2PLRA

Crystal structure of dtmp kinase (st1543) from sulfolobus tokodaii strain7
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
212
structure length
212
Chain Sequence
b'KKGVLIAFEGIDGSGKSSQATLLKDWIELKRDVYLTEWNSSDWIHDIIKEAKKKDLLTPLTFSLIHATDFSDRYERYILPMLKSGFIVISDRYIYTAYARDSVRGVDIDWVKKLYSFAIKPDITFYIRVSPDIALERIKKSKRKIKPQEAGADIFPGLSPEEGFLKYQGLITEVYDKLVKDENFIVIDGTKTPKEIQIQIRKFVGELIDNSF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable thymidylate kinase
publication title Crystal structure of dTMP kinase (st1543) from Sulfolobus Tokodaii Strain7
rcsb
source organism Sulfolobus tokodaii
molecule tags Transferase
total genus 86
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2007-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2plrA00
3DO6A 3TR0A 4AD8A 2AKYA 2HT6A 2JGNA 3OFNA 4YQFA 1U98A 5TVKA 5AUOB 1ZYUA 2VP4A 3HYTA 2IYXA 2ODWA 1DAIA 3TUZC 3VAAA 2CE7A 1Z6XA 4TSFD 4IHQA 3PEWA 2D4HA 1HT2E 1G5PA 1UKZA 1E2GA 1TQDA 3FKSA 5HKKA 2E1RA 4XSGA 2OHFA 3SR0A 5G3YA 2Q3MA 2CVFA 4X8OA 3BFKA 1OIVA 3AP2A 2WSSA 3BB3A 3HDTA 5FTNA 3K1JA 2EFGA 4RZUA 4CRWB 3KB2A 4DRZA 4WW0A 2BEJA 1IXRC 1AGRA 4I1UA 3EPJA 1ZUHA 3QE0A 4E03A 2J7KA 1W36D 4ZCMA 4US2R 1VECA 2NOAA 2OILA 5ELXA 1ZD9A 3FGNA 4MRPA 4ZIRB 4PC1A 2QSYA 1NY5A 1E2LA 1OXUA 4PO1A 5FUYA 4RD0A 5L3RA 4DIDA 4HUTA 1D9XA 2Q9BA 3H4MA 2WIBA 3A6PC 2QSZA 2QRZA 3LX5A 1EESA 1W4AA 1T91A 1WP9A 1G17A 3VR4A 4EQ6B 1OB5A 5HKKD 4B35A 1E9CA 3IEVA 3ZVMA 1QHSA 5EE3A 4M22A 1VTKA 1KDRA 5CM9C 4OI0A 2QORA 4QM7A 3BGWA 3JVUA 2CBZA 5EE5B 3LLMA 2AWNA 2WJYA 4GZLA 5SZHB 4V0MA 2RHDA 3KKMA 4LHXA 1VYTA 5TB5A 1OXTA 1DG3A 2GF0A 1CJUC 3DKPA 2XZPA 2BCGY 2BBTA 4R9UC 4D4KA 4A0FA 2BEKA 4EJSA 2CL7X 2HXYA 1XTKA 1HH4A 1Z06A 2BIFA 1G7CA 4JT4A 1TUIA 1EFUA 1U99A 5LDDC 2F3TA 2ODNA 1N25A 