L 3MP9A 2LHEA 1IBXB 1YMHE 1K52A 1F2RI 4IOIE 1GB1A 2N7JA 1MVKA 2KQ4X 1Q10A 2PLPA 1KH0A 1PGXA 2ZW1A 2OEDA 2J52A 3FILB 1GB4A 1K51A 2JWUA 2ZW0A 4KGTA 1D4BA 1YNTE 1K50A 1P7FA 5HHDG 4D2KA 4MACA 2N9LA 5HI1A 3UI3A 2QSDA 1HEZE 2EELA 2ONQA 5HG2A 1MPEA 4KGRA 1MHXA 5BMGA 1FCLA 2JU6X 4OZAA 2N9KA 3FILA 1FD6A 2JZPA 1P7EA 2I38A 2QMTA 5BMHA 2J53A 2K0PA 5BMIA 2LUMA 1C9FA 4GLSC
chains in the Genus database with same CATH superfamily
3B1LX 2RDBC 1XLPA 3CMMB 4YT0B 4GMVA 2QJLA 4DDID 4C4VA 3H8HA 3NRZA 4I6PA 1KLGD 2HD5B 2M0XA 4O1NA 4NAWB 1V5TA 4FULA 3Q8EA 1T0RC 4IM0A 4BBNF 3ABVB 1LFDA 2WNMA 5IO9A 1FFVA 2M19A 4S0RA 2ZVOA 4FJZA 4W9HA 2FE8A 1RRBA 2GB1A 3APFA 1V49A 2LWPA 4HKQA 1AARA 4EKUA 4NNJB 2OHFA 3KW5B 4P1BC 1SE9A 1N63A 1WGGA 3DBSA 2UYZB 3MHZA 4H2AA 2IYDB 2AX5A 2AL6A 3Q3OC 4WURA 1XQQA 2DX5B 3NZSA 2GI9A 1YD8U 4FBJB 1Q1OA 1JMLA 5L83A 2WXQA 1SJHD 3EA6A 2JX5A 1EM7A 3R7QA 1V8CA 4B0MA 4RM9A 3NS8A 1J7CA 1UUPA 1ZDXA 2PEAA 1D3ZA 2TSSA 2IY0B 3N9YC 1E0ZA 2FUG1 5E6NA 1WE6A 1TZOA 1YN5A 2GBNA 3UIPB 2RPQA 2PVGC 3DBLI 4HLEA 3ZTCA 3AE8B 2DZKA 3ALBA 4GXBA 5JHAA 5G5HA 1KFYB 3OLMD 3V6EB 5HG2A 3NJTA 2JUOA 4HPPA 1WGHA 3ZTDA 1KOTA 1P0RA 4LJPB 2JZZA 4HXDA 2WXKA 3AB5A 3RUIB 1NDDA 3ZDTA 4I6LB 1RYJA 4W9IA 4EZLA 3PLVA 1Z2MA 2RPVA 4BZAA 2KT7A 2G9HD 1KJTA 5FKAC 1WZ3A 3P4SB 4M0WA 4E71A 1LGRA 2ACZB 3ZDMC 1YIWA 2BW2A 4P6VF 4BOZB 1F52A 1MFWA 4HJGE 4ICUA 3R8BA 1YQBA 1XLQA 4XGAB 2EMTA 5CX3A 4BKSD 3AE5B 3Q6BA 4BOSC 4MGZE 4MGIE 4EFOA 3U7ZA 4DBGA 3KWLA 3RD2A 1JWBD 3U8ZA 5HFYA 3IBEA 2A4ZA 1IGCA 3B9JA 1TZ1A 2WXPA 3VTVA 4B6WA 1XD3B 3MC9A 3SFEB 2BYVE 4A20A 1A70A 1D5XC 1WY8A 2O6VB 4N6EB 2JRIB 4XC2A 1IBXA 4WWOA 4ZHPA 3X0WA 4K7SA 3QWZB 2DHZA 1JWAD 4GDLA 4KDIC 2FCMA 1IBXB 4REZA 3NS1A 4XDCA 4J3OD 4ZYSA 3DHIC 4YTMB 3RULA 3V62A 1UZXB 1L4ZB 1KH0A 4W9EA 2ZNVC 5JH5C 1SE3A 1TY0A 2IY1B 1RFKA 2KKCA 2KWUB 3I3TB 1UBQA 1XEEA 3RNAC 5BYSA 3IVFA 1YJ1A 3BIID 3RI7C 2J53A 2HTHA 2LUMA 1BXTA 1EUVB 3SFDB 3NUHB 3MJWA 3NOBA 4BKSA 1FIQA 2L76A 3B08A 4W9CA 1YN4A 4C7ZA 3AE9B 1RAXA 1KLVA 1MI0A 1KM7A 2K1FA 2L52A 2RGFA 4PK1A 3GOEA 3DHGC 2M1MA 1XXGA 2DYBA 3Q3JA 2KLGA 3N1YC 3ML8A 2GMIC 2NCNA 4HEA1 1PFDA 2LGYA 3AE2B 4IC7B 3VRAB 4MSMB 3V60A 3IAM1 4FA6A 1B1ZA 1ENFA 3W5VB 2LVOA 4MDKE 5J2RA 3PLUA 4F8CB 2LJ5A 2L0TA 2WGSA 4EE2A 1MG4A 2M4NA 1WYWB 2WXLA 1HA5A 4CYEA 4WJNA 2G4DB 1C1YB 4C80A 1VCBA 4M02A 3H6NA 4XWTA 2LHEA 1D5ZC 2N9EB 2MCNB 1I4RA 1WGRA 1E8WA 3I5JC 1NEKB 4JL9A 3TEWA 2L05A 3OWEB 3E56A 4FLHA 1BT0A 3EFUA 1X1MA 2BYFA 4YTNB 2XN9C 2Y5PA 3DOWA 2D10A 4M01A 5CTRC 3WIMA 3LXFA 1NYRA 2N9LA 2QSDA 3PVLA 2DZIA 3C19A 4R3DA 4HROA 1N5XA 2VZKB 3GE8C 2HE7A 5C2TB 2LVPA 3W1SC 3RZFA 4W9KA 5J17A 2BB5A 3WCQA 2K9XA 3AI5A 3BZDB 3VDZA 3LJ3A 2IGHA 1KLUD 2CS4A 4LCDE 2V1YA 2BYTA 1GPXA 1IYFA 1IGDA 1GAQB 2MSED 5FK9C 3K9OB 2N1VA 2IPKD 2KN4A 3A9KA 3TIXA 1PQSA 2MJDA 4K7UA 4BVUC 4G0NB 3V05A 3AEFB 3GB1A 3R3MA 2X38A 3A9KB 1WJNA 2N0SB 1PGAA 1MHHE 3E9SA 1QQRA 1CZPA 2IO2B 2NBUA 2WXRA 1EU3A 3RPFC 2W9NA 1G6JA 1L6VA 1WMHB 3U52E 3IT4B 4W9LA 3RFZB 3D32A 2JWZA 3NVZA 1WJ6A 1NI2A 5LLIA 3VUXA 2KTRA 3MC0B 2CJOA 1LM8B 1WXQA 3DCGA 1XT9B 3N30A 2C7NB 2KTRB 5EE3A 3OAWA 3ZGZA 2FCNA 3AEDB 4XWWA 2FBWB 2UWQA 3ZNID 3U7DA 4N59A 5EE9A 4HCNB 1PDXA 2GLSA 3DVGX 3IFWB 3EHVA 1C79A 1L5PA 2C5LC 2CKHB 1UBIA 2KX3A 1FD6A 3ONSA 2ZPYA 3DWMA 1HTQA 2YVCA 3RNEC 1J19A 2NTTA 1T0QC 4XDDA 3KWVA 2MLBA 3KYCD 1ZDVA 2MBQA 4RGTA 4JIOU 4CQNA 5D6JB 3ECIA 4ARCA 4ZRQA 2DNFA 1XO3A 4QAYA 1IP9A 2D11A 4GDKB 4BKTA 3A1QA 5DPTA 3TEYA 4XYCA 2J0KA 4TKNA 1WJUA 1P1AA 2K3UA 2OJRA 2X8XX 3A1QB 5IP4D 1ROEA 1V1PA 3NZ3A 4MT5A 3UGBB 3L10B 1AWDA 1T3QA 4LNOA 2CJNA 3EECA 3HHMA 3ZQ4A 3L0WB 1XF5L 3VXWA 1DYQA 3IXSA 2J0MA 3AE4B 5H92C 1F2RI 3VRBB 3EUB2 2V3PA 2PLPA 4FADA 1PGXA 4FXCA 1ESFA 2J52A 2XNAC 2KHWB 4RNAA 4KX6B 3PREA 2N7DA 3AEEB 1RFAA 2BS3B 2O2VA 4TQ0A 1QZEA 3JW0X 4IWQA 2NPTB 1E5WA 5D3IB 2NBVB 4KSLC 3TL5A 1WE7A 5C3JB 2NBWB 4JPSA 4W9JA 2KWVB 4W9DA 1XLOA 3N3KB 1V81A 3BYTB 2KTFA 3DHHC 2WXNA 1FXAA 3L4PA 2KYWA 2VRRB 2FIDA 3DBRB 2HDEA 3ZO5B 2N1WA 2WXIA 3AXCA 3QAQA 1DOXA 2KFKA 2D3AA 1VD2A 2LMCA 4FJVB 4PS3A 5BYQA 5KHOA 1I42A 2R61A 2V4IB 2IZVB 3RT3B 1WXMA 4TQ1A 4WQMA 1N61A 2BWFA 3SDLC 3HM6X 4JGHB 1TBEA 3X23A 1ZXIA 3QA8A 3R7RA 3SU8X 3L13A 2WP9B 4IM2A 4NAWA 2K39A 5I4DA 2ZZPB 4CO7A 2WDRB 5BO4B 2MW5A 1V5OA 2EKEC 1C3TA 2BYEA 1T0SC 1Y56A 3VQIA 3DVNU 2JPHA 1TS2A 4ZRJA 5LNK1 3NVYA 2JY6A 3ZRFA 4IM3A 3CSFA 1WM2A 4KZCA 1C4CA 3PRPB 2MJEA 1YQ4B 2HTME 5AUKA 5MPOA 2OOBB 3SHQA 4FJYA 1JWUD 2BT6A 4HPLB 2INDC 2XBBC 3ZNHB 1D4BA 3BVMA 2ZCBA 4DHJB 1FRRA 2Z0DB 2ZJDA 4YSZB 4URKA 4OVVA 1S3SG 3ZYYX 1NYQA 4NY0A 2O6VD 1FCLA 4LNKA 4OZAA 3PHXB 1E7UA 4ZDVA 2PMVA 1QF6A 1JCKB 4CHKA 1SF0A 2W3RA 1WR1A 3VTUA 4PS8A 2LD9A 4GN1A 4HVBA 2IO0B 1HTOA 4GIVA 1E8ZA 1QOBA 2Q5WD 3W5UB 4PYUA 1DOIA 5JZEB 2L0FA 4W9GA 3LYYA 3Q3FA 4K81A 2G1EA 3FC4A 3AU4A 1NENB 2WXOA 4HDOA 2WDTB 1VJKA 1XCTL 4WJPA 4MH0E 4ASWC 1N5WA 5CHFA 3Q2AC 1SJED 3DBRI 1VRAB 4DHZE 4IKGA 1WYGA 2KVZA 2RDHA 1PUTA 4HK2A 3BK2A 2D3BA 4IOIE 2J42A 3DWGC 3ZIMA 4WWNA 2O6VA 4ICVA 4EUTA 1KTKA 1F77A 1L2NA 1I4QA 2G3QB 2R2QA 2QEJC 5DCNA 1DOYA 2WX0A 3ZUNA 3Q3MC 2WDQB 1SEBD 3U2SC 4D2KA 2EELA 2W82A 3PO0A 4WWPA 