2PLRA

Crystal structure of dtmp kinase (st1543) from sulfolobus tokodaii strain7
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
212
structure length
212
Chain Sequence
b'KKGVLIAFEGIDGSGKSSQATLLKDWIELKRDVYLTEWNSSDWIHDIIKEAKKKDLLTPLTFSLIHATDFSDRYERYILPMLKSGFIVISDRYIYTAYARDSVRGVDIDWVKKLYSFAIKPDITFYIRVSPDIALERIKKSKRKIKPQEAGADIFPGLSPEEGFLKYQGLITEVYDKLVKDENFIVIDGTKTPKEIQIQIRKFVGELIDNSF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable thymidylate kinase
molecule tags Transferase
source organism Sulfolobus tokodaii
publication title Crystal structure of dTMP kinase (st1543) from Sulfolobus Tokodaii Strain7
rcsb
total genus 86
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2007-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2plrA00
1G1MA 1N6HA 1UBEA 2OO7A 2VSFA 3K70C 2ZE6A 4KU4A 1ZD1A 4XTCS 3MWLA 4Q1BA 2GF0A 2GCOB 1Z6AA 5HCNA 2ZVQX 2EYUA 2GILA 4A4DA 1F6BA 3UK6A 2CVFA 1CXZA 3GCGA 3KUCA 4IDQA 4B34A 1NY5A 3VHLB 3SS8A 2J59A 2J46A 4RD4A 2F55A 1GNPA 4PO8A 4FMDF 1E4VA 1GWNA 1N6RA 1QBKC 2PZGA 5IDVA 2V7QA 1JQJC 3WP0A 4HB0A 4W5WA 4QKQA 1XRJA 4GMDA 4UQOA 4W5HA 1M2OB 4MYCA 2IF0A 3B7GA 1A2KC 1TPZA 4B6FA 1NSFA 5TMPA 2H8KA 4GDFA 2X1VA 3UWKA 2GNOA 4B2LA 1RC8A 1AZSC 3W6OA 4GSYA 4BFSA 4ZDWA 1Y3AA 4Q9JA 3CRMA 1CEEA 5B30A 3MG9A 3PUVA 1LS1A 4PSVA 4D82A 2YWHA 1TF2A 1AK2A 1JR3D 4LSGA 5LD2C 2EFGA 4BLQA 3CNOA 1VCIA 1Q1EA 1FUUA 2C95A 2J9RA 3WYFA 2ZR7A 4L9SA 1P61B 1ZD9A 1VDZA 2O8FB 1X6VA 1JECA 4EPRA 1S9HA 3ZGXA 4RCZA 5H70A 2CJWB 3FTQA 3SBEA 3N70A 3A37A 1LS6A 4FI3C 1ZMXA 2AD5A 2ZETA 4R9UC 3S1AB 1P5ZB 2EYQA 1Q21A 3ZQJA 5J47A 2LKDA 3EZ2A 1S96A 2VP6A 5CK4A 5G41A 3AVWA 6Q21A 4MRVA 4US0R 1S3SA 2ZRGA 3LO5A 2NGRA 1OXSC 2FFAA 5EP4A 4Z54A 1XMIA 4JT2A 3AVYA 3ND8A 4UXJA 3THYA 1MABB 3NEJA 5D3QA 3ZDQA 1X8KA 4Q4LA 5F98A 4O25A 1KMHA 3PFIA 1R10A 4FMCF 4XWKA 4LJ4A 1P75A 1NKSA 4LHXA 3P20A 4F4CA 1QHGA 3FFBA 3MJHA 1EX7A 1EFRD 2QM8A 1IBRA 3GLGA 1YR7A 3QKTA 4OBEA 4PC2A 5BXQC 1ZM7A 1VG8A 4QRHA 2WJHA 4B3XA 1NN0A 4PX9A 4DT1A 4B3GA 1II0A 2DFKB 1LV7A 3RC3A 4HDQB 1G9XA 1G3QA 1NN5A 3AF2A 3B60A 3KXIA 4QC2A 2ZS8A 2A2ZA 2RGBA 1Z0DA 3ADBA 4B48A 5LBIA 2G9NA 3F0TA 3T5GA 5B64A 2P5SA 3MGCA 3WRYC 2FNAA 4US1R 5J5CA 3ZZTA 1P9RA 5IF9A 2NO1A 2WMOB 2V8OA 1RRFA 5BYJA 4BWYA 4CGZA 1KSJA 2Z83A 1OLOA 2ZUDA 1Q1ZA 2YC2C 3CWZA 5LDDC 1AS3A 2VYFA 1JB1A 1E9AA 2CMKA 2ZAOA 4N3NA 5EXSA 1ZNWA 2ZRIA 3MD0A 4QJ4A 1R0ZA 3MAAC 5CK5A 3WYGA 2AD1A 1IXZA 4DBLC 2NO6A 4I1OA 5AUPB 4G5QA 4M22A 1A2BA 2G83A 4IFBA 1P7CA 1NNEA 3X1WA 1E2FA 3Q9LA 2J3EA 3UG7A 2VPPA 5JSZB 4OI4A 4KFUA 3RWMB 3VHXA 4DLZA 2GVDC 4FWTA 3VR6A 4OQNA 4F38A 2A5JA 1XD2A 4XIGS 1CTQA 2QQ0A 1IHUA 4EPTA 2GZDA 3ZVNA 4ZPXA 1IJFA 3C7KA 1OXXK 3LVQE 4DLSA 2XZOA 2O8BB 2BMFA 4POAA 1PJRA 3VX4A 4G3XA 4HLCA 4IDNA 5G53C 1KIMA 3SFZA 1YZUA 4TLBA 4PANA 4L9WA 3U3JA 4DCSA 1XP8A 5KSYA 2ASEA 5FI1B 3EPKA 1XTJA 1AGRA 1SXJD 2ZJAA 3K8YA 4A0HA 4C0SA 1QF9A 1KNQA 1KTVA 4PO1A 4DVGA 3K9HA 2QROA 3PVSA 2NOAA 1OFHA 3E5HA 4B3FX 4HLDA 5K8UA 4UXIA 4BZPA 5AJYA 3L2OB 2RHDA 2B6HA 1EWRA 1SHKA 1FP6A 2ZROA 4ILEA 3CZPA 4E22A 1N0VC 1DAHA 3AVPA 1L4YA 3OEEA 2IEZA 4H1UA 1S8FA 2J0SA 1XXHE 1OFIA 1P9NA 3WY9A 4A6PA 2OBMA 2JLSA 5BWMA 1XTSA 4L15A 1KI6A 3OF5A 1XJCA 2GDJA 2D7DA 3QI2A 2CL7X 4Q1DA 1D6JA 1X1SA 2NTYC 1G41A 5GJVC 3GP8A 2YZ2A 1LTQA 2IS2A 2QMHA 1S1MA 2L0XA 4ITRC 2D2FA 1XEWX 3EZFA 2DWQA 1Z8FA 1IAQA 4Q7LA 3BB4A 3FHTA 5DLQC 3VR3A 3PEYA 3ZS8A 2PX0A 2A5DA 3K09A 1ETUA 5IK2A 4LX0A 3ICEA 2ZSFA 1KJWA 3PUXA 5J4VA 2J45A 2W6ID 1P2SA 1N0WA 2XEXA 3QF7A 4DDTA 3FMOB 2F3TA 5D3MA 2GKSA 1JAHA 1CKEA 3CKLA 1GUAA 1KK1A 4BE7B 1R5BA 1HTWA 3SYKA 2A5YB 5DN6A 1DADA 2BJVA 2Z4SA 2KI5A 5TDHA 2QGNA 3R9XA 3PUZA 5FL7A 4BLSA 2VP4A 3K0AA 2QPTA 1D2EA 3IDQA 4ZO4A 3MUFA 2QPAA 4HAXA 1XD8A 3TUIC 3MMPA 2NIPA 1TU4A 1DBSA 3IQXA 2ORIA 3EA0A 3F3YA 2XAUA 1MKYA 4C0KA 3BAFA 4URXR 3TVDA 1AS2A 1XDBA 3EAQA 2GXAA 1OE0A 3Q5EA 3TK1A 1Z47A 2IXEA 4PQYA 1WQ1R 3LXXA 3SI7A 3VR5A 4LPKA 1QVAA 3LV8A 2PMDA 4V03A 4OHZA 2O0KA 3QVUA 1PV4A 4G0NA 3GLFB 1WXQA 1ZUIA 1VKJA 4KFTA 3IPYA 3A8TA 2JLRA 4BZXA 1TQ6A 1TNDA 4HAUA 4W9MC 3QKRA 1QHSA 5BN3A 1Z63A 1OYYA 4JLVA 1E1RD 2JJ2A 4LPSA 1MO4A 1S0UA 4TTQA 2YJTD 4YONB 421PA 4PAOA 5FUVA 3L8ZA 4PSKA 4PZLA 3LBHA 1F2UB 4QBHA 4HLQB 1BMFA 3IIKA 1NBME 2ANBA 4QBFA 1Z06A 2VHQA 4PAQA 1W48A 3B8HA 5EE3A 1N5JA 2D06A 3T61A 1CP2A 4PZZA 4ERNA 4KFSA 2HT1A 3D7MA 2BCJQ 2C9CA 1ZCBA 3G82C 1GIAA 3BFVA 2PH1A 4B75A 1RJ9B 3K0AB 4EJSC 4RD1A 2ZRCA 2QAGC 3U7EB 2KBFA 1AQYA 2WJVA 1V43A 5HPYB 2ZE5A 5DI3B 1FPMA 1WDTA 4OL0A 4JT4A 3GJ0A 4ZCLA 3GFOA 1OXVA 4JIMA 4D0LB 1E9CA 2IYWA 1OH7A 3CPEA 2GAOA 1DEKA 4U02A 5F9FA 2FFBA 3JZAA 4D2IA 2QA5A 5TXGA 2ZM5A 4TQAA 4QJ5A 4Y0VA 2Y8EA 4JL8A 1BH2A 2HV8A 2QTFA 4P4SA 3AP3A 1T5LA 4PHFA 4ZDKA 4M1KA 3LBIA 2BC9A 5CYPA 2O0JA 4Q1FA 1YZKA 3LAWA 4BFZA 1XD2B 4RD3A 2ZI7A 5FR1A 3O8DA 1GRNA 4KV9A 1NN3A 3RWOA 1QRAA 3B9QA 4U5XA 1R8SA 1D2NA 2ORVA 3LWNA 3DOEA 4EKDA 4M9ZA 3NXSA 3BOSA 4Q4JB 1NSTA 1QHNA 5FOVA 5EE9A 2G1JA 1G3IA 1UPTA 3K70D 3U5ZB 2YKGA 1NI3A 1KHTA 5FTNA 1YZLA 2IX3A 1AQUA 1LNZA 1UKVY 2ODNA 4JBYA 1GOTA 3B5JA 2WKQA 4I1UA 2F9LA 1TQ4A 3CIOA 4YXWD 2O8DA 