2PLRA

Crystal structure of dtmp kinase (st1543) from sulfolobus tokodaii strain7
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
212
structure length
212
Chain Sequence
KKGVLIAFEGIDGSGKSSQATLLKDWIELKRDVYLTEWNSSDWIHDIIKEAKKKDLLTPLTFSLIHATDFSDRYERYILPMLKSGFIVISDRYIYTAYARDSVRGVDIDWVKKLYSFAIKPDITFYIRVSPDIALERIKKSKRKIKPQEAGADIFPGLSPEEGFLKYQGLITEVYDKLVKDENFIVIDGTKTPKEIQIQIRKFVGELIDNSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable thymidylate kinase
publication title Crystal structure of dTMP kinase (st1543) from Sulfolobus Tokodaii Strain7
rcsb
source organism Sulfolobus tokodaii
molecule tags Transferase
total genus 86
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2007-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2plrA00
3QBVA 4ESVA 3LQQA 1EGAA 4IOMA 5FBVB 1E9EA 4PHHA 4JLOA 1TPZA 4PSKA 2A5YB 1ZP6A 2XSZD 3IPXA 4GL2A 4HUQA 2BMDA 2G0NA 4DXAA 2HV8A 2DWPA 1F2TB 1VTKA 4Q5IA 1R0YA 1XEXB 2EYQA 2VHQA 4QNMA 3TW4A 1OH5A 1NG9A 4JMPA 5C18A 1E4YA 3CR7A 1TADA 3HU1A 5LD2C 3KL4A 1G8PA 2Q3FA 2G9NA 2CVFA 3DKPA 1ZM2A 2GK7A 1KDTA 5FPYA 1NMYA 4Q1DA 1UDWA 3PEYA 4LOAA 3EAQA 4V0ME 5AR1A 3I8SA 1M7GA 5FR1A 1QRAA 2QGNA 2ZU6A 2J0SA 4JVSB 3MWJA 4JT4A 4CGZA 4RZ2A 3UK6A 1E9RA 1TU4A 2XOKD 1DAKA 4A2QA 4GOJA 1FNNA 1OKKD 2FSGA 4JKIA 4QBIA 3RNLA 3C41J 3QG5A 5HE9A 2YYZA 2YVUA 4TLBA 2ZM5A 5E7IA 1X1RA 4N3NA 1FNMA 2QTHA 2GBLC 2BMJA 4KVAA 1COWD 3WHKA 1Z6GA 1G4UR 4HLCA 4YDHB 5JI3E 2QEQA 3T5DA 3I3SR 1E2PA 4EQ6A 1T3LA 5IK2D 2G0TA 1U8ZA 3K9GA 1FW6A 3H0KA 4Q21A 1AM4D 1DG3A 1PLJA 1Z22A 4DSUA 1E2DA 4M9XA 3CF0A 1EFRD 2GJ8A 2ZJYA 3AQ4A 1XEFA 1AA9A 4LI0A 4NHOA 1E2FA 3BB3A 1T0HB 4ESHA 3QVUA 2PEYA 2ZRHA 4P3YA 2IYQA 3QPWA 4M1TA 4AK9A 4D4JA 2CMKA 3AVPA 3A1UA 4POAA 2IWHA 3R8FA 3FGNA 1OYWA 4XWOA 3LXXA 1XPRA 2ZI7A 5FBQB 3IDQA 4Q1CA 3WRXC 3LA6A 2GCNA 2X2FA 4R71A 1NVUQ 3BK7A 2J0VA 5LB4A 5LB2A 3GJ3A 3LLUA 1XEWY 3QKTA 1YKSA 4P4SB 1VIAA 3QENA 5L3SB 3BORA 2ZITA 4K81B 3OIUA 2QZ4A 2JLQA 5KO2A 3VR2A 1VG1A 2RH5A 2XEXA 2DCUA 4Q4JB 1ZJ6A 1YZQA 4Q7LA 5IT5A 2XOKA 1SZPA 1M7HA 1WDTA 1OKKA 3T06B 2Y8EA 4OL0A 1IM2A 3QF4B 4D25A 2JLYA 4RD3A 3GEIA 1WE2A 4TMXA 4QRHA 2KWIA 2ZRLA 3AH8A 4WAUA 2EU8A 2GF0A 2JJ1A 1COWA 2V1XA 1S96A 4JLNA 3BXZA 1FP7A 3PG5A 1NN3A 2QAJA 2BBOA 4PPGA 4QGFA 1JQLB 4G5GA 1Q1EA 1G8GA 3LVRE 3KQKA 2VF7A 1P73A 3W6PA 1BMFD 4EPYA 1GRQA 1W5TA 5BQ5A 4A0FA 4OI2A 821PA 4EPRA 2QE7D 1MKYA 1LB1B 2VP6A 3NC1C 1A7JA 2PT5A 2OXCA 3O8DA 1FUUA 4Q19A 1P72A 5L8VA 2NGRA 3NH6A 2PT7A 3L8ZA 2O8EB 5JSZB 1XCGB 1NKTA 2BCJQ 1ZC3A 1Q44A 5FPSA 2QU8A 4BRWA 1ESMA 3IQXA 1JR3E 4NYJR 1E0JA 4O25A 4OI0A 3T12A 2GCOA 2ODBA 1JB1A 2IF2A 1XD2B 2VP9A 4BPBA 1ZMXA 4JT2A 1R6BX 3T1QA 4BZQA 3U4QB 2GVZC 2WJVA 2OAQ1 1ZNYA 2NO9A 5CITA 5HZKA 1S3SA 2AKAB 4RZXA 1MABB 4KVGA 2W0SA 1GILA 3CX8A 5BYJA 4EJSB 3A1TA 4AIIA 3E5HA 4ACBA 2RGGA 2HT6A 2V6IA 1P9RA 4JLMA 3KJEA 5KTYA 5ANRB 4WA7A 2QSZA 2N42A 3LFUA 4QC2A 2CLDX 1MRNA 1HE1C 4V0LA 3ZZUA 2GXAA 2WPDD 3K0CC 3THXB 5CDFA 1TAGA 3R7WA 3KKNA 5KNDA 3SU8A 2WM9B 1G8YA 1N5JA 4UXHA 2DY1A 4AYXA 5J4LA 1ZD9A 3K9NA 1G41A 4IOKA 4RKFA 4IDOA 3MMPA 4FMCF 3E1SA 4FI3C 1T3SA 3CWZA 2ZRAA 2ZRFA 3C16C 4OJQA 4LBYA 1AS3A 4W5HA 5EQTA 2BJWA 3T1VA 2BEJA 2QE7A 1GNRA 5SZIA 2GEDA 1OIXA 3QG1A 3R20A 1CRPA 2C9OA 2HEIA 2RMKA 2J7PD 4BASA 3CR8A 5JHHB 4A4DA 5JEDA 3J81k 4KSBA 2JIZD 1E2JA 3CONA 5UKDA 4K46A 3NHBA 1G16A 1M8PA 2K5UA 2ZJAA 3OIVA 4Q47A 2XTZA 4US1R 4E09A 3GLFA 4EFLA 2J0UB 1RJ9B 2BDTA 1KJZA 3SN6A 1KO5A 1HV8A 3TQCA 4W7SA 2AD1A 1TF2A 1AJEA 3FFBA 4LPSA 1UBCA 3BERA 4KFRA 3A4LA 1PUIA 1N2CE 2NTYC 4CEHA 2FMXA 3A37A 3THYB 4E5UA 1YZGA 4R7ZA 3Q85A 3LD9A 2AWOA 5HE8A 3CPEA 3LLMA 3PUVA 1NVXQ 4C2TA 2O8BB 1XXHB 2ANCA 2ZE6A 2IF0A 2WPDA 1KKLA 1L7VC 3CRW1 2D2FA 4RD4A 1KDPA 2H17A 4DDVA 3DMDA 5DI3A 1T3HA 2IYYA 3TIFA 4BGDA 1MO3A 3P20A 5D3MA 4OK5A 4XVRA 4D6PA 5FPKA 2E1RA 3BS4A 2WAXA 4XJXA 5EXXA 4BFWA 3FE2A 5CJ2A 3X1YA 4I1UA 3UATA 2O8CA 3QXXA 5F9HA 2ZSFA 4YONB 3IIJA 1KI8A 1LS1A 3QQ5A 4KBFA 1E9AA 1G7SA 3RAPR 4FCTA 5KOYA 4LYAA 4DLYA 4GFDA 3L82B 2JA1A 1XP8A 2FNAA 4B44A 4PAQA 2PJZA 3THOA 2IA5A 1YVDA 1E6CA 3EG5A 5P21A 2FSFA 4E07A 3JZMA 6Q21A 3T34A 3WP0A 1Z0IA 2FG5A 1BKDR 1J90A 1E2MA 2WWGA 4BLRA 5KPDA 1ELOA 4TL7A 4PZYA 1S3GA 4J0QA 4V0MA 2XB4A 4S35A 1I4LD 2IYXA 1E1QD 2QPOA 2G1KA 3P27A 1K6MA 2GXSA 3CW2A 4TMZA 4RD1A 1SVSA 5GVSA 2YOGA 4W5WA 1GKUB 1W4CA 3H1TA 2ZRGA 1WF3A 1Q1BA 3OEED 3OAAD 3WRYC 1DO0A 1F60A 1M6NA 4Q7MB 2QT1A 3BFVA 5TMPA 1E2GA 1W0JA 2WOJA 3AF0A 2A3RA 5KSPA 2WWFA 2BMFA 3DL0A 3EZ2A 2OEPA 2ZYTX 3KJHA 1KYIA 3L0OA 4RY2A 1HEIA 2UKDA 1W5SA 4W5JA 2IWRA 4TTRA 2RGBA 4AYTA 2Z5FA 2ZAOA 4BFTA 1W47A 2N1BA 1F2UB 2F7SA 3FHTA 3R8CA 1YU9A 4UJ3A 3JVVA 3K0AA 5FL7A 1OB2A 5FPTA 4B6EA 1GKIA 4D82A 3SNHA 2QNRA 3FOZA 3LXRA 3T15A 1XTJA 1EX7A 4FD2A 2ZE8A 1RRGA 5JS8A 1YZTA 3ZVLA 3AF4A 1F6BA 4TQAA 5FI0B 2ZS9A 2BV3A 5SZJA 5KSZA 2J41A 1AS0A 3K0SA 1Z07A 4TN1A 1JR3D 1DELA 2WZQA 3RDPA 2GCPA 1UPTA 4DCUA 5CIQA 1GFIA 4TLCA 3TSWA 4UXJA 4KAXA 2NPFA 1O87A 3D8BA 1E2IA 1HQCA 4JLJA 3SJAA 1E96A 4TYQA 2ZRMA 3THWB 1FL9A 2CL7X 1UKVY 4LYJA 3I8XA 5G41A 4G5SA 1W4RA 1E1QA 2CHVA 4PPFA 2OT3B 3AVTA 1XPOA 