4OW0A 4NQLB 2LEKA 4KGRA 1OQYA 2GBKA 2AQ1B 4P1CC 1VDVA 3H7PB 3BVZA 1RLFA 5AZGA 2MWSB 3KQ4A 2INNE 4LJOB 3VUWA 2AWTA 3MC8A 3PTFC 1EO6A 3H1UA 4E3CA 3MHSD 2J4XA 4HDQA 3VTWA 2AQ3B 2IO1B 1M4VA 3ZW3A 2MJ3A 3ZKJC 2KOXA 2J0JA 3DBHB 2JYEA 1R4NB 3W1YA 1H4RA 1WSPA 3WANA 3GZNB 1ZXHA 2KZRA 2CHXA 1WXVA 2SAKA 2ASQA 2L8JA 2VZKD 2ON8A 2N9XA 2PTLA 5G55A 1KRHA 1OTRB 4NJ7A 3SR6A 4OVZA 2W55A 1WGYA 1R7SA 4BKGA 2BVCA 4MELA 1ISNA 4XX5A 2KN5A 2QDFA 4B0EA 2IBIB 1FM0D 1QKZA 2V0GA 1C4PA 3NY5A 2BKFA 2H89B 4TMAB 1GOZA 5GXGB 3KUZA 2XK5A 1A5RA 2C7MB 2HJ1A 5IA7A 1P9DU 3DVGY 4NZLB 1Y8RC 1WR6E 1GB1A 2XK5B 5E6OA 2BPSA 1J7BA 5IOIA 1E7PB 1MJDA 4A8XC 2DZJA 3FILB 1TT5B 1FNUA 2ZW0A 4DK5A 1I7HA 4MJSA 2B3AA 2DBYA 1K50A 1P7FA 3CSTA 4RFBA 2Y5BB 4GU2A 1WRIA 3T3NA 3AU5A 1MHXA 4MJSB 2MA9B 4US9A 1S1QB 2N9KA 1WM3A 2JZPA 1YN3A 3V6CB 4ZHOA 5HKHA 1FCCC 1TIFA 3EGRA 3Q8FA 1GNUA 5AUIA 1JRPA 3GS2A 2WDVB 4ZYNA 2JVCA 4I6NB 2FCQA 3P42A 4AWJA 1CK1A 1Z5SB 1WXSA 1AW7A 1ZGUB 4US8A 5KHQA 1WWTA 2D2QA 2K5PA 1BUIC 4RGOS 4B95A 3ZRCA 1FPYA 2PKOA 2G4SA 1FNVA 2DYOA 4AUQC 4GOCA 2LZ6A 2KLCA 3AULA 4K7WA 5T8IA 3P1MA 1TYGB 1E7VA 3O13A 1GJZA 1ZUD2 1E8XA 4ARIA 2DYMA 1EF1A 1QILA 2I1KA 3AECB 3CIRB 4KGSA 3V61A 3BY4B 4EEWA 2Z8LA 4KKIA 1V9JA 4P16A 2B76B 3DBHI 1R4NI 1JRUA 3GZNI 1WMHA 3HK0A 3OJ4B 3K9PB 2QC8A 3R2TA 1P3QU 2KQ7A 1QT9A 2KDEB 5FR3A 2KQ4X 5E6JA 1QOAA 3HM3A 5G2NA 4L23A 3P4PB 3GE3C 4J6IA 1SE4A 1I4XA 2PPHA 4DHZB 2V9HA 3RYTA 3AE7B 4KIKA 5H8YE 3BVGA 1RM6C 4BBNC 5EE0A 3ENEA 4KIKB 2ZNVB 5BMHA 3PPAA 4UDUC 1TS4A 3UIOB 4M8MA 1I4PA 2K8BA 2DWQA 4ZRIA 3ZNZB 1TJEA 2WU2B 3OG5A 2M0AA 1NI3A 2DAJA 2W54A 2GOWA 1GC7A 4EZKA 2KDFB 1SB3C 1OGWA 1UGMA 3ML9A 1QLBB 1HZ5A 1ZOYB 1V97A 2KD0A 3A9JB 2WHIA 4WH4A 2MX2A 4GDKA 4RCOA 3RZWC 2KAJA 3FKYA 1OFFA 2KC2A 3M95A 2MH7A 1V86A 4MEMA 4A9AA 3UQAA 3Q14C 3H7SA 3ZLZA 1AN8A 4PS7A 1TGZB 4MGKE 1VZ7A 2LRUA 3KVFB 1YMHE 3MJ5A 1VZ8A 2BS4B 3QHTA 2KMCA 3URYA 5D7GA 2OEDA 3IHPC 2LUEA 4KGTA 1CMXB 2WWZA 1WI0A 5HHDG 4ZRKA 5HI1A 3QK0A 3UI3A 2GBRA 1HEZE 2L83A 1WXAA 1YOVB 3PZDA 1IUEA 2LFIA 4ACFA 2KNBA 1P7EA 2MEKA 1FRDA 1FXTB 1FMAD 1ZPSA 5BMIA 2LRWA 2KXJA 4II2B 2KX0A 3RCZA 2LGIA 2WU5B 3W1SA 2NPTA 2JRHA 1OQQA 1YJIA 3QJZA 4B9KA 3M62B 4M8NA 4DHJD 1T5XD 4LNFA 3Q69A 4WAAA 5E6PA 3JSVA 4ANVA 2QILA 1QOFA 3DPDA 2DAFA 1V6EA 5DPWA 3JSVB 1N6ZA 2L00B 4AS1A 2RMMA 3HRDD 2BTEA 2L3ZA 4WIPA 2MHJA 2KACA 3P2BA 2FIFA 2J7QB 3N1XC 4HJKA 3T8MA 3KLSX 4WJOA 5CHWA 1MG8A 3DDCB 4N9F4 2JXTA 1LO5D 2H88B 4G50A 4YSXB 1DGJA 3UINB 1NVID 3MP9A 4IG7B 4WWMA 2ZCCA 1WX7A 1B9RA 1GC6A 4G3XB 4LNIA 5LXHA 2WXJA 3R66C 2CHWA 4X57B 3B2FA 1SXTA 3VR8B 3Q8BA 3APDA 1FNWA 2QHOA 1JWMD 1YNTE 3NZUA 3W2DA 4HPMB 2JF5A 1FEHA 5EE1A 1J7AA 3NVWA 2VH1A 5BMGA 3QARA 3KYDD 1Q0WB 4C4VB 1VR9A 2ICIA 2I38A 3TMPB 2PE9A 1HXYD 2XEWA 2D07B 1IPGA 2BB6A 3AH7A 4AOFA 2IGGA 2EMSA 5EDSA 4ANXA 3U30A 1OEYA 2WXFA 2LXCA 1XCQL 2LHDA 1HE8A 3AN1A 3MFGA 3DQVA 2PVOD 1ZP0B 1UNSA 1VLBA 1WX8A 2KDMA 3SD5A 2PW9A 2IJ0A 2JQRB 2INPE 1M94A 2BWES 2R2OA 3TBLD 4LTUA 4WJQA 1V1OA 3M63B 4TUUA 2Z0EB 3H9DA 3LB8C 3VVWB 4A6QA 1TKGA 1QOGA 1TKYA 2K22A 4YL8A 4HKZE 1ZKHA 2AYOB 4DXAB 2C7HA 3QCAA 3T9LA 4HCPB 4C7YA 2RR9A 3L17A 4GB9A 1ET9A 2Y5CA 2PIAA 5AEKB 3HIZA 2QCZA 2REXA 3TEXA 1MVKA 1BMLC 1Q10A 2Z59B 5DPSA 4RGMA 2MBOA 2ZW1A 1GUAB 3AE3B 1F0ZA 1I4GA 1OEYJ 3RN9C 2DENB 1WIAA 4KVGB 2KDIA 3PHWB 2LXAA 3GP7A 4KV2A 2RD0A 4GGQA 3VUYA 3I63C 1MPEA 4BAXA 3ZVVA 2CR5A 1E6EB 4JX1C 1EU4A 3M3JA 2GRIA 3KUDB 1YQ3B 3TCAA 4M0WB 5IKCM 2QMTA 2WS3B 4F1SA 2MBHA 4ZRPA 2MP2A 2NVUI 3I9V1 1JALA 3L54A 4OHJA 3RNGC 2KWDA 2MBEA 1F2RC 4L2YA 4W9FA 1HZ6A 2MP2B 1E9MA 3H7PA 3L08A 1JQ4A 2E6XA 3BYYB 3IT6B 5DPRA 4MSQB 2V3SA 4LK0M 2NR2A 2LGDA 3MTNB 1KF6B 4MGYE 1WF9A 5J18A 4TV3A 2HJ8A 5FR6A 4IWOA 3QX1A 2KJHB 1D5MC 3BINA 3KH0A 1L0VB 2RSUA 4WAFA 2K6DB 2IDYA 4HRSA 2A5UA 2WX1A 4GDLB 2C9WB 3CF6E 1SSNA 4M00A 1L4DB 2BKRB 2JYTA 3QQ8B 1JROA 5JXVA 2PE6B 3ZXRA 1ZW7A 2QIEB 2JZ3B 4MH8A 1V80A 1UD7A 2KANA 5D3DA 2BGFA 3Q3NC 3KUCB 4LDTD 4NPNA 1TY2A 2MRPA 4LNNA 3UF8A 1K52A 3N1ZC 1UH6A 1VZ6A 3DVNV 1C77A 4A55A 3L16A 1ZE3D 4S17A 4EZJA 1U4AA 4YTPB 1K51A 2JWUA 1K8RB 2GBMA 3EFCA 1YJJA 1N60A 5D94A 1H8CA 3TJPA 4XE0A 4MACA 2PJHA 5GMVA 3WAOA 1I4HA 4YWGG 2CHZA 1R4MB 2V3NA 3BWUD 2WXHA 1EWCA 2WXGA 4ANWA 1STEA 3FILA 2D3CA 4A3PA 3A4SC 1F1HA 2FAZA 4BFRA 2DLBA 1C9FA 4G11A 5LXIB 3AMZA 2KFJA 2KJ6A 2W3SA 3Q8AA 1TS3A 4PT5A 4FHJA 3PZ8A 4JLCA 4K1RB 2JSVX 2M56B 3ZJTA 4DWFA 1E10A 3CWIA 4IW0A 3AE1B 4JWSC 2UU7A 1PGBA 3AM9A 2MQJA 3QIJA 3EC8A 4ANUA 3A4RA 2INCC 3AE6B 3VAWA 2EKIA 3FAHA 1LXDA 2D3GA 2M17A 3RNFC 4LDTB 3PSEB 4KDLB 2BBCA 4NAMA 3V3XA 2E3TA 3W9CB 3NHEB 1WJ4A 4RF0A 3NVVA 4IUMB 3AEGB 3AEBB 1YX5B 2I1JA 3O65B 3PRMB 1PYWD 1WZ0A 2N7JA 4IDIA 3VR9B 2FNJB 3B2GA 1GB4A 1CQVA 2KO3A 4AJWA 4YSYB 5CHVC 1ET6A 3S2AA 3VH3B 1TKEA 4TSSA 3VHTC 3VFKA 2V4LA 4ZOHC 2ONQA 4PYZA 2LGXA 4AJYB 2IO3B 3A33B 1YX6B 3TEZA 3APCA 3P63A 5L95C 1RWSA 1P98A 2N4FA 1TTNA 4MM3A 2I2YA 2FCSA 4C56C 4JWUC 1UF0A 4MM3B 3WAPA 3T3OA 3R2IA 3RNCC 2KQSA 2WXMA 1SIJA 2AL3A 5JHBA 1R4MI 3C8YA 1WGKA 5TSSA 1SIFA 3P4QB 1UWMA 4HWIB 1WRDB 1T6BX 3TUOA 4C00A 2AEHA 2KC1A 3PZ7A 2Y3AA 3QC8B 1OQRA 1JW9D 5C1ZA 4KSKC 2NS5A 2BQQA 2K6QA 