2O8EB 1XFAA 2ZRHA 1Q12A 1EK0A 1KJYA 1SGWA 2ZANA 2NG1A 4AC9A 4LPKA 4AYTA 4DLTA 1RRCA 4JLMA 5DISB 4D80A 5DYGA 2WWYA 1YHNA 2W0MA 4NDZA 3BH0A 2J1LA 3GLHA 5GJBA 1OYYA 2ANCA 2WOJA 1NLYA 3QXSA 3QF4A 3P20A 4URXR 1SULA 2FGKA 3BE4A 3MLEA 1R0ZA 1NJFA 3HYRA 4NKRA 3KKOA 5HE8A 1OE0A 4YXWA 4IEIA 1BS1A 1SKQA 3FKQA 3QJYA 2WTUA 3QKRA 5JJIA 2QA5A 1CEEA 1NBMA 1KNQA 3NBXX 4PC7A 5EE0A 5KNDA 2ODBA 1G16A 4HB3A 2WMNB 1DO0A 2VSFA 2ZSEA 2C9YA 3LAWA 3K0FA 5FOVA 4B74A 1I2MA 2UVQA 3K09A 3U7GA 1KJWA 2GXAA 3BFVA 3WXMA 2C9CA 1TQ6A 1G5RA 1E9EA 2PCJA 2VHUA 2ZI7A 3OHMA 2ZE5A 1JNYA 1KSGA 4FIDA 4TTQA 1E2MA 2IS4A 1KI6B 1ZP6A 1QRAA 2EW1A 4ZDIA 3AVXA 1IN7A 4KVGA 2QAGB 5JI3E 4OYHA 1KY2A 3IGFA 3CRW1 2OG2A 1VPLA 1D9ZA 4DJTA 2ZRKA 2C5LA 4DLXA 1KO4A 4HUQA 2VF7A 4TMWA 1EFCA 4KBGA 2AR7A 3H1TA 5L3VA 1BMFD 4LCBA 4V0OA 1KTVA 3L43A 3PVSA 1QHYA 1CULC 1P62B 3X1WA 1GNPA 4GDFA 1J90A 2YC2C 2BWJA 4HI0E 4I1VA 3ETLA 2FV8A 3K70C 4B76A 2MMGA 3ADCA 1DAHA 3A58B 3U5ZB 5JJLA 4B2PA 2NIPA 1Q3TA 2D7CA 2ZU6A 3N70A 1W0KD 4M4SA 4QL3A 2KB0A 4RFSA 2F7SA 2V8OA 3WRYC 4B32A 4KFUA 4L4UA 1X8KA 4TWZA 5HCNA 4B6FA 4BFXA 4QGFA 3SS8A 3U60B 3AVWA 3LD9A 4IFEA 1P72A 1Q22A 4BUJA 4OL0A 4KYIB 1N6LA 2ZS8A 4DWJA 2CHVA 4TZ6A 4AYXA 1G4UR 2RGGA 4L5BA 5IF9A 1E0KA 1OV4A 2QU8A 3HU1A 3A37A 2QNRA 3MGCA 2Q21A 1EFTA 1EFRD 1RE0A 3TH5A 2CK3D 1NG9A 3HR8A 3RWMB 1NVXQ 2REBA 2XTZA 4Y0VA 1JXOA 3X1ZA 2UZIR 4LYFA 5H1YA 1COWA 1MRSA 1YRAA 2P5SA 1TL7C 2ZE7A 1Q21A 4GRAA 3SZRA 3KQNA 4BRUA 3IO5A 1H8HD 2FA9A 4D0GA 4RJLA 5F98A 5AUQA 4C2UA 221PA 5DSZA 5AJWA 1N3BA 1E9AA 1Z29A 1XBTA 2EWVA 2G77B 2ZPTX 2VHCA 4TMTA 3ND9A 1C9KA 4MUAA 4NE2A 1OIXA 3MWLA 5J40A 3QY0A 4YONB 3A4LA 4YDHB 1HQCA 1JI0A 2ZIAA 3TAUA 1OB2A 4Q18A 3Q3JB 1J8YF 3MCAA 3B13B 1ZCBA 4D0NA 2IYWA 1MRNA 3EPKA 4OHZA 1N6IA 2VHTA 1NN1A 1UJ2A 3Q5EA 