1KK2A 2ZI9A 4HAUA 1SVLA 4B43A 1G1MA 2OESA 5DIFA 2A5GA 5FPHA 3ZYCA 3KB1A 3LV8A 3TGPA 1II8B 3GFPA 3O8RA 1W7AA 1TTTA 1W2HA 3UPUA 3D31A 3OEEA 3OAAA 621PA 1CEEA 4P4UA 2VP0A 4QBHA 2YKGA 4MGKR 3X1DA 2OE2A 1ZM9A 1GP2A 4OBEA 3U3OA 5EP3A 1YZUA 3AKCA 3CLVA 4MRPA 3AVOA 3BAFA 3FKQA 2GVDC 3K9HA 2QTVB 4LJ5A 4DT1A 1HQYE 5AUNB 1EWRA 2VP2A 1NIJA 2CCGA 4M21A 5DO9A 3RVBA 3WXMA 2CXXA 1EX6A 2MSEB 4BFUA 2IX3A 4QGGA 2EYUA 4MYUA 3VAAA 2XNSA 3UXMA 4NZYA 1S1MA 1ZM7A 2IXFA 4DVGA 4HB0A 5JRJA 4QM6A 4LY6A 1Z6XA 3GCGA 1RE0A 5HTKA 1XRJA 1M2OB 2ZI3A 4MYTA 3VU9A 5FR2A 4GMDA 1IXSB 3QSYA 3VKHA 2FZ4A 1E9DA 1IN4A 1G5RA 4IVRA 1P2VA 2FF7A 4B2PA 1U98A 1UADA 1MRSA 1P2TA 1KNXA 2WICA 4A92A 2GNOA 4UXIA 4DIEA 2ZJ5A 5EP2A 1UF9A 4NCIA 5J4KA 5GJVC 3GLHE 3L0PA 3GJ5A 2FFHA 4N1AA 2W00A 3VR1A 4Q1FA 1N6LA 1Z0JA 2IC5A 3ZIAD 4JLBA 4OQMA 4HAVA 4UNRA 3G5UA 5KUTA 4FIDA 1KK1A 3LO5A 5LBIA 1M1YE 4DCNA 4B3FX 3CWQA 3AVVA 5J4YA 5J47A 2FFBA 4Q66C 4DCVA 3LW8A 1CJMA 4U00A 1XJCA 2VQSA 1P2SA 3TUJC 4LJYA 3RRZA 2CHQA 3SFZA 1OF1A 4OQNA 3VHLB 1NLYA 4DRZA 3HYTA 3O8BA 1CXZA 2QROA 1KMQA 2D4HA 4DKXA 3EPKA 1XMVA 3QIAA 2PJRA 2ZR7A 3JZAA 5J4HA 3C5HA 2B8WA 1G64A 1IN6A 1O3YA 2FEOA 3DKVA 2GJAA 3WP1B 4PC6A 4FINA 1UFQA 2VIIA 4HLQB 4L4UA 4Q9LA 4Q9KA 1OXTA 3LH5A 2IUUA 4B3BA 3KKOA 1JAIA 2A5DA 3QPVA 3BH6A 1E4VA 1R0XA 4HUTA 5GVRA 3ADBA 2WIBA 2OILA 1Q57A 1NVVR 2IYWA 5EE1A 2XXAB 3TVTA 1TQ4A 3DZ8A 5JEEA 3EPLA 1IXRC 4BLSA 1D2MA 2O0JA 2PCLA 1KO7A 2IXGA 4OQFA 4BZXA 1MO6A 1P4SA 1A2BA 5CIWA 3ZQ6A 1T8TA 1TQDA 5C46F 1R5NA 1RRCA 5JRZA 1ZW6A 2RHMA 2G77B 3AV0B 3ZD6A 3ZIAA 2ASEA 3RWOA 1C9KA 2CL0X 5CYPA 4G01B 2C8VA 2HCBA 2HLDA 3VFDA 2RGDA 1SKYE 5FBLB 2NOAA 1IAQA 4LHWA 3H84A 3PCRB 3BH7A 3UANA 1E9BA 3CZPA 3X1XA 3A58B 1GG2A 1JNYA 3UIEA 2HYIC 1XPUA 5EZ6B 2PZGA 1QBKC 3D3QA 2O8FA 2F43A 3IHWA 3B1WA 3PQCA 3UMFA 2QT0A 4O3MA 1G17A 1IBRA 3AKYA 5AJZA 4C0QC 1J8MF 3QPUA 1CJKC 3ADCA 4KHZA 4NH0A 1A5TA 3HPQA 4QKQA 2Q0HA 1Z6AA 1KHTA 1KO4A 2EQBA 4A8JA 2J7KA 2P65A 2ZQ5A 1YZLA 3EARA 3LNCA 1SXJE 1K5DA 2VEDA 4M1YA 2IYUA 1I2MA 4JYCA 4TMTA 4JSTA 2XTMA 2C9CA 4XTRA 1UKEA 4MKIA 1YJ5A 1GL7A 1G6HA 3E70C 2JLXA 1J7KA 2ZPTX 4EPXA 2ZS7A 4BQSA 4TSFD 3WMFA 3NHAA 4LHXA 3FPAA 1TEXA 4URVR 1M74A 2Z83A 3MRSA 1XDBA 1U0LA 3LVQE 1G19A 3U3RA 3S1AA 3G0HA 1NVWQ 4KU4A 3W6NA 3T1OA 2LKDA 4B34A 1U90A 4TZ0A 1E1RD 3K53A 4K8OA 1CR4A 1Z28A 2PLRA 4IEIA 3SHWA 3CB4A 1US8A 3HP1A 4TL9A 3JVUA 2QUZA 3VQTA 3ZVRA 3KQHA 4BLPA 2OZEA 2QAGB 3AEZA 1IQPA 4EDHA 1AN0A 3R9XA 1KI1A 2A7QA 2OHFA 2Q9BA 2ZYUX 2XX3A 2IYVA 4YDSA 1OH6A 4DC9A 1Y63A 3T61A 1G5TA 1N0WA 3OHMA 4JBWA 2H92A 5D3MB 1L8QA 1Q1ZA 2ZXUA 3RS4A 3ZJYA 1J70A 3W34A 1N6OA 1H8HD 3Q7QA 4M1KA 2BOVA 4O2RA 2Q21A 4ITRC 2NO6A 1UBFA 4ZDIA 1CS4C 2VRWA 4QGHA 2C2HA 3QNUA 3UWKA 2OFWA 3GEEA 2JLUA 1ZUHA 2SHKA 1DG1G 1V5WA 2FJUA 2QP4A 4HZUB 1ZVQA 4LX0A 5JWHA 4ASUD 2QL6A 4DLZA 4NPHA 1W36C 4L15A 4AKIA 3NH9A 4TSFA 2ODEA 3K70B 1KSFX 2HJVA 1ETUA 1Z3IX 1XTRA 2W2VA 1ODFA 4JLKA 3W5JA 2W83A 2L0XA 3ASYA 2C03A 5F3WB 1G8FA 4ERNA 1E1RA 3A1WA 2ZEJA 2A5FA 2RGNA 2AR7A 1SULA 3U60B 2VHUA 2CNWD 4KO8A 5F2EA 5JJIA 4UNNA 2ZREA 4YMTA 4YQFA 1OPXA 4Q18A 2OCBA 3CF6R 3SJBA 1KY2A 1XBTA 1KO8A 3KXIA 4LSGA 4RFSA 5TY0A 4IFEA 4TMWA 4JL6A 4OHZA 1IN8A 2AFHE 3RANA 3W9YA 3X1WA 2WHXA 2ZR0A 1RZ3A 3ZH9B 4JSYA 5C2JB 3VR5A 3P4YA 1RC8A 4P33A 4LJ9A 1R7RA 2CBZA 3MGCA 2JDIA 1KI3A 4QOSA 4TLDA 1Z83A 2XZOA 1H8HA 1VCMA 3SC3A 2F6RA 2FE4A 1SVKA 4C7OA 1Z06A 3BB1A 1IY0A 3I92A 5D3QA 3DVLA 3SI7A 1WQ1R 5CJPA 3NDBB 3A6PC 4HAZA 3I62A 2HXYA 1RW4A 2QI9C 3LRPA 3RS2A 5LD2B 1NNEA 4MKFA 4ASUA 1DAIA 1BO6A 1N5LA 3GLGE 3K1JA 4Z51A 2JLRA 1QHIA 5FUVA 5FTKA 3CO5A 2OBMA 3EIQA 2IS4A 5FBWB 2JJ1D 1XCPA 4D80A 2V3CC 1JAHA 3IHLA 4JBYA 3GFOA 2J87A 4Q1EA 1LVGA 1NIPA 4IVPA 2OFXA 3WBKA 4EIWA 5KNBA 1VYUA 4MH0R 5L3QB 1S8FA 3RS7A 3GLHA 3GPLA 1BYUA 2ANBA 4DEYA 2IT1A 1GVNB 2CNWA 1OJLA 2HCJB 5JZVA 3WMGA 1NN5A 2QP3A 2VO1A 3CNLA 1KK0A 3H86A 4I1SA 1JXOA 2P5TB 1Q3HA 1DAHA 3DM5A 2YWHA 3TAUA 2OXRA 2ZE7A 1AZTA 2WKRA 4TTPA 2YC2C 1T91A 4JL5A 4KJZA 5FOVA 4PC2A 2IXEA 3KXLA 4NU0A 1IJFA 1VIYA 4URXR 1VHTA 2BBSA 3FMFA 4MKGA 5JWRA 4AY2A 2J0QA 3PV0A 1D8TA 3AP1A 2ORWA 1OXUA 3B1ZA 4YLGA 2PMKA 1E2NA 4F38A 3ONWA 4DSOA 4E22A 2BJVA 2WSMA 4NYJQ 2JJ2D 4CT5A 4ZCIA 2PX0A 1F3OA 3BIFA 2IYRA 5TVKA 3BFXA 4AG6A 4OHVA 3WNCA 1SXJD 3A1SA 4RJLA 3BBPA 1KGDA 1TF7A 1IY1A 2BMEA 2D7CA 1OXVA 1JXMA 3UMRA 3B9QA 4ZI2A 2O8DA 5FTNA 2VL7A 3FTQA 4US2R 3BGWA 3CIOA 5JMTA 721PA 1R5BA 3OF5A 4V02A 1JPJA 2RGCA 2V1UA 2E9SA 3PEVA 4DB4A 1IN5A 1P60A 1Q22A 4UNQA 4QJ4A 4GNKA 3B1VA 3B7GA 1Q21A 2GXUA 3CNOA 1LS6A 1S4QA 2EFCB 3CRMA 1QVRA 3Q7PA 2P2LA 1L4UA 1GIAA 3PUYA 1L2TA 4A36A 5DI9A 3U7FB 2CEAA 4Q4HA 1RFLA 2DFLA 4ZIRA 3AVYA 1EWQA 4MA4A 5FUWA 2JLZA 2AK3A 2FGJA 2HT1A 2A30A 2CJWB 1N6NA 4NCNA 1ANKA 4D0NA 4IOJA 3SR0A 4EPVA 2KBFA 3SS8A 3AB3A 3T35A 4AKEA 5BYKA 2NZJA 2QA5A 1AKYA 2BHRA 1XZPA 2KBEA 4H1VA 2RGAA 3W5IA 1OFUX 3TW8B 1A4RA 4QHSA 4BFSA 3RRYA 1RYFA 2YZ2A 2JJ2A 1KI7A 1FZQA 3QKRB 4OI4A 5ELXA 2AFIE 2I3BA 3NXSA 5CLLA 1N6KA 3A4MA 1E98A 2F1IA 5G3ZA 1KSHA 1SXJA 2R6CA 5DN6A 4PPQA 2C98A 4IEEA 2WJIA 5F98A 4GZMA 5JLJA 3RYTC 1IHUA 4CRWB 2FSIA 1I2DA 1ONBA 