4L1BA 3PV1A 1SGHA 2N9PC 3JVZX 1CJEA 2KDBA 3TSSA 1EF5A 2WYQA 3C0RB 2ZPNA 1HQRD 4IWPA 4RGNA 2LGSA 4LLGM 1WX9A 1L0YB 3IG3A 1L6UA 1C78A 1L0XB 2JXXA 2KK8A 4DQOC 1C76A 1K53A 1J0GA 1Q5WB 4EOYA 2KMMA 2WLBA 1WH3A 3ZJUA 2K25A 3BK1A 1I35A 1WFYA 3A9JA 2LASA 5AZHA 4N58A 1C4AA 2GBJA 3N32A 3N20C 3U4EG 3PT2B 2ZEQA 2G45B 3UQBA 1JWSD 3HUIA 4XZ4A 4KZ0A 5IN7A 1T0YA 2SEBD 3RNBC 2JT4B 1FXIA 3IAS1 1AYFA 2DZMA 2VH2A 4K3BA 3AV8A 4II3B 1L7YA 2KJRA 3I57A 5IAAC 3WAMA 2FUHB 2BF8B 3LDZE 2MBBB 2AQ2B 3P4RB 4F7ZA 2YLMA 3PRZA 1SE2A 3JYUA 5TR5A 4JQWC 1ACCA 4GLSC 3WA0A 4DXFA 4JE3B 3WALA 1J8CA 4NQKE 2N7EA 4DDGD 3J9CA 5BYRA 1D6EC 4OZBA 1LQBA 3AEAB 4OZCA 1E8YA 4YXDB 2M8SA 2KWCA 5D2MB 4FN2A 1V1PB 2L32A 2ZVNA 2NTSA 4NJ6A 4RF1A 4DXGA 1UWXA 2IGDA 3OJ3A 4E74A 4RH6A 2K8CA 4ITKA 3PS6A 2K8HA 2LJIA 4GSWA 2L1AA 3DBLB 1NBFC 2NMQA 1WGDA 4KKJA 3ZXVA 1UGJA 4RM8A 1SBBB 3NG0A 1FFUA 2OJWA 3ZJVA 2LI5A 3RMKC 1E90A 1XLNA 5AZFA 2WQYB 5C23A 2KMAA 5G5GA 2D5GA 4K3CA 4RMAA 4Q2JA 2O2VB 1F9JA 2CU1A 4AQ7A 1EWYC 3VH4B 3SEBA 4FHKA 1GG3A 2KVRA 2LVQA 2RDGA 4OVUA 2YEPB 4A90A 4USAA 2C60A 3ZNGC 4AP4C 1UELA 3HVZA 4WQOB 2JU6X 2YEPF 3PGEA 2CU3A 1TS5A 3ETRA 2L7RA 3B0AA 4P7IA 1FO4A 4A3OA 4NJCA 2K0PA 1N62A 1V2YA 2BS2B 2KFKB 3Q8CA 3HVDA
chains in the Genus database with same CATH topology
1FCCC 3EGRA 1JALA 3I9V1 2NTTA 3Q8FA 4XDDA 4OHJA 5AUIA 1JRPA 2KWDA 1XLPA 3GS2A 1F2RC 2WDVB 3KWVA 4L2YA 2QJLA 4YT0B 1ZDVA 1HZ6A 3H8HA 4RGTA 1E9MA 3NRZA 4CQNA 1KLGD 3P42A 4ARCA 1JQ4A 2E6XA 1CK1A 4O1NA 4NAWB 4ZRQA 3BYYB 3IT6B 1AW7A 3Q8EA 4US8A 4LK0M 1WWTA 2K5PA 1XO3A 1BUIC 3ABVB 4RGOS 1KF6B 2WNMA 1FFVA 2M19A 2PKOA 1FNVA 2DYOA 4GDKB 2FE8A 2GB1A 5T8IA 3P1MA 3TEYA 4HKQA 1D5MC 1L0VB 1TYGB 3O13A 2K3UA 2OHFA 1ZUD2 4WAFA 4ARIA 2DYMA 2IDYA 1N63A 4HRSA 4GDLB 1QILA 1ROEA 1V1PA 4H2AA 3MHZA 1SSNA 2AX5A 3AECB 1L4DB 3CIRB 3NZ3A 4KGSA 4MT5A 2JYTA 5JXVA 1JROA 1AWDA 1T3QA 4WURA 2GI9A 2Z8LA 4KKIA 4P16A 2CJNA 2B76B 1JMLA 3ZQ4A 2QIEB 2WXQA 1SJHD 4MH8A 3EA6A 2JX5A 1EM7A 1XF5L 5D3DA 1DYQA 1V8CA 3IXSA 4B0MA 1TY2A 3R2TA 3AE4B 5H92C 1K52A 1J7CA 1VZ6A 1F2RI 1UUPA 1ZDXA 1C77A 3VRBB 3EUB2 1QT9A 2TSSA 2V3PA 4A55A 5FR3A 1ZE3D 2KQ4X 5E6JA 2PLPA 3N9YC 1E0ZA 1PGXA 1QOAA 2FUG1 1YN5A 1TZOA 4FXCA 1ESFA 2J52A 2XNAC 4L23A 3P4PB 4YTPB 1K51A 2JWUA 2PVGC 4KX6B 4RNAA 1SE4A 1I4XA 1YJJA 1N60A 3AE8B 4XE0A 3AEEB 4MACA 5G5HA 1KFYB 1I4HA 4YWGG 2V3NA 5HG2A 3AE7B 3BWUD 5H8YE 2WXHA 1EWCA 2BS3B 3BVGA 2WXGA 4TQ0A 1RM6C 5EE0A 1STEA 3FILA 5D3IB 2WXKA 3AB5A 5C3JB 5BMHA 2DLBA 4JPSA 4UDUC 1XLOA 1TS4A 1RYJA 1C9FA 2RPVA 3BYTB 3AMZA 2G9HD 2WXNA 1FXAA 2W3SA 3L4PA 1I4PA 5FKAC 2DWQA 2HDEA 2WXIA 3P4SB 4M0WA 3Q8AA 1TS3A 2ACZB 1TJEA 4PT5A 1DOXA 2BW2A 3PZ8A 2WU2B 2M0AA 2JSVX 4P6VF 2LMCA 2M56B 3ZJTA 4HJGE 3R8BA 5BYQA 1E10A 1NI3A 3CWIA 1XLQA 2R61A 2V4IB 2W54A 3AE1B 4JWSC 4TQ1A 4WQMA 1N61A 3AE5B 1SB3C 1PGBA 1ZXIA 3AM9A 2WP9B 3U7ZA 3KWLA 1JWBD 1QLBB 5I4DA 5HFYA 3AE6B 2EKIA 3FAHA 1HZ5A 2WDRB 1ZOYB 1V97A 1IGCA 3B9JA 2WXPA 3SFEB 4WH4A 1Y56A 4RCOA 1A70A 2BBCA 1D5XC 2KAJA 3VQIA 4N6EB 4NAMA 1OFFA 3V3XA 1TS2A 2MH7A 1IBXA 5LNK1 3NVYA 4A9AA 4ZHPA 2E3TA 1AN8A 3W9CB 1JWAD 4RF0A 3NVVA 1IBXB 4REZA 3NS1A 1VZ7A 4XDCA 1C4CA 1YMHE 3AEGB 4J3OD 3AEBB 3MJ5A 4ZYSA 1VZ8A 2MJEA 1YQ4B 2HTME 5AUKA 1PYWD 5MPOA 4YTMB 2N7JA 2BS4B 1JWUD 2BT6A 1L4ZB 1KH0A 4IDIA 3URYA 5D7GA 3VR9B 2OEDA 3B2GA 1GB4A 1CQVA 1SE3A 1TY0A 4YSYB 1ET6A 4KGTA 1D4BA 1TKEA 4TSSA 1RFKA 5HHDG 5HI1A 3UI3A 1HEZE 2L83A 3BVMA 1FRRA 4ZOHC 2ONQA 4YSZB 1IUEA 3ZYYX 2LFIA 1NYQA 1FCLA 1XEEA 4OZAA 5BYSA 3TEZA 2PMVA 1QF6A 1P7EA 1JCKB 1FRDA 2MEKA 3P63A 3BIID 1FMAD 2J53A 1ZPSA 1RWSA 1SF0A 2W3RA 2LUMA 5BMIA 1BXTA 3SFDB 3NUHB 2I2YA 1FIQA 1QOBA 1YN4A 2LGIA 4C7ZA 2WU5B 4C56C 2Q5WD 3W1SA 3W5UB 4JWUC 3AE9B 4MM3B 1OQQA 1YJIA 1DOIA 3T3OA 3R2IA 1MI0A 3LYYA 2L52A 2WXMA 1SIJA 2G1EA 3FC4A 3C8YA 1WGKA 5TSSA 1NENB 3P4QB 1UWMA 1T6BX 2WXOA 3TUOA 1XXGA 1T5XD 3Q69A 3PZ7A 2Y3AA 1OQRA 1JW9D 4HEA1 2QILA 1PFDA 3AE2B 1VJKA 3VRAB 1QOFA 3IAM1 1XCTL 4L1BA 1B1ZA 1ENFA 3W5VB 1CJEA 4AS1A 2RMMA 1N5WA 3HRDD 3TSSA 4WIPA 2BTEA 2KACA 1HQRD 1SJED 1VRAB 4IKGA 4EE2A 1WYGA 4RGNA 2WXLA 4LLGM 3KLSX 1L0YB 1L6UA 1HA5A 2RDHA 1C78A 1L0XB 2JXTA 4DQOC 1C76A 1K53A 1LO5D 4C80A 1PUTA 2H88B 4YSXB 2KMMA 1DGJA 2WLBA 1NVID 3BK2A 3ZJUA 3BK1A 3MP9A 2LHEA 4XWTA 1D5ZC 4WWMA 1B9RA 4IOIE 1I4RA 2J42A 3DWGC 4N58A 1C4AA 1NEKB 3U4EG 3TEWA 2WXJA 1KTKA 1F77A 3OWEB 3E56A 3B2FA 1I4QA 1SXTA 1JWSD 3VR8B 3HUIA 3Q8BA 2QEJC 4YTNB 2XN9C 2Y5PA 1DOYA 1FNWA 2SEBD 1JWMD 2WDQB 1SEBD 1YNTE 3LXFA 3U2SC 3W2DA 4D2KA 1FXIA 1NYRA 2N9LA 1AYFA 3IAS1 2QSDA 1FEHA 2EELA 2W82A 3AV8A 3PO0A 5EE1A 4OW0A 1J7AA 3NVWA 2LEKA 4KGRA 4R3DA 4HROA 1N5XA 5BMGA 2VZKB 2AQ1B 3I57A 1VDVA 1VR9A 5C2TB 2ICIA 3BVZA 2I38A 2AQ2B 3KQ4A 2INNE 3P4RB 2BB5A 3WCQA 1SE2A 1HXYD 2K9XA 3BZDB 1ACCA 4GLSC 4DXFA 2BB6A 4JE3B 3AH7A 2J4XA 2IGGA 2IGHA 1KLUD 2BYTA 1GPXA 2AQ3B 1M4VA 1IGDA 1GAQB 2WXFA 2MJ3A 5FK9C 3J9CA 5BYRA 1D6EC 4OZBA 1XCQL 2IPKD 2KN4A 2LHDA 3AEAB 4OZCA 3AN1A 4YXDB 2MJDA 3MFGA 2JYEA 1WSPA 3V05A 3AEFB 3GB1A 1ZXHA 2X38A 1V1PB 2PVOD 1ZP0B 2L32A 1UNSA 2N0SB 2NTSA 2SAKA 4RF1A 1VLBA 1PGAA 2VZKD 1MHHE 4DXGA 2KDMA 2ON8A 1UWXA 2IGDA 2PTLA 2PW9A 2IJ0A 3E9SA 