1R8QA 3B2EA 2DFTA 1SXJC 4DCTA 5BYKA 5GVSA 2H7VA 3FGNA 1SVIA 4M1SA 5EXXA 2REBA 2ATXA 4RD6A 5FFMA 2DCUA 4DT1B 2UKDA 1OB2A 2ZS9A 1C9KA 1Z22A 4GBMA 1Z28A 2IHYA 2RGXA 1Z0JA 5ELXA 2UZIR 5CB8A 3O8RA 4AI6A 4AG6A 1VCMA 4R71A 2J7PA 3OIWA 3W5IA 2GRJA 1FZQA 4B74A 1D8TA 3I32A 2IEYA 4PC3A 1VPLA 4X8OA 3EASA 2RGAA 2ZI3A 4I1SA 4EQ6B 1EXMA 4L8GA 3B1VA 4I81A 4Q48A 3CR8A 4OK3A 3NBYC 3B78A 4KI0A 3DKPA 1OH5A 1KI7A 4UJ5A 3NH9A 5JEEA 4P33A 1KO8A 4MUBA 4CDGA 5E4FA 1XTKA 4DSOA 3J81k 2ORWA 2RCNA 5DHFA 3REFA 4UNPA 5CM9C 1Q0UA 2RMKA 3LBNA 5EQTA 3HR7A 1ZIOA 2ZJZA 1RYFA 4TZ6A 1SXJE 4HAVA 1S4QA 4OKSA 2W0SA 3DO6A 4ESHA 3AV0B 5EP1A 1OIVA 1IM2A 3BH7A 4LBWA 3RSLA 1SZPA 4HYYA 4B43A 2ECKA 1N5IA 5CIWA 3I62A 1R0WA 2HF8A 1ANKA 2F9MA 4OHWA 4WA7A 2ZRFA 1V5WA 2HCJB 1FNMA 1RRGA 3NBFA 4LRWA 3EZ6A 4MA4A 4C7OA 2CLDX 1Z0FA 3CPJB 2AXPA 4RKEA 1DELA 5TY0A 1CF4A 4OYHA 3IO3A 4E5UA 2WWFA 1RJ9A 3L0OA 4BPBA 1JJ7A 4ZI3A 3P32A 1J8YF 1JPNA 4PC1A 4DLTA 4QG7A 2ZXUA 4F91B 1IONA 3TBKA 1G5RA 5C18A 2IHBA 1P6XA 1T0HB 2IWRA 4B33A 2ZSBA 2ZUBA 1JR6A 2NO0A 2XNDD 3QXHA 4JS0A 4A0RA 5KDDA 2QN6A 3CO5A 4ZIRB 4CEHA 4DSNA 1EX6A 3WHKA 2ZRDA 2O8BA 3OIUA 4ASUD 3F8TA 2AR7A 1CR4A 4KO8A 1P2VA 1CJVC 2GHIA 2ZR9A 3LX5A 5DSZA 1XFAA 5KUTA 1VYUA 3PQCA 2IA5A 1QZXA 2Z4RA 2ZJYA 3Q85A 2X8AA 2C8VA 2WSSA 1ZC3A 2CBZA 2VP0A 2XTNA 2QE7A 3P1JA 4RKFA 5GJCA 1X8JA 4BLRA 3EX7C 2REXB 3KJEA 5KDOA 2HF9A 3C5HA 1FW6A 5FPKA 3VU9B 1EK0A 4CYMA 5KHOC 5L3VA 1E0AA 721PA 3PITA 4DB2A 3QEOA 4GP7A 4RCYA 3CW2A 1G7RA 3RRMA 1M8PA 1XTRA 3DMDA 4LHVA 2AK2A 4IOKA 2JASA 4JL5A 2UZ3A 5UKDA 4NONA 1VCOA 3LQRA 5KSPA 5FBVB 2IUUA 3H2YA 4Q4AB 2ATVA 5KTYA 3NC1C 2O5VA 3ADCA 2DYKA 3SE0A 1Z6XA 1CR0A 3UPUA 4D0NA 1CLUA 1NIPA 1EFRA 2IYQA 2OCAA 5JCZA 1JEEA 5FOWA 1S3GA 2XOKA 2Q3MA 1NVWQ 3MWYW 4ZIRA 4Q01A 1E9RA 1T4GA 3A1UA 4G5RA 3FDIA 3EXAA 2O8EB 2VRWA 3QE0A 2GZAA 1KO7A 5DIFA 1E0SA 4Q66C 1EG7A 2CK3A 4JMPA 2OLJA 3BIFA 4JBXA 1G5PA 4Q9LA 3K0SA 1TUEA 3KJIA 4NKRA 2ONJA 1BS1A 2OFXA 1DAEA 3DM5A 4LJ5A 5AUQA 1ZP6A 2PCJA 3S1AA 1LVGA 3A4NA 4HDOB 3JZMA 5AJVB 1KJYA 4IVQA 4Q5IA 5HZHA 1JI0A 1G18A 2J7KA 2Q3HA 5FOTA 1II8B 5FPSA 3GJ3A 1VIAA 2R6GA 3TQFA 3I5XA 3UWOA 5DN6D 1WP9A 4IFEA 3UG6A 1ZM2A 3ZH9B 2ZVPX 2ZITA 2B7CA 3IUYA 4IEEA 5JBQA 3HU2A 1TAGA 2CHQA 1N6IA 2ZRMA 4XOIA 5FL7D 2C78A 3BFKA 1DAKA 1UBCA 2BV3A 1O3YA 2W2TA 3RHFA 2AHOA 2CL0X 1EFHA 1ZM4A 1EWQA 1W46A 5L3SB 2HEIA 2IS4A 3X1DA 1OHHA 4NP6A 4HDCA 4Q02A 1OKKA 3IO5A 1MRSA 1KMHB 4MRNA 4OI2A 4MITA 3I73A 2GAAA 4IXMA 3SQXA 4M53A 2GCNA 4JLDA 1Q1BA 1XXHB 4Q9IA 4MKGA 3Q7PA 2PZEA 4FCTA 1JAIA 4MRRA 3GLFA 2OHFA 1W2GA 1SXJA 3CRVA 2KB0A 2VP5A 2GEUA 3PENA 3WBJA 3VNUA 3AVOA 3KKQA 2WOJA 2ZI5A 5CJPA 1UBGA 3TLXA 3VFDA 2GXSA 4LYAA 3DM9B 2C77A 2HJGA 5CLQA 2PBRA 1SVWA 2J0VA 2F43A 3N2IA 1R5OA 5FL3A 4PHHA 3OEED 3QUSA 2JJ1D 1ZU4A 1QHIA 2ZUCA 4C0AC 5JI2E 2C03A 2YYZA 3BORA 3W6PA 2FGKA 3THOA 2FA9A 2FMXA 3QKUA 3SHFA 2OM2A 3TVTA 1BMFD 1HEIA 4JL6A 2JATA 3W3AA 2P5TB 3K0FB 2NZ8A 2CEAA 4CEIA 4HSEA 2V54A 3EIQA 4YC7A 3WBKA 3FMFA 4LJ8A 2QRZA 2GETA 2QMEA 4WIAA 2YINC 5H68A 1TU3A 4LY6A 1DO0A 3B6EA 5KPJA 1NJGA 2HYDA 2JCSA 3QPUA 4H1VA 5DO9A 1AM4D 3GJ7A 5F9HA 4C2UA 5L3QA 2AWNA 3R7WA 3OEHA 1ZC4A 1ZBDA 2W6IA 4XSGA 3SEAA 3I5YA 3FMPB 4HZUB 2R6FA 3QOFA 4AY2A 4JVSB 1OV4A 3OIVA 4EPWA 4FCWA 4LBVA 1WA5A 5CJ2A 3THYB 2YV5A 1P62B 4LI0A 1E79A 4ZKEA 2CLSA 3IHWA 3U7FB 2FFQA 4MKIA 1G16A 1ELOA 2WM9B 1P72A 1TEXA 1E9DA 4NCHA 1PLKA 2A78A 2QRNA 4R2IA 5JS7A 5JSZA 3TQCA 2JLWA 4KITB 1Z5ZA 3CZQA 4FMCB 2MSDB 4II7A 4LHYA 4BLOA 4P4TA 4JKYA 4URZR 1KI6B 5CDFA 2JLQA 2RHMA 3OAAA 4DLRA 4KLZA 4XJXA 4MDEA 1RZ3A 2CHGA 2GZHA 4FXPA 4AD8A 2OV2A 1US8A 5FUXA 1G8HA 1I4TD 2GCOA 2VF8A 2PEZA 3RABA 3M4YA 1J70A 4D4MA 1P9WA 4K81B 121PA 5SZKB 1U81A 5F2EA 3DPUA 4GOXA 2OFOA 1OIXA 5EE1A 4QFMA 4WW0A 3GPLA 4LC1A 3CBQA 2EWVA 1E32A 3HPQA 1NL3A 4LBYA 4TLCA 2R6AA 2P0EA 4URVR 2ZE7A 4AYWA 3CH4B 4GZLA 1PVOA 4D4JA 3NTUA 1GKIA 3RS3A 4EDHA 1XU4A 2R6DA 3QIAA 4MGYR 3AF3A 3QPVA 3PR1A 4U7DA 1NMXA 4M9SA 3CX7A 3AF0A 1XTIA 4WAUA 3ZZ0A 2EQBA 4PC6A 3CUEF 1KSHA 2VHCA 4TSFA 2ANCA 4NYJQ 1NN1A 3PEUA 2YNMA 2BM0A 4W7SA 2I3BA 3IQWA 4LJYA 4R7ZA 4MKHA 1QG4A 5KO2A 2YWFA 3WYAA 2ZE8A 1KMQA 3M0EA 4QNMA 2DY1A 1W4BA 3GQBA 1SXJB 2YWEA 4P3YA 1MV5A 4LGMA 3LD9A 1CS4C 4QM7A 2CCKA 4WOPA 1ZU5A 4OHVA 5EUQB 1E4YA 1XBTA 2JEOA 2X2EA 1UJ2A 3D8BA 1GL7A 2X19A 1G6OA 221PA 5L3QB 1G3UA 1XNJA 1N5KA 1F48A 1FX0B 1SGWA 1VYTA 4P31A 4KBFA 3ZD7A 2DR3A 3IBGA 4IEIA 4LYHA 3B82A 1UM8A 1SVLA 2OG2A 5HTKA 2JLVA 2QBYA 3RS2A 3GLGE 2P6NA 2QZ4A 2QUZA 4CEIB 1ZM3A 1FTSA 3DKVA 3SBDA 4TMWA 5DH9A 5G3YA 2FSFA 2FSIA 3SU8A 2RGNC 3A6PC 5TB5A 3EC2A 4U00A 3QJYA 2A5GA 2QNRA 1E2LA 1MABA 5C4MA 1RVDA 4A8JC 1G3RA 1MOZA 4EPYA 2HLDA 1E9BA 3BGWA 1W2HA 4C0QC 3THXB 1YRAA 2IXGA 2JDIA 2VSOA 3CX6A 4QHYA 1E2MA 1XJQA 1SKYE 3ZJYA 1ODFA 3A1TA 3I72A 1D5CA 4HAZA 1E9FA 5DGXA 4DUGD 4EJSA 3P4XA 4LOAA 1P60A 1PLLA 1Q3TA 1U0JA 1Z07A 3ZS9A 1GTVA 3K9LA 2OAQ1 3KJGA 4ABYA 8OHMA 4M9QA 4AIIA 1BIFA 2OBNA 2VH5R 4PHGA 3X1ZA 1KI2A 2VHUA 1YR6A 1NF3A 4HLUC 4MYUA 1GNQA 4D26A 1R2QA 3HR8A 4QGFA 3FKQA 5FPYA 1W49A 4G01B 1RKBA 3I61A 1U9IA 4DIDA 2C99A 4DLYA 2KWIA 1KSFX 3TIFA 