4NKRA 2UZIR 1G21E 2O0KA 2V7QD 1Z0AA 2WVJA 4AD8A 1KMHB 2IHBA 3Q9LA 3UWOA 1YZKA 4CEIB 4CEJA 1E2LA 1QG2A 2B7CA 2A2ZA 1QHHA 1Z29A 2IHYA 1AK2A 4B73A 2WOOA 3VX4A 4GSYA 3GLIB 1A2KC 3MWLA 3A4NA 4BWYA 3A8TA 1E9CA 1NSTA 3RRMA 5HPYB 4KYIB 5FTJA 3GEHA 1KJWA 4WW0A 2ZS8A 1KKMA 3RS3A 4LWZA 4ZPXA 1ZRHA 4BLTA 2R6AA 4Q9IA 4X8OA 2QBYA 2Q9CA 2CHGA 2OCYC 3Q3JB 2OLKA 2DFKB 1ZUIA 3E2IA 3L8YA 1SVIA 2V55B 1VG8A 3KB2A 3MD0A 3OIWA 4NYIR 4OQLA 1FTNA 4A8JC 3FHCB 1VKJA 4TYPA 4U5XA 4CZ2A 4R2HA 2GEUA 1NY6A 4TQ9A 3AKDA 4PC3A 2ZSDA 4KSCA 5FFMA 1KSGA 2ZRDA 4M22A 4DWJA 3KTAA 1DADA 1G3QA 4HDOB 5AUQA 1D2NA 1VECA 4Q4AA 4D0LB 4OK3A 1E99A 3EWAA 4Y0VA 3L2OB 3PUWA 3ND9A 4KFUA 4B71A 1GUAA 1T9HA 4KFTA 1E2KA 2BKEA 3AF3A 4CYMA 5HR5A 2YJTD 4B3DA 1C1YA 3NTUA 2XGJA 4QBFA 1Z0KA 1E3MA 5KU1A 4LK2A 3NEYA 1W36D 2KI5A 3QXHA 4V0KA 5FUXA 3BJIC 4LCBA 1DO2A 4GI7A 5G3YA 2XJ9A 3C15C 1ZAKA 1L4YA 3U44B 1CJUC 2V7QA 3OFND 2VTKA 2YOHA 2WTUA 2RKOA 4UNPA 1JQJC 1E94E 1LW7A 1N3BA 3TE6A 1BIFA 1BOFA 3TJZA 4GPTA 4QHYA 3BE4A 1NY5A 4DLWA 1LV7A 1E9FA 1FX0B 1NLFA 1QDEA 1W0JD 4ZDKA 1CTQA 2R6FA 2QP9X 3HWSA 3QOFA 4OI1A 1KI6A 2G6BA 3DOFA 2HF8A 3RRNA 5EUMA 4MDFA 1Y3AA 2QY9A 3LBIA 4FW9A 5H8WA 4ZDJA 3WNBA 4L9SA 5DHAA 5KNCA 3EC1A 4XD7A 2DB3A 1HH4A 2RGXA 3RWMB 3I72A 2ERYA 5FL7D 1Q1QA 3TAHA 2WMOB 2O0HA 1J2JA 1DS6A 2P0EA 3ND8A 2H57A 4N0DA 4V03A 4DUGA 1AS2A 4B32A 3U7HB 1GL9B 2A78A 2X8AA 3FHOA 2BWJA 3QKSB 4PHFA 4A2PA 1HT2E 1CKEA 1E0KA 3EC2A 5GADl 3ETLA 2AHOA 4MGZR 2F3RA 2VHJA 1ZNZA 1XNJA 5GJCA 3EPJA 2D7DA 4UQOA 4V0NA 4YXWD 5B58C 2ZYWX 2RB4A 4LYFA 4MYHA 3U7GA 3CPHA 2IYSA 2IYLD 4GZLA 2WMNB 3K0FB 4URZR 2F55A 1FQJA 2AXNA 4PSAA 3N2EA 5HCIA 1ZBDA 3V4RA 2IEZA 1OW3B 1KIMA 2YINC 4WZ6A 2JLWA 1XXHE 3TLXA 3I4LA 4ARZB 1HA3A 2FPMA 1XMJA 1LY1A 5BN3A 3CM0A 4Z8YA 4B35A 3EXAA 4BFVA 4G1UC 1GSIA 3SBDA 1KI2A 2GAAA 1JR6A 4HI0E 1AIPA 2Z4RA 3OFNA 5E7JA 3U3KA 1Z2CA 3A36A 2RGNC 2Q3MA 3GLGA 5DGXA 5JECA 2P6NA 3CPJB 3RABA 3QE0A 3PITA 4M1WA 4ZI3A 1YE8A 1GITA 3EZ7A 2NO1A 2I1QA 3NC0C 2EW1A 2H7VA 4PO9A 5LPNA 3AGQA 1EESA 1GRNA 1H65A 1E2EA 2PLFA 3NBYC 1E0AA 1LF5A 4BLOA 4LJ8A 2W2XA 1R2QA 3U3MA 1Z0FA 3LX5A 2WIAA 3CRQA 4P31A 4PAMA 3M4YA 1AGRA 4NP6A 2ZETA 3PUXA 4WXRA 1N6IA 1DAGA 1F2TA 4DBLC 1EFHA 1XEXA 2Z4SA 2KJQA 3OEHA 4HSEA 3GJ7A 4HUQB 2X2EA 2FPKA 4BLQA 5CM8B 2ZRIA 2C99A 2JATA 1FMJA 1KZ7B 1PUJA 2GXQA 4JJKA 4LBVA 3W8NA 1N0VC 3TR5A 3TSZA 3RHFA 4YXWA 3DMNA 3REGA 3DDCA 2D3WA 2G1JA 4RD2A 2QM7A 1BYIA 1HYQA 3IILA 2ZTSA 3C7KA 4JLVA 4DZZA 1U8YA 4PHGA 1NLZA 2ZI6A 1WA5A 3CX7A 2WWWA 4RSGA 2YNMA 3ECCA 4MUBA 3PJRA 1OV4A 1KTVA 3N2IA 3ZGXA 2DBYA 2EFEB 1U81A 3SQXA 2OAP1 3F8TA 4Q7JB 4DDTA 4HB3A 4MUAA 5K8TA 3O8CA 1PJRA 1Z08A 2YWEA 4X8MA 2RGEA 3BH0A 4PZLA 4L9WA 2ODWA 1D9ZA 2JCSA 2QMEA 5JS7A 1U0JA 4UNSA 2O5VA 1T5LA 1TQ6A 2FH5B 2HYDA 1U2RA 1WCV1 1JPNA 1UKYA 3UG6A 2BC9A 4EQ6B 2VHTA 1KY3A 1QHGA 4DLTA 3AVXA 3NEJA 1LTQA 4AG5A 1HT1E 3RC3A 4G0NA 1AQUA 4M1MA 2OM2A 4DCSA 3HYRA 3B6EA 4FXPA 2AD5A 2X1VA 4PXAA 5H1YA 2MSCB 4Q9JA 3IO5A 3AP2A 2VHCA 2QTFA 4QGAA 1UAAA 4B74A 2AX4A 4MDEA 3SBEA 4H1UA 1MV5A 2GA8A 4MGYR 3I1FA 3QEOA 2QGZA 1ESNA 1NSFA 3BC1A 3TNFA 3KKMA 3EZ9A 3WY9A 2FGKA 2QENA 3DPUA 5KDOA 1KZGB 2DWQA 2NG1A 4KBGA 3O47A 1FMLA 2WBLC 1G9XA 3I32A 4Q4JA 2BVNA 4OHXA 1P5ZB 1V43A 2F1JA 2JEOA 3GJ0A 4RFVA 1MR3F 1N5KA 1NVVQ 2AN9A 1X1SA 5C4GB 3QF4A 4U02A 4IDNA 2HLDD 1G6OA 2PZFA 4JLPA 3SYLA 4GT1A 1KAOA 1VG9B 2QM8A 5HZHA 4F4IA 3KKPA 4DIDA 3TSOA 3UKDA 4MRVA 1S9HA 1HY3A 1P2UA 1R0ZA 2BEKA 3K09A 3Q8XB 4HB2A 4TT3A 4Z54A 4BZPA 2J5XA 2EWWA 3B5JA 3AUYA 3KX2A 5B2ZA 2CL6X 1CIPA 4Q1AA 4F4CA 3OE7A 2LKCA 1D6JA 2E87A 3SEAA 5JJKA 3C5CA 1S1CA 1Z0DA 3QXJA 1AQYA 1H8ED 4GP6A 2AL7A 1UDXA 3RS5A 2V4ZA 2F1RA 3B2EA 2O8EA 1DTSA 1CJTC 5JSZA 1E32A 4BFZA 2KB0A 1KO1A 1P6XA 3PEWA 5FI1B 5AJXA 1T6NA 1WRBA 3FWYA 3EA0A 5H68A 1SKYB 2ZRNA 4OHYA 1WBBA 1W49A 1S2MA 1ZINA 1P9WA 2OBLA 1XD2A 3MUFA 4JLDA 3AM1A 5E4FA 2ZRKA 3P4XA 2H5EA 3NIBA 5EUQB 2GCOB 3U4QA 4TMKA 1DAFA 1SXJC 2PMDA 5FOWA 3QBTA 3SJZA 2CCJA 3CZQA 3ASZA 4XVUA 4R98A 3TR0A 4ABYA 1GAJA 1MABA 3D6TB 3MAAC 4EJSA 2WWHA 2ORIA 3FVQA 1HURA 4B2IA 1X8LA 1CR2A 4DDUA 4M9SA 1YQTA 2H1LA 2BM1A 4NL4H 4RCZA 3K9LA 3DOEA 4HAXA 3VX3A 4MITA 2FFQA 4XWAA 4LRWA 3THXA 2DR3A 2ZRPA 3KDSE 4M53A 1OXXK 2ZRJA 3B85A 3PVSA 4M1SA 2IYTA 1JEEA 4PANA 3GQBA 4ZCLA 4EUNA 3K0EA 2JLVA 3R7WB 1W44A 3AVQA 2GJ9A 4MRSA 4DSTA 3X1ZA 2QRZA 5K8LA 4D26A 2O52A 4NMMA 2WSSD 4V0OA 4BECA 2YV5A 2FX3A 3EIEA 3NBZC 3KFXA 3RLFA 1GRRA 1R10A 3I61A 4WOPA 4CF7A 2QMHA 1H8EA 2FV8A 3G82C 1U99A 4S2EA 1YZNA 2REXB 4X8LA 3GJ4A 3SHFA 1N25A 2XJ4A 3TMKA 4FMDB 1TNDA 3HR7A 1KDOA 2ECKA 4R9UC 2OV2A 4M2LA 3ZS9A 1NRJB 2ZJ2A 5G53C 2YC4C 1GTVA 5J40A 4DLVA 3EPHA 2I4IA 2JASA 1TU3A 4NE2A 1RRFA 4F92B 2J0UA 1FPMA 1RJ9A 1G5PA 5BWMA 2VLIA 4YMWA 1YR7A 3P32A 4IKEA 3GLFB 2NQ2C 1ZYUA 4L5BA 2Z0MA 2HXSA 4PC7A 3GJXC 3THYA 3CKLA 1G3IA 1NJFA 1G4AE 1Q3TA 4JIMA 3SDZA 4CEHB 3TVDA 3UMSA 2J59A 3PENA 2ONKA 1VG0B 2C5LA 1XXHA 2V54A 1OB5A 3MJHA 2H8KA 2OFOA 4C3ZA 4XWKA 2GDJA 2YHSA 1D9XA 2NIPA 1EFUA 5BN4A 3V00A 3W3ZB 3M1IA 1NBME 2C95A 1DOAA 1KAGA 1OT3A 4NBSA 2IS1A 2QMUA 2WSSA 4IHQA 2GRJA 5DI3B 3ZVNA 4O0MA 1QVAA 