2PLRA

Crystal structure of dtmp kinase (st1543) from sulfolobus tokodaii strain7
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
212
structure length
212
Chain Sequence
KKGVLIAFEGIDGSGKSSQATLLKDWIELKRDVYLTEWNSSDWIHDIIKEAKKKDLLTPLTFSLIHATDFSDRYERYILPMLKSGFIVISDRYIYTAYARDSVRGVDIDWVKKLYSFAIKPDITFYIRVSPDIALERIKKSKRKIKPQEAGADIFPGLSPEEGFLKYQGLITEVYDKLVKDENFIVIDGTKTPKEIQIQIRKFVGELIDNSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of dTMP kinase (st1543) from Sulfolobus Tokodaii Strain7
rcsb
molecule keywords Probable thymidylate kinase
molecule tags Transferase
source organism Sulfolobus tokodaii
total genus 86
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2007-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2plrA00
1G19A 4AYXA 1FTNA 3RRNA 3K70B 3SJZA 3GLIA 1TU4A 1GITA 5FH9A 4TSFA 1WB9A 3NEJA 1U90A 1U8YA 3BXZA 1RFLA 4Q4JB 2NPFA 2ZR7A 1R7RA 4RZ2A 1TL7C 4PFSA 2WVJA 2ZYWX 3TSWA 3WNCA 4ESHA 1TUEA 3KDSE 5CLLA 5KSZA 2OESA 1DS6A 1AKYA 4MA4A 2CLDX 3RS0A 3AVUA 5CJ2A 1W4CA 2QN6A 5BN4A 4P3YA 3I4LA 3W8NA 3NDPA 4ZIRB 4Q1DA 3LBNA 4WA7A 1T9HA 2W0SA 3MGCA 1KZGB 1WF3A 1S9HA 3T35A 1KI7A 1GZSA 3EWAA 4ARZA 3BORA 4JSYA 3L8ZA 4QHYA 3OFND 1Q57A 2F1JA 1T4GA 1FFHA 4R71A 1TX4B 2H7VA 4OK6A 3HWSA 3KB1A 1IM2A 3F5FA 2ZTSA 2GCOB 3CF6R 1CU1A 5JRJA 1GIAA 2E1RA 1JJVA 4C0QC 1IAQA 3A1SA 2G1KA 3CR7A 2G6BA 3VR6A 1F6BA 2XNDD 1Q1QA 2QTHA 4R98A 3GLGB 4OHWA 3ADCA 1KMHB 2AWOA 2JLSA 2XX3A 2V6JA 1B0UA 2KJQA 1KI8A 5B57C 4TT3D 3EW9A 3SBDA 4Y0AA 1UBFA 2XZLA 2A30A 3RRYA 1Y3AA 3UKDA 3O8BA 3G82C 1HYQA 2EWWA 3CX7A 2G9NA 5DYGA 4B76A 3NHBA 1GM5A 2RCNA 2ZRBA 3ZS8A 4F92B 1TADA 2WZQA 3G5UA 5KSPA 2EFDB 2AFIE 4N3NA 1NNEA 1S8FA 4TLAA 4EAQA 3KQKA 4HI0E 1OB2A 2HF8A 4WXRA 3X2SA 2XGJA 4ACAA 3RRMA 3T5DA 4JLAA 5IK2A 4DLWA 5GJBA 2AN9A 1XF9A 4PHFA 1NN1A 4D4LA 1GKIA 1XTIA 2OBLA 2WICA 4CIDA 4CEHA 1QHGA 3MUFA 4HB2A 1WP9A 2UZIR 4POAA 4KBGA 3X1YA 1GUAA 4E03A 1UAAA 5EJEA 2Q6TA 4HAUA 4URYR 1P9NA 4BLPA 1ZNWA 2Q9CA 2UZ3A 4YXWA 1YZGA 2GJKA 4GT1A 1AQUA 1UEJA 1GNPA 2IYZA 4DLVA 2FV8A 4D0LB 1G5PA 1W49A 1L8QA 3GLHB 4R2IA 3AF2A 1II0A 5EE3A 3U3JA 3AQ4A 1F2TB 2REBA 4UNSA 2GEDA 3I32A 3QXXA 1YVDA 4FMCB 5CM8B 5GADl 3R9WA 3I62A 5FOSA 5LPNA 3KQHA 4DB2A 5FTJA 1UEIA 3LV8A 2ANBA 2Z83A 2PT7A 2ODEA 2XNSA 3ND8A 3W9YA 4ZI2A 3QPWA 1SXJB 1NLFA 1HV8A 3C14C 5C2JB 5LDDC 3AV0B 3C4JA 3KQUA 2XZPA 1CJKC 1OYYA 4B3CA 1S1CA 3MCAA 4ZCIA 2JDID 3QEOA 5E95A 4F4JA 1YR6A 4IXNA 1RZ3A 3PIRA 4XTRA 3SDZA 3ZIAD 3ZVMA 1OKKA 4CW7A 4AC9A 2V54A 3TMKA 4AG6A 1G21E 2C96A 1G16A 4A0RA 2IX3A 5CLQA 4HLQB 1G18A 5AK0A 5BW8A 2X77A 1ZM2A 4TSFD 2NIPA 1YE8A 3JZAA 2PLRA 2GF9A 1EX6A 2YC4C 3FVQA 4NBSA 4DEYA 2MSDB 4GI7A 5FI0B 4NZYA 4DCUA 2HF9A 3QENA 1QG4A 2JJ2A 1D2NA 1U0HC 3KX2A 3QI2A 1UADA 4Q00A 2X19A 2P5TB 2YC2C 2VP4A 1KI9A 2WAYA 4D25A 3Q85A 3U44B 2O0HA 3TUJC 3KKNA 4CT5A 1JR3A 1D5CA 4PSVA 2BBTA 2PJZA 3EA0A 2WAXA 1AKEA 3CRW1 1LS6A 4C2UA 1SKYE 2QI9C 4DHEA 5DLQC 4BUJA 1P2TA 5DHFA 1WE2A 1G9XA 2XJ9A 1RYFA 3QEJA 1OW3B 4XD7D 4HUTA 3GCGA 5ELXA 3PR1A 4URVR 2ANCA 2ZRFA 1TMKA 2ZJ5A 3SNHA 2CCKA 2QNRA 5H68A 2OHFA 5IRCD 5JECA 3BE4A 4L4UA 2ZVQX 5GJCA 4P4SA 5DHAA 2GAOA 1LV7A 3THYB 2QU8A 1LFDB 5F3WB 2C9YA 1OB5A 1XTRA 3H0KA 4A36A 1N6RA 4TL8A 3NC1C 2Q0HA 1W5SA 4TLCA 2A78A 1Q0UA 2F7SA 1CR2A 4MGYR 4TYYA 1VCMA 2CLCX 3IEUA 4DDTA 1UKEA 4G5QA 3RVBA 2O8BA 1X6VA 3U6BA 2ZAMA 3AKEA 1RJ9B 4BRWA 1KDTA 6Q21A 2Q3FA 4DDWA 2JJ1A 5BXQC 4AYTA 1O3YA 4DDVA 2IYTA 5BWMA 1G7RA 4A8JB 2UKDA 2X2FA 2CE7A 2GKSA 3LRPA 2MMGA 1DE0A 2DHRA 3R8CA 4Q02A 3HR7A 1Z3IX 3QKTA 1G5RA 2CE2X 4RZUA 2CDNA 3QF7A 2GXAA 3ZJYA 2ZE7A 1DAFA 4KFTA 1MT0A 3OEEA 3TUIC 5EXXA 1S96A 3EXAA 1RIFA 2BKEA 3CB4A 1BO6A 3C41J 4X8LA 1G1MA 2RB4A 3T1TA 3RANA 4LBWA 3QXSA 4R2HA 3LA6A 1KO4A 2QQEA 1I2MA 3THXB 1EGAA 2F1HA 4YXWD 2PX3A 2GESA 1Z6YA 1N5IA 1N2CE 2CNWA 2OAP1 1E1QD 2Q9BA 2OZEA 3SQWA 3LQQA 1J70A 1M7GA 4NYIQ 1ZD1A 3QQ5A 4ZPXA 2D7CA 2VP5A 4XIGS 4Q1FA 3RS4A 2DCUA 1HA3A 3QUSA 3R20A 2O52A 1Q21A 3FKSD 1KKLA 4B75A 2GA8A 3KTAA 4ZCLA 3FPAA 5EUQB 5TY0A 2ZRNA 4PZZA 2SHKA 4BWYA 4U00A 2G3YA 1A4RA 1NF3A 2FPMA 1C4OA 4NKRA 1NL3A 3LFUA 2Z5FA 4KFUA 2B8WA 2IWHA 1VCIA 4Q47A 3CF2A 4G5RA 2QPOA 1BYUA 2Z0MA 2IYWA 1NKTA 1M6NA 3QVVA 2QSZA 4GMXA 1Z0KA 3Q7PA 3TKLA 3W5IA 1OKKD 2WV9A 1FMLA 2BM0A 2WJGA 1DG1G 3B9PA 3A8TA 1O87A 4Q7LA 1S0UA 1UBGA 3BFKA 4MGKR 2WMOB 3NH6A 1S4QA 2DYKA 2YV5A 4PPQA 2ECKA 2CL7X 5HE8A 1UPTA 3UXMA 3E2IA 4C2TA 4KV9A 2ZRDA 4LRWA 3K53A 1U94A 3IBYA 1SHZA 4TZ6A 2D2EA 1E79A 2JJ2D 3BERA 4CGZA 4HAZA 1MRNA 1NP6A 2J0SA 4FW9A 2IS2A 3VKHA 1U99A 5AJXA 1MO4A 1VYUA 2EVWX 2QL6A 2QZ4A 4O25A 1M74A 2F9MA 2GXSA 5LBIA 1JR3D 1L4YA 2EQBA 2W00A 1QRAA 2CJWB 2PCLA 4KFRA 4HLUC 5HKKD 3AKDA 4TL6A 4RD3A 3B5JA 4Q03A 3FHOA 2ZRGA 5KDLA 4P33A 4EKDA 2RGXA 2IBMA 2A5GA 3QY0A 2BMJA 4OL0A 1V43A 1E96A 2IA5A 4LY6A 1Z0IA 3EIQA 3LBIA 1N6OA 3C15C 4PR0A 4UXIA 2WJVA 5FPTA 1DAMA 3S1AA 1TQDA 2IYVA 2QGZA 3DDCA 2WKQA 4D6PA 3AVYA 4C0BA 3DM9B 3U4QB 1YZLA 5EP2A 3JVUA 3GLIE 3RLFA 1E98A 4HDOB 4V0OA 3BH0A 2JAQA 4ZV4A 1R10A 4Q9HA 4RCZA 5ANRB 2QORA 3K0CC 5A5GA 4URZR 2JLWA 1ODFA 1F48A 4DT1B 1Z6GA 3FHCB 4GMDA 2XAUA 5FTKA 