1NVUQ 4V0KA 1W7AA 2ZJ8A 4PPGA 3WHLA 4KAXA 4M2LA 3ETLA 3WNBA 1IN5A 2JLUA 1N0UA 4GRAA 3AUYA 3AVQA 3MRSA 3EG5A 4M1YA 4B35A 1FQKA 4DCVA 1SVMA 4E03A 3AF4A 2QP4A 1NJFA 1DAGA 3LXRA 1W47A 5DNYB 2I4IA 4XD7A 1EGAA 2ZJOA 1XCPA 1ZINA 2RH5A 4RFVA 5AR1A 4JLOA 1VHTA 4LJ7A 4B3DA 1LB1B 3KKPA 1ZVQA 2DB3A 2BKUA 2Q3FA 2FV8A 2ZRNA 5C4GB 4YMVA 3SOPA 1DTSA 2QG6A 4C3ZA 2WWWA 2YHSA 4HI0E 1N6PA 4LUCA 3EA5A 4P32A 3WMFA 2GA8A 4A2QA 1CJMA 3AH8A 4OI1A 3GLFE 1CBUA 3DZ8A 4M8NE 4HB3A 4DRZA 3SYLA 3HPRA 5J40A 3OFND 4CVNA 4IVPA 4B71A 1M7GA 1NRJB 5JJLA 2O8DB 1R0YA 4B2PA 5CYOA 4HB2A 2B8WA 1UEJA 2RKOA 1E9SA 4F4IA 1A5TA 3BE4A 5SZHB 5F3WB 4NU0A 5A5GA 5FH9A 2GK6A 2CCJA 3I3SR 1NLZA 2CNWA 1TF7A 3QXSA 4QGHA 2J5XA 3IEUA 4HATA 1M7HA 5FTJA 1BOFA 1Q12A 4DCNA 5A0FA 4CT4B 3K53A 1S1CA 5FPTA 1E9EA 3QVVA 1OKKD 4Q03A 4B6EA 4NYIR 2GBLC 1HQCA 4Q47A 2F3RA 3I92A 1Z0IA 4L4UA 1T3SA 3C16C 3ONWA 2F43B 3H84A 3T34A 1W36C 1WBBA 1HH4A 3B13B 2GWHA 4IVRA 1LF5A 3FE2A 2ZS7A 4ZI2A 4GOKA 1G20E 1L8QA 3MCAA 4EIWA 2RGGA 2Q0HA 1DARA 1DS6A 1S2MA 5TARA 4TT3D 1KZGB 5FTLA 4JBWA 4YDSA 1K5GA 3IPXA 4HUQA 3H0KA 4JLJA 3V9PA 1FTNA 1UKZA 4DZZA 3GLHE 3GLIB 2ZI6A 2ZRBA 4BLTA 2RB4A 1M7BA 4D6PA 2WJJA 4DWJA 2H1LA 2WMNB 3U6BA 3ZLJA 5JCPA 3QXJA 1FQJA 4B2IA 2RGEA 4JYCA 1TQDA 1QVRA 4IXNA 3IILA 1AZTA 4IKEA 4B44A 3VQTA 4Z8YA 3K0EA 2BEJA 1N6KA 4V02A 1NVVR 1JEDA 4B3CA 2BEKA 3GJ6A 1RFLA 3TUJC 4XVRA 4JVMA 4M1MA 4F92B 3IKJA 4QGGA 4CW7A 2Z43A 2OCYC 5JFGA 2VA8A 1AIPA 2C04A 3C14C 5GADl 4GOJA 4R98A 4A0GA 3GJXC 1UF9A 4JLAA 5JWHA 3PCRB 3NHAA 2FFHA 3OEHD 3U4QA 1TADA 2GJ9A 1KDRA 3CWQA 5AUOB 4MUAA 3PUYA 3VKHA 3LW7A 1YU9A 1AKYA 4GT1A 4DLWA 3ZVRA 1Z3IX 2QU8A 3MWKA 4GI7A 3NG1A 3VU9A 1UBFA 1E2KA 1JNYA 4QBIA 1XCGB 4D80A 4F4JA 4NYIQ 2IYXA 2D4HA 2H5EA 1IXSB 5J4YA 3Q7QA 1XWIA 4AC9A 1BKDR 2AKAB 4AWXA 1E79D 2KE5A 2NPIA 4D4LA 3AM1A 3RDPA 3SHWA 2J1LA 4GPTA 2ZRHA 3G0HA 1I2DA 2G6BA 1DG3A 3QXXA 1FNNA 4NHOA 2FPLA 3U44B 3QBVA 4LDJA 1ONBA 3NIBA 1YVDA 2QP3A 1K8RA 1T5IA 2IYRA 3OAAD 1PUIA 4RD0A 1TQ2A 4Z1MD 3W8RA 1WMSA 1PUJA 3R9IA 2G3YA 4IW3B 1NMZA 5FR2A 2DHRA 4AK9A 1K5DA 2FSGA 1HURA 1U94A 2CHVA 3KKNA 5E7JA 5FOXA 5J4HA 2QORA 1JQLB 1YZQA 1DPFA 2YWGA 3QBTA 1CRQA 4X8LA 1KY2A 2ZRJA 5CDFE 3BB1A 4UXHA 2AFIE 4DSTA 4BZQA 5DYGA 3RRZA 1E2HA 4MGKR 1OB5A 1KK0A 2ZPTX 3VR4A 3U60B 2F6RA 4NMMA 1FUKA 1DOAA 4A1FA 2W58A 4CZ2A 2DPXA 1H65A 4EJSB 2QAJA 1CRPA 4XVQA 2XNDA 3IIJA 4Q7KA 1CR1A 4NYMQ 1XEFA 3KL4A 3PIRA 3A4MA 2OLKA 1AN0A 3VNVA 3I1FA 5E3HA 5JZVA 3QNUA 1JBKA 2DWOA 2WSSD 2XB4A 3ZVMA 4NTZA 2XXAB 3SZRA 3BERA 3THWB 5EXTA 1F2TB 3NH6A 2N1BA 3VR2A 3GEEA 2XZLA 2QMUA 3ZYCA 1E2EA 1F60A 5KNCA 3NKVA 4UNRA 3CNNA 2VIIA 1VIYA 4KYUA 4AKGA 1UDXA 1ZUHA 1TTTA 4KHZA 3K1JA 2WJGA 1MO3A 2FE4A 3UMFA 4F7WA 5HCIA 3KQLA 1H8HD 2A5FA 3M1IA 3OESA 4Q4AA 1ZRHA 4JKIA 5JHHB 4ESVA 2W00A 2PT7A 1G7CA 4DSUA 5HKKA 4LBZA 3GJ5A 2ZJ5A 1E1QA 3A1VA 3V4FA 2ZI9A 3FKSA 1C4OA 1N6OA 1P73A 1W36D 1GILA 4OHXA 5EE5B 4JSTA 2BOVA 1IXRC 4FMDB 4DIEA 1G8GA 2BBTA 2PJZA 4KXFB 3W5JA 3VKGA 3M6AA 1F3OA 2FJUA 4OJQA 1QG2A 2ERYA 5FBRB 5KU1A 1TL7C 2O8EA 3BJIC 4QBGB 1XX6A 2A30A 1W4CA 2QT0A 3AGPA 3MWJA 3WMGA 2BVNA 1GKUB 1N3BA 3ADDA 1YE8A 3A1WA 3H86A 3GLHB 3ND9A 3WP1B 3GLIE 1SKYB 4FWIB 3IBYA 5K8TA 1ZCAA 1U8ZA 3KX2A 4PC7A 3Q3JB 5IRCD 3KQHA 3ICQB 2GJKA 1ZIPA 1E96A 1FFHA 1QHHB 1TMKA 2FGJA 1PZNA 2YC4C 4HAWA 3CH5A 1RE0A 1NG1A 1IN4A 2E87A 3I8SA 2H92A 3AVVA 2IUTA 4ASUA 3W8NA 2K5UA 1XCMA 4JLNA 2G88A 3UIEA 2EFDB 2QMOA 4JLBA 2AXNA 3LNCA 2WWYA 1DO2A 3GJ8A 4ZCMA 4MDFA 3HDTA 4P0TA 1KZ7B 4FN5A 4RVCA 4M0LA 1FL9A 1SULA 3TW4A 1JALA 4I1VA 3K09C 5DISB 1KKMA 5JS8A 1MH1A 2WKRA 4IOLA 1W1WA 1AJEA 2AFHE 2XXAA 3ZIAD 4MQBA 3AGQA 1GSIA 4BEJA 4IDHA 3NDBB 2J0UA 4OK5A 5EXPA 1G5TA 4TL7A 2MSCB 3H1TA 1AS0A 2PEYA 3I8XA 5LD2B 1SVSA 3PEVA 5CM8B 4PO9A 3HYTA 3QXCA 2WZQA 3TKLA 4DDUA 2OFWA 3QEJA 2C98A 1XMVA 4ZCIA 3CRW1 2QSZA 5CLLA 1UADA 4W5JA 1W44A 2CJWA 2Q9AA 5FTKA 1RRPA 4IOJA 1IY1A 1KNXA 3B85A 3LFUA 4M1OA 4AYXA 5JJKA 4O2RA 2JJ1A 5C46F 2G77B 1Q1QA 2NO9A 4HEJA 3AUXA 2QGZA 2VBCA 4PPFA 2XOKD 2BCGY 2R65A 3EWSA 4UNNA 4JLMA 2OBLA 1SHZA 3CF2A 2EFEB 3IIMA 2ZREA 4YLGA 2R2AA 1CJTC 2WAYA 2H18A 2O8CA 1ZNZA 1LF0A 2JDID 4O2LA 4HB4A 1EFTA 1Z2AA 3TR5A 4D81A 5KSOA 1XEXA 3IGFA 4X8HA 2GESA 4IOMA 2IYLD 4A36A 1CJUC 3RS0A 3LRPA 4A82A 1W0JA 1KOFA 3EIEA 4NCJA 4LZZA 2IYZA 2CNWD 3W9YA 4PZYA 3OE7D 1OXUA 3CLVA 1DAIA 1ZW6A 4TMKA 2AL7A 2CL6X 2WJIA 3EC1A 1Z2CA 3C4JA 1OJLA 2D3WA 2YOHA 2ZSDA 1G3MA 4GP6A 3CRRA 5FBLB 4EFLA 3FB4A 4L16A 1LFDB 3WXMA 3RAPR 2IW3A 2PLFA 3D6TB 4KVGA 4PFSA 4B32A 3RNLA 2WV9A 3UKDA 5DI3A 3X1YA 2DWPA 4Q4JA 3T5DA 2BIFA 2ZTSA 1G4UR 4QHTA 1OHHD 2VP9A 521PA 3ZZUA 3U3OA 3NC0C 2IT1A 2XJ4A 4TT3A 2JJ8A 4BEBA 5JJIA 1GG2A 4P4SB 1OF1A 4I4LA 4BFTA 1RIFA 1E2DA 2I1VB 2ZR0A 2R6CA 4PQRA 3A1SA 2EW1A 3QPWA 4XD7D 5H8WA 2FZ4A 1NLYA 4TWZA 2JAQA 1OXTA 3TGPA 2V6IA 1E98A 1KAOA 4Q4HA 2HDNB 3DHWC 1FMJA 1GNRA 3L0SA 4I99A 1HY3A 3FVQA 5FOUA 3NWJA 4IJMA 4KLNA 3QG5A 4KSCA 3EARA 4WZ6A 2V9PA 4EAQA 1KO4A 4LK2A 4PTLA 3BBPA 1XPUA 5KDLA 2C96A 4LHWA 1CIPA 2OAP1 3AKEA 3O8CA 1UDWA 4OQLA 3NDPA 3A36A 2I1QA 2OXRA 1OW3B 2OXCA 1G8PA 2J0UB 1E0JA 2V55B 4NH0A 2VQSA 4TSFD 