1ANKA 4QBFA 4IXNA 3GLGA 2ZR9A 3U7FB 5FPYA 1CP2A 3CONA 4M1TA 1LY1A 4Q1EA 1W7AA 1E2KA 4RZXA 4CEJA 2DBYA 1NIJA 4OQLA 3SEAA 3OAAA 2IYLD 1ZM3A 2ONKA 5AWFC 2IYYA 4YMTA 2A30A 1P2UA 1KI9A 3D8BA 1NKSA 5K8LA 2RHMA 2C99A 2JATA 4S2EA 2FG5A 4LJYA 2X77A 5JECA 2QT0A 4M1OA 3UXMA 1M7GA 3RS2A 1MT0A 4BFSA 1F2TB 3RS3A 4FI3C 5TARA 4Q19A 4JKIA 2J0VA 3WY9A 4IVPA 3Q72A 5BXQC 3GCGA 5D3MA 2VP2A 4IOKA 3HP1A 3CWZA 1RKBA 1CR0A 4UXHA 5B58C 3W6OA 5G41A 4F92B 1ZM7A 3G5UA 3TQFA 1HUQA 1Q1EA 3BXZA 3EIHA 1D2EA 1E1RD 2B8TA 3PEUA 1KO5A 4NCHA 1GFIA 3UKDA 3VR5A 4HAWA 2ZAMA 4P4UA 2H92A 3CPJB 3IPXA 2GCPA 4JLAA 3KQKA 2PZEA 2QGNA 3EWAA 3I3SR 3PEVA 4PZZA 4BWYA 1ZAKA 2OLKA 3R8FA 3W5IA 1VCMA 4QHTA 2FPMA 2BMEA 2YWFA 2O8BA 3GJXC 2WJGA 3DKVA 1WMSA 1M2OB 2IUSA 1P9WA 4NYMR 4C3ZA 4PQRA 2KSQA 3KKQA 2R6GA 4HB2A 4UQOA 5E7JA 3FE2A 4YLGA 2WJJA 2OM2A 2EU8A 2ZSFA 4CT4B 4LC0A 1EX7A 2MSDB 3U44A 1ZM4A 3D6TB 4MRVA 4Q7JB 4Z54A 1ZD8A 1Q1ZA 3KQHA 2ZRJA 4K46A 3J81k 2OZEA 4FWIB 3BD9A 2YOHA 2JDID 2GILA 2J0UA 3ASZA 2J3EA 3RS0A 2JLZA 1WE2A 3PUWA 4D82A 1IN8A 1D6JA 2A3RA 1LF5A 3VR3A 4D0LB 2WVJA 3EG5A 1IBRA 5FPSA 4B3XA 3SFZA 1J8MF 1LTQA 4ARZB 2AD1A 3N2IA 3Q5DA 2PMKA 4I4LA 2E9SA 4MGIR 3MJHA 3AF1A 5JSZB 1KDTA 4DDVA 3BWDD 2ZJZA 2QTVB 3PQCA 2OFOA 4D81A 5J4LA 3RSLA 1FX0B 1XCGB 3CRMA 4HZIA 3LQRA 2OLJA 4ZDKA 4M9ZA 1I4DD 1DAKA 3IKJA 4W5HA 1KZ7B 3PR1A 1C4OA 2ZYUX 3EC2A 1BYUA 2PH1A 2KJQA 2ZETA 4LDJA 4LC1A 3GP8A 4P3YA 1N0VC 2R6FA 5A4JA 4LHVA 3A1TA 4JT2A 1A2KC 2OAQ1 2AK2A 2DYKA 2KE5A 4GOKA 5FI1B 3WRXC 2D2FA 2KBEA 1U0HC 2IUUA 1KJZA 3LQQA 4RKFA 2PX3A 4HEJA 3KTAA 1T8TA 4CW7A 3B1ZA 3U3RA 4NYMQ 1WQ1R 4LHYA 4ASUD 1VG0B 3AKCA 1A4RA 4V0LA 4I1SA 3BS4A 5FR2A 3NHAA 1HE1C 5P21A 1GZSA 4Q1BA 4Q4HB 1KSFX 5CB8A 1PZNA 4F4CA 3KKPA 1T3LA 4JYCA 1Z8FA 2QEQA 2ZRMA 1K8RA 2DFTA 2XJ9A 1SVIA 4QHSA 