1QQRA 2JQRB 1CZPA 4RH6A 2WXRA 1EU3A 2INPE 3RPFC 1KRHA 4ITKA 1L6VA 3SR6A 4LTUA 1V1OA 4OVZA 2LJIA 3U52E 2W55A 3LB8C 1R7SA 3IT4B 2L1AA 4A6QA 1TKGA 2NMQA 4KKJA 3RFZB 4B0EA 1QOGA 1TKYA 2K22A 3NVZA 1FM0D 4HKZE 1QKZA 2V0GA 1UGJA 1C4PA 2H89B 1SBBB 4TMAB 1GOZA 5GXGB 3MC0B 1FFUA 2CJOA 3ZJVA 4C7YA 1WXQA 4NZLB 1XLNA 5EE3A 3ZGZA 2WQYB 1ET9A 2Y5CA 2PIAA 3AEDB 1GB1A 4XWWA 2FBWB 5G5GA 3TEXA 1MVKA 1J7BA 2D5GA 1BMLC 1Q10A 1E7PB 4N59A 4RGMA 4Q2JA 2ZW1A 3AE3B 4A8XC 1F0ZA 5EE9A 1I4GA 4AQ7A 1EWYC 3FILB 3GP7A 3SEBA 1FNUA 1PDXA 2ZW0A 1I7HA 2RDGA 2DBYA 1K50A 1P7FA 4RFBA 1WRIA 1C79A 1L5PA 2YEPB 3T3NA 4A90A 1MPEA 4USAA 1MHXA 4US9A 1E6EB 3HVZA 4JX1C 2JU6X 2YEPF 1EU4A 2N9KA 2GRIA 2CU3A 1FD6A 1YQ3B 2JZPA 1YN3A 1TS5A 2QMTA 3ETRA 2WS3B 1FO4A 4NJCA 2K0PA 1N62A 4ZHOA 2BS2B 3Q8CA 3HVDA 4ZRPA 3DWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RPV A;  1FCC C;  2I2Y A;  2IGG A;  2IGH A;  2KWD A;  1F2R C;  2LGI A;  1HZ6 A;  1IGD A;  4OZB A;  1XCQ L;  2KN4 A;  2LHD A;  1MI0 A;  4OZC A;  2JSV X;  4HJG E;  3GB1 A;  1ZXH A;  1PGA A;  1MHH E;  2KDM A;  2ON8 A;  1PGB A;  1UWX A;  2IGD A;  2GB1 A;  2PTL A;  2PW9 A;  1XCT L;  5HFY A;  1HZ5 A;  2RMM A;  1IGC A;  2KAC A;  4KGS A;  2NMQ A;  4IKG A;  4WH4 A;  5JXV A;  2GI9 A;  3V3X A;  4HKZ E;  1QKZ A;  1JML A;  1IBX A;  2JXT A;  1K53 A;  1EM7 A;  1XF5 L;  3MP9 A;  2LHE A;  1IBX B;  1YMH E;  1K52 A;  1F2R I;  4IOI E;  1GB1 A;  2N7J A;  1MVK A;  2KQ4 X;  1Q10 A;  2PLP A;  1KH0 A;  1PGX A;  2ZW1 A;  2OED A;  2J52 A;  3FIL B;  1GB4 A;  1K51 A;  2JWU A;  2ZW0 A;  4KGT A;  1D4B A;  1YNT E;  1K50 A;  1P7F A;  5HHD G;  4D2K A;  4MAC A;  2N9L A;  5HI1 A;  3UI3 A;  2QSD A;  1HEZ E;  2EEL A;  2ONQ A;  5HG2 A;  1MPE A;  4KGR A;  1MHX A;  5BMG A;  1FCL A;  2JU6 X;  4OZA A;  2N9K A;  3FIL A;  1FD6 A;  2JZP A;  1P7E A;  2I38 A;  2QMT A;  5BMH A;  2J53 A;  2K0P A;  5BMI A;  2LUM A;  1C9F A;  4GLS C; 
#chains in the Genus database with same CATH topology
 3B1L X;  2RDB C;  1XLP A;  3CMM B;  4YT0 B;  4GMV A;  2QJL A;  4DDI D;  4C4V A;  3H8H A;  3NRZ A;  4I6P A;  1KLG D;  2HD5 B;  2M0X A;  4O1N A;  4NAW B;  1V5T A;  4FUL A;  3Q8E A;  1T0R C;  4IM0 A;  4BBN F;  3ABV B;  1LFD A;  2WNM A;  5IO9 A;  1FFV A;  2M19 A;  4S0R A;  2ZVO A;  4FJZ A;  4W9H A;  2FE8 A;  1RRB A;  2GB1 A;  3APF A;  1V49 A;  2LWP A;  4HKQ A;  1AAR A;  4EKU A;  4NNJ B;  2OHF A;  3KW5 B;  4P1B C;  1SE9 A;  1N63 A;  1WGG A;  3DBS A;  2UYZ B;  3MHZ A;  4H2A A;  2IYD B;  2AX5 A;  2AL6 A;  3Q3O C;  4WUR A;  1XQQ A;  2DX5 B;  3NZS A;  2GI9 A;  1YD8 U;  4FBJ B;  1Q1O A;  1JML A;  5L83 A;  2WXQ A;  1SJH D;  3EA6 A;  2JX5 A;  1EM7 A;  3R7Q A;  1V8C A;  4B0M A;  4RM9 A;  3NS8 A;  1J7C A;  1UUP A;  1ZDX A;  2PEA A;  1D3Z A;  2TSS A;  2IY0 B;  3N9Y C;  1E0Z A;  2FUG 1;  5E6N A;  1WE6 A;  1TZO A;  1YN5 A;  2GBN A;  3UIP B;  2RPQ A;  2PVG C;  3DBL I;  4HLE A;  3ZTC A;  3AE8 B;  2DZK A;  3ALB A;  4GXB A;  5JHA A;  5G5H A;  1KFY B;  3OLM D;  3V6E B;  5HG2 A;  3NJT A;  2JUO A;  4HPP A;  1WGH A;  3ZTD A;  1KOT A;  1P0R A;  4LJP B;  2JZZ A;  4HXD A;  2WXK A;  3AB5 A;  3RUI B;  1NDD A;  3ZDT A;  4I6L B;  1RYJ A;  4W9I A;  4EZL A;  3PLV A;  1Z2M A;  2RPV A;  4BZA A;  2KT7 A;  2G9H D;  1KJT A;  5FKA C;  1WZ3 A;  3P4S B;  4M0W A;  4E71 A;  1LGR A;  2ACZ B;  3ZDM C;  1YIW A;  2BW2 A;  4P6V F;  4BOZ B;  1F52 A;  1MFW A;  4HJG E;  4ICU A;  3R8B A;  1YQB A;  1XLQ A;  4XGA B;  2EMT A;  5CX3 A;  4BKS D;  3AE5 B;  3Q6B A;  4BOS C;  4MGZ E;  4MGI E;  4EFO A;  3U7Z A;  4DBG A;  3KWL A;  3RD2 A;  1JWB D;  3U8Z A;  5HFY A;  3IBE A;  2A4Z A;  1IGC A;  3B9J A;  1TZ1 A;  2WXP A;  3VTV A;  4B6W A;  1XD3 B;  3MC9 A;  3SFE B;  2BYV E;  4A20 A;  1A70 A;  1D5X C;  1WY8 A;  2O6V B;  4N6E B;  2JRI B;  4XC2 A;  1IBX A;  4WWO A;  4ZHP A;  3X0W A;  4K7S A;  3QWZ B;  2DHZ A;  1JWA D;  4GDL A;  4KDI C;  2FCM A;  1IBX B;  4REZ A;  3NS1 A;  4XDC A;  4J3O D;  4ZYS A;  3DHI C;  4YTM B;  3RUL A;  3V62 A;  1UZX B;  1L4Z B;  1KH0 A;  4W9E A;  2ZNV C;  5JH5 C;  1SE3 A;  1TY0 A;  2IY1 B;  1RFK A;  2KKC A;  2KWU B;  3I3T B;  1UBQ A;  1XEE A;  3RNA C;  5BYS A;  3IVF A;  1YJ1 A;  3BII D;  3RI7 C;  2J53 A;  2HTH A;  2LUM A;  1BXT A;  1EUV B;  3SFD B;  3NUH B;  3MJW A;  3NOB A;  4BKS A;  1FIQ A;  2L76 A;  3B08 A;  4W9C A;  1YN4 A;  4C7Z A;  3AE9 B;  1RAX A;  1KLV A;  1MI0 A;  1KM7 A;  2K1F A;  2L52 A;  2RGF A;  4PK1 A;  3GOE A;  3DHG C;  2M1M A;  1XXG A;  2DYB A;  3Q3J A;  2KLG A;  3N1Y C;  3ML8 A;  2GMI C;  2NCN A;  4HEA 1;  1PFD A;  2LGY A;  3AE2 B;  4IC7 B;  3VRA B;  4MSM B;  3V60 A;  3IAM 1;  4FA6 A;  1B1Z A;  1ENF A;  3W5V B;  2LVO A;  4MDK E;  5J2R A;  3PLU A;  4F8C B;  2LJ5 A;  2L0T A;  2WGS A;  4EE2 A;  1MG4 A;  2M4N A;  1WYW B;  2WXL A;  1HA5 A;  4CYE A;  4WJN A;  2G4D B;  1C1Y B;  4C80 A;  1VCB A;  4M02 A;  3H6N A;  4XWT A;  2LHE A;  1D5Z C;  2N9E B;  2MCN B;  1I4R A;  1WGR A;  1E8W A;  3I5J C;  1NEK B;  4JL9 A;  3TEW A;  2L05 A;  3OWE B;  3E56 A;  4FLH A;  1BT0 A;  3EFU A;  1X1M A;  2BYF A;  4YTN B;  2XN9 C;  2Y5P A;  3DOW A;  2D10 A;  4M01 A;  5CTR C;  3WIM A;  3LXF A;  1NYR A;  2N9L