2WHXA 4PC1A 4NCKA 1PVOA 2ZRMA 2PEYA 5KPJA 2VBCA 2VP6A 5F98A 1G20E 1W48A 2VPPA 4JLOA 1M7HA 4TLBA 4NU0A 2PX0A 2JJ1D 4FD2A 3AF3A 3TW8B 4IFEA 3K8YA 3BK7A 2F6RA 2WJJA 1R0WA 5KDOA 5FTNA 1GNRA 1Y63A 3VR4A 1E0AA 2QPAA 3EASA 3VR2A 1E2QA 1TPZA 4JJKA 3VMFA 2VIIA 1E2IA 5SZKB 3OEED 3K0FA 3RABA 1Z22A 1KYIA 1PLJA 4PQYA 4BECA 4CF7A 4EFLA 4IDOA 5FR2A 4JS0A 5EXTA 3QVUA 4M1KA 5HCIA 2W6JA 4EPTA 4MH0R 2CNWD 4OQMA 4MYCA 2HT1A 1OIVA 2HXYA 5DIFA 2GRJA 2WPDA 2JJ8A 4F38A 2GEVA 2GCNA 5DH9A 3QXJA 1OH6A 2N42A 1ZNXA 2VHUA 3R7WB 1U9IC 2ZSAA 3MWJA 4FCTA 4LHZA 5SZHB 5EZ6B 1G4AE 3HPQA 4HAXA 4A0FA 5HE9A 1DO2A 3X1XA 4O0MA 2A2ZA 4LYAA 3TH5A 3K70C 4LDJA 4PC2A 4LBYA 3W6PA 2RHMA 4TQAA 2DFLA 4RD0A 4PXAA 1E69A 1K6MA 1IY2A 2FSIA 4RZ3A 3O8RA 4XVRA 2Y8EA 4NHOA 1UBCA 2BV3A 3UIEA 5KOYA 1K5GA 4M9XA 1JPNA 4E09A 4LC1A 3WMEA 3EARA 5P21A 2F43B 3X1WA 3VKGA 2I3BA 1P3JA 2BHRA 2ORWA 2DY1A 1G3MA 1XWIA 2QA5A 4HATA 1ZMXA 3GFOA 2CK3A 2EYUA 1T3SA 3UMFA 1TEVA 5KO2A 3SQXA 2B7CA 1ZC4A 5TMPA 3CLVA 4DSNA 4DVGA 1E79D 3MWLA 5E4FA 3QJYA 3QSYA 4I4LA 5JEEA 1XPRA 1US8B 2JLVA 4IOLA 2AHOA 3B82A 4URXR 5KTYA 5AUPB 4WOPA 2O8CA 4H9GA 1JPJA 1K5DA 3VR3A 2CCGA 2YZ2A 3EWSA 3ZH9B 4PO9A 3L8YA 4ZDJA 1W36C 1YR9A 2NO7A 2O0JA 1KI1A 3MJHA 2P0EA 3LBHA 1OFIA 2OBNA 4ITRC 1E2MA 2CBZA 1BMFD 4D4JA 5G3ZA 3MMPA 2ZS7A 2P6UA 4ZO4A 4D0NA 3TRFA 3V4FA 5FBVB 1N6PA 3NWJA 2HLDA 2REXB 3QF4B 3CNOA 1Z0FA 1HT2E 5JWOA 2QBYB 3RS2A 3TR0A 2ZU0C 4FINA 4IDQA 5K8LA 1D9ZA 1OLOA 1KJWA 4IEEA 3H86A 4NCHA 1UKYA 3AVTA 3CM0A 3FB4A 2FFHA 4YONB 4NCIA 4KLNA 1W47A 1E3MA 2EFHB 4JLDA 3CPJB 3L0OA 3VQTA 2P3SA 2AXNA 1E2EA 3WP0A 3ZS9A 2PJRA 4HLUA 1QF9A 1GAJA 3LXRA 1IN4A 1OIWA 1XBTA 4KU4A 4M1MA 2ZI5A 3FMPB 3QXHA 1SVMA 3VR1A 1X8JA 3TE6A 2XNDA 4Q7MB 3KXKA 1RKBA 1Z2AA 1IJEA 1JR3E 1JJ7A 1DADA 2A3RA 2VH5R 2X8AA 1QHXA 1YZTA 2ZETA 3L0IB 4M21A 4Q18A 4QHSA 3WYGA 2OLJA 3AP1A 2B92A 1DEKA 1KK1A 4JLBA 3PEWA 3PQCA 4DRZA 2QTVB 5KNCA 1NBMA 1SGWA 2JA1A 1XD8A 1G3QA 5B64A 4OI1A 5DN6D 2VHJA 3R9XA 3MWKA 1K8RA 1GL9B 1ZP6A 2FSFA 2JCSA 3A37A 3DKVA 3K0CA 3QE0A 3FFAA 4Q4HA 1P4SA 4XSHA 5E7IA 2W6JD 5FTLA 3ND9A 5CIWA 1YRAA 3U7EB 3AH8A 1HQCA 3M6AA 4YDSA 1OFUX 2WPDD 3MRSA 1SXJC 3AF1A 2IUTA 3KKQA 3IHWA 4B73A 4L8GA 1KIMA 1AS2A 5HTKA 1AA9A 3A1VA 3ECCA 2ZU6A 2R44A 4LJ5A 2XEXA 4ZCMA 2QAJA 1SVSA 4IW3B 5JI2E 621PA 4EUNA 1XCMA 2J0UA 3RRZA 1YR8A 1XCGB 1KI4A 2AKAB 3WYAA 4M53A 1W4AA 1GRRA 2R6FA 5HCNA 3R9IA 4B34A 3AGQA 3BH7A 1XD2B 5L3RA 4XWAA 2N46A 4GRAA 4QJ3A 5CB8A 2XXAA 4GOKA 4JT2A 2YJTD 4LJ4A 1E2DA 1PUJA 2IF0A 1P6XA 2YKGA 1H8EA 1GVNB 2AK2A 3QKUA 5TV2A 1CKEA 5DI3A 1BS1A 2CK3D 3DL0A 3MWYW 3A4NA 3BB3A 4R9UC 2WJYA 5JBQA 4QGAA 2NZJA 3TIFA 4AI6A 4BLSA 1HY3A 1MO6A 3BWDD 1KK0A 2CXXA 1CLUA 3SHFA 1ZCBA 3V4RA 3I61A 1FUUA 2RGGA 2BKUA 4LPSA 3KKMA 421PA 5IF9A 2IYYA 2OT3B 3B1XA 3RS5A 3FWYA 3RWMB 2FDCA 3H4MA 4OHVA 3K09C 5FPYA 2IYSA 4A6PA 3KFVA 1QBKC 3CRVA 3P1JA 3PUVA 5L3SB 1W2HA 2ZI7A 1W1WA 2VRWA 4Q4JA 3ZIAA 4NONA 2JIZA 2R6GA 3CNLA 2W0MA 3IO3A 3CX6A 3CRQA 4E07A 1ZUIA 2HJGA 1WCV1 1QHYA 1UF9A 4A2QA 2P2LA 2V55B 2CEAA 2RGAA 4QGHA 4OHXA 1MOZA 3HDTA 4TYPA 1Z07A 1FP6A 4G0NA 4OI2A 2N1BA 1XXHA 1SVWA 5FOVA 4KYIB 2HLDD 1ZM4A 4AD8A 2EFCB 3QKSB 4JSTA 1AGRA 1BH2A 2MSCB 2EFGA 2QAGB 4M1SA 1FQJA 1OXTA 4QRHA 2OFOA 1E0JA 3QBTA 3C5HA 3F3YA 1FQKA 1OXVA 1U0LA 4EQ6A 3GEHA 2WKRA 4Q66C 1Q1EA 3U3OA 3BAFA 1XEWX 4JL8A 5DSZA 4A8JC 2Q21A 4AURA 1L2TA 2GCOA 4DSTA 4LHYA 5DI9A 3IPXA 2FX3A 2G83A 3GLIB 5F9FA 1Z8FA 1R8SA 4XD7A 1NKSA 1RC8A 4LV6A 2D06A 2VHQA 1KMHA 2WWIA 4UJ5A 1U0JA 3B2EA 4URWR 1XMSA 3B78A 4BZXA 4KVGA 4G1UC 4V03A 2ZI6A 4UXHA 3KKOA 1Z47A 2VTKA 4H1UA 3U3KA 3PENA 4Q9JA 1W2GA 2FEOA 2F55A 5JMTA 2J7PA 4RZXA 3SOPA 1F60A 1R5BA 2BWJA 1OF1A 1NBMD 4PAMA 3W3AA 1LNZA 2V6IA 3A1TA 1BIFA 4UXJA 1KDOA 1VTKA 2C77A 3PV0A 1HUQA 3CF0A 4NE2A 3A6PC 2ZXUA 3SZRA 2P6NA 2VP0A 4DCTA 4Z8YA 1Z5ZA 2BBOA 2OCAA 4HEJA 4EIWA 1PV4A 5A4JA 4CEJB 5L3QB 1DTSA 3WBKA 3THWA 2F3RA 4BRUA 4LUCA 1A82A 3LW7A 3FMFA 1CJTC 4D81A 4MDFA 3OF5A 4BLRA 1N0WA 4JLVA 4QC2A 1XDBA 4M1OA 1XMVA 1RYHA 2H17A 2AR7A 4QBFA 1J7KA 5JS7A 3HU2A 4Q1CA 2IWRA 4B35A 2YWFA 2HYDA 1ZM3A 3BD9A 1Z0JA 2OG2A 3GLHA 1Q1BA 2AD5A 2P5SA 3PG5A 4Q9LA 5TB5A 2O8EA 1YZQA 1KDPA 4AY2A 1D6JA 1F2TA 3QG1A 1DAIA 4C3ZA 5JS8A 4OK5A 1E1QA 2BBWA 3BB4A 3BJIC 1H65A 4DLRA 3ADBA 1OIXA 3NKVA 2XITA 3Q3JB 1XZPA 4XVUA 3R8FA 1P72A 2IEZA 4C0SA 2XZOA 2ODBA 1WRBA 4DLZA 1H8ED 2GBLC 5AJZA 4EPXA 1DOAA 2ZJ2A 3FKSA 1Z28A 3UWOA 1EESA 4A2WA 4HSEA 2G0NA 3C8UA 2VSXA 4OHYA 1GP2A 5HPYB 1G17A 5FBQB 1NLYA 3D3QA 3KJIA 2IXFA 5EUMA 4CEHB 1Q3TA 1Q44A 4OQLA 4ZKDA 1KKMA 1HEIA 3RSOA 4E22A 3K70D 3WMGA 2CCJA 1II9A 2OM2A 2ONKA 4PHTA 2CHQA 2ZYTX 4S2EA 2ZRJA 2C95A 3NHAA 5J4VA 3E70C 1HTWA 2BEKA 3HU1A 4Y0VA 4Q19A 2JIZD 5D3MB 2YOGA 3BFXA 2DWOA 4LYJA 3U2QA 2IS1A 4Z1MD 4TYWA 3W6OA 4B2LA 1QHSA 1OXUA 4I1OA 3RAPR 1TU3A 2BJWA 4RD4A 3VNVA 4O2RA 3TVDA 5J4KA 3DO6A 5CIQA 1ANKA 2FSGA 3AB3A 3U44A 2QY9A 2WM9B 3LDAA 1FL9A 2VSOA 3DKPA 3FFBA 4TMKA 1COWD 1YJ5A 5CM9C 3ZQJA 4FN5A 3BOSA 3QPUA 2QMHA 1VMAA 2ZS9A 1R0XA 4JVMA 5G41A 1OXXK 3F0TA 1HE1C 3K09A 1CEEA 2V1XA 2KI5A 4DWJA 1IN6A 4OQFA 4AWXA 3VTKA 3B6EA 5HKKA 1W36D 4LHWA 2J46A 