2VP4A 2BBTA 2JGNA 1YRBA 4Q01A 2ZI5A 4JKYA 2ZU0C 2CLSA 3LX8A 5DH9A 4CDGA 2IS6A 5BW8A 1E69A 3AF2A 2JDID 4PSVA 3SOPA 4I1VA 4Z8XA 1E79A 1VCNA 2PCJA 3D7MA 4URYR 2AWNA 2IYZA 2O8CB 4AC9A 1FTSA 5K8UA 1CULC 3F0TA 2WJHA 3EX7C 5DSZA 3QY0A 1Q0UA 4QL3A 5CK5A 3AF1A 4TLEA 4HDCA 2PBRA 4MQBA 1XTSA 2P6RA 1HUQA 4BE7B 2WAYA 3A1VA 5SZHB 3IGFA 1XEWX 4BUJA 4NDZA 3ZD7A 4NYMQ 4KCGA 2R62A 4AKHA 1AGPA 1D5CA 2GZAA 2HJGA 2B8TA 1G291 1X86B 5JCZA 1M34E 4LHYA 4P0TA 4UJ5A 4LC1A 4A0GA 2FU5C 2PEZA 5HKKD 4GP7A 4ZKDA 4US0R 3B1XA 4FCWA 4Q48A 3IQWA 2NO0A 4NCHA 4G3XA 1GZSA 1W36B 2PX3A 4HYYA 2ZYVX 5DYIA 1G7RA 1MT0A 3PEUA 4OK6A 4GDFA 4EKDA 2H18A 2GAOA 2F9LA 5IRCD 4XTCS 3NG1A 5DYGA 3FMIA 2ZJZA 2MMGA 5EE0A 2ZANA 2TMKA 4AURA 4TZ6A 1NI3A 4PR0A 2OG2A 1OHHA 2ZJ8A 4M8NE 4IXNA 3VKWA 1RKBA 2RCNA 4C2UA 4DSNA 1F2UA 1B0UA 1RIFA 4G5OA 1FOEB 3QF7A 4Q9HA 2VSFA 1QHYA 1TQ2A 4A0HA 5LDDC 3MSXA 4NYMR 1QHNA 5SZKB 1IXZA 1EK0A 1T0JB 2DFNA 2VPPA 2XZLA 3K0AB 1WP9A 3X2SA 2ZRBA 1U0HC 2AXPA 3HU3A 2FWRA 4KV9A 1HTWA 5C1BA 1SVOA 3U6KA 1C4OA 2WJYA 2BM0A 4OQXA 3DZDA 1Q20A 5CYOA 4PFSA 1LNZA 1N5IA 3SFVA 3N70A 4F4JA 4G5QA 1NMZA 2GJKA 1G8HA 3C8UA 3FDIA 3THWA 1UBEA 2D2EA 2DHRA 4LV5B 1JI0A 2EVWX 5HKKA 2FEMA 121PA 2NZ8A 4ZV4A 3W6OA 5L3VA 3CH5A 5KDLA 2ZE5A 4Z1MD 1I4TD 4NTZA 5CB6A 5IF9A 3WMEA 4C0JA 3Q5EA 2W6JD 1GOTA 5FTMA 2KE5A 3ZLJA 3EZFA 4B6FA 1II8A 3SQWA 1KI9A 2VF8A 5CK4A 5B64A 1XX6A 1N6RA 1KJYA 1J99A 3QKUA 5FOSA 2PZEA 4XOIA 2ATVA 1VCIA 4TMVA 2Q9AA 4LGMA 1XZQA 4FCVA 3Q72A 2V6JA 4TL8A 1PLLA 2WV9A 1X8JA 1EFTA 2VBCA 4GBMA 3WYGA 2ZJOA 2CCKA 2J1LA 4DT1B 3VR4A 4HEJA 2RHDA 3TBKA 1W1WA 3QJYA 4LHZA 4G5RA 3T5GA 1CJVC 2VA8A 1CRQA 1I4DD 3Q5DA 4Q1BA 4PTLA 1G3MA 2XSZA 2QMOA 3FMPB 2ZROA 1JBKA 3ICQB 2GTPA 3FYHA 5EE3A 3DO6A 2D62A 3IO3A 5DN6D 3GMTA 2MSDB 3P26A 3PIRA 2XAUA 5JCPA 1YRAA 2XB2A 1NL3A 3VU9B 3LW7A 4WXPA 2I1VB 1G7TA 4LPKA 5TXGA 5EJEA 1UEJA 4D4LA 2V8OA 1II9A 3EW9A 1LF0A 1ZNWA 4ZO4A 3K09C 2REOA 3HDTA 3NKVA 4B2LA 4I1OA 4Z1MA 4F93B 2JLSA 1GNPA 3ZVMA 1EFCA 2W6JA 5B57C 4JYBA 4PZZA 4TYWA 4LBZA 3TUIC 4QFMA 5K8IA 4ACAA 4M0LA 3RC8A 3U2QA 2A9KA 3IEUA 3KJIA 4FN5A 3VNVA 4JS0A 4OHWA 4YC7A 4A6XA 2OUKA 5GJBA 1KSJA 1K5GA 4PX9A 4WZBE 4WIAA 4XH9B 4PQFA 3R9WA 1NBMD 1GL6A 5AJWA 5KYKA 5IK2A 3GJ8A 3EIHA 2XITA 3M6AA 5EP1A 4KI0A 3HPRA 2ZUDA 1EFRA 3QXSA 2GF9A 2EWVA 3UG7A 4NCKA 4NYIQ 1B23P 2XTNA 5DISB 4PAOA 4FMCB 5J4VA 1TF5A 2CK3D 2FDCA 4B3CA 5FOTA 3W8RA 221PA 1A1VA 4EJSC 1NJGA 5FH9A 3WNDA 4A0RA 4RVCA 2XXAA 3NDPA 2OBNA 4UKDA 3QUSA 2ZI4A 1JECA 3L43A 4DLUA 4KLZA 4X8HA 3V4FA 1Z5ZA 2P3SA 3F3YA 1D2EA 4IDHA 3T1TA 1R8SA 2IEYA 4A2WA 2OCAA 2V9PA 1KDRA 1VCOA 2AKYA 2DFTA 1CP2A 1E2QA 1X6VA 2YOFA 4QJ3A 4F91B 4IOLA 3DHWC 2W0MA 1KNQA 3SYKA 1ZD8A 3CNNA 1RYHA 4PQYA 5EZ5A 3RSLA 3ADDA 1Z63A 3IUYA 1PLKA 4P32A 4DLRA 3IBGA 1NN0A 2C78A 2D74A 2ZSEA 4XD7D 3LBNA 2DPXA 3HJNA 4ZDWA 3I73A 3ZZTA 3TKLA 3TK1A 1UEIA 2BKUA 4MRNA 1OYYA 3WYAA 3LBHA 2GEVA 4DUGD 1KOFA 1NBMA 1XTIA 4MGIR 4W9MC 4DLSA 1N6PA 1QHXA 3FMOB 3KFVA 4IRUB 3W3AA 1UBGA 2A5JA 2CLCX 2D06A 2F43B 5A0FA 2P5SA 3R9IA 1BMFA 5DNYB 2O8FB 2C9YA 1CLUA 4EAQA 1W4AA 2ZAMA 2ZUBA 2NMVA 4GOKA 4Q4LA 4A6PA 4D81A 2R8RA 1NF3A 3RSOA 1ZC4A 2ZR9A 4B76A 4KLNA 4BEBA 4LJ6A 1M7BA 4NONA 4E03A 5KPJA 2CK3A 2VSOA 2ZRCA 4LJ7A 4A8JB 1LFDB 4RD0A 1SHKA 2W6ID 2J46A 3CRRA 3BWDD 1X3SA 2PL3A 2J9RA 3M0EA 1G3RA 4R2IA 2X77A 4JL8A 3FKSD 4OYHA 4LYHA 4PQRA 3U5ZB 2JJ8A 4DCTA 5A5GA 4C0HA 1VPLA 3GLIE 3HR8A 1DARA 3BB4A 2C04A 1QHSA 2G83A 4AWXA 3K70D 1NKSA 2JAQA 3KJGA 5TB5A 4KODA 4EFMA 1OH8A 4FMBB 4C9BA 3V9PA 5B30A 3KKQA 3SE0A 2GESA 4QJ5A 2EFDB 5AUPB 5FTLA 3VNUA 1XMIA 4PO1A 3S1AB 1IONA 2ZIAA 4AKGA 1VHLA 4IW3B 3WYFA 1P9NA 1R5OA 2QAGA 5GJWC 3ZZ0A 4BEJA 3VR3A 1HE8B 1NP6A 5EE9A 2IUTA 3P1JA 1US8B 4JVNA 4LZZA 1YR9A 2Q6TA 3OEHD 3KQLA 1W46A 1JJVA 4CT4B 1VYVA 4U7DA 1W48A 2ZSAA 8OHMA 3MWYW 1VMAA 2NPIA 4RCYA 1Z6TA 4HATA 1OFHA 1A82A 2ODNA 3B9PA 3MCAA 5E95A 5CM9C 4PC1A 1J8YF 3BRWD 3L0SA 4URUR 4Y0AA 3RS0A 2J7PA 2GKSA 4GOXA 4WZAE 2B7BA 2W6IA 4B3GA 2GJSA 2UZ3A 2JIZA 2QPTA 4HZUA 4Q03A 3FKSA 3VMFA 4L8GA 1II0A 3IBYA 3B13B 3KZ1E 4M1OA 1XTKA 2ZVQX 5KSYA 4C0KA 1ZD1A 2CDNA 3IKJA 4TYYA 2HDNB 4HLUA 3SYNA 1U9IA 1XWIA 2QORA 4PPNA 4QM7A 3LAWA 1GDDA 3VR6A 2QN6A 3U3JA 5EP4A 4AYWA 4QXAA 3VTKA 1P3JA 5JI2E 421PA 4EPTA 4YMUA 1FQKA 2Q3HA 4BFXA 2F9MA 5AWFC 4D4MA 1CBUA 2UVQA 5G40A 4XVQA 2J3EA 3EZ6A 4HB4A 4RFSB 4LJ4A 5DLQC 4M9ZA 4A1FA 4H9GA 1P7CA 3CX6A 4LDJA 4KYUA 5J5CA 1UKZA 4A9AA 1JEDA 4FWIB 1UM8A 3MJRA 5FOUA 1WMSA 1AZSC 3NVAA 1ZUNB 2BIFA 3ADKA 5JHGB 1N6HA 3I5YA 5CB8A 4C7OB 1E2HA 1SVMA 3KQNA 4L16A 3MFYA 3CUEF 3PR1A 3NWJA 2EFGA 4HAYA 2N46A 2GK6A 2ONJA 1OFTA 2GETA 4JVMA 2P6UA 4TT3D 1MOZA 5AK0A 3REFA 2R2AA 5E7MA 5EXSA 1G3UA 1X8KA 4B48A 5L3QA 2CE7A 2WJGA 2F1HA 4A82A 1UJ2A 4B33A 2R65A 3OE7D 4MYCA 4O2LA 1W0KD 3GLHB 4GMXA 2QG6A 4C0AC 2ZUCA 4LC0A 2GBLA 4TTQA 5AJVB 3TRFA 1OH7A 3ICEA 1P61B 1Z6YA 2ZJBA 3EA5A 2PH1A 3DEFA 1IY2A 1T4GA 5E3HA 2OLJA 1OLOA 1E9SA 3H2YA 4IFBA 1BS1A 4JBXA 3U6BA 2IUSA 4XSGA 4HZIA 4WBSA 1W4BA 2OO7A 5TV2A 4P4SA 3GD7A 4PHTA 5L3SA 2X19A 3L0IB 2FZLA 2VH5R 4P4TA 1KI4A 2H16A 1W2GA 4TL6A 3SJCA 4IXMA 1SKQA 1FP6A 4YMVA 5CLQA 