A;  2QSD A;  3PVL A;  2DZI A;  3C19 A;  4R3D A;  4HRO A;  1N5X A;  2VZK B;  3GE8 C;  2HE7 A;  5C2T B;  2LVP A;  3W1S C;  3RZF A;  4W9K A;  5J17 A;  2BB5 A;  3WCQ A;  2K9X A;  3AI5 A;  3BZD B;  3VDZ A;  3LJ3 A;  2IGH A;  1KLU D;  2CS4 A;  4LCD E;  2V1Y A;  2BYT A;  1GPX A;  1IYF A;  1IGD A;  1GAQ B;  2MSE D;  5FK9 C;  3K9O B;  2N1V A;  2IPK D;  2KN4 A;  3A9K A;  3TIX A;  1PQS A;  2MJD A;  4K7U A;  4BVU C;  4G0N B;  3V05 A;  3AEF B;  3GB1 A;  3R3M A;  2X38 A;  3A9K B;  1WJN A;  2N0S B;  1PGA A;  1MHH E;  3E9S A;  1QQR A;  1CZP A;  2IO2 B;  2NBU A;  2WXR A;  1EU3 A;  3RPF C;  2W9N A;  1G6J A;  1L6V A;  1WMH B;  3U52 E;  3IT4 B;  4W9L A;  3RFZ B;  3D32 A;  2JWZ A;  3NVZ A;  1WJ6 A;  1NI2 A;  5LLI A;  3VUX A;  2KTR A;  3MC0 B;  2CJO A;  1LM8 B;  1WXQ A;  3DCG A;  1XT9 B;  3N30 A;  2C7N B;  2KTR B;  5EE3 A;  3OAW A;  3ZGZ A;  2FCN A;  3AED B;  4XWW A;  2FBW B;  2UWQ A;  3ZNI D;  3U7D A;  4N59 A;  5EE9 A;  4HCN B;  1PDX A;  2GLS A;  3DVG X;  3IFW B;  3EHV A;  1C79 A;  1L5P A;  2C5L C;  2CKH B;  1UBI A;  2KX3 A;  1FD6 A;  3ONS A;  2ZPY A;  3DWM A;  1HTQ A;  2YVC A;  3RNE C;  1J19 A;  2NTT A;  1T0Q C;  4XDD A;  3KWV A;  2MLB A;  3KYC D;  1ZDV A;  2MBQ A;  4RGT A;  4JIO U;  4CQN A;  5D6J B;  3ECI A;  4ARC A;  4ZRQ A;  2DNF A;  1XO3 A;  4QAY A;  1IP9 A;  2D11 A;  4GDK B;  4BKT A;  3A1Q A;  5DPT A;  3TEY A;  4XYC A;  2J0K A;  4TKN A;  1WJU A;  1P1A A;  2K3U A;  2OJR A;  2X8X X;  3A1Q B;  5IP4 D;  1ROE A;  1V1P A;  3NZ3 A;  4MT5 A;  3UGB B;  3L10 B;  1AWD A;  1T3Q A;  4LNO A;  2CJN A;  3EEC A;  3HHM A;  3ZQ4 A;  3L0W B;  1XF5 L;  3VXW A;  1DYQ A;  3IXS A;  2J0M A;  3AE4 B;  5H92 C;  1F2R I;  3VRB B;  3EUB 2;  2V3P A;  2PLP A;  4FAD A;  1PGX A;  4FXC A;  1ESF A;  2J52 A;  2XNA C;  2KHW B;  4RNA A;  4KX6 B;  3PRE A;  2N7D A;  3AEE B;  1RFA A;  2BS3 B;  2O2V A;  4TQ0 A;  1QZE A;  3JW0 X;  4IWQ A;  2NPT B;  1E5W A;  5D3I B;  2NBV B;  4KSL C;  3TL5 A;  1WE7 A;  5C3J B;  2NBW B;  4JPS A;  4W9J A;  2KWV B;  4W9D A;  1XLO A;  3N3K B;  1V81 A;  3BYT B;  2KTF A;  3DHH C;  2WXN A;  1FXA A;  3L4P A;  2KYW A;  2VRR B;  2FID A;  3DBR B;  2HDE A;  3ZO5 B;  2N1W A;  2WXI A;  3AXC A;  3QAQ A;  1DOX A;  2KFK A;  2D3A A;  1VD2 A;  2LMC A;  4FJV B;  4PS3 A;  5BYQ A;  5KHO A;  1I42 A;  2R61 A;  2V4I B;  2IZV B;  3RT3 B;  1WXM A;  4TQ1 A;  4WQM A;  1N61 A;  2BWF A;  3SDL C;  3HM6 X;  4JGH B;  1TBE A;  3X23 A;  1ZXI A;  3QA8 A;  3R7R A;  3SU8 X;  3L13 A;  2WP9 B;  4IM2 A;  4NAW A;  2K39 A;  5I4D A;  2ZZP B;  4CO7 A;  2WDR B;  5BO4 B;  2MW5 A;  1V5O A;  2EKE C;  1C3T A;  2BYE A;  1T0S C;  1Y56 A;  3VQI A;  3DVN U;  2JPH A;  1TS2 A;  4ZRJ A;  5LNK 1;  3NVY A;  2JY6 A;  3ZRF A;  4IM3 A;  3CSF A;  1WM2 A;  4KZC A;  1C4C A;  3PRP B;  2MJE A;  1YQ4 B;  2HTM E;  5AUK A;  5MPO A;  2OOB B;  3SHQ A;  4FJY A;  1JWU D;  2BT6 A;  4HPL B;  2IND C;  2XBB C;  3ZNH B;  1D4B A;  3BVM A;  2ZCB A;  4DHJ B;  1FRR A;  2Z0D B;  2ZJD A;  4YSZ B;  4URK A;  4OVV A;  1S3S G;  3ZYY X;  1NYQ A;  4NY0 A;  2O6V D;  1FCL A;  4LNK A;  4OZA A;  3PHX B;  1E7U A;  4ZDV A;  2PMV A;  1QF6 A;  1JCK B;  4CHK A;  1SF0 A;  2W3R A;  1WR1 A;  3VTU A;  4PS8 A;  2LD9 A;  4GN1 A;  4HVB A;  2IO0 B;  1HTO A;  4GIV A;  1E8Z A;  1QOB A;  2Q5W D;  3W5U B;  4PYU A;  1DOI A;  5JZE B;  2L0F A;  4W9G A;  3LYY A;  3Q3F A;  4K81 A;  2G1E A;  3FC4 A;  3AU4 A;  1NEN B;  2WXO A;  4HDO A;  2WDT B;  1VJK A;  1XCT L;  4WJP A;  4MH0 E;  4ASW C;  1N5W A;  5CHF A;  3Q2A C;  1SJE D;  3DBR I;  1VRA B;  4DHZ E;  4IKG A;  1WYG A;  2KVZ A;  2RDH A;  1PUT A;  4HK2 A;  3BK2 A;  2D3B A;  4IOI E;  2J42 A;  3DWG C;  3ZIM A;  4WWN A;  2O6V A;  4ICV A;  4EUT A;  1KTK A;  1F77 A;  1L2N A;  1I4Q A;  2G3Q B;  2R2Q A;  2QEJ C;  5DCN A;  1DOY A;  2WX0 A;  3ZUN A;  3Q3M C;  2WDQ B;  1SEB D;  3U2S C;  4D2K A;  2EEL A;  2W82 A;  3PO0 A;  4WWP A;  4OW0 A;  4NQL B;  2LEK A;  4KGR A;  1OQY A;  2GBK A;  2AQ1 B;  4P1C C;  1VDV A;  3H7P B;  3BVZ A;  1RLF A;  5AZG A;  2MWS B;  3KQ4 A;  2INN E;  4LJO B;  3VUW A;  2AWT A;  3MC8 A;  3PTF C;  1EO6 A;  3H1U A;  4E3C A;  3MHS D;  2J4X A;  4HDQ A;  3VTW A;  2AQ3 B;  2IO1 B;  1M4V A;  3ZW3 A;  2MJ3 A;  3ZKJ C;  2KOX A;  2J0J A;  3DBH B;  2JYE A;  1R4N B;  3W1Y A;  1H4R A;  1WSP A;  3WAN A;  3GZN B;  1ZXH A;  2KZR A;  2CHX A;  1WXV A;  2SAK A;  2ASQ A;  2L8J A;  2VZK D;  2ON8 A;  2N9X A;  2PTL A;  5G55 A;  1KRH A;  1OTR B;  4NJ7 A;  3SR6 A;  4OVZ A;  2W55 A;  1WGY A;  1R7S A;  4BKG A;  2BVC A;  4MEL A;  1ISN A;  4XX5 A;  2KN5 A;  2QDF A;  4B0E A;  2IBI B;  1FM0 D;  1QKZ A;  2V0G A;  1C4P A;  3NY5 A;  2BKF A;  2H89 B;  4TMA B;  1GOZ A;  5GXG B;  3KUZ A;  2XK5 A;  1A5R A;  2C7M B;  2HJ1 A;  5IA7 A;  1P9D U;  3DVG Y;  4NZL B;  1Y8R C;  1WR6 E;  1GB1 A;  2XK5 B;  5E6O A;  2BPS A;  1J7B A;  5IOI A;  1E7P B;  1MJD A;  4A8X C;  2DZJ A;  3FIL B;  1TT5 B;  1FNU A;  2ZW0 A;  4DK5 A;  1I7H A;  4MJS A;  2B3A A;  2DBY A;  1K50 A;  1P7F A;  3CST A;  4RFB A;  2Y5B B;  4GU2 A;  1WRI A;  3T3N A;  3AU5 A;  1MHX A;  4MJS B;  2MA9 B;  4US9 A;  1S1Q B;  2N9K A;  1WM3 A;  2JZP A;  1YN3 A;  3V6C B;  