4A2WA 3K70B 2WWXA 4RZXA 1P4SA 1QDEA 2ZIAA 1KY3A 1COWD 3O8BA 2OE2A 1ESMA 3RSOA 2BBWA 2F1JA 3LLMA 3EZ9A 1XTQA 3PEWA 1B23P 3THXA 1OH6A 4MH0R 2Z5FA 3ZQ6A 2QL6A 4D4KA 3EW9A 2BMEA 3CONA 3LVRE 2NZJA 1E2QA 3TAUA 4EUNA 5C2JB 4CF7A 5FUYA 2P3SA 3U6KA 3AVTA 1TX4B 1XXHA 2RGDA 4H9GA 3SYNA 1W5SA 2D74A 4C2TA 3AP2A 4PXAA 2ZSEA 1OYWA 3C5CA 3RANA 2VLIA 3GEHA 2GJAA 4A15A 4WVFA 4AG5A 3AP1A 3LW8A 4Z1MA 2VEDA 1DAFA 3LA6A 1N5LA 2LCFA 4YMSA 4Q18A 2W2XA 2VO1A 4QXAA 2ODEA 1I2MA 1BYIA 1M34E 4PSAA 3IEVA 1IOZA 2J0QA 2XSZA 3QKSA 3KUDA 4Q7MB 4G1UC 1W4RA 2IXFA 1XEXB 3VKWA 2CDNA 3RLFA 5JEDA 2OESA 4XSHA 3QENA 1U2RA 1Z6YA 3KKOA 5EZ6B 4D25A 4A0FA 2R8RA 1XZQA 2B7BA 4BASA 2IK8A 2WIAA 2ZI4A 1J8MF 4TQUS 5D3MB 5LB4A 3B1WA 4DLVA 2HLDD 2WHXA 2XX3A 2WWIA 2R9VA 2EVWX 2XJ9A 1G64A 4E09A 1VG9B 3MJRA 3U3RA 3WMEA 3FWYA 1OH8A 4JZKA 4PR0A 1B0UA 3Q8XB 4V0MA 4DJTA 4LV6A 1JXOA 4TL9A 4ZV4A 4S35A 1UAAA 2GEDA 4HZUA 2QENA 4KJZA 4YMTA 2YVUA 3GLIA 3K0CA 4URUR 1GZSA 4GFDA 1UEIA 2PLRA 5DI9A 1RRCA 5DYIA 2QSYA 3EWAA 2ZQ5A 5SZIA 2GK7A 3EPLA 3W34A 3I4LA 1ZJ6A 4FCVA 1YR8A 5SZJA 3TNFA 1N6LA 1SKQA 3KDSE 4O3MA 1T8TA 4LC0A 4NYJR 3VTKA 3T1TA 1G7TA 2EU8A 1JPJA 2ZU0C 5EP2A 1XB2A 3L43A 1NBMA 5JWRA 1T3LA 3BK7A 4YMUA 1VHLA 4GL2A 2B21A 2TMKA 3K9NA 4G5SA 3K0CC 3ZVLA 2AK3A 5HKKD 5JRZA 1R6BX 1E1QD 3BFXA 2YOFA 1W0KD 3P26A 4QGAA 4RSGA 3W3ZB 4R2HA 4BQSA 2IYYA 4JYBA 4QJ3A 1L4UA 3QF4B 4DKXA 2IS1A 1IJEA 2QAGB 621PA 1GRRA 2W83A 2WSMA 2VL7A 4QNRA 1PLJA 3O47A 2J87A 5AJWA 5J4LA 1P2TA 3U44A 3QKRB 4K46A 3RVBA 3C8UA 2PT5A 3GLHA 1IN7A 1DG1G 2F1IA 1UKYA 4KYIB 4B3BA 4DEXA 2GCPA 3VMFA 4NDZA 2G0TA 4OI0A 4TMVA 5K8IA 1ZNXA 4QL3A 3PXGA 2ZEJA 1NMYA 3CNLA 1OFUX 3B1YA 4NE2A 1R0XA 2DFLA 1Z0AA 2QBYB 4MRPA 2IL1A 2B92A 3KQKA 2FSHA 1HE1C 3OFNA 1D9XA 2KJQA 2WBLC 5C1BA 4TL6A 1A4RA 1E94E 1E2NA 4OK6A 1W36B 5G3ZA 1NVVQ 2QTVB 1IY2A 4MKFA 2HXYA 1A82A 4XWAA 4N1AA 1NP6A 2JIZD 4NCKA 2CLCX 4TYPA 2AWOA 3T35A 4DUGA 3TSOA 2FX3A 2WPDA 4A8JA 1U98A 1JJVA 4BLPA 4XWOA 4NBSA 1Z6TA 3DMNA 1JR3A 1KDPA 3PUWA 4WXRA 2PCLA 2XTZA 1E0KA 1G17A 1HUQA 2GXQA 4FIDA 1GL6A 3TH5A 4QM6A 5FTMA 1KAGA 3ZIAA 3A58B 2IBMA 2ZRKA 3T06B 2H57A 1GKYA 4TYYA 2F1RA 2O8FA 1W4AA 1R4AA 1P2UA 2Q21A 1R5NA 2IUSA 1HQYE 4BFYA 4Q9HA 2H17A 1H8EA 3GMTA 4V0ME 4EQ6A 4HLUA 4TYNA 1GL9B 3QQ5A 1D2MA 4TMXA 4C0JA 1G8FA 3QSYA 5FUWA 2WIBA 1BYUA 2GVZC 2OSBA 1WCV1 4DEYA 1VTKA 4NCIA 2P6UA 2FF7A 1FX0A 2YOGA 1E99A 2XTMA 4B73A 2PX3A 4BFWA 5KYKA 1G19A 4LV5B 1J90A 2AN9A 5L3SA 2IC5A 1VCNA 4YDHB 4HZIA 4DLUA 3LLUA 1TF5A 1QHYA 4FINA 1Z29A 4BECA 3N5CA 1OIWA 5KNDA 1II9A 2QI9C 4NL4H 3EIHA 2WICA 1SVOA 4F93B 1VG1A 1KI1A 3OHMA 3ZD6A 2FZLA 2LKCA 1L2TA 2REOA 3BB3A 5IK2D 2BHRA 3T15A 3MLEA 1W0JD 1G6HA 2ZAMA 2C5LA 2V4ZA 4RFSB 1G8YA 3OIYA 3AEZA 1HT1E 3QY0A 5FI0B 1NVXQ 1NG9A 2RGNA 1YZNA 2N46A 3U2QA 4DLXA 5FPHA 1QHHA 5HZKA 2O52A 4RZ2A 5KSZA 5ANRB 5M04A 1X1RA 1ESNA 4TN1A 3LQQA 1FOEB 2FPMA 5KNBA 2BM1A 1LY1A 3P27A 1E6CA 5FBWB 3E1SA 4M21A 2WWHA 2WVJA 2QM7A 1Z83A 1KKLA 2NO7A 2NPFA 1WB9A 4CEHB 1TUIA 3DOFA 4RJLA 1CR2A 3NBZC 2Z6VA 4DHEA 5HE9A 3X2SA 2V1UA 5EP3A 4E07A 4YQFA 4DB4A 1YRBA 1Z0KA 2W6JD 1RYHA 3QG1A 2V1XA 4LV8B 1J2JA 2G1KA 2PJRA 1KDOA 3H4MA 1KGDA 2EFCB 4IDPA 3AKDA 3UXMA 1NIJA 3WNCA 2ZRAA 2V3CC 4US2R 1M1YE 1OPXA 3U7GA 2V7QD 4ZDIA 4MYHA 3U3KA 5P21A 3U3MA 3FMIA 1XZPA 1YZGA 1D9ZA 3RC8A 1VG0B 2IF2A 3C41J 4A6XA 4JJKA 4TLAA 3SFVA 3TMKA 1NY6A 2R62A 4MYTA 2GBLA 4N0EA 4C0LA 1Z08A 2FEMA 5EJEA 3HU1A 4UKDA 3SQWA 4PPQA 5FBQB 4HUQB 4LJ9A 1U99A 5AUNB 1HE8B 1YR9A 3CB4A 3HU3A 4URWR 3T12A 2CVHA 2OZEA 1C1YA 2FN4A 2KSQA 3D31A 4D0GA 4GZMA 3KXLA 3AVXA 3BRWD 3CF0A 4XH9B 1KI4A 2ZRPA 1Q44A 1XMJA 4CRWB 1KO5A 2F1HA 5TVKA 1KJZA 2XZPA 1KI3A 4M4SA 4AKEA 1U0HC 4O0MA 2OT3B 1YJ5A 3B1XA 4FW9A 4CEJA 2ZYUX 4OHYA 3KXKA 3E2IA 4JLKA 1T8UA 2BWJA 2FWRA 4BRUA 3QKSB 4AKHA 3LY5A 4TMZA 1F5NA 3U4QB 2WAXA 4GMXA 3DZDA 1H8HA 3KB1A 4JVLA 1GFIA 3KFXA 2XITA 4FD2A 2CE7A 3V00A 4AYTA 4DDWA 3MSXA 2A7QA 3EPHA 1XJ0A 3AVUA 4QOSA 4CT5A 3Q72A 1CULC 5KPDA 4Q1AA 3QF4A 4MGZR 2RAPA 4NCNA 3HJNA 1Q3HA 1T6NA 5JHGB 3NEYA 4Q1CA 2OCBA 1MT0A 3SJBA 1KI9A 1M74A 3NBXX 4TMTA 2RGCA 4UNQA 4ZDJA 2JLXA 3UANA 4QHSA 5DE3A 3RRYA 3TRFA 2QT1A 3GD7A 4TZ0A 1VECA 2IYSA 1OFTA 1ZD8A 3CF6R 2UVQA 3CPHA 3AKYA 4WBSA 2JLYA 1OSNA 1MO6A 3LDAA 4BUJA 5EZ5A 1A7JA 3C15C 4AKIA 1VYVA 4WXPA 3BS4A 3LH5A 3PV0A 2MMGA 4HUTA 3FYHA 1MO5A 3TSZA 2QTHA 4TLDA 4YXWA 3T1VA 1U8AA 4JLPA 4OJKA 4X8MA 2J41A 2EWWA 3A4LA 1ZNYA 3BH6A 2C9OA 3GFTA 1EFCA 1XD9A 2GJ8A 3SJZA 1E1RA 3EZ7A 1VMAA 2JJ2D 4RZ3A 1U90A 4LHZA 4KVAA 3DEFA 1GM5A 2IWHA 2BMJA 1FP7A 2ZYWX 3JVUA 3EPJA 3TUZC 4LJAA 1J7KA 4KCGA 4DXAA 2J7PD 1XEWY 2FOLA 1AGPA 5E7IA 2O8CB 4XTRA 4Z8XA 5B2ZA 2LWIA 2AX4A 1EFUA 4Q7JB 2EFHB 5IHPA 1COWA 1Y63A 1U0LA 3KTAA 1HV8A 3RYTC 5J4KA 4PAMA 3BH0A 1ZM9A 2ERXA 4FMBB 2P67A 4J0QA 5CIQA 2HYIC 3AB3A 2JA1A 4OQMA 1IQPA 2BDTA 4M9XA 2HCBA 4C4PA 1GVNB 1W5TA 3B9PA 3RS7A 4BRWA 3SJCA 4RY2A 4BFVA 1XPRA 1TEVA 2IYUA 2QP9X 2V6JA 3G5UA 2A9KA 4ON9A 4A92A 2X77A 5JRJA 1N25A 1WRBA 2FDCA 2O0HA 4EFNA 3PG5A 3BXZA 3T1QA 1US8B 1JXMA 1DE0A 4JSYA 4C7OB 2X2FA 4JVNA 5B58C 1F2TA 4C9BA 4TQ9A 3BWDD 3SR0A 1RPZA 4B76A 2OUKA 1IN6A 1Z6GA 