4Q4JB 4OQFA 5FBWB 4DEXA 1E9SA 3U4QA 3CNNA 3RAPR 3CF2A 5JS8A 2NO9A 2QE7D 2OFXA 3NKVA 3THWB 1Z47A 3CX8A 4IFBA 1D5CA 5HPYB 3NHBA 4AKIA 3CR7A 1QG2A 3KJEA 5DN6A 1SXJB 2EWWA 1XMSA 3F8TA 1OPXA 2OCAA 4C0AC 3UMRA 1Z63A 1CTQA 3DVLA 2QTFA 3AGQA 1GSIA 5CLLA 4LJ6A 2WKRA 1RJ9A 2RGNC 5HZKA 3E5HA 3AGPA 2ODEA 2JAQA 3BRWD 1MABA 3AH8A 3KB1A 5JSZA 1VG9B 4NCNA 3T1VA 4URUR 2BKUA 3IIMA 3QF7A 3BFXA 1IY1A 4XD7A 1DS6A 2XNDA 2FFBA 1XWIA 1E94E 3W6PA 3IPYA 4ZCIA 1XB2A 4UNQA 4M21A 3ADDA 3BB1A 3W3ZB 2VA8A 3PITA 4KHZA 2NPIA 1OJLA 2J5XA 3CNOA 3AF4A 3QIAA 5CJ2A 1JEEA 4D4LA 5EP3A 2FEOA 4TT3A 4KLNA 3TUJC 3B85A 1T3SA 2G6BA 4A2PA 1KK1A 1T8UA 1G3UA 2G83A 4QBGB 1YJ5A 5AJYA 2JA1A 2ZU0C 1RFLA 1KKMA 2QMOA 2PJZA 1W1WA 2QY9A 3CBQA 4LY6A 2C96A 2HV8A 1M74A 4CEHA 3SYLA 3A36A 3L82B 3VU9A 3K9NA 2ZRCA 1TNDA 2ZYTX 3DMNA 3NXSA 3KZ1E 4RZ3A 4BEBA 3W5JA 1II8A 1K6MA 3B1WA 1OHHA 4CEIA 4XTCS 5GJCA 4QNMA 3THYA 3G82C 1OXXK 3K0AA 4PC3A 3GJ6A 3TNFA 1E4VA 4AI6A 1G41A 3LY5A 4Q4HA 1VYVA 1XP8A 3AVOA 5KTYA 1P7CA 1XTIA 4Q9LA 1W36C 1HYQA 1IM2A 3LBIA 1AGPA 4QHYA 1KMHA 5FBQB 5L3QA 1N5LA 5BN4A 5EP4A 2BMFA 5CITA 2GRJA 1NI3A 4KFRA 2N42A 5CK5A 5J47A 3I61A 2WWIA 3ONWA 1KY3A 3EXAA 2ZRBA 5KDLA 4ZKEA 4OI1A 3LO5A 4NHOA 2JLUA 3OE7D 1KOFA 1W0JA 3QENA 2I1QA 1G8GA 3LWNA 4ZKDA 4FMDB 1KO1A 2LKDA 4GSYA 3LVQE 4UNRA 4TYQA 2IYQA 4X8HA 3DOEA 2OXCA 5JS7A 2XJ4A 2A5YB 3WBJA 3P4XA 5E4FA 4HAXA 5SZIA 5CYPA 3AM1A 1WRBA 1U9IA 3RYTC 3U3JA 4E22A 4LGMA 2SHKA 2PEZA 1Q57A 3U7EB 4Q5IA 3U3OA 4PHHA 6Q21A 1XTJA 4B75A 3I5XA 5CIQA 5LBIA 2WKQA 1L2TA 4RVCA 1G6HA 1SXJD 4JLVA 5BWMA 2O8DB 1YZKA 2KI5A 2A78A 2ATVA 2CEAA 1IAQA 3QXJA 3AP3A 2FH5B 5CM8B 4A1FA 5JBQA 4NPHA 1XZQA 4BFZA 3AVYA 3KQLA 4LX0A 2HYIC 3NC0C 3VQTA 3TE6A 1F2UA 1FNMA 4TZ0A 3ZDQA 2R6AA 2V1XA 3FFBA 3M0EA 4IDPA 3TBKA 4C0JA 2J7PA 3IQWA 