4ZHO A;  5HKH A;  1FCC C;  1TIF A;  3EGR A;  3Q8F A;  1GNU A;  5AUI A;  1JRP A;  3GS2 A;  2WDV B;  4ZYN A;  2JVC A;  4I6N B;  2FCQ A;  3P42 A;  4AWJ A;  1CK1 A;  1Z5S B;  1WXS A;  1AW7 A;  1ZGU B;  4US8 A;  5KHQ A;  1WWT A;  2D2Q A;  2K5P A;  1BUI C;  4RGO S;  4B95 A;  3ZRC A;  1FPY A;  2PKO A;  2G4S A;  1FNV A;  2DYO A;  4AUQ C;  4GOC A;  2LZ6 A;  2KLC A;  3AUL A;  4K7W A;  5T8I A;  3P1M A;  1TYG B;  1E7V A;  3O13 A;  1GJZ A;  1ZUD 2;  1E8X A;  4ARI A;  2DYM A;  1EF1 A;  1QIL A;  2I1K A;  3AEC B;  3CIR B;  4KGS A;  3V61 A;  3BY4 B;  4EEW A;  2Z8L A;  4KKI A;  1V9J A;  4P16 A;  2B76 B;  3DBH I;  1R4N I;  1JRU A;  3GZN I;  1WMH A;  3HK0 A;  3OJ4 B;  3K9P B;  2QC8 A;  3R2T A;  1P3Q U;  2KQ7 A;  1QT9 A;  2KDE B;  5FR3 A;  2KQ4 X;  5E6J A;  1QOA A;  3HM3 A;  5G2N A;  4L23 A;  3P4P B;  3GE3 C;  4J6I A;  1SE4 A;  1I4X A;  2PPH A;  4DHZ B;  2V9H A;  3RYT A;  3AE7 B;  4KIK A;  5H8Y E;  3BVG A;  1RM6 C;  4BBN C;  5EE0 A;  3ENE A;  4KIK B;  2ZNV B;  5BMH A;  3PPA A;  4UDU C;  1TS4 A;  3UIO B;  4M8M A;  1I4P A;  2K8B A;  2DWQ A;  4ZRI A;  3ZNZ B;  1TJE A;  2WU2 B;  3OG5 A;  2M0A A;  1NI3 A;  2DAJ A;  2W54 A;  2GOW A;  1GC7 A;  4EZK A;  2KDF B;  1SB3 C;  1OGW A;  1UGM A;  3ML9 A;  1QLB B;  1HZ5 A;  1ZOY B;  1V97 A;  2KD0 A;  3A9J B;  2WHI A;  4WH4 A;  2MX2 A;  4GDK A;  4RCO A;  3RZW C;  2KAJ A;  3FKY A;  1OFF A;  2KC2 A;  3M95 A;  2MH7 A;  1V86 A;  4MEM A;  4A9A A;  3UQA A;  3Q14 C;  3H7S A;  3ZLZ A;  1AN8 A;  4PS7 A;  1TGZ B;  4MGK E;  1VZ7 A;  2LRU A;  3KVF B;  1YMH E;  3MJ5 A;  1VZ8 A;  2BS4 B;  3QHT A;  2KMC A;  3URY A;  5D7G A;  2OED A;  3IHP C;  2LUE A;  4KGT A;  1CMX B;  2WWZ A;  1WI0 A;  5HHD G;  4ZRK A;  5HI1 A;  3QK0 A;  3UI3 A;  2GBR A;  1HEZ E;  2L83 A;  1WXA A;  1YOV B;  3PZD A;  1IUE A;  2LFI A;  4ACF A;  2KNB A;  1P7E A;  2MEK A;  1FRD A;  1FXT B;  1FMA D;  1ZPS A;  5BMI A;  2LRW A;  2KXJ A;  4II2 B;  2KX0 A;  3RCZ A;  2LGI A;  2WU5 B;  3W1S A;  2NPT A;  2JRH A;  1OQQ A;  1YJI A;  3QJZ A;  4B9K A;  3M62 B;  4M8N A;  4DHJ D;  1T5X D;  4LNF A;  3Q69 A;  4WAA A;  5E6P A;  3JSV A;  4ANV A;  2QIL A;  1QOF A;  3DPD A;  2DAF A;  1V6E A;  5DPW A;  3JSV B;  1N6Z A;  2L00 B;  4AS1 A;  2RMM A;  3HRD D;  2BTE A;  2L3Z A;  4WIP A;  2MHJ A;  2KAC A;  3P2B A;  2FIF A;  2J7Q B;  3N1X C;  4HJK A;  3T8M A;  3KLS X;  4WJO A;  5CHW A;  1MG8 A;  3DDC B;  4N9F 4;  2JXT A;  1LO5 D;  2H88 B;  4G50 A;  4YSX B;  1DGJ A;  3UIN B;  1NVI D;  3MP9 A;  4IG7 B;  4WWM A;  2ZCC A;  1WX7 A;  1B9R A;  1GC6 A;  4G3X B;  4LNI A;  5LXH A;  2WXJ A;  3R66 C;  2CHW A;  4X57 B;  3B2F A;  1SXT A;  3VR8 B;  3Q8B A;  3APD A;  1FNW A;  2QHO A;  1JWM D;  1YNT E;  3NZU A;  3W2D A;  4HPM B;  2JF5 A;  1FEH A;  5EE1 A;  1J7A A;  3NVW A;  2VH1 A;  5BMG A;  3QAR A;  3KYD D;  1Q0W B;  4C4V B;  1VR9 A;  2ICI A;  2I38 A;  3TMP B;  2PE9 A;  1HXY D;  2XEW A;  2D07 B;  1IPG A;  2BB6 A;  3AH7 A;  4AOF A;  2IGG A;  2EMS A;  5EDS A;  4ANX A;  3U30 A;  1OEY A;  2WXF A;  2LXC A;  1XCQ L;  2LHD A;  1HE8 A;  3AN1 A;  3MFG A;  3DQV A;  2PVO D;  1ZP0 B;  1UNS A;  1VLB A;  1WX8 A;  2KDM A;  3SD5 A;  2PW9 A;  2IJ0 A;  2JQR B;  2INP E;  1M94 A;  2BWE S;  2R2O A;  3TBL D;  4LTU A;  4WJQ A;  1V1O A;  3M63 B;  4TUU A;  2Z0E B;  3H9D A;  3LB8 C;  3VVW B;  4A6Q A;  1TKG A;  1QOG A;  1TKY A;  2K22 A;  4YL8 A;  4HKZ E;  1ZKH A;  2AYO B;  4DXA B;  2C7H A;  3QCA A;  3T9L A;  4HCP B;  4C7Y A;  2RR9 A;  3L17 A;  4GB9 A;  1ET9 A;  2Y5C A;  2PIA A;  5AEK B;  3HIZ A;  2QCZ A;  2REX A;  3TEX A;  1MVK A;  1BML C;  1Q10 A;  2Z59 B;  5DPS A;  4RGM A;  2MBO A;  2ZW1 A;  1GUA B;  3AE3 B;  1F0Z A;  1I4G A;  1OEY J;  3RN9 C;  2DEN B;  1WIA A;  4KVG B;  2KDI A;  3PHW B;  2LXA A;  3GP7 A;  4KV2 A;  2RD0 A;  4GGQ A;  3VUY A;  3I63 C;  1MPE A;  4BAX A;  3ZVV A;  2CR5 A;  1E6E B;  4JX1 C;  1EU4 A;  3M3J A;  2GRI A;  3KUD B;  1YQ3 B;  3TCA A;  4M0W B;  5IKC M;  2QMT A;  2WS3 B;  4F1S A;  2MBH A;  4ZRP A;  2MP2 A;  2NVU I;  3I9V 1;  1JAL A;  3L54 A;  4OHJ A;  3RNG C;  2KWD A;  2MBE A;  1F2R C;  4L2Y A;  4W9F A;  1HZ6 A;  2MP2 B;  1E9M A;  3H7P A;  3L08 A;  1JQ4 A;  2E6X A;  3BYY B;  3IT6 B;  5DPR A;  4MSQ B;  2V3S A;  4LK0 M;  2NR2 A;  2LGD A;  3MTN B;  1KF6 B;  4MGY E;  1WF9 A;  5J18 A;  4TV3 A;  2HJ8 A;  5FR6 A;  4IWO A;  3QX1 A;  2KJH B;  1D5M C;  3BIN A;  3KH0 A;  1L0V B;  2RSU A;  4WAF A;  2K6D B;  2IDY A;  4HRS A;  2A5U A;  2WX1 A;  4GDL B;  2C9W B;  3CF6 E;  1SSN A;  4M00 A;  1L4D B;  2BKR B;  2JYT A;  3QQ8 B;  1JRO A;  5JXV A;  2PE6 B;  3ZXR A;  1ZW7 A;  2QIE B;  2JZ3 B;  4MH8 A;  1V80 A;  1UD7 A;  2KAN A;  5D3D A;  2BGF A;  3Q3N C;  3KUC B;  4LDT D;  4NPN A;  1TY2 A;  2MRP A;  4LNN A;  3UF8 A;  1K52 A;  3N1Z C;  1UH6 A;  1VZ6 A;  3DVN V;  1C77 A;  4A55 A;  3L16 A;  1ZE3 D;  4S17 A;  4EZJ A;  1U4A A;  4YTP B;  1K51 A;  2JWU A;  1K8R B;  2GBM A;  3EFC A;  1YJJ A;  1N60 A;  5D94 A;  1H8C A;  3TJP A;  4XE0 A;  4MAC A;  2PJH A;  5GMV A;  3WAO A;  1I4H A;  4YWG G;  2CHZ A;  1R4M B;  2V3N A;  3BWU D;  2WXH A;  1EWC A;  2WXG A;  4ANW A;  1STE A;  3FIL A;  2D3C A;  4A3P A;  3A4S C;  1F1H