2NG1A 2P65A 3CRQA 1E2IA 3FKSD 3GJ4A 2WWGA 5GJWC 2HUPA 3WNDA 1E2JA 1UKEA 1X3SA 1Q22A 4WZBE 2H16A 4TLEA 4CEJB 2MMCA 2C2HA 4M1WA 1XMSA 4MRSA 3SN6A 821PA 5JI3E 2QPOA 2D62A 3N2EA 1KI8A 3P4YA 3AQ4A 1RW4A 5AWFC 3KB2A 2ONKA 3DL0A 2IS6A 1XF9A 1GRQA 4ACAA 3VX3A 2ZSAA 1KO1A 1WBDA 1KK3A 2VHTA 5JMTA 5L8VA 2BKEA 2Q6TA 5L3RA 5K8LA 4EPXA 1Q20A 2JIZA 4Q4HB 1HA3A 3V4RA 2VHJA 2P2LA 3GLGB 5H1YA 1WF3A 1E3MA 1ZUNB 4YMWA 2WPDD 2CCGA 4KBGA 4ZKDA 1OT3A 1YKSA 3R20A 5CITA 5HE8A 2BBSA 2E9SA 4MGIR 1T3HA 3OE7A 1MR3F 2FU5C 3JVVA 1KDTA 2FPKA 2ZU6A 4EFMA 5BN4A 2FH5B 3RS5A 3TJZA 5JLJA 2F7SA 4L5BA 1M6NA 1GITA 1E2PA 1WE2A 5AJZA 5IT5A 2ODBA 5DHAA 2GJSA 2HXSA 4DCUA 4A2PA 1E69A 2JGNA 1CU1A 4RFSA 3E70C 4G5GA 5GJBA 3R7WB 2MSEB 1ZAKA 4OQXA 5BN5A 1N2CE 1T0JB 3UATA 3AF1A 3HWSA 3Q5DA 3UMRA 5JECA 2VP2A 2IYVA 2AKYA 3KTAB 4BFUA 2NMVA 1YZTA 2GXUA 3KZ1E 5BW8A 2Z0MA 2QY9A 3DDCA 3KQNA 2CXXA 3ADKA 4EPVA 2WKPA 3NVAA 1W0KA 1AA9A 3ASZA 3SNHA 4ACBA 5KOYA 4AURA 4KFRA 2XB2A 2ZRLA 2XNSA 3CR7A 2QQEA 1T91A 2GEVA 2FG5A 3L0PA 2GTPA 4GNKA 1J99A 2IYTA 2C9YA 4ARZB 4K8OA 1LW7A 4RD2A 4PQFA 4Y0AA 4N0DA 4B47A 1FMLA 2JLZA 2XGJA 1F2UA 1S9DA 4Q19A 2Q9BA 3R8FA 1MRNA 1GP2A 2NQ2C 3VAAA 1EESA 2WOOA 4Q00A 5A4JA 4TYWA 2HT6A 4C0HA 2OCPA 3MFYA 4Q21A 1I4LD 2WJYA 3CX8A 3F5FA 1KSGA 1Q57A 2A3RA 5E7MA 4NPHA 3K0FA 3SC3A 3L8YA 3R9WA 1K6MA 4WZAE 4OQFA 2PMKA 2CE2X 3FOZA 4LYJA 3TSWA 4LWZA 5GVRA 3ECCA 5E95A 2ZJBA 1KYIA 3KJHA 3GEIA 4KODA 2FEOA 3GFPA 2PZFA 3IHLA 3CM0A 2E1RA 2VF7A 1YHNA 4C0BA 2DBYA 4LCBA 5EUMA 5CB6A 2P6RA 2VSXA 1GDDA 4RZUA 4TYQA 3RS4A 4A8JB 2QE7D 4Z51A 2D7CA 5LPNA 3T1OA 1IN8A 4XVUA 5LB2A 4BFXA 1IY0A 2G0NA 5TV2A 3TE6A 4G5OA 1DVRA 1NKTA 2W6JA 1XPOA 2D2EA 3HP1A 5HR5A 5BQ5A 5G40A 5AJXA 3WRXC 2ODWA 2ZYVX 4IHQA 4TTPA 3X1XA 4DC9A 1P3JA 1X8LA 4DDVA 2W0MA 2XSZD 4HAYA 3REGA 1H8ED 4NZYA 1NLFA 1HYQA 3W90A 4BGDA 1L7VC 2BJWA 1YQTA 3LX8A 4CIDA 2KBEA 3U61B 4IRUB 3KQUA 3W6NA 3U7HB 1AKEA 3TAHA 3DVLA 3VR1A 3D3QA 2BBOA 2VTKA 5B57C 4UJ3A 2HJVA 1BO6A 1HT2E 3R8CA 4PHTA 3THWA 3B1ZA 4V0LA 4Q9KA 4M1TA 4TTRA 4LJ6A 2B8TA 3SDZA 1T9HA 3SJAA 1U9IC 3HYRA 2PL3A 1G21E 2GF9A 3FFAA 1KK2A 4C30A 4IDOA 3PJRA 3NHBA 2Q9CA 3BD9A 3K9GA 4V0OA 4JJZA 1DAMA 1R7RA 2W2VA 2ZANA 4A9AA 3AKCA 2WTUA 1GAJA 4LYFA 1E2GA 2OILA 2CK3D 2ZYTX 3FHOA 3L82B 1I4DD 5JWOA 1SQ5A 1UFQA 3KKMA 4URYR 3FHCB 5EE0A 5AK0A 3UMSA 2OEPA 3KFVA 4TL8A 4UNSA 2BMDA 5FOSA 1X86B 2DFNA 1G7SA 3FPAA 1O87A 2QEQA 4P4UA 4V0NA 2R44A 1G4AE 2ZJ2A 1CJKC 1U8YA 1A1VA 1NBMD 1SVKA 2QAGA 4S2EA 2SHKA 2N42A 4PPNA 3BC1A 4KSBA 4NYMR 4Q1EA 1QHXA 1JR3E 3L0IB 1II8A 3OZXA 3TW8B 1N6NA 1ZYUA 3ASYA 3RRNA 4ARZA 3TR0A 1G291
chains in the Genus database with same CATH superfamily
4Z0PA 3CGWA 2HFJA 4AVYA 4OH7A 3PXBA 3WIDA 4XTCS 3GEDA 5JUWA 2H48A 5HCNA 4HNVA 1ZI8A 4CQMA 2CXSA 1EHIA 1RBMA 4RTMA 3DCYA 5JANA 2WTMA 3IMCA 4S05A 2C82A 1CXZA 2BCEA 3A25A 3NKFA 2ZJ4A 4B34A 1SB8A 2IHUA 1NY5A 3ENNA 2D8AA 3ZGLA 1NXXA 3KALA 3HV0A 5EJEA 4G1BA 1RP1A 2BE9A 2E4ZA 3H1AA 3UKOA 2F55A 1PYOA 5A3SA 2PRSA 1W73A 2QR2A 3MUEA 4H4DA 1LSSA 2C8JA 4ZK2A 4IZOA 3VSCA 2B6NA 3QU5A 1N3YA 2I71A 4X1IA 5JO9A 1FNSA 3HWX1 3SM3A 1XRJA 4W5HA 1MPTA 1O8CA 1A9PA 2OK8A 1T2FA 3GNQA 4HDKA 3KPUA 3BHJA 4MYCA 3B7GA 3PVZA 3FRIA 4RAOA 1A2KC 4Z9BA 1QYCA 1ORHA 2VXOA 2VYQA 3ETJA 4LRXA 4HQ0A 1A9SA 3FVWA 1QYVA 3V7FA 4GDFA 5E1DA 1SC1A 4NCAA 3RIXA 3R3WA 4D1YA 5AQ1A 3AKZA 3UW3A 2RGRA 1CUBA 2DR0A 3LF1A 4RELA 4AY6A 1Z2EA 5BV2P 4FYIA 3W6OA 2OHIA 4GVPA 1GPUA 3DA8A 4Z4CA 1Y3AA 3I83A 3P96A 4Q9JA 3NYIA 3BPSA 4J3NA 4KXXA 2EKQA 4I2VA 5J63A 1JUDA 4EP1A 1RADA 2AC2A 2ETVA 5KJ6A 3N39C 1H2EA 3LUPA 3TTWA 4BLQA 5BNWA 4YH1A 3D4OA 1VCIA 5CT5A 1Q1EA 1V1RA 2EBHX 2C95A 4OXNA 5KOJB 2ZR7A 4IJWA 1RMTA 4E5VA 8GPBA 5CUQA 3HA2A 3HBMA 1KS2A 3IE2A 3ER9A 5EIAA 1RLTA 1ZJ4A 4BO3A 3C4VA 4QTYA 1T6BY 2CJWB 3SBEA 3N70A 4OB6A 4ZTUB 1FFDA 5E2AA 5FLKA 1QH8B 1EFAA 3ZQJA 4JYMA 3RRBA 2EYQA 5J47A 1P33A 3BREA 3T52A 2JH8A 1B14A 4WFIA 1ODIA 4PN7A 3R0ZA 5JFOA 1UBMS 3GAZA 2XYQA 3JD2A 3PRKE 3M33A 2NGRA 1I9GA 1IVNA 5FI5A 4ZVRA 4P86A 4Z54A 5BSEA 5HCUA 2PQ2A 3ZV5A 2AC7A 1NUHA 2P2ZA 3THYA 2HHLA 1KF0A 1YAJA 3VYTB 1NV9A 3ZDQA 4Q4LA 5F98A 2H65A 2WU1A 4GNRA 2X40A 1KMHA 1QMPA 3PFIA 1R10A 4J7AA 4JH0A 4Y1RB 5ALQA 3A1DA 3E9CA 3JQRA 1NATA 1NKSA 2WABA 5G1NA 5CBPB 5KYWB 3FHLA 3FFBA 1J97A 2BEVB 2OCLA 3LC0A 2QM8A 2F4NA 3M3PA 1HMYA 4HCJA 1CZKA 1VBMA 1GN8A 5E2BA 5FB3A 4XIJA 1YR7A 5HRUA 2ILTA 1MVOA 2CNBA 3OWOA 4AJJA 4PC2A 4QZVA 3ETEA 3PE4A 4QRHA 3E7FA 3AF5A 1KU6A 5I3ZA 4B3GA 5EKSA 3TL2A 4ALKA 1JVSA 2AV6A 1NN5A 4HDQB 3ZBPA 1CUUA 3EW7A 4GGPA 3CIFA 3WQHA 1PEDA 3EXG1 1Q84A 1VZ2A 2A2ZA 2A59A 4KXWA 3W7BA 2HZ7A 5A9SB 4PGMA 4ETIA 4PLCA 1MX9A 1CB0A 2G9NA 4R0VA 4DN6A 5KQMA 5B64A 3NOVA 2XOEA 3MGCA 3IKLA 3GL9A 3M1LA 4CHGA 1XLTC 1P9RA 2A94A 3F8SA 1NNEA 3I9JA 4GYYA 5K8CA 2WMOB 3NPMA 1RRFA 4MQFA 4CGZA 2XYVA 4IG4A 4M46A 3O82A 1VSTA 2OV6A 2ZUDA 5CH5A 2ZAOA 1JQKA 3MAAC 3IP9A 1E3EA 2ZT6A 5CK5A 1YUNA 4ZXFA 5LIPA 3O3CA 5AUPB 5B1YA 1A2BA 1R3UA 3H8VA 1CUAA 2DFDA 3N7UA 2C9BA 3OZEA 3O3MB 4J0FA 4RSHA 4MVWA 3Q9LA 4E13A 2MCFA 2UU9B 1FJGB 5JSZB 3PR2B 3ZXUB 2XRMA 1YK0A 1ND5A 1OWNA 2HRRA 2J3QA 2GVDC 2ZUUA 