5FBRB 1IJEA 2RAPA 1OE0A 3NBXX 4EFNA 4QHTA 3U7EB 4GRAA 3VKGA 4DEXA 1JR3A 3BFKA 4I4LA 3ZS8A 3LY5A 3I5XA 3DM9B 2GZDA 5DE3A 3HU2A 3QXCA 3B82A 4IDQA 3AP3A 3LDAA 1YR8A 1ZNXA 2O8DB 2ZVPX 2IL1A 4LV6A 3B60A 3TH5A 5JWOA 1GM5A 3EWSA 1QG4A 1XCMA 2VSXA 5FUYA 3C14C 2IK8A 2XZPA 4ILEA 2HUPA 2W2TA 521PA 5F9FA 1TUEA 1W0KA 4LHVA 3W90A 5TARA 2FA9A 4BRUA 1EXMA 1XMSA 2GZHA 4C0SA 2GILA 2C77A 1K8RA 4JJZA 1MH1A 4ON9A 1E0SA 4OKSA 1S0UA 4Q4HB 4D4KA 1ZCAA 4QNRA 1OSNA 1R4AA 2CJWA 4ZIRB 1DEKA 1XFAA 4DLXA 4B47A 1IOZA 1U8AA 2QRNA 3ZQJA 4KFSA 1ZM4A 1R8QA 5JBQA 4II7A 5HCNA 1WB9A 4DHEA 3QVVA 1XTQA 5TDHA 1WBDA 1DPFA 2QQEA 1P75A 4JLAA 1RVDA 3AVUA 1RRPA 2F3TA 3QKRA 3PUZA 1R0WA 2LWIA 3CH4B 3H4MA 4ZKEA 1QZXA 2FOLA 1NMXA 4DJTA 1G18A 4C30A 2WKPA 3AKEA 4Q00A 1MO5A 2AK2A 3GFTA 3OIYA 5L3RA 1SXJB 4F7WA 2FPLA 1KMHA 4D2IA 4LJAA 2W58A 4CEIA 5H70A 3WBJA 2XNDD 1YHNA 5FL3A 1G7CA 1XD8A 1U94A 3GLIA 1SGWA 4QG7A 1BH2A 1DAMA 4CEJB 1CF4A 2Z43A 3N5CA 1F48A 1QHHB 5AJYA 4C4PA 3KQUA 2B21A 4FWTA 1PV4A 1ZM3A 1XD9A 1YR6A 1AKEA 4NCJA 4CIDA 3CRVA 2YWFA 3K0CA 5IDVA 5JJLA 3B1YA 4URWR 1JJ7A 3WHLA 1E79D 1NN1A 5EE5B 5KDDA 1Z8FA 4DDWA 1XU4A 3PXGA 1GKYA 1N0UA 2FFAA 1F5NA 1RPZA 4I81A 2QBYB 2YWGA 4RD6A 2WJJA 3FB4A 1WXQA 2IBMA 3BOSA 1DBSA 4OJKA 2QQ0A 2R6GA 4TQUS 5C4MA 2KSQA 3KTAB 1GWNA 2WKQA 4RZUA 1MO4A 2IW3A 3GJ6A 1TUIA 3TUZC 2FN4A 4Q4AB 1CR1A 2EFHB 3IEVA 1ZU5A 4TYNA 1OXSC 2VYFA 3IIKA 4EPWA 2R6DA 3KXKA 2VP5A 2R9VA 1XJQA 3IPYA 2G3YA 3B78A 3IIMA 1DE0A 4LBWA 1T8UA 4HAWA 1XB2A 5CDFE 4IVQA 2O8BA 3U44A 1ZU4A 4PO8A 4N0EA 2OCPA 3KUCA 4WVFA 4C0BA 5IHPA 2WWYA 1Q12A 1DVRA 3LWNA 4LV8B 2HF9A 3B8HA 2ERXA 2XNDA 4FMDF 2OSBA 3TQFA 2QPAA 3AUXA 5JFGA 1TEVA 2QAGC 4HLDA 4Q7KA 1FX0A 1KK3A 1QF9A 2MMCA 1T5IA 5EXPA 3LQRA 2WWXA 4B75A 1OHHD 4D0GA 5AUOB 1SQ5A 4TWZA 1KI6B 1P62B 4MRRA 4CVNA 1NG1A 3AGPA 2B6HA 4IDPA 1XJ0A 3MLEA 3ZDQA 2WWIA 4KXFB 2B92A 3C4JA 1JALA 1VYTA 2ATXA 2BCGY 4M9QA 4XSHA 5KHOC 3QKSA 1PVOA 4MKHA 2G88A 4LUCA 4TLAA 3GLFE 1Z47A 2J45A 2QSYA 4AI6A 2CE2X 3FFAA 1ZIPA 1CR0A 1OFIA 1ZIOA 3KUDA 1SHZA 3OESA 5KSOA 3K0FA 4ZCMA 2CVHA 1TL7C 5A4JA 1FUKA 1FFHA 2ZSBA 5DHFA 4JZKA 3EASA 4Q02A 3U61B 1GNQA 4RKEA 2DYKA 5M04A 2NO7A 2P67A 3GP8A 3K70C 4C0LA 1PZNA 2C96A 3F5FA 1Z2AA 4ARZA 5BXQC 1XF9A 2IS2A 2BBWA 4BFYA 1TX4B 4CW7A 3MWKA 4KITB 4JVLA 3SZRA 1IN7A 1S9DA 2ORVA 4A15A 3CBQA 4HLUC 3QI2A 3MG9A 1U9IC 4DB2A 1G20E 3AVWA 1CU1A 4M4SA 3OZXA 4QBGB 1SVWA 3QEJA 4IJMA 2Z6VA 5FOXA 4YMSA 2DWOA 3VHXA 3CF2A 1VDZA 4RZ3A 1OIVA 1ZCBA 5BN5A 3GLGB 1DAEA 2GHIA 4HDQB 3NBFA 4I99A 2LCFA 2R44A 2GWHA 1OIWA 1TMKA 3K8YA 2FSHA 4XIGS 4B3XA 1EG7A 5EXTA 3BD9A 3PFIA 2REBA
chains in the Genus database with same CATH superfamily
1C9JA 3A6JA 5KTOA 4G0QA 1JLRA 1EGAA 3AFGA 3TNLA 5CU7A 4E5SA 3COZA 2BDEA 1JG6A 1P1IA 3HY4A 4LKRA 2BI4A 2Q0XA 4JI5B 3VH4A 1MP0A 4HUQA 2B1QA 1T1JA 4QLOA 4OLFA 5D5HA 1F2TB 1R3UA 1XEXB 2OCIA 4MCIA 3TW4A 3E27A 3IHTA 4MUGA 3EGXB 3P0EA 4IMIB 1U0GA 4NQZA 3TRJA 3C48A 1TADA 3NT4A 1CQWA 2Q3FA 4P2BA 3VPGA 5K6AC 5FPYA 1DTEA 3AXSA 4RX1A 4XEUA 3T7CA 1O94A 3U17A 3PFHA 5KQPA 3CG4A 3EAQA 1ODSA 2J9XB 3PEYA 4FEGA 3DMTC 3I8SA 4INPA 1JT9A 4YV7A 3ISTA 4CKCB 4UOZA 5I7SA 5AKIA 4HH4A 4CDNA 2JI6A 1A72A 3G68A 1ZK2A 4LRXA 5FA8A 3UK6A 4C0WA 5FDFA 1DAKA 5AM2A 1ORRA 1X3LA 1FNNA 1OKKD 4QBIA 4B3RB 1UZMA 1AXGA 4CMEC 4LZOA 3TZKA 2IEAA 3ONDA 4J0HA 5J63A 1EX1A 1NQ5A 3B12A 3BWBA 4H6PA 1X1RA 5CYFA 1RYMA 3B20A 2QTHA 1FXUA 4KKXB 4BBAA 3K9CA 1QIHA 3FF1A 3ZQ4A 4KVAA 2OHIA 1G4UR 1EG2A 3RHZA 4EA8A 4YJ2A 2COEA 5FX2A 3D4PA 4EQ6A 1D2CA 2UZAA 1KEPA 1ZH0A 2D2IA 1TTHA 1L6RA 1GCGA 2IZ1A 4Q21A 2XHZA 1UM9A 2PM8A 5CT9A 5AW8A 1VYHA 3A6DA 4BDTA 2XQGA 4ZOCA 3OFSA 3PLRA 5HRCA 1WU8A 2LNDA 1EFRD 2CYCA 2E4AA 2VK4A 3CF0A 1OY1A 3N39C 1FP4A 3V80A 3S2FA 3ZCTA 1W0CA 3OX3A 1YDFA 4ESHA 3RVOA 3QVUA 2ZRHA 3ZHBA 8ADHA 4P3YA 4LG1A 1H1LA 1M2OA 3ILSA 3HHEA 4B17A 3AVPA 3A1UA 4D4JA 1FFAA 1Z6PA 5BY2A 1U7PA 1FVHA 1OYWA 1VRWA 2EIXA 1R8XA 2ZI7A 3N07A 4H27A 4HNGA 3IDQA 4YT5A 4EI8A 3E5MA 1OWOA 2VQFB 4OYYA 1NVUQ 2C07A 4J90A 2FR1A 4Y1FA 2DXIA 5LB4A 2ODQA 1XLUA 3GJ3A 4LA4A 3T7IA 2N3ZA 3Q7TA 5B12A 3DDNA 1MQ9A 4TN5A 4N5MA 3QKTA 5DTQA 5J5AA 4AZVA 4P4SB 5A9RA 1NXVA 2C58A 4PLHA 3WA6A 3BORA 5L3SB 3O4GA 3M33A 3ZOKA 2BZSA 1O0SA 5LMNB 2QRKA 3DZKA 3Q6NA 2G1AA 3H5TA 1QZUA 5KO2A 3IXLA 1B8UA 1VG1A 3BCRA 2KM1A 4K5QA 3HO8A 4BAZA 3ERCA 1M7HA 3G8CA 2P78A 1GPMA 1Y98A 1X19A 4CDMA 4D25A 5IKXA 1AY0A 4ZC8A 3GEIA 1W4ZA 3N0XA 3AX6A 3OT5A 4J6EA 4M76B 2FEXA 3DYIA 3SG0A 1QKJA 3WL8A 5CJJA 3NV9A 2GF0A 3M81A 4FQ8A 2JJ1A 1GAXA 5C8YB 1AXEA 5GOTA 3FJOA 2PVPA 3PEFA 3KZNA 4MLCA 4WNAA 1M2GA 2BBOA 2FSPA 2YV3A 2FWNA 3GMDA 4IH4A 3R0IA 3HEAA 2QJFA 4G5GA 4HZGA 4YHBA 5EHNA 3W6PA 4U2CA 4CQLA 1YRQA 4EPYA 5M5BA 4E3WA 1WVGA 3EFOA 3IOMA 4EPRA 1T9AA 1LB1B 3NC1C 1JDSA 5AMXA 3W9UA 2PT5A 5L8VA 2BR4A 3LDFA 3WYNA 4ER7A 4IGEA 5LIPA 4M6WB 3IIEA 3RC1A 2XGMA 1TYCA 1XMQB 4PLVA 2R1TB 5KHLB 2R79A 3GGOA 1Q44A 2GYUA 3DYVA 3DH0A 5FPSA 4JZYA 3IQXA 4YREA 2PBZA 4NYJR 3Q8LA 1SO8A 3OOYA 4ER0A 1E0JA 4O25A 3OZIA 2GCOA 2E5WA 1JB1A 1WW8A 2IF2A 4L75A 2HKIA 3T0IA 2A0YA 4JGIA 3OF3A 4BPBA 3EOAI 5COQA 3S2SA 1JYEA 3WK6A 2Q3DA 2RJNA 