5AWFC 3TVTA 2FN4A 3WNDA 2ZPTX 2V7QA 2RGEA 2O5VA 3UANA 3NIBA 3I8XA 2C78A 2I4IA 2ZRLA 1A2KC 2IS4A 4LWZA 3REFA 2E87A 1JXOA 1W0JA 5J47A 4ASUA 4A15A 3GJ8A 4A92A 1XFAA 1IXSB 1TF2A 2B6HA 1EFCA 4KHZA 1CJUC 3TQCA 1YR7A 3EC2A 4MKGA 2ORIA 1ZVQA 5C4GB 4II7A 1CBUA 2RGCA 1VYVA 3E1SA 2WMNB 4HLDA 2J7PD 3K0AA 1RJ9A 1P2UA 1YHNA 2IYLD 1GOTA 2FGKA 4KCGA 4AKEA 1YU9A 1E9SA 1YZUA 1FZQA 1TQ6A 2ZS8A 4I1SA 2H18A 1R6BX 4A8JA 4MUBA 4QG7A 1G7SA 2WWHA 1RPZA 4B2PA 1KAOA 2ZSBA 1E2HA 3KKPA 1TF7A 4P0TA 2WTUA 4LSGA 1KNXA 4F4CA 2L0XA 2R62A 1R2QA 1UM8A 3CZPA 4NP6A 1GL6A 1SHKA 2AWNA 2OCBA 3D7MA 4LJ9A 5KNDA 1F2UB 2R6AA 3N2EA 4F91B 4JT4A 4ABYA 1OFHA 3KXIA 1M34E 5M04A 3L0PA 1TUIA 2QQ0A 5DYIA 4XH9B 4PPFA 3JZMA 4JLKA 1IN5A 4PZYA 1CR0A 4YMVA 1P2SA 2VO1A 3X1DA 3WXMA 1E2GA 1OPXA 4HAWA 1KO8A 2OEPA 2O8BB 2JLZA 3N5CA 4WW0A 1E94E 5LD2B 1KAGA 4ESVA 4M4SA 5KHOC 4B47A 3K0EA 1H8HA 1XEXA 2ATVA 3H1TA 4M9QA 3I1FA 2PMDA 2GHIA 5CITA 4RSGA 3QOFA 2VP2A 3FTQA 3A1WA 1NBME 1SXJD 2ZEJA 1CXZA 2GJAA 2GCPA 4MYHA 4EJSB 2F1IA 3AEZA 3LH5A 1LTQA 5K8UA 1N6NA 2PEZA 1X1SA 4BFUA 5J4HA 4Q7JB 4M1WA 1XB2A 4B6EA 1EX7A 5EE9A 4GZMA 2GJ9A 4UJ3A 2QMUA 3NVAA 4MITA 3B1WA 4JIMA 4A4DA 4MKIA 3ZVRA 4TYQA 4KODA 4LCBA 3SU8A 3PEYA 4IOKA 4KITB 1DAEA 2BC9A 2ZROA 3IBGA 2C04A 4LBVA 3O8CA 4PX9A 3TJZA 4AKGA 4NL4H 3B1ZA 2PLFA 2GK7A 3REGA 1ETUA 4DLUA 2VF7A 1ZYUA 2TMKA 4M1YA 1KTVA 4QHTA 4QNMA 3B60A 4QGGA 2CVHA 1CTQA 3Q9LA 2OO7A 4PAOA 1M2OB 4LYFA 5JLJA 3GD7A 2ZRHA 2FFBA 1IY1A 4OK3A 4A9AA 4XJXA 1MO5A 1E9RA 1F5NA 2ZRKA 3ZDQA 3TW4A 1XNJA 3MLEA 3QKRA 2FA9A 1S3GA 2IK8A 2J7KA 5DNYB 4JL6A 3W5JA 2O8FA 2AX4A 3BIFA 1S1MA 3OAAD 5HZKA 5FOWA 4PPNA 3GMTA 2EW1A 4YQFA 1GRNA 5FBRB 4DIDA 3FMIA 2ZJAA 3VX3A 2CHVA 3TUZC 1G5TA 3U7FB 1OV4A 1BMFA 1P9RA 1UJ2A 3QG5A 1XCPA 3MJRA 1GTVA 3AVPA 2WOJA 2V7QD 2XTMA 2WIAA 3EX7C 1ZAKA 3LNCA 2ERXA 3W34A 2P6RA 3WMFA 1VG0B 4P32A 1GL7A 2AFHE 1GWNA 3U4QA 1E2FA 2ZR0A 4C0AC 1P60A 4CRWB 1VG1A 1EXMA 1W0JD 1E0KA 4ASUD 1UKZA 1JECA 1CRQA 3D6TB 1M8PA 2ZI4A 1ESMA 2B7BA 4DT1A 4L5BA 4NCNA 1G3UA 5K8TA 1JXMA 2OLKA 4NYIR 1OH7A 1KI3A 3LAWA 1XRJA 4WZAE 3OE7D 5FL3A 3DOEA 1JB1A 3B85A 3EZFA 1S9DA 2DFNA 1W0KA 4RFSB 1XXHE 3DPUA 1RRFA 2C03A 4WBSA 1P7CA 4KSBA 2BBSA 2YOFA 4WIAA 1OE0A 4RKFA 2XOKA 5G53C 1MABB 1RRPA 3AUXA 2FU5C 5F9HA 1R8QA 2J59A 4V0KA 3T1VA 1NI3A 1W7AA 2RGNC 1KI6B 4Q5IA 3JVVA 5DISB 2VA8A 4IVQA 2DR3A 2NO6A 4PPGA 3C7KA 4OJQA 4GDFA 4NCJA 2PZGA 3W3ZB 4OI4A 3BC1A 1DARA 1CR1A 3IQWA 4BFYA 4RD6A 4E5UA 2WWXA 5JSZB 4US0R 1NY6A 4Q1AA 4TMXA 5H70A 2CMKA 4V0MA 3RSLA 3LW8A 1AJEA 2QPTA 3M4YA 2G88A 5DN6A 1EFTA 3PITA 1B23P 4CVNA 2BJVA 4WVFA 1DAKA 1ZM7A 4KYUA 4FCVA 1NVXQ 4BLQA 1TTTA 3D8BA 1JEDA 1T5LA 2ZQ5A 1R5NA 2J9RA 5FBWB 1QG2A 4GOXA 3GEIA 3O47A 3PUYA 4CZ2A 1H8HD 2AK3A 4FWIB 5C46F 4OBEA 3WBJA 2JLQA 4PO1A 3LVQE 4GP6A 1VHLA 1JBKA 1E6CA 2IYQA 1N5KA 3MD0A 3AP3A 4Z8XA 4V0NA 4BE7B 1TQ4A 2O8DB 1Z6XA 4GOJA 1ZW6A 1X8LA 2NO0A 3KB2A 2V9PA 1E9CA 1VG8A 1ZM9A 4W5JA 2D62A 2RKOA 4WZBE 2IYXA 2J0QA 4MRNA 5C4MA 1GKUB 1OSNA 4BFWA 4CEIB 3VHXA 2ZJZA 3GEEA 3LQRA 4BGDA 4K8OA 1XTJA 3U3MA 3I5XA 2OSBA 4MGZR 2QAGC 1R4AA 1IHUA 4TQ9A 2A9KA 3RHFA 3U6KA 3ADDA 2OXCA 4B3FX 1N5JA 1OFTA 4HAVA 5EE0A 3T1OA 4QM7A 4UKDA 1CIPA 4JMPA 4KSCA 4YMUA 1VPLA 2HT6A 1US8A 2XB2A 3LD9A 5B2ZA 5A0FA 3RNLA 2C9CA 5KDDA 3GLHE 1OXSC 3L82B 4N0DA 2BVNA 2IHYA 2QRZA 4XVQA 3PUZA 3SJBA 1Q12A 2EWVA 3B7GA 3GJ7A 3CZQA 1X86B 2XSZA 4IXMA 4U5XA 3HR8A 4B3BA 1ZUNB 4BFVA 4BFSA 4DUGA 1Q20A 5TXGA 1DAGA 3AVXA 1E2KA 3RDPA 4A0HA 1EFHA 1GRQA 4TMWA 1GKYA 3KUDA 1VHTA 4FI3C 4G3XA 2K5UA 2AD1A 5E3HA 2QBYA 1DO0A 2J5XA 4A6XA 1RW4A 3B1YA 1NVUQ 1LF5A 2OFXA 2P65A 2B21A 3CO5A 4PO8A 1OH8A 2ODWA 1UKVY 4URUR 5FOXA 2ZAOA 5J5CA 3EZ9A 1U8ZA 3DEFA 4XTCS 5IT5A 4ACBA 3IUYA 1G8GA 4LI0A 1SKYB 3U7HB 1S3SA 4TTPA 3GLFA 3WHKA 3KFXA 3OIVA 4TN1A 1XP8A 4LV5B 1U2RA 4D82A 1RRGA 2ZYUX 5CJPA 4QJ4A 1N25A 1G8FA 4Q4AB 4HDCA 2V8OA 1DBSA 2YOHA 4MGIR 2O8CB 2PZEA 2NQ2C 2ZJOA 2D4HA 2GZHA 1FOEB 3TAHA 1EWQA 3SYNA 4HUQB 3GFPA 1PUIA 3HYTA 1E9BA 4TLDA 4TYNA 1W0KD 1JNYA 1KOFA 1CJVC 5D3QA 3M0EA 3SS8A 2XOKD 3UMRA 2KBFA 1Z0DA 3PEVA 4NDZA 4EPVA 4DDUA 2MSEB 4M22A 5E7MA 2H5EA 2V4ZA 2VEDA 3BFVA 3SBEA 4C0KA 3K1JA 4NH0A 4UQOA 1LB1B 3ONWA 5CB6A 4FMCF 3AVOA 1GDDA 2VF8A 1HE8B 3IO5A 2BEJA 1WQ1R 4B2IA 2G77B 1IXRC 4C0HA 2JLUA 4F7WA 5G40A 2I1QA 1W4BA 3H2YA 1G4UR 5FPSA 2ZM5A 1D8TA 2BDTA 3IHLA 4L9WA 1T5IA 4B3GA 4W5HA 1SKQA 2FEMA 4Z51A 1JAHA 5FUVA 2IF2A 1LY1A 1QVRA 2GZDA 4FMDF 2DB3A 3AF4A 2IXGA 2NO1A 3CUEF 2IHBA 3M1IA 2AL7A 1KJZA 5JCPA 1VCNA 2DWQA 5KUTA 2Q3MA 1C9KA 2CLSA 1FMJA 3IIJA 1II8A 3SJCA 3OEHA 1MH1A 1NG1A 3QNUA 4LZZA 5F2EA 3F8TA 5KSYA 3BGWA 2VYFA 4FWTA 1JI0A 1FX0B 4PC7A 1AN0A 1N0UA 5BYKA 3AVWA 2VP9A 1J8MF 3GJ3A 2QGNA 4PSAA 3LWNA 4ILEA 3AKCA 3LO5A 3DM5A 3D31A 3LVRE 4RVCA 2FOLA 3NBXX 4IDPA 1NN5A 2NOAA 1Z2CA 4KAXA 4PHGA 2OILA 2ORVA 2YWGA 1N3BA 1XJQA 2ZVPX 1G64A 3C5CA 1NMYA 3H84A 3Q8XB 1N5LA 1FNNA 2VHTA 1IN8A 1G6HA 4NPHA 1P2VA 1E2JA 4Q21A 1PLKA 3BBPA 3IDQA 3EZ2A 4GFDA 5FBLB 1Z6AA 1U9IA 1E1RA 3CW2A 4BEBA 1MKYA 3DOFA 5L3SA 2W2XA 1Q1ZA 2PMKA 121PA 1AS3A 1ZU5A 4B32A 2GJSA 3IEVA 2F3TA 2RMKA 3VKWA 3VU9B 2Q3HA 2X1VA 