A;  2FAZ A;  4BFR A;  2DLB A;  1C9F A;  4G11 A;  5LXI B;  3AMZ A;  2KFJ A;  2KJ6 A;  2W3S A;  3Q8A A;  1TS3 A;  4PT5 A;  4FHJ A;  3PZ8 A;  4JLC A;  4K1R B;  2JSV X;  2M56 B;  3ZJT A;  4DWF A;  1E10 A;  3CWI A;  4IW0 A;  3AE1 B;  4JWS C;  2UU7 A;  1PGB A;  3AM9 A;  2MQJ A;  3QIJ A;  3EC8 A;  4ANU A;  3A4R A;  2INC C;  3AE6 B;  3VAW A;  2EKI A;  3FAH A;  1LXD A;  2D3G A;  2M17 A;  3RNF C;  4LDT B;  3PSE B;  4KDL B;  2BBC A;  4NAM A;  3V3X A;  2E3T A;  3W9C B;  3NHE B;  1WJ4 A;  4RF0 A;  3NVV A;  4IUM B;  3AEG B;  3AEB B;  1YX5 B;  2I1J A;  3O65 B;  3PRM B;  1PYW D;  1WZ0 A;  2N7J A;  4IDI A;  3VR9 B;  2FNJ B;  3B2G A;  1GB4 A;  1CQV A;  2KO3 A;  4AJW A;  4YSY B;  5CHV C;  1ET6 A;  3S2A A;  3VH3 B;  1TKE A;  4TSS A;  3VHT C;  3VFK A;  2V4L A;  4ZOH C;  2ONQ A;  4PYZ A;  2LGX A;  4AJY B;  2IO3 B;  3A33 B;  1YX6 B;  3TEZ A;  3APC A;  3P63 A;  5L95 C;  1RWS A;  1P98 A;  2N4F A;  1TTN A;  4MM3 A;  2I2Y A;  2FCS A;  4C56 C;  4JWU C;  1UF0 A;  4MM3 B;  3WAP A;  3T3O A;  3R2I A;  3RNC C;  2KQS A;  2WXM A;  1SIJ A;  2AL3 A;  5JHB A;  1R4M I;  3C8Y A;  1WGK A;  5TSS A;  1SIF A;  3P4Q B;  1UWM A;  4HWI B;  1WRD B;  1T6B X;  3TUO A;  4C00 A;  2AEH A;  2KC1 A;  3PZ7 A;  2Y3A A;  3QC8 B;  1OQR A;  1JW9 D;  5C1Z A;  4KSK C;  2NS5 A;  2BQQ A;  2K6Q A;  4L1B A;  3PV1 A;  1SGH A;  2N9P C;  3JVZ X;  1CJE A;  2KDB A;  3TSS A;  1EF5 A;  2WYQ A;  3C0R B;  2ZPN A;  1HQR D;  4IWP A;  4RGN A;  2LGS A;  4LLG M;  1WX9 A;  1L0Y B;  3IG3 A;  1L6U A;  1C78 A;  1L0X B;  2JXX A;  2KK8 A;  4DQO C;  1C76 A;  1K53 A;  1J0G A;  1Q5W B;  4EOY A;  2KMM A;  2WLB A;  1WH3 A;  3ZJU A;  2K25 A;  3BK1 A;  1I35 A;  1WFY A;  3A9J A;  2LAS A;  5AZH A;  4N58 A;  1C4A A;  2GBJ A;  3N32 A;  3N20 C;  3U4E G;  3PT2 B;  2ZEQ A;  2G45 B;  3UQB A;  1JWS D;  3HUI A;  4XZ4 A;  4KZ0 A;  5IN7 A;  1T0Y A;  2SEB D;  3RNB C;  2JT4 B;  1FXI A;  3IAS 1;  1AYF A;  2DZM A;  2VH2 A;  4K3B A;  3AV8 A;  4II3 B;  1L7Y A;  2KJR A;  3I57 A;  5IAA C;  3WAM A;  2FUH B;  2BF8 B;  3LDZ E;  2MBB B;  2AQ2 B;  3P4R B;  4F7Z A;  2YLM A;  3PRZ A;  1SE2 A;  3JYU A;  5TR5 A;  4JQW C;  1ACC A;  4GLS C;  3WA0 A;  4DXF A;  4JE3 B;  3WAL A;  1J8C A;  4NQK E;  2N7E A;  4DDG D;  3J9C A;  5BYR A;  1D6E C;  4OZB A;  1LQB A;  3AEA B;  4OZC A;  1E8Y A;  4YXD B;  2M8S A;  2KWC A;  5D2M B;  4FN2 A;  1V1P B;  2L32 A;  2ZVN A;  2NTS A;  4NJ6 A;  4RF1 A;  4DXG A;  1UWX A;  2IGD A;  3OJ3 A;  4E74 A;  4RH6 A;  2K8C A;  4ITK A;  3PS6 A;  2K8H A;  2LJI A;  4GSW A;  2L1A A;  3DBL B;  1NBF C;  2NMQ A;  1WGD A;  4KKJ A;  3ZXV A;  1UGJ A;  4RM8 A;  1SBB B;  3NG0 A;  1FFU A;  2OJW A;  3ZJV A;  2LI5 A;  3RMK C;  1E90 A;  1XLN A;  5AZF A;  2WQY B;  5C23 A;  2KMA A;  5G5G A;  2D5G A;  4K3C A;  4RMA A;  4Q2J A;  2O2V B;  1F9J A;  2CU1 A;  4AQ7 A;  1EWY C;  3VH4 B;  3SEB A;  4FHK A;  1GG3 A;  2KVR A;  2LVQ A;  2RDG A;  4OVU A;  2YEP B;  4A90 A;  4USA A;  2C60 A;  3ZNG C;  4AP4 C;  1UEL A;  3HVZ A;  4WQO B;  2JU6 X;  2YEP F;  3PGE A;  2CU3 A;  1TS5 A;  3ETR A;  2L7R A;  3B0A A;  4P7I A;  1FO4 A;  4A3O A;  4NJC A;  2K0P A;  1N62 A;  1V2Y A;  2BS2 B;  2KFK B;  3Q8C A;  3HVD A; 
#chains in the Genus database with same CATH homology
 1FCC C;  3EGR A;  1JAL A;  3I9V 1;  2NTT A;  3Q8F A;  4XDD A;  4OHJ A;  5AUI A;  1JRP A;  2KWD A;  1XLP A;  3GS2 A;  1F2R C;  2WDV B;  3KWV A;  4L2Y A;  2QJL A;  4YT0 B;  1ZDV A;  1HZ6 A;  3H8H A;  4RGT A;  1E9M A;  3NRZ A;  4CQN A;  1KLG D;  3P42 A;  4ARC A;  1JQ4 A;  2E6X A;  1CK1 A;  4O1N A;  4NAW B;  4ZRQ A;  3BYY B;  3IT6 B;  1AW7 A;  3Q8E A;  4US8 A;  4LK0 M;  1WWT A;  2K5P A;  1XO3 A;  1BUI C;  3ABV B;  4RGO S;  1KF6 B;  2WNM A;  1FFV A;  2M19 A;  2PKO A;  1FNV A;  2DYO A;  4GDK B;  2FE8 A;  2GB1 A;  5T8I A;  3P1M A;  3TEY A;  4HKQ A;  1D5M C;  1L0V B;  1TYG B;  3O13 A;  2K3U A;  2OHF A;  1ZUD 2;  4WAF A;  4ARI A;  2DYM A;  2IDY A;  1N63 A;  4HRS A;  4GDL B;  1QIL A;  1ROE A;  1V1P A;  4H2A A;  3MHZ A;  1SSN A;  2AX5 A;  3AEC B;  1L4D B;  3CIR B;  3NZ3 A;  4KGS A;  4MT5 A;  2JYT A;  5JXV A;  1JRO A;  1AWD A;  1T3Q A;  4WUR A;  2GI9 A;  2Z8L A;  4KKI A;  4P16 A;  2CJN A;  2B76 B;  1JML A;  3ZQ4 A;  2QIE B;  2WXQ A;  1SJH D;  4MH8 A;  3EA6 A;  2JX5 A;  1EM7 A;  1XF5 L;  5D3D A;  1DYQ A;  1V8C A;  3IXS A;  4B0M A;  1TY2 A;  3R2T A;  3AE4 B;  5H92 C;  1K52 A;  1J7C A;  1VZ6 A;  1F2R I;  1UUP A;  1ZDX A;  1C77 A;  3VRB B;  3EUB 2;  1QT9 A;  2TSS A;  2V3P A;  4A55 A;  5FR3 A;  1ZE3 D;  2KQ4 X;  5E6J A;  2PLP A;  3N9Y C;  1E0Z A;  1PGX A;  1QOA A;  2FUG 1;  1YN5 A;  1TZO A;  4FXC A;  1ESF A;  2J52 A;  2XNA C;  4L23 A;  3P4P B;  4YTP B;  1K51 A;  2JWU A;  2PVG C;  4KX6 B;  4RNA A;  1SE4 A;  1I4X A;  1YJJ A;  1N60 A;  3AE8 B;  4XE0 A;  3AEE B;  4MAC A;  5G5H A;  1KFY B;  1I4H A;  4YWG G;  2V3N A;  5HG2 A;  3AE7 B;  3BWU D;  5H8Y E;  2WXH A;  1EWC A;  2BS3 B;  3BVG A;  2WXG A;  4TQ0 A;  1RM6 C;  5EE0 A;  1STE A;  3FIL A;  5D3I B;  2WXK A;  3AB5 A;  5C3J B;  5BMH A;  2DLB A;  4JPS A;  4UDU C;  1XLO A;  1TS4 A;  1RYJ A;  1C9F A;  2RPV A;  3BYT B;  3AMZ A;  2G9H D;  2WXN A;  1FXA A;  