4JT2A 1T1GA 4B4OA 2QLTA 3D0RA 2Z2JA 3AM3A 3IHKA 2OAQ1 1H4SA 3QMWA 1M6HA 4F5YA 2X0KA 4EJ0A 3O7MA 4ML3A 5ALSA 2I2XB 3FRIA 3HVUA 1VE5A 2YDYA 1C2YA 4AO8A 1VJTA 2JGEA 2D5AA 5BWBA 1GILA 5BYJA 3A1TA 3C0KA 3FJYA 2EF0A 4JLMA 4JLUA 4BXOB 1H0HA 1H0RA 3GDWA 4WA7A 2N42A 4QC2A 1XV5A 2CLDX 1EP2B 1H6AA 1Q3KA 2I6UA 5IH3A 3TCKA 1PBTA 3V4SA 3VR3D 3ZZUA 2BELA 1O96A 1QV7A 2QUHA 4XPZA 4LTDA 2WM9B 3SU8A 2Q1TA 2Q5FA 2VF4X 2XQFA 2DY1A 4UXHA 3SFTA 2VUTA 3E61A 5H9WA 4IOKA 3MMPA 4FMCF 1HC7A 3U31A 6REQA 2FZKA 3BGOS 5CT8A 1DNPA 1NTRA 1PFQA 1T3SA 3CWZA 4N03A 2HU8A 4A5OA 4DXDA 4A8PA 1JLMA 4OJQA 1HG0A 5A7GA 2YVQA 4ZRMA 5GZ3A 3T1VA 3SZGA 3CXRA 3T3MB 4AZWA 2QE7A 5JH7B 2P35A 4IIJF 1OIXA 3G88A 2AC4A 1BQEA 1PJQA 4Z7QB 4QG3A 3A9VA 1MMFB 4NE7A 5JPIA 2HEIA 1BGVA 3DD1A 3EDCA 4R1OA 4DAOA 4E46A 2IZ0A 3DAOA 5EOVA 1GRCA 1Y0BA 3G49A 3T5PA 1MT3A 1KWGA 3ZEAA 2L2QA 4KSBA 3CONA 3PNQA 1K27A 2YQ4A 5AK5A 2FXVA 3OIVA 4US1R 4XYEA 3FOCA 4E09A 4Y1RA 3VZRA 4J1TC 1A8PA 1CUFA 1E1KA 1HORA 2J0UB 4I2VA 1RJ9B 5IBCA 4KIGA 1KJZA 3TRKA 1KAQA 5CA1A 2YIVX 1KO5A 3S2YA 4AXBA 1TF2A 2WJAA 3F6PA 5JXWA 1DCTA 1SB9A 1UBCA 3BERA 1PS8A 4KFRA 1I0IA 3A4LA 3O4FA 5E9WA 4L4YA 4UFOA 1N2CE 2NTYC 3JS5A 4Z3DA 3Q3VA 4ER5A 2LV8A 2ZB3A 4ZARA 1DCFA 1YDGA 1YZGA 1Q7CA 3AILA 8ABPA 3NMUF 3BGVA 4NDAA 5HE8A 3FYSA 3RFXA 2FMUA 3CPEA 1NVXQ 2H2IA 3F5SA 3D7KA 5K0EA 2OMKA 1F2DA 2XXBA 4IX1A 4OAQA 1TT7A 1L7VC 1A7KA 1BS9A 2BSAA 2EATA 4L3WA 4QEZA 4ZK6A 4I50F 3B51X 5LLDA 3STUA 3ADOA 2PTGA 3DMDA 5FYQA 3BPSA 2QTGA 4ZGGA 1LUAA 2P4HX 3DGFC 4G0WA 1F8FA 2X41A 2X8BA 4GLJA 1AV7A 4BMXA 1LVUA 3VJMA 4DL9A 4XVRA 2EG9A 1TJYA 1GGHA 2FMTA 2IYFA 3KLBA 3D6NB 4J7AA 3VZDA 3WJ1A 4BAGA 4W63A 3FE2A 5CJ2A 1W1UA 2JIMA 4GE3A 3RS8A 3KL2A 16PKA 2C2GA 2ST1A 1G0NA 4KACA 5ED4A 2G7MC 4OBXA 2JHGA 2OL4A 3UB3A 1L7RA 2VDWA 2VRCA 3OVMA 3P2IA 5JPCA 3VC7A 1GPUA 3H11A 3RAPR 4C6TA 1P1RA 4DLYA 1EEHA 5AYVA 4GKJB 2GH1A 1XP8A 1S7GA 4EJFA 4MVWA 2UYOA 4R84A 2BEUB 3LL4A 2I4LA 2PJZA 3C3YA 1SA0A 1E6CA 6Q21A 3OHSX 3T34A 4M83A 2C2MA 1Z0IA 3BL8A 3K9BA 2Q5LA 4M89A 4NBTA 5JALA 1Y5IA 1R9MA 3OT4A 3NHSA 4M3NA 4MVJI 2VDPB 1E0DA 3V3TA 5I9MA 1CRZA 9ATCA 3NWOA 1JMVA 4ZJPA 2XB4A 1T1IA 3RIGA 1I4LD 2IHVA 3K0HA 4M88A 2GFIA 2PFSA 4N5LA 4UC0A 4PW0A 1IOWA 1VLHA 3L7LA 1K6MA 2GXSA 4DYHA 3G0BA 1Q0RA 4RD1A 3L84A 1SVSA 3DC7A 4MWEA 4MHTA 2VWHA 3N3AC 5KYXA 2NVWA 1FCJA 1W4CA 1WF3A 2R7KA 4Z4CA 3OPQA 4W99A 3WRYC 1EP3B 2JCGA 3UWPA 5BOSA 2X4GA 1OWLA 5TMPA 1E2GA 1D2AA 2WOJA 3AF0A 2YWDA 1N34B 2WWFA 2HHAA 4IMRA 5BN5B 1IB0A 2BMFA 2G67A 3K4PA 2OEPA 3GFSA 2DFPA 2R85A 2WVHA 1XK7A 2B3DA 4W5JA 4TTRA 2RGBA 2C9ZA 2XA9A 2E6UX 2ZAOA 4WGGA 4AYTA 3G6WA 4D43A 4EVRA 1F2UB 3TLYA 4E5DA 3FPBA 1FDSA 4Z7JA 3JX9A 2WDZA 2YQZA 5LXTF 4K1XA 3G2KA 3JVVA 4C05A 3K0AA 4EG4A 1Q17A 1ZMTA 2OQ2A 2JRCA 2HU2A 1XTJA 2E4VA 2XDQB 1P6QA 4O2AF 4RW0A 1HTBA 4YCSA 3ZVLA 5JS8A 4TQAA 2A57A 2ALJA 4WK2B 4FR5A 5FHQA 4UTXA 3ACBA 4GEGA 4TN1A 4QU9A 1B00A 1JR3D 1YJXA 1DELA 3RDPA 5JNWA 2IEGA 3RCBA 4EBBA 3O3OB 4MR7B 2VJNA 4XYMA 1GFIA 5BMVF 4HRAA 4KAXA 2AUNA 1WMEA 3GCWA 3HJGA 3JQCA 3A14A 3VGJA 3CBGA 3BULA 5CTAA 4CE6A 4TYQA 2G0AA 1IEVA 1Z25A 2J08A 3GW8A 3OX2A 4LGCA 2RG7A 5TPWA 1BWRA 5BNZA 3N9IA 2CL7X 2B9EA 2BFMA 2J48A 2YBEA 4JYPA 3HLTA 4NZPA 4Q6WA 1KEUA 5TSDA 3RS9A 1UINA 3YASA 5HXAA 3MQ2A 3HB0A 4PPFA 3ETHA 5HYVA 3AVTA 3TQIA 2Q6VA 2ZYGA 1AO0A 4N65A 4QBTA 2QTAA 3W5UA 3RARA 2ZI9A 2VFAA 3RC2A 1J56A 1L7NA 5DIFA 2A5GA 2D2VA 2JFOA 5FPHA 3KB1A 3LV8A 3PFBA 4XDYA 5P8WA 2G72A 3L04A 3OU7A 1RMQA 4CCWA 4LXYA 5L4NA 1W7AA 1TTTA 3D31A 4Q34A 3OAAA 1GUZA 1CEEA 4NMWA 4F1JA 4YRAA 4P35A 2DUUA 4XFKA 3PC2A 2Y3IA 4I5EA 4K88A 1EDBA 4AX8A 1ZM9A 3FY4A 2IUYA 2O07A 3ZGNA 2FZCA 3ZGLA 2FLVA 3CLVA 4H4EA 4ZU6X 2I2DA 3BAFA 3FKQA 1V6SA 3K9HA 5AM5A 1CLEA 1EB9A 2KHZA 3ZY2A 3E4DA 4CTKA 2GPSA 4NU5A 4N3BA 2NADA 4WVLA 1I2CA 1KHHA 1YBFA 4QXPA 1T9ZA 2AMVA 3KSBC 4UCWA 3VAAA 3ZU3A 2XNSA 4UE3S 4LECA 3DFKA 1Y7PA 3DEYX 3AIOA 3CLUD 1DHRA 4DVGA 5E4JA 4P3KA 2K87A 1FLVA 3IESA 3WLOA 4GGMX 1N2XA 4BKOA 5DLYA 4DBZA 4LY6A 4QM6A 1B4DA 4GX5A 4EW6A 1L5YA 1O95A 4J3JA 5HTKA 5EJ5A 4OO3A 5B55A 4MUXA 1CQIA 1FSPA 3G1UA 3LY7A 4RS3A 3S5JA 4TWRA 1IFXA 3IC5A 4GMDA 4YHHB 5CBPA 1T36A 3QSYA 4RZHA 3Q12A 2EQ5A 5GMOA 1JG3A 5IUJC 4KE9A 2J0EA 4FS3A 5D6NA 3VSBA 3FLAA 3Q10A 2WILA 4I14A 1AN9A 1KJ9A 1PS9A 1EUCA 1UADA 4FMPA 2VOJA 2JAXA 5DT2A 1IBCA 2GN8A 2GNOA 2QGFA 5EP2A 4DIEA 3R4VA 3A4IA 1YK1A 2UUPA 2Q1YA 4P3PA 4IY1A 5GJVC 2NO5A 2V45A 1G5IA 3E2MA 4YH1A 3FZNA 4C2AA 3GLSA 4N1AA 3VR1A 4LGVA 1N57A 3PI7A 1C7QA 4FYXA 1PR5A 1HI9A 1Z0JA 1ENPA 3FTCA 4QYIB 2H1CA 3EA4A 5IVDA 3NP9A 1Z56C 4AMUA 4S1PA 4U7GA 4C1NA 3IAS6 3L4KA 3VO9A 3ZD8A 2AN4A 3D3NA 4HDRB 5EMLA 3VM6A 3ROXA 3CWQA 1K8YB 3PPWA 3G9XA 2FRDC 1DJPA 2Y1XA 1EUDB 1DFHA 3LZDA 1NNLA 3WIDA 3H4TA 4TKZA 1ETHA 4Q66C 1W85A 3X43A 3HY3A 4U00A 2VQSA 2IU3A 1ZGBA 1P2SA 1RYYA 2ZSKA 4WXMA 3GCZA 3TUJC 2PWAA 4LJYA 3STTA 3ESYA 1PKXA 1OF1A 3M6WA 4OQNA 1NLYA 3IJPA 1XZLA 3SFZA 2QROA 2Z1NA 5JG7A 3EPKA 2AIRA 2P9BA 1XMVA 3N5KA 2WNIA 3IAFA 3DT9A 3IAUA 4KC0A 4F1WA 2PJRA 2B8WA 1O3YA 2J4DA 2WZBA 3E9EA 3ZUPA 2GJAA 2ZP1A 1GYPA 3L49A 4UNIA 3ANLA 4Q6BA 3DDSA 3GZNA 1RLIA 