2IYUA 1FP7A 2XSZD 1LVGA 1T0JB 4DUGD 4HZUB 2OUKA 1AGPA 3HP1A 1Z06A 1W44A 5JI3E 3QKSA 4RY2A 4AK9A 2JATA 4Z1MA 3FKQA 3I73A 3CIOA 2QAGA 4YLGA 4YMWA 1JQLB 2J41A 3SHWA 4C7OB 2PBRA 2RH5A 3MFYA 5DI3B 1KY3A 4HYYA 4M9SA 4ZIRA 4YC7A 4J0QA 5G3YA 2AXPA 3IILA 4KFSA 1G8HA 4JKIA 3T61A 1COWA 4GSYA 3E5HA 5JFGA 2JLYA 1QHHB 2X2EA 5KSOA 1Z6TA 3ZD7A 1XEFA 1AIPA 3ZLJA 2PL3A 3CX8A 1VIAA 2WKPA 1YRBA 1R0ZA 2G0TA 5EXSA 3KJGA 1LF0A 3NH9A 1ZNZA 3IKJA 1IXZA 2C99A 4QBGB 5TARA 2J87A 2JEOA 3FYHA 1AQYA 5FPKA 3ZZUA 2ZITA 3GLGA 1E9EA 1I4DD 1IOZA 1NN0A 2J1LA 4NMMA 3T06B 1G3RA 1XXHB 4DB4A 3NG1A 2XB4A 1G291 4ERNA 5FR1A 3T5GA 4GL2A 4JL5A 3NEYA 3P26A 5B30A 1OH5A 1DVRA 1M7BA 3QIAA 4A2PA 4B3XA 4DC9A 4EQ6B 2JLRA 4KJZA 1IY0A 5LD2C 2IYRA 4EFMA 5HZHA 4CEJA 5L3QA 3EPLA 2HXSA 4UNQA 3SN6A 3PUXA 3P27A 2OFWA 1P73A 1HURA 1W36B 2XJ4A 2YHSA 2ZANA 3L0SA 3TAUA 4ARZB 4DCVA 5FPHA 4EJSC 3ETLA 1T3LA 1P62B 1L4UA 4K46A 2HEIA 2ZI9A 2ZRCA 3OZXA 4JLPA 4TZ0A 2QT1A 3CRRA 2FFAA 2Z43A 2ZJBA 3PCRB 2YYZA 5FL7A 2DFKB 5J4YA 1NVWQ 3KXLA 1CRPA 2A7QA 4LX0A 2D7DA 3CR8A 2C8VA 3MAAC 4RFVA 2HCBA 5GVRA 3CRMA 5JHHB 3OEHD 3DMNA 4MYUA 2C98A 3FE2A 4IVRA 1PLLA 1I4LD 2CVFA 4TMTA 1IN7A 2D2FA 5EXPA 4QM6A 4LJ6A 2D3WA 2H8KA 1KO1A 3ZZTA 1CS4C 1ELOA 4V0LA 1NN3A 4KVAA 4QOSA 1ZIOA 4RKEA 4G5SA 5IDVA 5CK4A 5BN5A 3I3SR 2JGNA 3SFVA 2ASEA 1SULA 2XTNA 3U61B 1U81A 4PC3A 3DHWC 3THWB 4FMBB 1BYIA 1NY5A 5DO9A 4IFBA 4C0LA 3CPEA 2VLIA 4LJ7A 4N0EA 2QUZA 4QXAA 4V0ME 3NBYC 1SXJA 1T6NA 3EAQA 2RAPA 1RE0A 3A4MA 1E1RD 2IW3A 2ZYVX 2BCGY 2W58A 1IBRA 221PA 2HYIC 1OHHD 2WWGA 5D3MA 4PTLA 4ZDKA 2FGJA 1G8PA 4ZDWA 2QTFA 2HDNB 2O8EB 2PH1A 1E4YA 4GP7A 3Q7QA 2WBLC 2GTPA 1G41A 2OAQ1 2YWHA 3DZ8A 4L9SA 1ZC3A 3EZ7A 4YMTA 1XEWY 3QBVA 4PQFA 2WWYA 2GWHA 1KSGA 3TQFA 2ZE6A 4TQUS 2AKYA 4F4IA 4PQRA 5CDFA 4GPTA 4U7DA 3CNNA 1N6HA 3K9HA 3QPVA 1I4TD 2NPIA 2VL7A 4LHVA 1U8AA 1E2PA 2W6IA 1J99A 1XU4A 1E32A 2FG5A 2ZRAA 4KLZA 1VECA 4X8OA 4FMDB 1Z08A 4DLTA 4LHXA 2G1JA 3FDIA 4IVPA 4O2LA 1QHIA 2IS6A 2FSHA 2NZ8A 5JCZA 5C1BA 3OAAA 1CJMA 2VSFA 1E9AA 2ATXA 5AR1A 4QFMA 4A0GA 4QBIA 1WBDA 1VDZA 3EIEA 1HQYE 1P5ZB 2PCJA 3UMSA 1XJ0A 2YVUA 3CONA 2IUSA 2NTYC 1TAGA 2GEUA 2HJVA 1KK3A 2Z4RA 3G0HA 4DLXA 5KNBA 1Z29A 2FF7A 2IUUA 5FUWA 4OKSA 1XTKA 3THYA 1TQ2A 2HV8A 1E4VA 1NG9A 4JKYA 1AM4D 5L3VA 1GFIA 3RS3A 3TNFA 4R7ZA 3RC8A 4QNRA 2A5FA 3EG5A 5FI1B 1FNMA 2ZI3A 3MG9A 3PJRA 5C18A 2GVDC 2R65A 2C9OA 4DBLC 3J81k 2REOA 1X3SA 2ZSDA 2RHDA 4JJZA 1OYWA 1ZNYA 3OE7A 3ZVNA 2KBEA 4DKXA 4M2LA 4P4TA 1JQJC 3VNUA 5LB2A 2ODNA 2ZUBA 4U02A 1KDRA 5EE5B 4ON9A 1BKDR 3AVQA 1FPMA 2BM1A 1F2UA 2OXRA 3GLFE 5CK5A 1N6LA 1SVKA 5KU1A 1E99A 5H8WA 3HU3A 1VIYA 1A5TA 4OYHA 1T91A 1LW7A 2R6CA 5FL7D 4ZI3A 1EG7A 5FOTA 1D9XA 3A58B 1P61B 1A1VA 3AKYA 3KJHA 4US2R 3RC3A 1LS1A 1ZBDA 1Z0AA 4RJLA 4P4SB 4X8HA 4DLYA 1NMZA 5AUNB 3THXA 4D0GA 4JBWA 3K0AB 3WY9A 5AJVB 3Q72A 3SC3A 2XTZA 3VAAA 4I81A 2O0KA 3CPHA 1NSFA 4HZIA 4HLCA 2QP3A 4Q01A 1R0YA 2W83A 2NMVA 2QSYA 1DG3A 4Q1EA 4EJSA 5IK2D 1ZD9A 1WBBA 3NC0C 1KK2A 1J8YF 2YINC 4BPBA 3OIYA 4LOAA 1EFUA 4JVNA 3SEAA 3CKLA 1HT1E 1Q22A 5TDHA 2F9LA 3HYRA 4Q9KA 4JYBA 3ASYA 1AZTA 1UBEA 1XTSA 2GDJA 4HB4A 3ICQB 1FUKA 3LX8A 1MO3A 1WDTA 4MYTA 4MRRA 4B3DA 4TLEA 5DGXA 4OJKA 4BFXA 1AK2A 4WZ6A 2H92A 3U60B 1ESNA 1UDWA 3LY5A 4GZLA 4PHHA 3WP1B 1KO7A 3FMOB 4M0LA 1XX6A 4Q9IA 3W6NA 4TWZA 3NBZC 2QE7A 2OCYC 2FFQA 4Q4LA 1XEXB 3FGNA 3AUYA 2FE4A 3GPLA 2DWPA 2IL1A 2OCPA 2GBLA 3L2OB 2EU8A 2WIBA 5IHPA 4KBFA 1KZ7B 3AM1A 4BZQA 4NYJQ 2ZSFA 2FPLA 1DPFA 2R6DA 1N6IA 3KTAB 4BLOA 1XTQA 4Q1BA 3B9QA 2DBYA 5LB4A 4DJTA 2W6ID 3FOZA 1Z83A 2CJWA 4B43A 2QEQA 5J40A 5JRZA 4BLTA 4C4PA 3CWZA 3GQBA 4M1TA 4JVLA 3V9PA 2QMOA 3UWKA 3P20A 2ZIAA 1E9DA 1SVOA 3A1UA 3IQXA 2DPXA 2EYQA 4IDHA 1I2DA 4B6FA 4BASA 1FTSA 1XMJA 1T3HA 1MV5A 3T15A 2H1LA 2QENA 5E7JA 5JZVA 1J90A 3K0SA 5FOUA 2MMCA 2IXEA 2Z4SA 1Q3HA 5JWRA 3MSXA 4S35A 4LC0A 4LPKA 4MRPA 2WJIA 5AUQA 4LGMA 3ZD6A 2CL0X 3OIWA 4QKQA 1T8TA 3DMDA 4B48A 2FPKA 2KE5A 4RFSA 3I92A 1NVVQ 1E2LA 2IC5A 3C16C 3CH5A 1Z63A 1E2NA 4MUAA 4DEXA 5JEDA 3QKRB 3PUWA 1MABA 3GJ5A 4G5OA 2KSQA 1U98A 3GJ6A 2O8FB 2NGRA 3WYFA 2KWIA 2VHCA 1QZXA 2QM8A 1KI6A 1NMXA 3X1ZA 1PZNA 3P4XA 2GVZC 2ZR9A 1G3IA 3LXXA 5EZ5A 3WNBA 5BQ5A 1VG9B 3BB1A 4LYHA 4DSOA 1N0VC 4W7SA 5JSZA 1MRSA 1ZINA 4RCYA 4JVSB 2RGBA 3VHLB 2IEYA 1KSFX 2QROA 4C9BA 3ZQ6A 2YNMA 1EWRA 3S1AB 1NJGA 3SR0A 5GVSA 1RRCA 4FCWA 4FXPA 4XSGA 3ICEA 3OESA 4TL9A 4TTRA 2QP4A 2GNOA 4QGFA 4X8MA 4WAUA 2BMDA 1TNDA 4MKHA 4C30A 3SYLA 1CF4A 4D2IA 2P67A 3TK1A 1G7TA 1E0SA 4BFZA 3GLGE 1IONA 4AYWA 3LLUA 2OV2A 4HDQB 3SFZA 1NRJB 1XPOA 3WHLA 4EFNA 5AJWA 1QHNA 5DE3A 3CWQA 2R8RA 4WXPA 3O8DA 4NYJR 821PA 2ZREA 3DVLA 2GK6A 3R7WA 3P4YA 3T12A 1MR3F 4V02A 3U5ZB 3I5YA 3NXSA 4XOIA 3EPHA 5JJLA 3K9NA 2C5LA 3SE0A 2J3EA 3VX4A 2O8DA 3OHMA 1ONBA 2NG1A 3LLMA 3NTUA 2GZAA 2WOOA 4PAQA 2GAAA 1GSIA 2BIFA 4JBYA 4D4MA 1EFRA 4EDHA 4CEIA 3T1QA 3TGPA 4Z54A 1KY2A 2E9SA 3HPRA 4JZKA 3KQNA 3K0FB 1NIPA 3B8HA 1NSTA 2F43A 5GJVC 3TSZA 5FTMA 4B74A 4W5WA 1KSJA 2PZFA 1D2EA 1S2MA 2IT1A 4DCNA 2GF0A 4PSKA 2Z6VA 4OQNA 4JYCA 4DXAA 4AG5A 2V1UA 1ZD8A 1CR4A 1D2MA 3BRWD 3ZZ0A 3W8RA 1NVVR 1X1RA 