2W3S A;  3L4P A;  1I4P A;  5FKA C;  2DWQ A;  2HDE A;  2WXI A;  3P4S B;  4M0W A;  3Q8A A;  1TS3 A;  2ACZ B;  1TJE A;  4PT5 A;  1DOX A;  2BW2 A;  3PZ8 A;  2WU2 B;  2M0A A;  2JSV X;  4P6V F;  2LMC A;  2M56 B;  3ZJT A;  4HJG E;  3R8B A;  5BYQ A;  1E10 A;  1NI3 A;  3CWI A;  1XLQ A;  2R61 A;  2V4I B;  2W54 A;  3AE1 B;  4JWS C;  4TQ1 A;  4WQM A;  1N61 A;  3AE5 B;  1SB3 C;  1PGB A;  1ZXI A;  3AM9 A;  2WP9 B;  3U7Z A;  3KWL A;  1JWB D;  1QLB B;  5I4D A;  5HFY A;  3AE6 B;  2EKI A;  3FAH A;  1HZ5 A;  2WDR B;  1ZOY B;  1V97 A;  1IGC A;  3B9J A;  2WXP A;  3SFE B;  4WH4 A;  1Y56 A;  4RCO A;  1A70 A;  2BBC A;  1D5X C;  2KAJ A;  3VQI A;  4N6E B;  4NAM A;  1OFF A;  3V3X A;  1TS2 A;  2MH7 A;  1IBX A;  5LNK 1;  3NVY A;  4A9A A;  4ZHP A;  2E3T A;  1AN8 A;  3W9C B;  1JWA D;  4RF0 A;  3NVV A;  1IBX B;  4REZ A;  3NS1 A;  1VZ7 A;  4XDC A;  1C4C A;  1YMH E;  3AEG B;  4J3O D;  3AEB B;  3MJ5 A;  4ZYS A;  1VZ8 A;  2MJE A;  1YQ4 B;  2HTM E;  5AUK A;  1PYW D;  5MPO A;  4YTM B;  2N7J A;  2BS4 B;  1JWU D;  2BT6 A;  1L4Z B;  1KH0 A;  4IDI A;  3URY A;  5D7G A;  3VR9 B;  2OED A;  3B2G A;  1GB4 A;  1CQV A;  1SE3 A;  1TY0 A;  4YSY B;  1ET6 A;  4KGT A;  1D4B A;  1TKE A;  4TSS A;  1RFK A;  5HHD G;  5HI1 A;  3UI3 A;  1HEZ E;  2L83 A;  3BVM A;  1FRR A;  4ZOH C;  2ONQ A;  4YSZ B;  1IUE A;  3ZYY X;  2LFI A;  1NYQ A;  1FCL A;  1XEE A;  4OZA A;  5BYS A;  3TEZ A;  2PMV A;  1QF6 A;  1P7E A;  1JCK B;  1FRD A;  2MEK A;  3P63 A;  3BII D;  1FMA D;  2J53 A;  1ZPS A;  1RWS A;  1SF0 A;  2W3R A;  2LUM A;  5BMI A;  1BXT A;  3SFD B;  3NUH B;  2I2Y A;  1FIQ A;  1QOB A;  1YN4 A;  2LGI A;  4C7Z A;  2WU5 B;  4C56 C;  2Q5W D;  3W1S A;  3W5U B;  4JWU C;  3AE9 B;  4MM3 B;  1OQQ A;  1YJI A;  1DOI A;  3T3O A;  3R2I A;  1MI0 A;  3LYY A;  2L52 A;  2WXM A;  1SIJ A;  2G1E A;  3FC4 A;  3C8Y A;  1WGK A;  5TSS A;  1NEN B;  3P4Q B;  1UWM A;  1T6B X;  2WXO A;  3TUO A;  1XXG A;  1T5X D;  3Q69 A;  3PZ7 A;  2Y3A A;  1OQR A;  1JW9 D;  4HEA 1;  2QIL A;  1PFD A;  3AE2 B;  1VJK A;  3VRA B;  1QOF A;  3IAM 1;  1XCT L;  4L1B A;  1B1Z A;  1ENF A;  3W5V B;  1CJE A;  4AS1 A;  2RMM A;  1N5W A;  3HRD D;  3TSS A;  4WIP A;  2BTE A;  2KAC A;  1HQR D;  1SJE D;  1VRA B;  4IKG A;  4EE2 A;  1WYG A;  4RGN A;  2WXL A;  4LLG M;  3KLS X;  1L0Y B;  1L6U A;  1HA5 A;  2RDH A;  1C78 A;  1L0X B;  2JXT A;  4DQO C;  1C76 A;  1K53 A;  1LO5 D;  4C80 A;  1PUT A;  2H88 B;  4YSX B;  2KMM A;  1DGJ A;  2WLB A;  1NVI D;  3BK2 A;  3ZJU A;  3BK1 A;  3MP9 A;  2LHE A;  4XWT A;  1D5Z C;  4WWM A;  1B9R A;  4IOI E;  1I4R A;  2J42 A;  3DWG C;  4N58 A;  1C4A A;  1NEK B;  3U4E G;  3TEW A;  2WXJ A;  1KTK A;  1F77 A;  3OWE B;  3E56 A;  3B2F A;  1I4Q A;  1SXT A;  1JWS D;  3VR8 B;  3HUI A;  3Q8B A;  2QEJ C;  4YTN B;  2XN9 C;  2Y5P A;  1DOY A;  1FNW A;  2SEB D;  1JWM D;  2WDQ B;  1SEB D;  1YNT E;  3LXF A;  3U2S C;  3W2D A;  4D2K A;  1FXI A;  1NYR A;  2N9L A;  1AYF A;  3IAS 1;  2QSD A;  1FEH A;  2EEL A;  2W82 A;  3AV8 A;  3PO0 A;  5EE1 A;  4OW0 A;  1J7A A;  3NVW A;  2LEK A;  4KGR A;  4R3D A;  4HRO A;  1N5X A;  5BMG A;  2VZK B;  2AQ1 B;  3I57 A;  1VDV A;  1VR9 A;  5C2T B;  2ICI A;  3BVZ A;  2I38 A;  2AQ2 B;  3KQ4 A;  2INN E;  3P4R B;  2BB5 A;  3WCQ A;  1SE2 A;  1HXY D;  2K9X A;  3BZD B;  1ACC A;  4GLS C;  4DXF A;  2BB6 A;  4JE3 B;  3AH7 A;  2J4X A;  2IGG A;  2IGH A;  1KLU D;  2BYT A;  1GPX A;  2AQ3 B;  1M4V A;  1IGD A;  1GAQ B;  2WXF A;  2MJ3 A;  5FK9 C;  3J9C A;  5BYR A;  1D6E C;  4OZB A;  1XCQ L;  2IPK D;  2KN4 A;  2LHD A;  3AEA B;  4OZC A;  3AN1 A;  4YXD B;  2MJD A;  3MFG A;  2JYE A;  1WSP A;  3V05 A;  3AEF B;  3GB1 A;  1ZXH A;  2X38 A;  1V1P B;  2PVO D;  1ZP0 B;  2L32 A;  1UNS A;  2N0S B;  2NTS A;  2SAK A;  4RF1 A;  1VLB A;  1PGA A;  2VZK D;  1MHH E;  4DXG A;  2KDM A;  2ON8 A;  1UWX A;  2IGD A;  2PTL A;  2PW9 A;  2IJ0 A;  3E9S A;  1QQR A;  2JQR B;  1CZP A;  4RH6 A;  2WXR A;  1EU3 A;  2INP E;  3RPF C;  1KRH A;  4ITK A;  1L6V A;  3SR6 A;  4LTU A;  1V1O A;  4OVZ A;  2LJI A;  3U52 E;  2W55 A;  3LB8 C;  1R7S A;  3IT4 B;  2L1A A;  4A6Q A;  1TKG A;  2NMQ A;  4KKJ A;  3RFZ B;  4B0E A;  1QOG A;  1TKY A;  2K22 A;  3NVZ A;  1FM0 D;  4HKZ E;  1QKZ A;  2V0G A;  1UGJ A;  1C4P A;  2H89 B;  1SBB B;  4TMA B;  1GOZ A;  5GXG B;  3MC0 B;  1FFU A;  2CJO A;  3ZJV A;  4C7Y A;  1WXQ A;  4NZL B;  1XLN A;  5EE3 A;  3ZGZ A;  2WQY B;  1ET9 A;  2Y5C A;  2PIA A;  3AED B;  1GB1 A;  4XWW A;  2FBW B;  5G5G A;  3TEX A;  1MVK A;  1J7B A;  2D5G A;  1BML C;  1Q10 A;  1E7P B;  4N59 A;  4RGM A;  4Q2J A;  2ZW1 A;  3AE3 B;  4A8X C;  1F0Z A;  5EE9 A;  1I4G A;  4AQ7 A;  1EWY C;  3FIL B;  3GP7 A;  3SEB A;  1FNU A;  1PDX A;  2ZW0 A;  1I7H A;  2RDG A;  2DBY A;  1K50 A;  1P7F A;  4RFB A;  1WRI A;  1C79 A;  1L5P A;  2YEP B;  3T3N A;  4A90 A;  1MPE A;  4USA A;  1MHX A;  4US9 A;  1E6E B;  3HVZ A;  4JX1 C;  2JU6 X;  2YEP F;  1EU4 A;  2N9K A;  2GRI A;  2CU3 A;  1FD6 A;  1YQ3 B;  2JZP A;  1YN3 A;  1TS5 A;  2QMT A;  3ETR A;  2WS3 B;  1FO4 A;  4NJC A;  2K0P A;  1N62 A;  4ZHO A;  2BS2 B;  3Q8C A;  3HVD A;  4ZRP A;  3DWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...