3KQVA 4FWTA 4F38A 3B1FA 4X6LA 5FOQA 4DLLA 1IHUA 3IXLA 3UJ8A 3W2IA 4D8TA 1X1BA 1LI7A 2QMYA 3OIFA 3JCZA 4B87A 3MHTA 1ODLA 1CPYA 2JCXA 5JXWA 4PO3X 1MA0A 3FVRA 4HLCA 2HPAA 2HMVA 4FK8A 1VHDA 2RHWA 3C0KA 4TLBA 5HIJA 3BQNB 1X1CA 3TX6A 1H42A 5KSYA 2QNBA 2PZAA 2P6PA 1MG0A 1XTJA 1AGRA 1SXJD 3R6TA 2ZXFA 5AHWA 4A0HA 2I54A 1PZMA 1OTXA 4PO1A 4DVGA 5CDTA 2NOAA 4O6VA 4HLDA 3F67A 4L8VA 7GPBA 3A14A 5K8UA 4AUEA 4TV9F 4EG6A 1HDOA 2ZBDA 2QGFA 1TGYA 2B6HA 2HSWA 2LIVA 1S8NA 2RHDA 2YBEA 3CZPA 2BFFB 4H7DA 4ZQCB 1DAHA 4QBTA 3GLSA 3AVPA 1L4YA 4YAWA 1Z6PA 1HLFA 1S8FA 1GHTA 3ZCPA 5I7VA 3HXOA 1K6IA 1WHTA 3IQGX 5IH7A 4O4JB 2GDJA 2D7DA 3QI2A 5BVGA 3INRA 1D6JA 1EWVA 2GD6A 5LZ8A 1X7YB 3BF8A 1FUEA 1BTOA 4N8DA 2EZUA 1DC8A 3LG2A 2IS2A 1S6YA 1S1MA 3O84A 4G97A 5SV2A 5BQXA 3U09A 4JR2A 1RZRD 1E5VA 2HSEA 5ITSA 3BB4A 3H9QA 3PNMA 4O4JF 4CM3A 1B16A 1ISHA 2PX0A 3BL8A 3K09A 1ETUA 2B1GA 1BNCA 2A0FA 2G9QA 2WZBA 3I2IA 4FW8A 5DHRA 3BZBA 1YR2A 1P2GA 4U0JA 4FVTA 1ZESA 2FMFA 2VVTA 3S70A 5A02A 2YY5A 1JLLB 2J45A 4ZYXA 3C7AA 3QF7A 1EZZA 2P5YA 4DDTA 1W29A 3B1KA 3W9UA 4PX2A 4EUKA 1B0PA 2Q62A 2O07A 3SEQA 1QFJA 1FZTA 5D3MA 1PVVA 1PJTA 1JAHA 1NRXA 4R1NA 2F9FA 4MS4B 2EGUA 3KKKA 3ZHBA 4YRBA 2CSXA 4B85A 1HTWA 3SYKA 1DADA 2QTCA 5K3CA 1OZHA 2KI5A 3IAM1 3B9RA 3OT1B 3VYVA 1U0BB 1ADFA 4ZYTA 1FYEA 4P08A 5HJEA 5IJZA 4J76A 1X80A 2QPTA 1D2EA 2QX8A 3FDZB 3JWHA 4BXOB 1M0SA 2XTAA 1U1IA 3MUFA 4C4OA 1NQ5A 5LP6F 1NU8A 1GFWA 2QPAA 4AY3A 4BAUA 4FLEA 3TUIC 3AHHA 2E18A 2RGUA 1DBSA 1QFMA 1L7DA 5MN4A 4P53A 4G4IA 3LBYA 2FWAA 3F3YA 1YONA 4C0KA 1BEUB 4JEMA 4E08A 1G5QA 4K9SA 3TVDA 2WE7A 3DBVO 1AS2A 4ZQIA 5L95A 1K1EA 3L1UA 5LNK1 3TQRA 4X3OA 3TK1A 3TIXB 4PQYA 5JVDB 1WUJS 1Y9AA 2H5JA 3Q4GA 2RD2A 1WQ1R 4QEKA 3QJ5A 1ZQ1A 2J08A 3VR5A 4LPKA 1N8TA 5IYZB 1SUCA 3BBLA 2VHWA 3NR2A 1PV4A 3IP5A 5F9MA 4QQFA 3DAPA 1YBAA 4PXYA 4B9AA 1RXSA 4HNTA 3K7EA 1H9BA 2X6TA 2WF6A 3IPYA 2OUIA 4OHRA 3ZBUA 5FPYA 5IAGA 5LP6C 3A3PA 4WKCA 4HAUA 3OKPA 1CFJA 1Z7BA 3MWEA 3QKRA 4O2BA 5B2EA 3I2YX 3KSMA 4W9MC 1E64A 4JCOA 1TCCA 4TTQA 1R6DA 2YJTD 3H2BA 2P91A 3L8ZA 4IGFA 4PAGA 5DSTA 3IIKA 4ZGBA 1CC1S 4BX9A 1J4AA 3I04A 3K4QA 4WCVA 4ZI5A 4CTNA 1JKMA 2R1VB 2GCEA 4GPBA 3PHGA 1ZH2A 4WX2B 5EE3A 1BN6A 1N5JA 1BN7A 3RW9A 2DERA 2O3QA 3OU7A 2BCJQ 2IU4A 5REQB 5CDYA 1AXEA 2JCGA 4HWTA 3O4VA 5CM2Z 2QAGC 2NYRA 1UIRA 4HFNA 2J3DA 4OOEA 5DI3B 1FPMA 5L4SA 3JQBA 3L6DA 2WUFA 2V59A 2OHXA 3WMXA 4D0LB 4YGXB 4UUOA 5JCJD 1OH7A 3CPEA 2J09A 4X1KB 4U02A 3DEAA 1ZISA 2FFBA 3JZAA 3NBQA 5CXUA 5IANA 5T8KA 3HVHA 4EYEA 3T5CA 2VNKA 4UTRA 2WSLA 1BX1A 1Z4OA 2Y8EA 1PG2A 4J0HA 2A9FA 3JQAD 2HO4A 2GTHA 3JQFA 3UK2A 2HA4A 3LMKA 4M1KA 3DXXA 2RK6A 5CYPA 3SLRA 2O0JA 4JK3A 3IS3A 1Q83A 5C8YF 3F47A 3WL8A 3RASA 2CD9A 1BEZA 1TKCA 3X1MA 4DMFA 1GLGA 1QNLA 1UPFA 2P2CA 1H2ZA 2EDCA 3B51X 3IBTA 3RWOA 4C43A 3EQ8A 4TWBA 3COPA 3JX9A 2QTMA 3Q7IA 4NVRA 2FWJA 4U5XA 5JNTA 3C5WP 3PNQA 1D2NA 2XT6A 3LPDA 5J5VA 3OZRA 4IH1A 1VRVA 4ZRDA 2C9ZA 3PQEA 3OTGA 4PCUA 4UVEA 4EKDA 5H3LA 3GFBA 4JB3A 4M9ZA 3RHZA 1AQJA 4Q4JB 1O4VA 3TW6A 1QTNA 1JDNA 5K4GA 2BDUA 5FOVA 3KL2A 3VH1A 5B1SA 3K9FC 3K30A 3W8FA 1G3IA 3C3WA 2VWGA 2PZMA 2RH8A 1OU4A 3IB6A 3WLLA 1DEHA 5SYMA 4KLCA 1NI3A 1BD3A 1OAOA 1VA5A 3NHMA 3TM5A 1KHTA 3WJAA 5FTNA 5B1IA 2IX3A 2NZYA 1JHDA 1Q0QA 3IESA 4GBED 1KQOA 1ZPDA 3KUUA 3HJAA 4HGYA 1ZI9A 1KEKA 4C7KA 3KU4A 3OLVA 2G70A 5AT1A 3INYA 2EDAA 2F9LA 3VPAA 4YV0A 4FFNA 1R8QA 4WLUA 4HX9A 3RUAA 2DFTA 1SBNE 2AE1A 3OH8A 2HJSA 1SVIA 4R1SA 1TA0A 4D98A 1AGYA 3RQIA 1WAMA 1NHGA 5KYYA 2MIIA 2O14A 1OB2A 3NP7A 2ZS9A 5B7NA 1RWVA 2PG3A 4Z9XA 1E2BA 2IHYA 5D85A 1Z0JA 5K0NA 5TF0A 4F4UA 2UZIR 5ELXA 4AI6A 4L8WB 1TJ3A 1XHEA 4CDRA 1FZQA 3CFYA 2GEKA 4B74A 1PT9A 3WSVA 1D4FA 2YNMD 2ZI3A 4EQ6B 5F52A 3KSBC 1MOQA 2WHPB 1JF8A 2ZYAA 3QJGA 4KTVE 3NBYC 1AUPA 3GD5A 4M8KA 3DKPA 4OK3A 4BV9A 1I2AA 1KYWA 4UJ5A 3NH9A 4DR5B 4GQBA 4P33A 2O2ZA 4CDGA 4Y7CA 3ANNA 1OA1A 2PGJA 3J81k 2F17A 2OD2A 3WLTA 2HW8A 2RCNA 4FHGA 5DHFA 3REFA 5CM9C 1P5FA 2RMKA 5I9MA 2XGOA 3WLAA 3SNKA 2OZLB 1PL8A 1XL0A 1SY7A 4TZ6A 4N3CA 3D6AA 3ESXA 1AXRA 2W0SA 1CUHA 5FWDA 2XMRA 3I9MA 3KZMA 2VCHA 4HQRA 5EP1A 3NT4A 2VG8A 5JW6A 1IM2A 2ZWOA 3D2LA 4HYYA 3KVVA 4PNPA 2B3TA 5CIWA 5TPZD 1Y42X 3ADOA 3GLKA 5HFAA 3I62A 1ANKA 1VE1A 1VYHA 1L4FA 2HCJB 1FNMA 2QVYX 4N6NA 4C7OA 2GARA 4DLKA 5LKAA 4P6VF 1Y3DE 1EVEA 3HBFA 3RG2A 4ZI7F 3CPJB 1TK2A 3FPJA 3PIDA 5AKHA 1YC2A 4LWQA 5IVKA 4N3BA 2IPMA 1EFDN 3E2PA 3PDIA 1V7QA 4RA9A 3RJTA 4E5UA 1RJ9A 2VHVA 2NO5A 3L0OA 4FHCA 4UTXA 5EZQA 1JJ7A 3UJBA 4D81A 1J8YF 2GAJA 5JSFA 3FFTA 1L9KA 4BBJA 2Q29A 3JQ8B 4GP9A 5DK4A 4OXXA 3M6WA 4GR4A 1ISFA 4K8RB 3TBKA 3WL7A 3PQ4A 3GGSA 4UDOA 2M32A 5C18A 3W5SA 1J8FA 3FGZA 4CKCB 1T0HB 2Y0BA 4B33A 1PFQA 1SK9A 3KOZA 3QXHA 2XNDD 2YUIA 4JS0A 4KR7A 4ZIRB 1Z75A 4CUKA 1A9XA 4DSNA 3MYYA 2R97A 2CF5A 5ALRA 4ASUD 2XIJA 4RTPA 4AQYB 4KO8A 1VBKA 4L6IA 4MUYA 4DF3A 5KUTA 2BEWB 4ABTA 3D2BA 3PQCA 2IA5A 4XFDA 5KINB 2C8VA 2WSSA 4M83A 1TU0A 3PF8A 1DEAA 2W70A 1QIFA 2VP0A 4UCXA 2Z8ZA 2AJTA 5KNDH 1RPJA 3ZWPA 1P1RA 4BLRA 3STXA 4KMOA 5KTMA 3EX7C 3ESZA 5TEVA 4C78A 1WTAA 2HF9A 3GA5A 3KLPX 1HK7A 1UFKA 2A9JA 2GS9A 3C5HA 2XPCA 3L49A 