2QE7D 2F1RA 1VCOA 4IOJA 2OBMA 4OI0A 4D4KA 3PVSA 3THOA 3AVVA 1JAIA 1KHTA 1T0HB 1VKJA 1PJRA 3HJNA 4OQXA 1XPUA 5JJIA 3FHTA 2FJUA 4B33A 1KO5A 1KNQA 3A4LA 2CL6X 1W4RA 2JASA 4IRUB 1P9WA 2WWWA 4Q48A 3SJAA 2GILA 4UNNA 4IHQA 4MKFA 4HB3A 2GXQA 4LBZA 3UATA 1YKSA 4EPRA 4ZDIA 1WXQA 5EQTA 3T34A 1QDEA 3UG6A 3GP8A 1JEEA 2PT5A 2NO9A 1KSHA 1QVAA 5B58C 2JLXA 5EE1A 4XWKA 1ZRHA 3U7GA 4MDEA 3QF4A 2W2VA 4HB0A 5SZJA 5HR5A 1SXJE 4D26A 2FMXA 4DLSA 1XMIA 5H1YA 4KXFB 2ZRIA 3KUCA 1J2JA 3BS4A 2WSSA 4B71A 1AZSC 4N1AA 4NTZA 3IIMA 1UFQA 2EFEB 1HH4A 3Q5EA 4Q4AA 4RD2A 3EPJA 4W9MC 2A5JA 2D74A 4LJAA 4D80A 3EPKA 1SVLA 1G7CA 5EP4A 3IPYA 4DIEA 4QBHA 3GJ4A 4HUQA 3TLXA 4CYMA 1V5WA 1IJFA 2ZUCA 3SYKA 1E9FA 3ADKA 5SZIA 5JWHA 2YWEA 4I1VA 3U3RA 4JBXA 1GNQA 3TR5A 3IIKA 1WA5A 2B8TA 2WSMA 4L16A 4M8NE 4ZKEA 4B44A 4Q7KA 4GBMA 2FZ4A 1RVDA 3PEUA 2QRNA 4UNPA 4F93B 3PFIA 1YZKA 4NYMQ 2LWIA 5CDFE 4EPYA 2A5YB 2R9VA 4BZPA 5AJYA 2H16A 3EIHA 8OHMA 4TL7A 4G01B 5EP1A 4PC6A 3RYTC 4TMZA 4LK2A 5BYJA 4TTQA 3PXGA 1DAHA 4P4UA 4DSUA 1P75A 4IOMA 4PANA 3I72A 3OIUA 2ONJA 3UK6A 3Q5DA 4DCSA 4MRVA 3N2IA 3V00A 3ZVLA 3NBFA 1OT3A 521PA 4BFTA 4EPWA 3GLFB 2HUPA 4AKHA 3UPUA 4FIDA 1OJLA 5K8IA 1SVIA 1KMQA 3CH4B 1T8UA 3OFNA 5CYOA 3ZGXA 3AF0A 2A5DA 3BH6A 4K81B 2I1VB 4DZZA 1SQ5A 2KB0A 5CYPA 4JLMA 2WWFA 2V3CC 2VQSA 3CBQA 3KJEA 1AS0A 3VFDA 4CDGA 2HCJB 3EA5A 1ZUHA 1CULC 4UNRA 3K9LA 3A36A 4TMVA 3I8SA 1W46A 4GNKA 1YZNA 4HAYA 2QP9X 4A1FA 1F3OA 1ZIPA 1ZJ6A 1IQPA 1XJCA 2CHGA 3L43A 4MRSA 4IEIA 1A7JA 1EK0A 1FX0A 2FZLA 4TT3A 3B1VA 2RGNA 5FUYA 1M1YE 3EC1A 1EFRD 4M9ZA 2GJ8A 4IKEA 1NLZA 2W2TA 1GG2A 2BCJQ 3AP2A 5KYKA 4IJMA 1XD2A 3GFTA 4A82A 1ZCAA 4O3MA 3ASZA 2WJHA 1DELA 5EP3A 2GXUA 3RWOA 1JR6A 3W90A 4JLJA 4YMSA 4OHZA 3QXCA 5GJWC 4H1VA 5BN3A 5FFMA 721PA 4AKIA 2H57A 3WRYC 4Q4HB 2Q9AA 3LX5A 1GILA 4PZLA 1JALA 3VR5A 2J45A 4RD1A 4BQSA 5AUOB 1XD9A 2ZRPA 2QMEA 5L8VA 5TVKA 4LJ8A 1FW6A 3AGPA 2ZJYA 4QL3A 2LKDA 3GJXC 4I99A 2QG6A 3VU9A 4LV8B 4KO8A 1II8B 4JLNA 1TF5A 1YQTA 2ZE5A 1TEXA 4LJYA 4NYMR 4HZUA 5UKDA 1L7VC 1OHHA 1C1YA 2ZUDA 3DZDA 4MQBA 1NIJA 2GETA 2C2HA 2J0UB 2QT0A 2RGDA 3GJ0A 4BEJA 4XWOA 1UDXA 3KZ1E 2BMEA 2ZE8A 1SZPA 3IGFA 4IDNA 3UG7A 4L15A 1G8YA 2FNAA 4CT4B 1G6OA 4C7OA 4G5GA 2OE2A 4KI0A 1WMSA 1ZU4A 2FWRA 3NDBB 1CP2A 3K9GA 4AIIA 1A2BA 5JJKA 2ZSEA 2R2AA 3P32A 4I1UA 3EZ6A 2XXAB 3WRXC 3TSOA 4C0JA 4P31A 5KPDA 1QHHA 3KL4A 1W5TA 1KGDA 1X8KA 2WSSD 4US1R 3KQLA 5J4LA 3N70A 2LKCA 2DFTA 3B13B 2ZJ8A 2FH5B 4QJ5A 4YDHB 1N6KA 3SI7A 1R5OA 1VYTA 5FUXA 3TBKA 1BOFA 1KI2A 2J0VA 2UVQA 2LCFA 1XZQA 2BOVA 3RS7A 1KJYA 2JDIA 1NJFA 2BMFA 2QM7A 3ZYCA 2ERYA 5JHGB
chains in the Genus database with same CATH superfamily
1G19A 3KZMA 3W3AH 3NVDA 1FTNA 2VUHB 3RRNA 2JIPA 4C6TA 3SJZA 3TECE 3GLIA 3WNVA 1CERA 3BQMB 2XCRB 2QRUA 1F12A 1FFWA 4CI0B 1G5QA 4TSFA 4UNIA 1DJMA 2DBVO 2GM5A 1U8YA 1DIOB 4JHLA 3AHEA 5LM3A 1RFLA 3ENZA 2ZR7A 3OKPA 1XNRB 3IEPA 2XW6A 5C5CA 3O91A 5ERYA 1KYWA 3TSWA 4UUAA 2ZYWX 2AJCA 5BMVF 2JEYA 1JLHA 2VDOB 1J8QA 5KSZA 2AXEA 1N77A 2X42A 2I67A 5AHWA 2BUBA 1PJAA 3GT4A 1DAOA 4M8KA 2DULA 5CJ2A 3PQ5A 3UAGA 1JAXA 3JAWA 1W4CA 4P3YA 3W8NA 5CB4A 1PR2A 3IAS1 5FV7A 4LF8B 4H1WA 1RLJA 1E1CB 1WF3A 2GN6A 3HO6A 2ZB8A 4YLYA 2ES4A 1I0LA 5G0SA 5TS3A 3IHKA 1GZSA 3BXOA 4LWPA 3EWAA 4ARZA 3BORA 2BW0A 4JSYA 4UZFA 3RK0A 1HEYA 3ZU3A 1KU6A 1FFHA 4MW2A 1NT2A 4BIIA 2H7VA 3HJGA 2XUDA 3HB4X 4Z53A 2NVWA 4CQLA 3HWSA 3KB1A 3ZI0A 4BVLA 1SXQA 4IIYA 3I0ZA 4MWZA 3F3SA 2CXTA 3RSCA 4J7AA 4XSVA 2PUAA 1IAQA 3A1SA 1PGQA 4EHIA 3ADCA 4ALKA 3H04A 1TJYA 1TQHA 4U5QA 3CBGA 2KJQA 2XKJE 3SBDA 1ZBQA 3HJFA 1UBFA 1PBNA 3E4CA 4NBWA 5IASA 4MWSA 2XZLA 1Y7PA 2A30A 2Q7OE 2ZQZA 3C3MA 3H11A 2BELA 2BFOA 3L1IA 2EFYA 3RRYA 4GM1A 3WZMA 1HYQA 2HIAA 3CX7A 1DZIA 5DYGA 5LZ9A 2FSSA 3ZV3A 1Z26A 3NHBA 3WJ1A 2ZRBA 4B79A 1GM5A 1KARA 3FROA 2HO5A 1SCUB 1Q17A 2EFDB 2AFIE 1NFFA 2HWYA 1SN7A 1ZD2P 2TYSB 1NNEA 3B3QA 3FWKA 3HCPA 1X39A 2D0PB 4TLAA 1H5UA 5AW8A 3A14A 2GFHA 2X0NA 1NONA 2C9ZA 5L45A 4OGKA 2W8BB 3AOEC 3X2SA 1C8BA 3WMWA 3WSWA 1SD2A 2VDJA 3LLVA 4OHBA 3BIJA 4ACAA 2JZOA 3T5DA 4PYMA 3FFTA 4DLWA 2SBTA 3PFFA 4CG3A 2AN9A 2B2XA 3VGPA 1SCAA 4QTYA 4WK4B 2Y71A 2Y99A 4WLOA 1L5NA 3V8VA 4B4OA 1QHGA 1C3OB 3KE9A 4PLVA 1JKMA 4ZHQA 2AKEA 3BSFA 4MIOA 2IE8A 1IE3A 5GMOA 5U4XA 4OIMA 5GZ6A 1S02A 1V3UA 5EJEA 5B1IA 1UAAA 4K87A 2Q50A 5DU2A 2QUHA 3GXBA 2QKYA 2OFFA 3UWSA 4UTVA 3WB0A 3FDJA 3PUKA 1S5PA 3PPYA 2RAVA 5E9JA 1UEJA 5M7EA 4HMOA 4JJAA 3OT1A 4RETA 2FV8A 4DLVA 3AR7A 1DHRA 1QOQB 5F1YA 4TMFA 1RVV1 1G5PA 3DE3X 1C3XA 4R2IA 3IMFA 2WQ7A 1SCJA 1WD7A 4HDMB 3X44A 2Q4DA 2GPSA 3F2VA 2YUTA 2C5AA 2H1WA 3G7NA 2GEDA 4FGSA 3PUHA 4UNSA 4X71A 4ZZ0A 3R0IA 5KS2A 3HG7A 3QXXA 1L7XA 4DJ5X 4IV8A 5CM8B 1PL6A 2R1ZA 3R9WA 2WPNA 3R8XA 3KQHA 4I55A 3A1CA 3IUQA 1NUUA 1UEIA 5ERXA 3LV8A 5D85A 4XWTA 2XNSA 2QG4A 3W9YA 2J30A 2WM3A 3DOHA 1ZQ9A 3DHNA 1QLHA 1WDMA 2ESRA 4EECA 4C88A 1XNQB 2XZPA 3CCCA 2QB5A 4B3CA 1PL8A 4UOZA 2AJBA 1USKA 5E95A 3DWGA 5NLLA 4D8VA 3HXLA 3PIRA 5JARA 3NOQA 4KW7A 4JBIA 1NMSA 3GJQA 4ZI7B 1U3GA 3KETA 2AF4C 2C96A 1SXPA 2Q4OA 5AK4A 4HLQB 5HK8A 2Z8ZA 1IRIA 5BO5A 5LBUA 4AZ0A 2EKLA 2EX0A 2PS3A 3JZAA 