3HUFA 3GFBA 3EIXA 3FOBA 1OZFA 1OGJA 3HVJA 3W5HA 3O3MB 3KSAC 2WU3A 3KKOA 2C9MA 3ROPA 5H4GA 3QPVA 1SFRA 3BH6A 1UIMA 2R1ZA 1JDUA 1E4VA 3FZYA 3WGQA 3HKCB 3JAKB 3JQ6A 1Z6ZA 2OILA 1Q57A 1DJQA 4MJXA 4BMCA 2RARA 1C3JA 3FNHA 5JEEA 3NUZA 3OZUA 1RQRA 5A3VA 1TC1A 4MR8A 3JQ7B 2WMYA 5JZMA 4DAEA 4D8YA 1JEYB 1ULUA 1MO6A 1P4SA 5LC1A 3HFRA 3BKWA 3KDPA 1T5DX 3DDZX 2F62A 1LQTA 2R11A 3GRKA 3I9OA 3VYWA 1NW9B 2PGXA 3FDXA 3PK0A 1OBFO 1P4GA 1C9KA 2XNJA 5K0TA 2C8VA 2A92A 5FAXA 4PG7A 3MERA 5K9ZA 3JR3A 1U2TA 4LHWA 4IAOA 2HMYB 2FWMX 5JVDF 4J6FA 3EDMA 3MCTA 1UOQA 3TQHA 4EMBA 5AP9A 3GPBA 1M75A 3AWIA 3GJQA 1R9GA 1JNYA 4TTVA 3N2GA 1HYHA 3L4BC 5EZ6B 1JVNA 1MBZA 1AURA 1TCBA 2PZGA 3GIWA 4GVPA 2AJDA 3IHWA 3G23A 5BWCA 4XUGB 4MYRA 2HR1A 4OKNA 3UT5B 1G17A 1IBRA 4NJEB 1W94A 5I9TA 5B58T 1OASA 4D02A 3JY6A 3RKRA 3ABSB 3CF4A 1YFKA 3CEHA 3I6QA 3QPUA 4HFRA 4KIFA 5CLIA 5H16A 4KHZA 4NH0A 3RYHB 1N2JA 3EUWA 3HPQA 4GXNA 4H17A 1J5PA 5CB4A 4POOA 4Z3OA 1AU9A 1KHTA 2DG2A 2EQBA 2FPPA 3M6LA 3U0BA 3SF0A 2ZWPA 2CHFA 3EARA 4L2IB 4DMCA 4RDXA 5LP6C 5L9AA 1D2RA 5KC8A 2O8NA 3FETA 8AT1A 3C8ZA 4FGJA 3DZGA 4XTRA 1IDN1 1PQWA 2IVFA 2F59A 1XG5A 1XZIA 4MKIA 3I9FA 2W6MA 3F9CA 1V6AA 4CI0B 2XB6A 4WA8A 1FS6A 2L18A 2A1TR 3K0BA 3ER6A 2ZPTX 1ATZA 3BHMA 4EPXA 1PJAA 2VJQA 1TIPA 4QZVA 1KP3A 5JDIC 2DFDA 2QN2A 1L5KA 4BCBA 1PX0A 2QTRA 1YZFA 4NBVA 3AYXB 2B78A 1C0EA 1KFCB 2QX7A 3MB8A 3WMFA 3FPAA 1TEXA 3BEDA 3ZHOA 3ZHTA 3RKUA 1BS2A 1HF3A 2G9VA 2R8PA 3RUEA 2W2LA 3DNPA 3S1AA 4KU4A 3VPHA 3RK1A 3RVQA 1V1RA 1YS1X 4G0ZA 1PF7E 2PGNA 4YACA 1GY8A 1E61A 4DY4A 4NJMA 5MF6A 3K53A 3O8QB 1IHPA 1GGFA 4K8OA 1Z28A 4UBLA 3QLUA 4G97A 4AFNA 1QC5B 4J0CA 1US8A 4TL9A 3GX1A 5LNK6 1BCSA 2BL4A 1ZR4A 3WLKX 1YSCA 1ZVVA 2OZEA 3EVCA 4QLAA 3A3PA 3AEZA 4KI7A 1HSZA 1XAGA 4UU0A 2W6ZA 3UH1A 4EDHA 1D2HA 4UTPA 1DFIA 1NUAA 1TKBA 3HCBA 1KI1A 2O5CA 3KXPA 3D3EA 4S2UA 4JOCA 4KW7A 2YXDA 2BF4A 4ZU3A 3MAJA 3BILA 3I1JA 3ZTWA 1IQUA 1G5TA 2J31A 1RPJA 3DFFA 3RT9A 5D3MB 5K0SA 3Q1LA 1W30A 1BNCA 1MOPA 1J70A 2J3JA 3KJXA 3MS4A 3W34A 2BHLA 1H8HD 1GUFA 4UBJA 2BOVA 4HWPA 4NICA 2Y77A 4ITRC 2FWIA 2NO6A 2J3IA 3H18A 4F6LA 1Z18A 3WAGA 4LFAB 2OKGA 4ZDIA 4QGHA 2N0SA 3VBEA 1QG6A 3W2GA 5BQXA 3W9BA 3EGVA 1TAUA 1C3OA 1ZUHA 1A71A 2SHKA 2VYQA 3AV3A 1V5WA 3K1AA 3PQ6A 3L6OO 4HZUB 1ZVQA 4QBKA 5E0OA 1TYDE 2QL6A 3B1KA 3UOAB 4ASUD 4DJ5X 1OGYA 3KTFA 3FVTA 4AKIA 4X6UA 3ET4A 4NNOA 4TSFA 4YQEA 4XWYA 3AZOA 4XW2A 4EB8A 5DTIA 1PYOA 2B4YA 3EFHA 3U80A 3UPTA 1XTRA 2YY7A 2E37A 4ZMRA 4ZAVA 1KDYA 1ODFA 4MEAA 2H1IA 4Q3CA 4CIXA 4CLRA 1OAKA 2L0XA 3AFHA 3GLTA 1PGOA 4Q82A 4ZTUB 2PIAA 3NHRA 1D5WA 4XDZA 5LYJB 4MPPA 3VYTB 3H99A 5B3JC 3DOJA 3CISA 1SIWA 4R9NA 2VHUA 3V6LA 3QP9A 3RR2A 1O9GA 2ON6A 2WRZA 3G59A 3TLEA 4NMHA 4NCAA 4FYJA 1X80A 3ANXA 3GUHA 4LDZA 4YI3A 3TLZA 3S8YA 1YKFA 1GAEO 1QCYA 1Q7TA 5LLSA 3SJBA 5C5CA 4C78A 4LF6B 2W4IA 1T15A 1R3DA 2P2SA 1QZTA 5A62A 2GGSA 1I7QB 5K6RA 2FR8C 4JL6A 2I2CA 1IN8A 1P4HA 4KKVA 2GA9A 5KVVA 1U63A 4HWGA 5C2JB 1ODCA 2EP8A 2VZ0A 3P4YA 1UZLA 4P33A 2PBFA 5D7NA 3VR5A 4I4TF 3LOPA 1OLSB 1YAJA 4KIWA 3ZWXA 5JLAA 4PSCA 5E9QA 4YS6A 2XQKA 1ZUNA 4ND7A 2XZOA 4DV1B 3V2GA 3C8DA 2XRFA 5EPUA 3V7WA 1KVRA 1P0CA 3M6MD 3P9QA 1I01A 5D3QA 3BB1A 4C7OA 1WQ1R 3U16A 5CJPA 5EKSA 3C97A 3NDBB 3T4EA 4HAZA 2EGGA 3I62A 3RG2A 1RW4A 5IHXA 1RD4A 2B5OA 5ED0A 3GFFA 5CA0A 3RS2A 4BP9A 3KEMA 1R0SA 1ADJA 1CQZA 1FFDA 1ZY2A 2W8ZA 3DBLB 4OFXA 5B1DA 4AROA 3GLGE 2VNJA 3O3CA 4Z51A 5JTTA 5FTKA 3N7UA 4RXTA 4OJYA 2QR3A 2QMZA 2OBMA 4A16A 1PJLA 4YMGA 2C20A 4KDFA 2IS4A 1PFUA 1XCPA 1C41A 4EWLA 1P7ZA 4D80A 1WXFA 2V3CC 1GEEA 3IHLA 2GN4A 3PSAA 5FOQA 5KU7A 1CT9A 2OFXA 1YQ9A 4EARA 5KNBA 3SIPA 4MH0R 1V8FA 2NSLA 3FIJA 1S8FA 2NSDA 1TRHA 3HCFA 3RS7A 1ZRNA 1Q92A 5C7IO 1J06A 3OZDA 2C4UA 3UJBA 4EEKA 2WIKA 5EKXA 4YDRA 4DEYA 4M99A 1NE2A 5DEOA 5JZVA 2C0QA 1QJ4A 2HUNA 2DM6A 1IZ0A 2QP3A 2D8MA 1KK0A 2WM2A 5TX7A 3K9QO 1JXOA 3U7QB 3ZBPA 2P5TB 1USWA 9ABPA 1YZVA 4DV6B 1L4GA 1M1YA 2D1YA 4YIKA 4HY3A 2XEDA 3OQBA 2J3DA 2ZE7A 2WKRA 1RJFA 1BHQ1 1T91A 4KJZA 1J21A 1X42A 4R41A 3K6SB 4OQPA 4F8EA 3DPIA 1VIYA 3KEOA 3PB3A 7AT1A 1TZ2A 2BBSA 2G5GX 2P4UA 3GAZA 4LJSA 3IOEA 3LHIA 4PLCA 1KZHA 4I8IA 4AY2A 2J0QA 3IXMA 2GYWA 2B4AA 2OHHA 4Y6SA 3ZCUA 1OD6A 3G13A 4F38A 1LBQA 3CH7A 3CW9A 4YJHB 3S27A 4MCJA 5LWQA 4MS4A 1JFSA 4PZEA 5A06A 3A9WA 4RH1A 4HFNA 1FLAA 1NQUA 4IJWA 4ENWA 4U7WA 3J81A 1NJ5A 3OZGA 4G4SP 1D7OA 3K92A 4OHVA 4BMOB 3WNCA 3C6MA 2ZJ4A 1KGDA 3EXEB 1TF7A 2Z2YA 3DBOB 2BMEA 3GHYA 4M37A 4UPEA 3U1TA 1UQRA 3UMRA 4DM3A 1QORA 4NXMB 3JQQA 1RQGA 1TW3A 2WQ7A 4BV3A 2RD2A 3HL0A 4DC0A 2O8DA 1U02A 1E3WB 3HKEB 3OF5A 4O1HA 1WVMA 4OSPA 1JPJA 2CUZA 3G2JA 2E9SA 2G06A 4U3JB 2PVCA 3NEAA 1CRLA 3KSRA 1IN1A 3ETDA 1KYWA 4E30A 2V3VA 4MB0A 1LS6A 4MO9A 2EFCB 3G1WA 4UPDA 1V3QE 1QFZA 3EBLA 5MN6A 1XHLA 5FI5A 4HV4A 3D2BA 2VDUE 1SC1A 5ALUA 4HK4A 1QR6A 1JTFA 4ZI7A 2C42A 1K92A 1RFLA 1VGVA 2DFLA 2IY9A 4ZIRA 3AVYA 1NW3A 3ID6C 1V8DA 1M8KA 3PRYA 4XFDA 2EX1A 1DQZA 1GGKA 1QVWA 3CLUC 1LW6E 1SXIA 2R96A 4MICA 1XA0A 1N6NA 5AKGA 2DFVA 1KOJA 3E8XA 1QO0D 1ANKA 3JD1A 4WCFB 3VAYA 4D0NA 3SR0A 2H1HA 5ERGB 4XIIA 4BQFA 3SS8A 3JWJA 1PSDA 3C6KA 4NEHB 