4XDGA 5F78A 5FPKA 1FW6A 4CYMA 1QGZA 1W19A 2AG0A 1HKUA 1BE6A 3LBFA 2HMSA 4RDCA 1GUZA 4H1WA 1JFVA 4YO8A 4PG5A 3IJRA 3NS7A 3UA4A 2C54A 3BX1A 1MC4A 2PZLA 4GP7A 4RCYA 1E0DA 5F73A 1VKRA 3C3AA 4ND6A 4LXQA 1M8PA 1XTRA 2VT7A 1NWHA 2JEYA 3CZ4A 2JASA 4IOKA 4JL5A 5F3DA 1XVLA 3X3HA 4PONA 3ZQUA 4YDQA 4R01A 1VSVA 2F8TA 3U13A 4GWGA 2IUUA 4RDHA 3OOYA 3N0WA 2ZYRA 1OYVA 1H2WA 5KOHA 4EHLA 1JVBA 2MT9A 2QW8A 4RQBA 2DYKA 4JP8A 3V8BA 4BGEA 2FXVA 4UUNA 4GE0A 1CZUA 1AHIA 1CLUA 2WUGA 3AHGA 1F8UA 4JB0A 5JCZA 1QNFA 4AF7A 4XGIA 1HTBA 2FUCA 2R85A 2XOKA 3UT0A 1NVWQ 2HI0A 3DB1A 4LI3X 4JHLA 4BQIA 3KZOA 4X6UA 3OFVA 4Q01A 4HGOA 3U3XA 3AESB 4GS5A 1Y8ZA 3I6IA 5DX8A 4CKEA 2IPOA 4E3ZA 2WYUA 2C4UA 4NESA 1FK8A 1KO7A 1DQSA 4BKMA 3IALA 1B73A 1A7AA 2CDAA 4IQ4A 1PS8A 3JAWA 4EHHA 2EJWA 4EEKA 4F5YA 4JBXA 4Q9LA 1G5PA 1SUFA 3KAPA 1C8KA 2P2DA 2DPYA 1BS1A 4HPXB 5T4HA 1QC5B 5EEHA 3S1AA 4UBIA 3RC7A 1H85A 2WIJA 4XCXA 4N3GA 5AJVB 2GEFA 1QH1A 4WK2B 4KXLA 1EUYA 1EHYA 1G18A 1II8B 1U28C 3Q7TA 2ISSD 2LV8A 4CQMB 4R41A 3TQFA 1DUVG 4HRXA 1WP9A 3JQFC 3ZH9B 3EQ2A 2ZITA 3TQIA 3ZU3A 2Z58A 3ZDDA 1E3SA 1MG5A 1TAGA 2QV0A 1N6IA 3AHCA 1IZ9A 3ABSB 3HU2A 5EIBD 5HKAA 5JJBA 1DAKA 1FU7A 1UBCA 1Y48E 2BV3A 2LE0A 2DU8A 1O3YA 2PYDA 2W2TA 3F5MA 2OGSA 1PV2A 4KMMA 4XKJA 3RHFA 2V4UA 4Z49A 1EFHA 1WKBA 4FC6A 1YKFA 4D9MA 1EWQA 2VYNA 5L3SB 3QHPA 4MUFA 2KS6A 3I30X 1BDBA 3ZHQA 1AT1A 1NU6A 1OHHA 1Q92A 1UAGA 3NBKA 4L27A 4Y2YA 5DRTA 1U7ZA 2QN1A 4BRZA 4TKLA 3Q5GA 5THQA 3KYCA 3I73A 1GFZA 3JWPA 4DLZA 4IXMA 1S3FA 2DX7A 2J3LA 2X4LA 3L40A 4XLLA 1QZTA 4JLDA 1Q1BA 1XXHB 4J91A 2EQAA 3Q7PA 1K92A 3BTSA 4G84A 2XZTA 1WXWA 4EZBA 5AW0A 2XKKA 1TVEA 1W2GA 2J48A 3CRVA 3IKVA 2KB0A 3ICPA 4U7JA 2HEGA 1DJNA 4FJ2A 4IZIA 4EHAA 3M5CA 5DBFA 4EKNB 1ZN2A 5K20A 3LGSA 2FWIA 4YIHA 1XI2A 2MYNA 2WOJA 1QP8A 1UBGA 3N3AC 5DLDA 4LYAA 3ZXXA 1ML3A 3PFWO 2I2DA 1VIMA 3IUMA 4ZQGA 2VJMB 2R2GA 3GDHA 3UJAA 4DM4A 2J0VA 3ES9A 4O1MA 5TGZA 1R5OA 2CVQA 2X1MA 4HS9A 4IIYA 4EOGA 2VNJA 1ZU4A 2QV7A 1PS9A 2C5AA 5TQ0A 4RMJA 1HBJA 3EFOB 3EEBA 5AMXA 4YAFA 3F73A 2YYZA 2FGKA 5KU7A 2FA9A 2FMXA 5JT1A 3SHFA 4X61A 3TVTA 1HEIA 1X74A 1FDIA 1NP7A 1I51A 4TM7A 5REQA 1JHVA 1KZ1A 3EFEA 7REQA 2IZOA 2WILA 1RD4A 4LJ8A 2QRZA 4W8HA 2PKEA 3MINB 2PY6A 2QMEA 1JA1A 4GWLA 4WIAA 5ES4B 4I4TA 5EIBC 4DCMA 4MV1A 4Y8VA 2ZOSA 2QX6A 3FX2A 3QLTA 3B6EA 4QREA 4DIFA 2DQYA 3E15A 1NJGA 1AKUA 5DO9A 3DMGA 3GJ7A 5TS3A 5L3QA 3WB1A 5EKXA 4UPEA 4DNQA 4OXRA 1YXMA 5AKJA 4IO0A 2VZ9A 4XSGA 3KHSA 1Z4LA 5E8RA 3SEAA 3MTAA 4CODB 1VFNA 2EP8A 4IX9A 2BTEA 3GPCA 2VQ3A 3OIVA 2AZTA 3HCBA 4B7CA 4FCWA 3G0IA 4RGQA 1P62B 4HXEB 4F4DA 3VJRA 1TVKB 2HDHA 3QWFA 5CVUA 1OR8A 1X9HA 4YN3A 2INGX 3GRYA 1E79A 3KPYA 4JUFA 4ZKEA 1YFZA 3IHWA 4QULA 4MKIA 1G16A 3VZBA 1RPAA 2AQIA 1E9DA 4KK3A 5DB4A 2A78A 2E37A 3ORSA 3FOWA 4R2IA 3P0FA 2W11A 3I3OA 4OHUA 4DIUA 1QLJA 3CZQA 3HGMA 4JKYA 2VNIA 2Q1SA 4JI1B 5CDFA 3R1IA 3OAAA 4DLRA 1PWZA 3TRJA 2JS7A 3UXHA 1RZ3A 2GZHA 3O2QB 4AD8A 4E2XA 2QPLA 2VF8A 4JHXA 1ONOA 2OYRA 2ALJA 3GH3A 2AVDA 1IBMB 1YI8A 1MAHA 2R6JA 1Q15A 3HCPA 2A57A 2VEOA 3ODGA 3GPLA 1E77A 2WFLB 1OY1A 4W9NA 3CBQA 1O6CA 3HLYA 3RYCB 5KYUB 1MTZA 1NL3A 4H35A 2BGNA 4EGJA 3SBOA 1Z25A 2WF9A 2BFEA 1AQLA 1RI1A 2FY8A 2H9AA 2JFWA 4HYEA 4XJVA 1QG0A 4MJLA 4Y2PA 5DNEA 2LD4A 2N1MA 1IQUA 3WGGA 3E8MA 4XAQA 3U4DA 4A16A 1WABA 1GKIA 1DWOA 2L2QA 2R6DA 2FPSA 4HNRA 1PWEA 5GIOE 3QPVA 1KPGA 5THXA 3FOEC 3QA9A 3FTPA 3QM1A 4I9UA 4P4GA 1XDZA 4Q7EA 2BL4A 3P2KA 3U80A 5I9LA 4EUHA 3SWWA 3I09A 1SC9A 4WAUA 1OFUA 3ABOB 3UBTA 4GLLA 4TSFA 2ANCA 4WACA 5HQ3B 2X14A 1M2OA 4D9JA 4EA8A 4YPVA 3FPEA 3HVUA 2O06A 1C14A 3D1VA 2FKNA 1ECFA 1BJKA 2FPUA 2R0QC 1QG4A 4GMGA 4L78A 5KO2A 1JSXA 4D56A 2XNKA 1RWQA 1YDHA 3F8WA 3DMPA 5JNWA 4DLNA 2AJ8A 3O6VA 3ZPXA 5HKBA 3R3VA 4HL6A 4DG8A 5K2OA 3TKAA 1OJ7A 3I5MA 2XMDA 5FQOA 3D7KA 1UPCA 4E2YA 1SNYA 1W6RA 3ROQA 5AKZA 3GT0A 3UYKA 1I7SB 1A96A 1EP1B 5EFOA 2CCKA 2DZDA 1ZU5A 2WDPA 5IUJC 3CZCA 3Q1LA 4OHVA 5IW8A 5AW2A 1ID1A 1IBLB 3BMOA 2QN9A 1XO1A 1W35A 5C53B 1S3IA 2ESRA 2GPBA 3THRA 2O48X 1DMRA 2PWZA 1JKXA 1W30A 5M34A 2PX2A 1AKMA 2X19A 5ICSA 3KKZA 1K08A 2XKAA 5L3QB 5MDHA 3II6X 1F48A 3MGGA 5DM2A 2FWNA 2NP7A 4KBFA 1M2FA 4FYKA 5ALOA 1P39A 1T8WA 4IEIA 3R09A 4D9GA 3HNRA 4EBFA 4TVSA 4IIUA 4GPAA 2PFKA 2VI5A 2GMWA 1Q0RA 2O3UA 1CNMA 1JQEA 1SVLA 5HDQA 5HTKA 4BLVA 2C9DA 5JQWA 4IFIA 2XMZA 4GI3A 2VF4X 1WX1A 2J31A 4KGDA 2QUZA 5E0KB 3GMSA 1FTSA 1XA0A 3DKVA 4MUHA 4TMWA 4ZCSA 5DH9A 2CUTA 2FSFA 3RYHB 2W93A 4TKUA 2RGNC 1HYEA 1PTJC 2P2NA 3AEQB 1WUKS 1ILWA 1MT3A 3EC2A 3KSZO 5TB5A 3IVRA 4U00A 2IYFA 4ND3A 1J8QA 2FWMX 1UK6A 2IXDA 2J3JA 3U4MA 1K3TA 3EK2A 4Y6SA 4LF9B 3WQBA 2J3MA 3ANLA 1XRPA 2OGWA 3K6JA 3NRCA 1T3GA 3BGWA 1E9BA 3FR7A 1RQPA 1Z37A 3P2EA 1XJQA 4QQ8A 4X24A 3V6MA 3K4HA 1FQOA 2AMVA 2JJMA 3I72A 2P4QA 4HAZA 1E9FA 1KQNA 3T3PB 4Q6BA 4DUGD 5FUVA 3MTBA 1Y3BE 3M70A 5K3BA 1Q3TA 1VGRA 1XAIA 4G0WA 4YFVA 1Q2XA 1U0JA 5DBIA 2UYGA 3G2JA 1R5JA 4YUXA 2RCYA 5ICGA 3K9LA 2OAQ1 4NICA 2JHPA 4M7OA 2GDZA 1EXNA 3THSA 3CJTA 4GKVA 1QVVA 1BIFA 1LI5A 3OZAA 1H2YA 3RSFA 4MYSA 1G8MA 3EVCA 3QSGA 3PSAA 4Y9SA 1DKPA 2X7HA 2OBNA 1GGEA 3RFFA 3E7WA 2AMLA 2P4EA 