3NEPX 4KQJA 2HSJA 2GF9A 2G1PA 5JSHA 1UMKA 3PFGA 1NLUA 4XYBA 2HUNA 4UVEA 5C8YA 1JDUA 3DGEC 3WO1A 3I2FA 3PFHA 3KOXA 3OJXA 2PQ2A 1U0HC 3G1WA 4OB6A 4MVJF 4OAQA 1UADA 4R01A 2QU7A 1P1BA 2BTOA 2FW8A 4RMNA 1YZFA 2B8EA 4E2WA 2VWQA 3DMYA 4MI1A 5KVVA 4EO4A 3T4UA 3ZKWA 3OVMA 3U44B 3A1EA 3TPZA 2WD7A 4TWRA 1E5XA 2AOXA 4CT5A 1NVTA 1JR3A 2BGJA 3RUHA 2BBTA 3EA0A 4QT4A 3L1HA 5AVRA 1I01A 5A2GA 2JFYA 1GPKA 3ZV5A 3IELA 1HDGO 1EAMA 3H5NA 3NXKA 4YBRA 4ZAXA 1P1JA 3L7BA 2AGVA 5L4NA 1ISHA 3I23A 4RPKA 3GA7A 1WE2A 1G9XA 1RYFA 1P4AA 1DDOA 1OW3B 1SXHA 4PV7A 4XD7D 4HNRA 2HHLA 1NOIA 4ZTUB 5DX1A 2FYTA 4DIOA 3H0CA 2ANCA 5SICE 1EQUA 1GJRA 3COSA 5CURA 3TLZA 3KBBA 3KQYA 3GVHA 5COBA 4ZK2A 1DSSG 3O8NA 4O4IB 1KQNA 5AM1A 4KX5A 4IF4A 1Q84A 4E12A 1VIDA 3PA8A 5JECA 1XVVA 1U5BA 2K2WA 4L4UA 2X4IA 5AI0A 5L40A 2AH5A 3DZCA 4P4SA 2FEXA 4QPZA 5DHAA 1JMKC 3QVGA 4XQGA 1LFDB 1CB7A 3N07A 1JW9B 1URPA 2C9YA 1W85B 1C0EA 1EE2A 1Z68A 3LPAA 4ZO9A 1WMEA 4CI9A 3TRKA 5A6SA 1LBHA 4B84A 4A36A 4TL8A 1RQPA 1Y8RA 2PUVA 3EULA 5FA8A 1W5SA 4TLCA 1RXSA 3STUA 3BE8A 4EVIA 5KJFA 4MGYR 1CR2A 3ICPA 5ENDA 4TYYA 2CLCX 3VTFA 1NW7A 1FVXA 1W581 4YRGA 2FX5A 1ZR2A 2O8BA 4KAAA 1IM5A 4AS3A 3BXGA 3U6BA 1E3TA 3O7MA 4BRWA 2A58A 5I9IA 1KDTA 1IFXA 4AIRA 5KYWA 2Q3FA 1HGXA 1HSOA 1M1YB 2JJ1A 1J0EA 5TRTA 4BWVA 4DDVA 2IYTA 1X13A 5DM4A 4A8JB 4G97A 4R6XA 4D9IA 1QH1B 1RHRA 1Y33E 2YMMA 3LRPA 2XZDA 3WLTA 4BO6A 4C4ZA 2DHRA 4ARSA 1XAIA 3ACDA 4Q02A 3V3TA 3T7KA 1A9TA 1Z3IX 1XO1A 5AKYA 1Y6JA 2NZ2A 1G5RA 2C94A 3DXYA 3EIWA 4RU1A 4DTIA 3T5AA 5HUJA 2E4VA 5E2AA 4QO7A 2ZE7A 2EL9A 3ZJYA 2GXAA 4HWTA 5FLKA 4G4GA 3WYBA 3I12A 5ER6A 1DKMA 1ITZA 4A91A 3EXAA 3SC4A 5TPWA 3C3PA 3OU2A 3INYA 4KR2A 4HQLA 4V3CA 4YRRA 5DCYA 3UK0A 4Q6BA 4LBWA 3LA6A 2AOTB 3JQCA 3W7AA 4V38A 4EKYA 4IJUA 4U7GA 4YT2A 3A6FA 5CG1A 3THXB 4YXWD 1TQ8A 4DA8A 1Y3DE 1Z6YA 4R41A 4CMIB 2OAP1 2X40A 5A3VA 3EPRA 2OQRA 5K0NA 1F6DA 3EEBA 3HCBA 5L6LB 1WY5A 3O6VA 1YQXA 4TLMB 1ACJA 1OLSB 2D7CA 4ZPXA 3SXUA 4Q1FA 3RS4A 1Q1AA 2AQKA 3FCUB 3LKVA 3PC2A 4Y2GA 5K3CA 4W9RA 2PRIA 2VDLB 1VKNA 3HADA 5TQVA 4MWCA 3WOVA 1JQEA 1NVAA 2EP7A 1C1DB 3JRXA 2G9ZA 3KTAA 1TIBA 3NOOA 1PGOA 1V6SA 2BFPA 5T4BA 5IUNC 1YCDA 3KXPA 3WQRA 3AB8A 1UXJA 3HGMA 2G3YA 1A4RA 3L5OA 4BNFA 2PLWA 4NKRA 4BE9A 4QLAA 2EATA 1E2BA 4IIFA 3QX3A 4KFUA 2B8WA 4J1TC 9MHTA 3DCNA 1VCIA 1GGKA 1P9OA 2DHQA 2QPOA 4G5RA 1VXRA 1XYGA 4IIBA 4QVKA 2Z3VA 2GD1O 2QSZA 4GMXA 1IB0A 1Z0KA 2E4UA 3NOXA 3I5AA 3Q7PA 4G1MB 1OKKD 2WV9A 4RSHA 5BPHA 1WPQA 1KP9A 2BM0A 5JXGA 1DG1G 3WAGA 2QD3A 1O87A 3PTAA 1S0UA 1UBGA 3BFKA 1F14A 4MGKR 4WERA 1S4QA 3TL2A 4C01A 2ECKA 2CL7X 3FCYA 3AFIA 4AJKA 2FQQA 2BRUA 3D6FA 2FN9A 4ER0A 2G9VA 2Q9UA 4BV9A 4ZJUA 2P4EA 1K4YA 3K53A 1PR4A 3FHLA 4GQIA 1V5FA 4MS4A 2IJGX 1RQLA 3OZBA 4NEGA 4CODB 5AJUA 2R11A 4UCQA 4DNFA 5KBYA 1GXSA 1WXXA 3X2FA 3MJ4A 4DRYA 2D2EA 1E79A 3L7IA 1DX6A 2JJ2D 2X2OA 3MS4A 3SQOA 2J5BA 4MGHA 5CH5A 1N33B 1ZK4A 3PC8C 1NP6A 1HRDA 3KUXA 1NM5A 2EVWX 1ZWKA 1KYXA 3VRHA 2YV4A 3SF0A 2OORA 2FN8A 3F4KA 3AI3A 5TQ2A 4Z2YA 5LBIA 4F9EA 3B3FA 1L4YA 3O1JC 3N53A 2YZ7A 3VR0A 4A8PA 1TYZA 1DC7A 2PCLA 4R05A 3TLGA 4ND5A 1NXSA 3W7BA 4RTRA 3AKDA 1RXYA 4RD3A 3W5DA 1FRFS 4O2AB 3NMUF 1A2OA 2PS1A 1KAMA 5ITSA 3K1TA 3H65A 2IBMA 3PSAA 3QY0A 3TLYA 4I1PA 2ADMA 4LY6A 1E62A 5A5VA 2OCXA 2RDMA 1Z0IA 3HRHA 4EA7A 1U0BB 2UXCB 1NJ6A 3EIQA 3LBIA 3LM8A 4R68A 3S5JA 3ZGNA 3F67A 3QEMA 5DLDA 3Q98A 3TCKA 3RYIA 3O4VA 2HKIA 3PXXA 2YJGA 3OZFA 4QE3A 3PB3A 5DHTA 3SEZA 4D6PA 1UKCA 2XLCA 4GLOA 5I8ZA 5ITVA 2G09A 2BKXA 1AMNA 1EE9A 1DJLA 2G28A 3GFSA 2ERCA 1YO6A 3JVUA 4UZEA 5GONA 5AP9A 1RYDA 3E2MA 5G4KA 5HG0A 4MS3A 2BSQA 5AVQA 2PO7A 5EEGA 2BONA 3KTFA 4Y98A 1Z2PX 4L72A 3U31A 1MQAA 5ANRB 4BLUA 2QORA 4EG6A 4IO1A 5A03A 2QD2A 3NRBA 3EXG2 5DWVA 1RMTA 3FHCB 2XAUA 3M34A 2WHXA 4PC1A 2RGRA 4NFHA 3JQGB 4KWCA 3AY7A 5KQGA 2GRAA 4UBJA 5G4LA 4NU0A 3WGHA 1UM9A 3KV1A 4FD2A 4WBNA 1DC6A 4KQWA 3FYUB 3SHOA 1HNWB 2LRHA 5AHKA 1T2VA 3G13A 2WJJA 2B4YA 2GEKA 3VHRA 5IT4A 4JBNA 5CNMA 5KDOA 1GNRA 3N3AC 4WEOA 3O73A 4JX9A 2HHJA 3VR4A 1NBHA 1WZIA 2QPAA 4EB8A 4EHJA 4ZJPA 1EDZA 1TPZA 4FYVA 4RK6A 4JJKA 3N86A 3NJRA 2NADA 3K71B 2O07A 3UV6A 1DJNA 1E2IA 3NEAA 3OEED 1UZUA 4UHKA 1Z22A 4EGFA 1VSVA 5AK6A 2XT0A 3OFJA 1P4JA 4EFLA 2O50A 1E77A 1KVRA 4X62B 1CY7A 1S4MA 2ZLBA 3I0MA 4ND1A 1PWZA 1V1RA 5FR2A 2ACVA 5EXTA 3INTA 4CKEA 1UOPA 5EY5B 5COAA 2IY9A 2L2QA 4M1KA 4S1VA 2IDJA 4X1IB 2YQ5A 2W6JA 5IJ9B 4PNEA 4NBRA 2YQ4A 3FCSB 3JVIA 4JH0A 3GRRA 2P27A 1FY2A 2GRJA 2C5HA 4F38A 1KAQA 1YL7A 2WTMA 2GEVA 2AZDA 3IVRA 1RLUA 3GX1A 4BRSA 1ZNXA 4DG5A 3DFIA 1FQWA 3R7WB 2ZSAA 3TXAA 3HPQA 4FZJA 1GZUA 5JSKA 2AG8A 5HE9A 7REQA 4ZT5A 1LLQA 1HE4A 3N2KA 6LDHA 3P0EA 3X1XA 4O0MA 5JD5A 1AU9A 4J0KA 5JS6A 1YV9A 3CINA 2VDNB 4LBYA 4KPEC 1VRCA 2RHMA 4TQAA 3S99A 5GTDA 5HRAA 3VNAA 2VEOA 2P9YA 1K6MA 1NLMA 1SIBE 3GDFA 2OHGA 2JHGA 4XVRA 4CJXA 1P17A 3UF0A 3UIEA 4GPAA 5B5SA 1GQQA 1PR1A 1HDRA 1K5GA 5AW1A 1JPNA 1NJ8A 2IBSA 1BDIA 3M5WA 3R44A 4LC1A 4C7JA 5CB4F 1T8WA 3FYSA 4X6YA 3AEUA 4MR9B 1BC5A 4YRIA 1BD3A 2H07A 4GH5A 1P3JA 3DAHA 2BHRA 4BP1A 2DY1A 3L4SO 4M8LA 3U4IA 3JYPA 2VQ6A 2EYUA 4MP6A 5FLEX 2BGWA 3HVUA 