1WB5A 1W52X 4TRNA 5F78A 1HYGA 3QVLA 2AKEA 3LP6A 2VSYA 3ZWNA 3UJHA 4OMCA 3TW8B 1G60A 4EYOA 2HK8A 5C8YF 2FE1A 1I2ZA 1RYFA 1YS6A 2JJ2A 1QQ5A 3DT8A 4OUDB 4UPVA 1P2GA 5C4IA 5KC9A 4C76A 5KTPA 3DMRA 3NXSA 5CLLA 4AJ2A 1N6KA 2IOYA 4PEVA 5F7JA 1F0PA 4L8FA 5DNEA 1SG9A 1UKAA 3O8NA 3WL7A 2IE0A 1Z4PX 5JLJA 1LLFA 1IHUA 3LIPA 3VDRA 2FPSA 1I2DA 4NKRA 4EGSA 1GDHA 1X8XA 2Z04A 2WVJA 1NUQA 3BMQB 3FCAA 3OP1A 4AD8A 5A2GA 3Q9LA 1ZMRA 3C98A 3BAZA 1YZKA 3UJPA 4BO8A 3EJ6A 5DIZA 1E2LA 2P6PA 3TM4A 4EW2A 4N5IX 5B4VA 5FWYA 2JAWA 4ZREA 1EP9A 4QQKA 3EQ7A 2FN3A 4B73A 1QIDA 4R1SA 2JZOA 3A4NA 3GT0A 1NSTA 1YR1A 1YL6A 4KYIB 5KNBH 4LRQA 2JHPA 1CUWA 2AT1A 1L5GB 2ZS8A 3NYRA 3T3GA 3W79A 4WZZA 5K3OA 3LPLA 1JDTA 4X8OA 5DPMA 1CDDA 3PJGA 4IUBS 1H9AA 3RBVA 2PAFA 2UZ0A 2BFFB 4AXXA 5A4KA 3COPA 1USKA 1VG8A 3DHYA 1BHO1 3KB2A 3NIFB 4NYIR 4QX6A 3TZEA 3WWZA 4KYVA 4TYPA 4A8JC 1UDAA 1FYDA 2IDMA 3WSVA 3AKDA 4KSCA 5F51A 4KE6A 2MCFA 1DXYA 5LUAA 2IOHA 1JSXA 1WKBA 3N75A 3ZBTA 1WCIA 3EH1A 3S2IA 1D0SA 1G3QA 4TM7A 1B15A 2YRFA 4UZSA 3UM9A 3UPDA 4WHMA 3QWIA 3H9UA 5HKAA 3NFYA 4I9HA 1MPTA 1WZEA 4KFUA 1JR2A 4L8WB 1JJAA 1T9HA 1PVDA 2BKEA 1E64A 2ZBUA 3AF3A 3DLIA 4KFTA 3RIYA 4FYYA 4GYKA 1FMCA 1NMSA 3G5MA 3INTA 4LJKA 4CMBA 1DC6A 3BWEA 5KU1A 3NEYA 1JIVA 2YRXA 2KI5A 3QXHA 3H5OA 4U63A 5K0CA 4GWLA 4V0KA 2MSNA 4IV0A 4LCBA 1L4MA 5G3YA 5JH7F 2XJ9A 3A04A 5JDCC 3RNOA 4P86A 2V7QA 3PA6A 1I3KA 1OXKB 3EQ9A 3T0FA 4DCCA 4UNPA 5IS2A 3SJUA 2AOTB 2Q5IA 3NQ41 4QHYA 4XGNA 4ZDKA 1FX0B 4O8ZA 2A4MA 4ZEMA 3TFOA 5DRYA 4P81A 2I78A 3V8EA 1BEUB 3BMNA 2CZCA 3QOFA 3FNGA 2G6BA 3DOFA 5AK6A 5EI5A 3ZNNA 3EVTA 4F7DA 2HK6A 5L4LA 4YLEA 4OXIA 3EJWA 1Y3AA 2Q5JA 2N75A 5J2UF 1PGJA 3GNQA 4FW9A 2Q41A 2AJTA 2ZWOA 5H8WA 3WNBA 1JWAB 3QA3E 3UT6A 2JFNA 4WXYB 1ZOSA 3GUUA 5KNCA 5FB3A 3KHKA 3KVYA 3HCWA 3V4LA 4PHCA 5FL7D 5HSGA 2BGJA 3TAHA 4ZGWA 3HR4A 1RAAA 5ARCA 1M2VA 1NBIA 3FNIA 3P96A 4KL8S 4FZVA 3TJRA 5EL0A 1LJLA 2X8AA 3FHOA 5KMGB 3OX1A 5GADl 1E0KA 1RC1A 3KAQA 4EF6A 2V65A 2AHOA 3FWZA 2F3RA 4MULA 3CZMA 4IXTA 1WLYA 4P3NA 1PR1A 4PYLA 5GJCA 3EPJA 1ZJZA 5BNIA 5B58C 3U7GA 3EH2A 3R3SA 1M6VB 5AVOA 3AONB 3K7EA 1IL0A 1WOMA 2IYSA 2IYLD 3A1CA 4QQRA 3SSNA 2RHRA 4CIAA 1W9HA 4TKMA 5JFTA 5M34A 2G17A 5DN9A 3NVMB 3AJAA 1PQYA 2W70A 1JAXA 1AUPA 4RF3A 4DQXA 1VC2A 1WTAA 1WPGA 2AXNA 2OWEA 3IBFA 3N2EA 4YMHA 3TGLA 3V4RA 5BSKA 3V42A 1KIMA 1JEAA 1PW7A 4PINA 4ARZB 4PLYA 2FPMA 1XMJA 5EPOA 2COKA 3GVPA 1O8BA 2OXIA 3UENA 4B35A 1H0KA 1N1EA 1OWMA 3IEPA 1RHQA 4G1UC 3SBDA 4WESA 1JR6A 3C7TA 1FRZA 3OFNA 4BZWA 5HVNA 4YJGB 1B76A 1TT5B 2RGNC 2CDBA 1JG4A 4IDDA 3T52A 2PWYA 3CPJB 4O4LA 1N2OA 2OHJA 3NBAA 3TSAA 1XI2A 4EHFA 1TA4A 3ZWMA 5DULA 4M1WA 1KFJB 3ENQA 4ZT2A 1KPGA 1TO6A 3EZ7A 3I28A 2NO1A 2QZ9A 1ZBQA 4I55A 4LQ4A 3NC0C 2K4MA 3HLYA 2FZGA 2H7VA 5LPNA 1ZZEA 3KOWA 2UXDB 2BLLA 2O2IA 2VK1A 4X1IB 4DSAA 1EESA 2EZ8A 1E2EA 5AW7A 3WFZA 3RJ5A 1T8RA 2NU7B 4Z53A 4GICA 5BOVA 3CMCO 3RVPA 2O8VA 3VYSB 1C1XB 2W2XA 5E9AA 3UVEA 1C0IA 1YC2A 4F8JA 1DUVG 1RCTE 3M1LA 2HJRA 2ZETA 3IDSA 1SQ6A 3OTQA 2CBXA 3P97A 3PUXA 4WXRA 5F4BA 2VK8A 3ZHVA 5K01A 2KJQA 2P9HA 1JDBC 3LY9A 4K9SA 4HUQB 4LRSB 4MXDA 4UMEA 3G2QA 1UZUA 3NATA 2V5AA 4V0SA 2ZRIA 1QP4A 1KZ7B 5EMMA 3L02A 3CNBA 3TR5A 1M2HA 3TSZA 5F5LA 2QT9A 4YXWA 1WV1A 3RGGA 1QRDA 3DMNA 3RHFA 3RVLA 3L7CA 2D3WA 1DBRA 5F3DA 3W9SA 3WMRA 1LSSA 4RD2A 1JQDA 2HGSA 4L8YA 3BMOA 5KWSA 2XADA 1BYIA 5TVGA 3VPSA 3IILA 5BYAA 3C7KA 3PNMA 4MQMA 3GJRA 1A50B 4HYQA 1ORIA 4QPPA 1I1OA 2PUGA 3CX7A 5JW6A 4ZT6A 1P1HA 1X9IA 4RSGA 1BDBA 3T9FA 3FWHA 1FSFA 2WKSA 3H42B 4XGRA 4EI7A 5IABA 3R5XA 4FVTA 1OV4A 1SXPA 3TM5A 3N2IA 2DBYA 3R7FA 4XM1A 3HJAA 3OKAA 3SQXA 2JVIA 2C2WA 3MBOA 1GNTA 1S2IA 2BGTA 4HB3A 1VPEA 4OU5A 3CE6A 3LDUA 4RK4A 4UHJA 1CUDA 1FNCA 1PJRA 1Z08A 4P36A 2EKDA 3NETA 3OCWA 1KVTA 3SBOA 4OMFG 4PLFA 4ENSA 4Y9TA 3FYUC 3EVEA 2QK4A 3EF3A 4YJ2B 3K5PA 1Z5NA 2O5VA 2VHVA 4EQ6B 2C7OA 3LGAA 2FEAA 2BC9A 4HXYA 5BRJA 1QHGA 5HHTA 3MSCA 3IQEA 1UM9B 5K3SA 3ROEA 3UC9A 2PD6A 4AG5A 5DNUA 3VOAA 5KNCH 3E7FA 4RJTA 1GPYA 4M0UA 3PC6A 3HYRA 1FP4B 2AZ4A 4DCSA 4E7OA 2X1VA 5BUZA 4FFLA 2WU8A 3HQ4O 2EV9A 5DGHA 1DCMA 5DCLA 5IAOA 4LZWA 2QM0A 2QTFA 1GU0A 1H1LB 2I6SA 1UUFA 4YMIA 3V1MA 4CMCA 1B74A 3MTBA 4H1UA 1MV5A 3LKBA 3ELDA 3PTLA 4C20A 1PJBA 5EZYA 4A23A 4B6SA 1F51E 1FW8A 2LBPA 1J9ZA 2ECQA 2QENA 3HO6A 3R7LA 1A88A 5KDOA 1UFKA 2DWQA 4KBGA 1P8JA 3O47A 3D7LA 1QG0A 4Q4JA 1X7XA 2BVNA 2XGOA 1NM5C 1O6GA 4RFVA 2YXPX 1YBAA 4G2TA 1CUBA 2XVAA 3JAMA 3DZCA 2NXCA 1UXIA 1V3UA 2AFIA 1SBZA 2FFJA 2H54A 1X87A 3EQ8A 4M0FA 5LQMA 13PKA 2PZ8A 2VJKA 2XKAA 1G6OA 2PZFA 4OP2A 7MDHA 3SY8A 4JLPA 4UUBA 3SYLA 2G4LA 1KAOA 3WR5A 4BBZA 3HZRA 3NZEA 3S4YA 4DIDA 3OKCA 3PNVA 4LCJA 1HY3A 2BEKA 1P2UA 2B9VA 3K09A 3Q8XB 4NLLA 4TT3A 1PDWA 4Z54A 1G21A 2OENG 4UQPA 2OZPA 3FHLA 1G9TA 2J5XA 3HKDA 4BZPA 3KX2A 3E9CA 1HYBA 2Q4BA 3G0OA 5ILGA 5L7WA 1RZRA 4WNAB 4F4CA 3D0QA 3D6HA 4HRVA 3ZBUA 3OE7A 4F3CA 3PNYA 4PZ9A 4JR1A 3KBOA 4QYWA 4AUEA 2VHWA 3C5CA 3ANSA 5GIOE 3DOCA 4CQLB 3QXJA 1O6ZA 4IQGA 3CUYA 3GMIA 4QOIA 4N49A 4MB2A 1I6KA 3EFOB 3LM8A 5B3LA 3B2EA 4E12A 2GM4A 1DTSA 1CJTC 2DKFA 4C43A 4RTPA 1CUCA 4MIEA 3WE7A 3LF2A 2G1PA