3KJXA 6LDHA 10MHA 4HLUC 1GNQA 5F7OA 2FPIA 2IYOA 4WFKA 1L5MA 2V7TA 5JIBA 1O97C 1CUSA 4QGFA 1U9ZA 3FKQA 2ZFUA 3MB8A 1JX6A 2FFRA 1AKQA 2EJCA 2Q1TA 4YCNA 3I61A 4PN3A 3TIFA 1XCJA 2A58A 4RESA 5CFNA 4M2LA 1U80A 1V8BA 5ILOA 1JWBB 3B2QA 4MR9A 3AVQA 4MKZA 4RCVA 3OMLA 4RO0A 3RUDA 1LTKA 4RH3A 3EG5A 3OIGA 3DJFA 4FZJA 3SQOA 3ZNQA 4IVNA 4ZOQI 3QYAA 4HDSB 3WWZA 1XHFA 5CNJA 4E03A 4UBOA 2NU9B 4OREX 3AL0C 3Q7SA 2AZXA 1ZINA 4ALMA 5TPWB 1KFJB 3KJZA 3E9NA 1RWXA 3G9QA 2CXHA 1GUFA 3OPNA 2IOHA 3LVFO 3OWHA 3JYHA 5IBQA 4AAYA 1AO0A 1F7VA 4WXYB 2Y93A 1FSGA 3L3BA 3RC2A 3ZLUA 4CKXA 4PWYA 4GICA 2FV8A 1LLDA 2ZRNA 5C4GB 3SPXA 2ZBQA 1QS0A 4MV6A 1Z7GA 4C3ZA 2VQDA 3ZE0B 1GCUA 4Y9RA 2JGJA 3UH0A 3WMFA 2ZJ0A 3TL3A 2W43A 1SXPA 3QX3A 2C92A 1YTLA 2HQ1A 3OQPA 1Q1AA 2ORED 1XT6A 3PA8A 4RVFA 3V1YA 2PKQP 1NW8A 3MPOA 3LUAA 1QO0A 3WAGA 2JNWA 5KTSA 5JJLA 3QEMB 1R0YA 1VE9A 3CKKA 1YZVA 2P2YA 4LOHA 4XPZA 2PMFA 5CYOA 5I3CA 3SVLA 3TGLA 2C1ZA 3LQ2A 3OCZA 3FG9A 4JD5A 4JWTA 4B4DA 1HX7A 3PWTA 2B8WA 4R0MA 3O0TA 1C8BA 2RKOA 1E9SA 2PGAA 3AR2A 2H4HA 4UHEA 2GK6A 1ODKA 2ZTVA 3EMKA 4UMDA 2O7SA 2Y99A 7REQB 2GWRA 2R25B 3WWEA 3DBHB 4IJVA 4QO8A 3AIOA 5FTJA 2XE7A 1BOFA 3U4HA 4DCNA 2PMWB 6REQA 4KP7A 4NEGA 3DT8A 3JPYA 3I05A 3Q3IA 5BSHA 2DRIA 3QVVA 5PNTA 2MYUA 4OGGA 4NYIR 1G59A 5CTJA 3DEHA 3Q6NA 2CVZA 4RMIA 1D4ZA 1MAAA 2F43B 1WBBA 3D5TA 1BA3A 4JOBA 2GWHA 4QUDA 3S2UA 4IGAA 2RBEA 2Z95A 3FE2A 1RJFA 2ZS7A 3MB5A 4II2A 1O96A 1TDJA 1IXKA 3VVLA 2C1XA 2ODTX 5I7EA 1NKVA 3Q7RA 4CKYA 1CY7A 2Q0HA 3CEAA 1CUDA 1DARA 1QGUB 1NVAA 4IXWA 1O77A 5TARA 4QQKA 2HCRA 3NAQA 1LLUA 2X58A 5FTLA 1HRKA 4YALA 3D6HA 3H0KA 4HUQA 4JLJA 4WLOA 3V9PA 3WA7A 5BO5A 3RAEC 3GLIB 2ZRBA 3EG9B 5BVHB 5JYEA 3AY3A 4D6PA 4BMOB 1ZX1A 4DWJA 4NV3A 1HMPA 2WMNB 3U6BA 1FUIA 4R5MA 4WKPA 5CYGA 3ZLJA 4X84A 4U7TB 2FEKA 1HZZA 3IILA 2PM8A 1AZTA 3E4DA 4YMGA 4B44A 2QD2A 3W3AD 4QTZA 2WT4A 3KAQA 1NVVR 4B3CA 4KVFA 1P9OA 4XVRA 1U0OC 4DQKA 4N39A 4F86A 4M1MA 4F92B 4QGGA 2XHZA 3D6FA 1IVSA 1OQAA 3UGKA 2CN1A 1AIPA 1B6SA 1L6IA 2C04A 4OVKA 3PKZA 3Q41A 4PYMA 4R98A 4X7PA 1Q1NA 5D3KA 3AHJA 5F3RA 1V7CA 4PRKA 4JLAA 5JWHA 2PV7A 3PCRB 1FYVA 4HQFA 2YZNA 1N8SA 3QMMA 1MZPA 3OEHD 5DXJA 4E46A 3C97A 2HL6A 3L8MA 3VKHA 2AXEA 1JHPA 4DLWA 2ZATA 3IP6A 1LBSA 1T26A 2EERA 1U7UA 5LP6B 3NG1A 3VR5H 3VU9A 1LVHA 1XAHA 3AR5A 5A62A 4D80A 4U1RA 1XCGB 4F4JA 2FCRA 1XROA 1YJ8A 2IYXA 1IMOA 3OBBA 2D4HA 3QVTA 1IXSB 1LPAB 5J4YA 4BBPA 3Q7QA 1WUYA 2YWDA 4N5HX 4MKRA 1E79D 4OP3A 5SICE 1LRKA 2NPIA 5JSUA 3RDPA 2CMFA 3T4UA 1E62A 3A7DA 2VJLA 4GPTA 2UZ1B 3AILA 4MQFB 2QI9F 3FF1A 5LLDA 1J07A 4KQWA 3EGOA 2FG6C 3S8EA 3ANXA 5KOIA 1P0CA 4NHOA 2FPLA 2P78A 4LDJA 4PYOA 5JVDF 4F3TA 4F9TA 1IBKB 1K8RA 1C1HA 5A4FS 4RD0A 3SHQA 1D1PA 5AW1A 4NIMA 1T9GS 4AICA 1LWOA 2G3YA 2MOKA 3KZKA 1TJ5A 5EPEA 2IDKA 3ABIA 3BL6A 3GPDG 4JQOA 2BKVA 3RS8A 3RTCA 4MP3A 4JI6B 5JY1A 2LP4Y 2Z8XA 3ORFA 1K5DA 1MX5A 2DPHA 1HURA 2CHVA 3DE6X 2NT4A 4YO7A 3SC2A 5BR1A 4WK4B 3KR0A 3FNHA 1L5RA 4GXNA 1RHJA 3PSHA 1DPFA 1DX6A 1SC4A 1T9AA 2ZB2A 3QBTA 5CVJA 3LX4A 2ZRJA 4F71A 5CDFE 4DSTA 2AT1A 2PA3A 4BZQA 5DYGA 3UNXA 1EJ0A 3HZHA 3TBHA 1NZDA 3ET5A 2D0DA 1JEJA 5AJUA 1FUKA 4A1FA 5C37A 1GPNA 3KTOA 3F2VA 4PYJA 4R2LA 1H65A 4KQHA 3I37X 5F12A 1C3EA 2DUNA 4BC0A 2XNDA 3FNEA 3LA8A 3U7IA 3ZDZB 4NATA 4B7ZA 1TB4A 2O05A 3C39A 4ZEMA 4BWFB 5KNLA 1MJGM 1XEFA 4PIVA 4MWCA 2BLLA 2OLKA 3KE8A 2DHEA 5ED0A 3ZN2A 2X9NA 2GJ4A 4EEXA 2QRVA 2Q27A 3GJTA 4MS4A 5KEIA 3V8VA 4C0WA 5KWJA 1JBKA 1H2FA 5ER9A 2KQUA 4F0JA 3ABZA 3WHIA 2VYVD 3AUTA 2SKDA 3WFIA 2B5OA 1RCTE 4BB9A 5JZ9A 4JOQA 1XHLA 3UO8B 5CEFA 3AI3A 3VR2A 2Y1OA 2OCKA 2QMUA 3OZTA 4IX1A 1F60A 2PVCA 5G4KA 4I55F 3GCDA 2LIPA 5FV7A 2VT6A 1Q7TA 3VPGA 1PK8A 1TW3A 4S1TA 2VJDA 4IHJB 2O7VA 2YRWA 1TTTA 2F3PA 4OHMA 3RU7A 1G8KA 2DBQA 5AKGA 4QOGA 2I6SA 4M37A 3TOZA 3UMFA 1GPWB 3M1IA 4IJ6A 3ZWMA 3KQLA 2VFAA 1UWKA 4JKOA 1XQVA 2AFIA 3O9MA 4G8DA 3N74A 4JGGA 2W00A 5JHHB 2OY0A 4Q82A 2GN9A 4MULA 2BR3A 3WRWA 1DWPA 1G7CA 3IX7A 4ZOLA 4DSUA 5JH7B 2XQKA 3DB2A 1FLVA 3HLKA 4C29A 3GJ5A 3PQ2A 2PT6A 4F7DA 5CX4A 3HBAA 2IEGA 3A1VA 3V4FA 1EAYA 1N6OA 1P73A 4LVUA 2FEPA 2C3MA 2A0WA 1U1FA 1PQ4A 4OHXA 2BOVA 4FMDB 4DIEA 1G8GA 2PJZA 1ZKDA 2OBFA 4KXFB 3VKGA 2IZ1A 5HJ5A 3M6LA 3ZLVA 1F3OA 2OCGA 5TPZA 3FCEA 1TD1A 3IAS6 4WZBA 4EB0A 1HG1A 1N2HA 1D6MA 2XRYA 2ERYA 2JGDA 3WICA 4IDBA 1TL7C 5BUZA 5C81A 1FQWA 3EMBA 3U3ZA 3LJKA 3UMGA 1W4CA 1WY5A 3H6GA 1JKIA 1T3TA 4NABA 4I7EA 1N3BA 4AX8A 4O2AF 2YN0A 3OLWA 2BR4A 2IP2A 3D6JA 1XUOA 3SZUA 3ND9A 4LJLA 3Q0IA 5K05A 1ZCAA 2WT8A 2BI4A 3OZIA 3Q3JB 3KQHA 4TUYF 2B78A 3KQPA 3RB8A 3Q8KA 3GI1A 4PCAA 1VE5A 2X9QA 3I1IA 4F3RA 2B83A 1P2DA 2VJCA 3PQDA 4HAWA 4ZHQA 2H6EA 3QVJA 5A4IS 1WS6A 2EL9A 3N76A 3O8OA 4CM4B 2O0LA 5L40A 3AVVA 1MFPA 3OE5A 3VJLA 4BO8A 1L7RA 1XEAA 3ELBA 1XC7A 2QMOA 3IURA 4JLBA 1WVIA 1MIOB 1Y9DA 1OPRA 2XH8A 4CI0B 1DO2A 2VUIB 3GJ8A 3JRWA 4ODIA 3FHJA 1W94A 3TZEA 3CW8X 4D6XA 4MDFA 2I8CA 1LC3A 1PK7A 3ORQA 1RPNA 4M0LA 2J9FB 1HSZA 3ECSA 3NWPA 4NFHA 3K09C 1K8ZB 2Q0XA 5JS8A 3EPPA 1LA2A 1MH1A 1U04A 3DKKA 4IOLA 3U1VA 3DZFA 1RBYA 1W1WA 2AFHE 2XXAA 3ZIAD 1DC7A 1U7OA 3C45A 3QUAA 4J03A 2AHRA 3B12A 4BEJA 1DJMA