5FO0A 1TEVA 3BDAA 3E2PA 3BEDA 3DGFC 2A9OA 3UC5A 3W7VA 2WSYB 3RFCA 5BUSA 3EQ6A 1W5FA 1SC9A 1O2DA 3OIDA 3GUVA 4YUYA 3ZXSA 1PR3A 3QJYA 4ZT7A 5ALLA 1B00A 3JV7A 4L7QA 3H6GA 4AMVA 3P9RA 1J0BA 3RT7A 4CG0A 5JEEA 2JLVA 2O8CA 2AZXA 3VR3A 2CCGA 2YZ2A 1TK9A 1OXMA 3E58A 4MHSA 2BGTA 3V32A 5DNWA 4PO9A 3ZH9B 4DRXA 1HXHA 2P9JA 3QX9A 3PD1A 4EF6A 5CDUA 2NO7A 4IL5A 4DUPA 1QIDA 2QL7A 3IAM6 3WAJA 2P0EA 3LBHA 2OBNA 1J2TA 1LLCA 1L7PA 3CLKA 1BMFD 4D4JA 2Z5LA 1RZUA 5G3ZA 4BWFB 2E2WA 4JB2A 3CVYA 4FQ5A 4D0NA 3RAEC 1IWBB 1QYVA 2AFVA 4R2XA 4AN4A 2REXB 4ZRDA 1RU3A 4MCAA 1YA8A 3AUJB 1QS0A 2ZTVA 4QEZA 5F2OA 1Z0FA 2Y6UA 3WI7A 5JWOA 1H85A 2ZT8A 2XUOA 3QUBA 4E94A 1PFKA 4V0RA 4JUFA 2OVBA 3C8DA 5AM4A 1GAWA 3AM3A 1IZ8A 4FINA 5K8LA 1D9ZA 5IJ0A 3ISJA 3O93A 3CUYA 5CFZA 1L4HA 1R6DA 1BMTA 1PZGA 2TRSB 4OG2A 1RP7A 1D2CA 3JARA 1N0IA 4NCIA 3GDOA 3NYRA 2JGRA 1E3MA 3QUQA 2QN7A 3JQBC 4BNTA 4JLDA 1WSDA 2J0EA 3RKSA 1M34A 2R7LA 3C39A 4GI3A 4JI0B 2R8EA 5KNLA 3FPLA 3DZJA 3PGKA 4G85A 2BI4A 4WXYB 2HH9A 1FRVA 1QK3A 3FRHA 2IP1A 3BWYA 4HLUA 4MEJA 1OBCA 3LXRA 1KWGA 1AHIA 2CW5A 1XBTA 2HMUA 4N7JA 5DRTA 2M1XA 3B89A 5CEEA 3LY8A 3FMPB 4WNAB 5BSRA 2VPZA 3VR5H 3V5NA 1Z4PX 3EBLA 3RF7A 3P5SA 1QP8A 4NBTA 1GU1A 1X8JA 2WUEA 3D0QA 4G41A 1IJEA 1VDMA 2A3RA 1ECFA 1DADA 2FZKA 2LCIA 2ZETA 5CLFA 4UPEA 1FP2A 2IHUA 2O2SA 3QPDA 4PCAA 2CF5A 2OLJA 3AP1A 4P53A 1KK1A 5AHXA 3QMWA 2ZWVA 5TEWA 4G0VA 5HKAA 2JA1A 4LGCA 2G9QA 5FKJA 2FSVA 2C4VA 4ZVSA 1FRZA 4OI1A 4I55F 4YCNA 2FSFA 1ZP6A 5CFNA 4FC6A 5KB3A 4U2GA 4HRYA 1RADA 3DKVA 4RGQA 1CF4A 2ZOSA 1RLTA 1HE2A 4N3CA 5CIWA 1YRAA 3A9SA 4YDSA 1P5RA 3MT8A 4TXJA 1O95D 1SXJC 4JEIA 5CHEA 2EJWA 3N75A 4J94A 1OGIA 4UFPA 2IUTA 3KKQA 4ARIA 4AZ3A 3VPFA 2Q3EA 3IUSA 4O4LB 4G56A 5GY7A 3OHPA 2FZWA 3AJRA 2ZU6A 1P7YA 4I9NA 4R83A 3IJPA 1VKRA 2Q46A 4PX5A 4NENA 2ZUEA 2VKTA 3DJFA 8ATCA 5FORA 1Y5LA 1C3JA 5L6MB 2O7RA 5JZBA 5HRCA 2DTEA 5C8YF 1JHRA 3KEQA 1GR0A 2AKAB 1B6RA 1RRVA 1RKXA 3VUFA 3WYAA 3JR7A 5B4UA 2P69A 1Z4IA 5JMOA 2O54A 1EDOA 1VHDA 1XD2B 2OGZA 4XWAA 4REQB 5L3RA 3UAXA 5NULA 3W8DA 4MCHA 1NAHA 4R9VA 4K6MA 1TZMA 2YJTD 4Q3LA 5ALXA 4KIGA 3LKDA 1XC7A 3SC6A 4D3DA 2YKGA 5JNLA 3PBKA 5TV2A 2HY7A 3UB2A 5KWEA 1FP1D 1BS1A 4R9SA 1SUCA 4PBSA 4RF3A 2CK3D 1A72A 1LH0A 3DL0A 1USGA 3A4NA 4Z2AA 2HX1A 3DMTA 2B7LA 1U4SA 3G5MA 2C0CA 4CNBA 4CU5A 5HOEA 3C6BA 2V5VA 1A5ZA 3AL2A 3D4PA 3R0QA 4I4IA 3UYKA 2SCUB 5F9MA 3WR5A 2CXXA 3RBAA 1T1EA 2A9RA 1ZCBA 2J67A 3V4RA 1BTOA 5K1ZA 4LPSA 3KKMA 4EEZA 4G8JA 3PE3A 4PX3A 1M73E 4IQGA 3L6CA 1ILEA 2FDCA 1VGVA 1K3TA 1PJBA 1YJCA 3H4MA 4MQFA 2BFMA 4X64B 1N2EA 1P6UA 2WSIA 1JU9A 3CRVA 3IUPA 3KFVA 4RL4A 2D5BA 5L3SB 1W2HA 1PQYA 3SAJA 2OSVA 3DYIA 4Q4JA 4FKZA 2APJA 3U48A 4LXTA 4PGGA 3CX6A 4M8IA 2OGUA 4OY3A 2D1YA 3C3XA 4Z3KA 4LTDA 1UF9A 4UUQA 4A2QA 4D4IA 2R6R1 3O8LA 4BNUA 1ZJJA 1J5XA 1U2SA 2EKQA 4EBFA 1SVNA 4BMDA 3VAYA 5LXTA 4N0QA 2VDWB 1SVWA 5FOVA 3LL4A 3QVJA 4MV3A 2EFCB 2Q8QA 4FFVA 3GHYA 3ST7A 2JHPA 1MX5A 1YI1A 1WXIA 2MSCB 1XRRA 2WP8J 4EI8A 2QAGB 4M1SA 3C4QA 3M2PA 4B4WA 1OXTA 2OECA 4J2TA 2Q4RA 2XVAA 3QHPA 4HWKA 3C5HA 3I2KA 3TNYA 4GO1A 1FQKA 1OWMA 3GH3A 5EOVA 4EQ6A 3GEHA 2WKRA 5HIIA 1Q1EA 3U3OA 4DA9A 1C0LA 1RBMA 3EGXB 4RM2A 1SBHA 4KMRA 4UHBA 4YAGA 1E59A 2IU0A 2GCOA 4OFZA 4JFRA 4G0QA 5JNRA 1H2HA 3IPXA 3WGZA 4E2YA 2OOSA 1KDYA 2WDPA 3KOMA 3PL1A 5F1PA 5AOVA 1QQAA 4H18A 4HWPA 5F9FA 1FFGA 2A57A 3G2JA 4XD7A 4BCBA 1JFRA 1CS0B 2D06A 4UJ5A 1KMHA 2QNIA 2H4YA 1U0JA 5D2CA 1JXQA 2A67A 1XMSA 2RFLA 3PF8A 5J1TB 3U0VA 4Q3CA 4BZXA 1SG6A 4D45A 1PZEA 1SBYA 1E6KA 2ZI6A 4OPMA 1QH0A 3DUWA 1E64A 2YICA 3IPRA 4BATA 2AX3A 4NV1A 1W9MA 3V4SA 3N74A 3DZBA 1XELA 4Q9JA 2EBUA 3S2YA 5FTWA 4LYGA 4OAPA 2J7PA 3EGCA 3OOYA 3SOPA 3L1JA 2X22A 3F6CA 5KNCD 4LE0A 3W3AA 5DNAA 5GOZA 2VUIB 1BIFA 1UPFA 2RGUA 2C1ZA 3VZRA 1Z5VA 4ZYLA 3EA4A 4KTTE 3CF0A 3E9ZA 3STVA 4MEBA 5CW2A 1LBEA 5KWJA 3VBCA 5FRDA 2OCAA 1PV4A 3L7LA 3EY4A 3ZDYB 4QTUB 5JSFA 1EJ0A 2J9YB 5I7RA 4S1PA 3OOJA 1OT5A 4DWOA 3TOSA 1OPRA 5SY4A 4MDFA 1OZHA 2FUEA 3DE7X 3T7JA 3W2FA 1N0WA 3AILA 1GQFA 3A2MA 4HSGA 1EVZA 4Q15A 4AVYA 4JWKA 2ECFA 3KVVA 2X0KA 1O03A 4YUWA 3QVWA 1EZ4A 2IIQA 2IXAA 5KC8A 1NJ1A 4RJJA 2ZWOA 4DY6A 1GKKA 5ADHA 3V4OA 4UFNA 3VTZA 5K51A 1Y1SA 2IKQA 2PPVA 1ZM3A 3A3KA 3BGSA 3BD9A 5THKA 5H02A 4XOUA 3FUUA 5B58T 1Q1BA 2AD5A 1E3EA 3ENKA 3IJ5A 2IE0A 3NR2A 3TJMA 5AVVA 2A1TS 4HDNB 5LIPA 3OT5A 1F2TA 3R5KA 4BNJA 1X1CA 1T5DX 1PJ2A 4KO2S 5CLGA 1E6WA 3DVAB 4CLRA 3ADBA 1OIXA 3R8FA 1V8BA 4EG8A 1AK9A 4LXYA 3KQPA 1WRBA 5AKKA 3Q12A 4MYSA 3ANNA 4QU8A 3WNZA 4P38A 4LDAA 1U65A 2JVIA 1QTRA 1DOAA 2ZJ2A 3DWFA 4MQUA 1Z28A 4TGLA 1BWPA 1OREA 2XT9A 1KRWA 2Q8PA 1EVJA 2EHDA 3FPGA 4RXMA 3ZNOA 5HKBA 3WQHA 4CQJA 5I5GA 3GZTB 4LJRA 1YA4A 2ZZNA 4E31A 3PWSA 1P5HA 3ZHYA 3UFXA 1CEQA 1VYHA 3RSOA 1J0DA 1XEAA 3ZBQA 3L93A 4KQFA 3T7DA 3A3OA 3DLHA 3AIIA 1YVUA 1ZL0A 4F9GA 2B9VA 3L1VA 3MVEA 3O8QB 5CVDA 5C1OA 2HSWA 2WZBA 3FWNA 1QIIA 4S2EA 1FYVA 4MPRA 4M6WA 3E70C 3DWEX 3GOHA 4Y0VA 4IVNA 1U9ZA 2JIZD 4URFA 1W8DA 5GONF 2YOGA 3RC1A 4DMFA 5CTJA 5AD1A 3F9IA 3PQFA 3V8NA 2IS1A 1MGPA 1TLTA 4HDKA 4B2LA 2C5EA 4MHTA 5HKLA 1R27A 1QHSA 2W2LD 3VPGA 1MIHA 3DZHA 4QU9A 4RD4A 1DKQA 2Q5EA 3DC7A 4FSDA 4PG4A 3LCMA 1L1EA 3HGTA 2RG7A 5F3DA 1MO2A 3CVVA 1ANKA 1N2JA 3AB3A 5DEIA 1L5MA 2QY9A 4O02B 4LHEA 2IZZA 3JTEA 4IMRA 4WN9B 4RKWA 4YJFB 3NRCA 2NVUB 1TJNA 4WBNF 1VM6A 3T3NA 3SWWA 3VYSB 3U56A 3D81A 4FN5A 3BOSA 3QPUA 4M98A 4IIJB 4JV5B 1OXXK 3F0TA 1PDOA 3IC5A 2V7PA 2NZXA 4NZNA 1UZMA 1VJTA 2V1XA 3RE1A 4TUYA 4DWJA 1RI5A 4Z7QB 2X9QA 3LUHA 5EHQA 4ARAA 2WE8A 3K05A 1YQUA 2EKBA 2GHRA 3F7MA 1I24A 1XRMA 5AWFC 4LI3X 2RHLA 3TVTA 2MINA 4DA4A 4K0KB 3U17A 4MV8A 2V7QA 4KR0A 2E6KA 4JUCA 4FWBA 2O5VA 3KVYA 4F4FA 1QYRA 2JK0A 3TXYA 4QGSA 1SBIA 1UQTA 1L5RA 3NIBA 5AKZA 5C3MA 2C78A 2DY0A 4UAUA 3W1EA 1A2KC 2IS4A 4F11A 3IB6A 4XQCA 3FWZA 1TDJA 3MUEA 2OHIA 4FZ5A 3SMVA 4G5XA 1H5NA 1IXSB 1LVHA 1XFAA 3F46A 5CVUA 4EEXA 1VLVA 3AR6A 4KHZA 1CJUC 1RKVA 1ZONA 3EC2A 4QATA 4MKGA 1P18A 2ORIA 3LPMA 4OSEA 4BQQA 1CBUA 2RGCA 4ZQGA 4IJKA 4E5DA 2WMNB 1YHNA 2GN2A 2WTBA 1GOTA 3K16A 4AKEA 1WY7A 1Y4ZA 3ICWA 1DQYA 1FZQA 1ULSA 3MXTA 4M9UA 2H18A 5FNVB 3DUFA 3UKJA 1R6BX 1S6YA 3OKAA 4BV3A 2FUG6 4QG3A 1LV8A 2OC4A 3ZGZA 4RH1A 1RPZA 1VSBA 1PKEA 1P45A 1E2HA 4MQMA 4NBKA 1FNCA 4OJMX 5AKGA 4PSUA 1A9QA 2F4NA 3HCWA 4P0TA 3NHUA 4KXWA 2Z6UA 3QFRA 1K5HA 3ICOA 3IOBA 4LSGA 3S2ZA 2EARA 3SP1A 4F4CA 2L0XA 2R62A 3CZPA 5C53B 4Z4FA 3I30X 3IDFA 1GL6A 4YACA 4DWVA 2OCBA 3D7MA 2PBFA 3SXJA 3HCAA 3FI9A 5D5QA 4F1JA 3DAOA 4L02A 1J42A 3L0PA 2V8BA 1F51E 1EVIA 2B35A 4NIMA 1KJ9A 1F8YA 1V6CA 3HSSA 1WX1A 3QWBA 1IN5A 5EC8A 1ULHA 3FJ1A 2H5JA 4UUMA 4LMPA 5D51S 1OU0A 5E1OA 3X1DA 1YS7A 5I9LA 5D00A 4EI2A 1K7YA 1M2VA 5F33A 1OPXA 1WUKS 3WYNA 2ZDQA 4GX5A 3N2GB 3BSSA 1USIA 5BMVB 4G84A 1VFNA 3BRCA 3DEIA 5DM60 4M99A 5LD2B 1KAGA 2P11A 1QVZA 4ESVA 4RJKA 2EFJA 3BD7A 3K0EA 2ATVA 1XEXA 3BZUA 3O9VA 1FSGA 4NCXA 1E3IA 2GHIA 4XLLA 3TRDA 2V0CA 1RM0A 2AW3A 1NBME 3CF4G 4HBZA 4PG6A 3QLVA 2VYQA 3LGSA 4MYHA 1GUYA 1XZCA 2OYRA 5K8UA 1QDUA 2JD1A 3HCCA 4RTOA 4QXOA 4CUKA 5BQPA 1RPNA 2YZNA 3JZDA 1BCRA 3PRJA 2OVFA 3BA1A 1R4NA 2NTNA 2R68A 4PGAA 3KAKA 3SR3A 4XUDA 1HDXA 3NM4A 2TECE 2VJKA 3JQ6A 2QMUA 1ENZA 3NVAA 2RG1A 1AXEA 2H5LA 3NASA 4JIMA 4BNYA 4BS9A 4FR5A 3JRNA 4JGBA 4GP9A 4MQEB 3QVMA 2BC9A 2VJPA 5K5EA 2HU8A 4LBVA 1EA7A 1ZNQO 2C61A 5JC8A 3WADA 4OO3A 5A2QA 3CSUA 4BLVA 9ATCA 3REGA 1TM5E 4LMRA 2TMKA 3JQQA 5TT0A 2LNDA 1XSEA 4QHTA 4BUCA 3PYXA 1GT6A 1RHMA 3CVJA 5I5EA 1SIWA 1IIBA 3EXIA 3MOSA 3OC0A 4NFSA 4LYFA 4BP9A 3CKMA 1J06A 3E35A 2IZ0A 1EVLA 3GDWA 2ZRHA 3U80A 2WLTA 2VC2B 4LRTB 1QZ3A 3FDZA 2FVYA 4A9AA 5KTOA 4C14A 1KZ1A 2YBDA 1EINA 1E4OA 2ZPAA 2CLKB 4HGYA 1F5NA 2ZRKA 3VDQA 3TW4A 1XNJA 1ZJ5A 3MLEA 2QLNA 3ZDQA 3V33A 1WZUA 4JL6A 4NSNA 5JW6A 5ITZB 1Z6QA 4V39A 1NV9A 1S1MA 3HDYA 1JIXA 2NU8B 5HZKA 2IVZA 4EDFA 1PJ4A 3PHJA 3SDSA 3BILA 4BFCA 1T36B 1ECLA 1OV4A 2HNAA 1BMFA 1P9RA 1QJ4A 1QYCA 2QWXA 2QRPA 3EN0A 1GTVA 2BFBB 3WNQA 4ROTA 1YZVA 1ZAKA 1ZN2A 2EW2A 3IDAA 3P4UA 3WMFA 4YN3A 4N7RA 3UXEA 2AFHE 3U4QA 2GQ0A 2HI0A 2XF8A 3C6KA 3R3SA 2UUPA 1P60A 3WS7A 2P3LA 2CUKA 4INPA 4PLZA 1EXMA 1W0JD 3DT8A 1P77A 3ANTA 4X91A 2Y92A 3JWPA 1XZHA 4ZRMA 3UJ8A 1UBRS 2JIOA 3AC0A 1CRQA 2WSBA 2XUKA 3D6TB 3I6IA 4J1SA 3P2KA 4YQYA 4RGVA 5ALWA 4DT1A 4LHSA 1L4LA 2B61A 3G2MA 3CE9A 3LCCA 5HS4A 3F78A 1OY1A 2HMAA 4J2HA 2ZJ7A 4E7PA 1S9DA 1W0KA 5FBZA 4N6NA 1RRFA 5ALDA 2C03A 2TMDA 3ORHA 1P7CA 4OUKX 4QUAA 4U7FA 3IBCA 4RKFA 4Y2JA 1TIKA 1IZ7A 3M33A 1MABB 5G53C 1ZEMA 2VNJA 1DQSA 5EJ7A 5B1DA 2ZIXB 4UCWA 4HP8A 3AXTA 1ZICA 3T1VA 4Y2QA 3ER8A 3KYCB 4Q5IA 3JVVA 1U2GC 5DISB 5AESA 4PPGA 3PVCA 3V8MA 4OJQA 4JP2A 1U5CA 5KNDD 2E5FA 4RX1A 2PZGA 3W1VA 4WESB 3W8EA 1DARA 3IQWA 5D5HA 1KH3A 3RYFB 4RD6A 1Z16A 4HADA 4W8GA 4B83A 3PNMA 2I22A 4UHHA 3AY3A 4MQ6A 2WM8A 3MJDA 3FVTA 2O7QA 2REQA 1NJ5A 1NW3A 4ITVA 4Q1AA 5H70A 4MQLA 3UO8B 4BC1A 2A0XA 4JN6B 5AQEA 2Q5CA 1NC3A 3VZBA 3E84A 4EYEA 3Q8KA 3RIGA 2I7XA 1VBMA 1ECPA 4I3GA 4XB6B 4WVFA 1JMYA 1EFVB 1KMIY 2XHEA 2ZT6A 4FCVA 4WOKA 5B3JA 3ZR4B 4AKSA 1TTTA 4OOEA 1R5NA 1QG2A 4GOXA 4ZJZA 2YZMA 3O47A 4IFTA 3QBDA 4BCCA 4UTNA 1PJSA 1HT0A 1Z82A 1V3QE 2AK3A 3Q2OA 4LA4A 5LYJA 4A8HA 4AY3A 4ZAVA 5C46F 4RTPA 1L5KA 1EK6A 5EXEA 2R7KA 1T0BA 3WBJA 2JLQA 4OYLA 3TGWA 1YFZA 4F9TA 3LVQE 2ABWA 3MGAA 4H77A 4TKMA 3F7TA 4E21A 1K9SA 2IYQA 3MD0A 1A7UA 1MDBA 2JFGA 2WUVA 1TQ4A 4QUIA 4YRTA 4YCDA 3RRXA 1ZW6A 1VIVA 2NO0A 2QR2A 2Y1FA 3KB2A 4L95C 4AY4A 2ZAIA 3GJZA 3I2JA 4KSYA 1ZM9A 4E13A 4G4SP 3UEOA 2IYXA 2EHJA 2QX9A 3PFNA 5H9WA 4MRNA 3Q7IA 5C4MA 1GKUB 3GAZA 4RKRA 3OCXA 5JJ5A 1FJ2A 5KAPA 2ZJZA 2ZCVA 1XG5A 2F17A 2VJBA 1QQ6A 5B1SA 3V1LA 4C4TA 3Q9SA 3NAZA 1L3CA 3DF9A 5F7XA 3I5XA 3G9ZA 3LT1A 3OFVA 5BNFA 2CNKA 2BUCA 1XIVA 2WYIA 3RHFA 3NX4A 3LYAA 1PP4A 1D1QA 4B3FX 1U2DA 4HAVA 2C3YA 4EO9A 2W4MA 2D5IA 1CIPA 3AETB 1OVMA 3JZIA 4HNGA 4JLWA 1US8A 2X58A 3C87A 1NF8A 4KSCA 3RV3A 1QR6A 3UJBA 3V4ZA 4NXMB 4GMFA 4FW8A 3U62A 3TLAA 3AHIA 3KVNA 1A9RA 1ZI6A 3QTLA 4WUTA 1JFSA 4JT8A 1OXSC 1QC5A 2NT3A 3JX9A 4I7EA 3N3BC 4EF4A 3GLIB 4N0DA 1ZXXA 3EVGA 2BVNA 4XVQA 3NYWA 3EIXA 2Z2XA 1Q12A 3GJ7A 2QLTA 4KPUB 3W4JA 5KTNA 3IAS6 4PNPA 4BFVA 3HR8A 1Q20A 3C74A 4MWBA 1DAGA 1E6UA 2WVAA 1AX9A 1HFEL 5EESA 4YHHB 3GNTA 2BH2A 2XBMA 3A4TA 3LT4A 3MCWA 6YASA 4DR1B 1B3RA 2FZEA