4EPRA 1N0UA 3CPHA 2H18A 3W6NA 5DI3A 2H16A 1UDXA 2FX3A 2VYFA 1AS0A 1KZGB 1QHGA 4LV8B 4C30A 2P2LA 4MGYR 5FBRB 4OQNA 5B30A 4MYHA 1CRQA 4LJ8A 1VMAA 3B82A 1KYIA 4PO8A 3ZVRA 4HB4A 1GIAA 4LBYA 3I8SA 2DHRA 1E1QA 2GCNA 3EIEA 1T6NA 1S1CA 3DMDA 4MQBA 3B9QA 4LRWA 4OJKA 1BYIA 4C9BA 4DLZA 2WAXA 2CXXA 1S4QA 2N46A 3F5FA 4KITB 2JJ1D 2QMEA 1G19A 2ZI6A 4UJ3A 4IDOA 4E07A 3L0IB 4RKEA 5F9HA 1W46A 1DG1G 1BH2A 4IOMA 1YE8A 3ZGXA 2QPAA 3CX7A 1PJRA 4G5OA 1B23P 3CH4B 3FMIA 5TDHA 5KSOA 3BBPA 1Z0DA 5LD2B 1CR4A 4MUBA 4QKQA 2VO1A 4RD3A 3R9XA 1MV5A 4Q1AA 2VHQA 4NH0A 1GKUB 2RGBA 2FDCA 1E79D 3ZIAD 4NCJA 1KK3A 4JLNA 3VR2A 5HE9A 4ERNA 3OIUA 3C15C 1GG2A 1XCPA 1NLZA 1ZBDA 1N0WA 5IRCD 4DSUA 3KDSE 1S8FA 4MRNA 5FTKA 1UBCA 2ZRNA 1XPOA 3FWYA 4B71A 4EJSB 3ZVLA 2PZGA 4ABYA 2V7QA 4GZMA 3B6EA 1DVRA 5SZKB 1PLKA 3ZZ0A 4C4PA 5IHPA 3AQ4A 1EG7A 1OFHA 3A8TA 4LSGA 3BAFA 2G0NA 1L4UA 3BORA 4HLQB 4PO9A 5DIFA 8OHMA 1IN5A 1YU9A 1H8ED 4C0LA 2GK7A 3EARA 2EFHB 2IXFA 1YZLA 1WBBA 1OKKD 3GLHB 1SXJE 1ZRHA 5KU1A 1BOFA 4URYR 3QF4B 3VR1A 4DSOA 2HF8A 5EP1A 1OH7A 3P32A 3SDZA 5KNCA 4JS0A 4QBIA 4Q47A 5IK2D 2GWHA 1NLFA 1CJTC 3RC3A 2IL1A 4IKEA 4JLPA 3QKRB 1OXSC 4LZZA 1XZPA 1O87A 3TIFA 1BKDR 1JPNA 1NVVQ 1II9A 3DEFA 1NMZA 2ASEA 2V6IA 2XOKA 3OFND 4GBMA 4DLYA 4TYNA 1UKYA 3K0FB 5CLQA 1N6RA 4IVRA 4L16A 1MKYA 2NO6A 3WMEA 4DCVA 2FSIA 1R0XA 1R8SA 3PUZA 2RGCA 2IT1A 4JSTA 4X8LA 3RC8A 4IJMA 4ESHA 3T12A 2W6JA 3ZS9A 3FKSD 4WZAE 2CHGA 4K8OA 1E2PA 3ZD6A 2O0KA 3PV0A 4D26A 4EDHA 1JBKA 2ZQ5A 2WSSD 2FMXA 2H5EA 4NCIA 4FMDF 4P4SA 5TY0A 2CCJA 5IDVA 2LKCA 4ITRC 2C95A 4HUQB 4N1AA 1U8ZA 2V9PA 4KODA 1NMYA 4K81B 3SNHA 4TL8A 1LW7A 2D2EA 4AG5A 2JCSA 3OESA 2BMDA 1Q44A 2GJKA 4EFMA 3F0TA 3K0CC 4C2TA 4HDQB 4LK2A 2BMJA 4RCYA 5CDFA 2ANBA 2ZJ8A 2QAGC 2CCGA 4IOJA 3VFDA 1YRBA 2VTKA 5KOYA 4P0TA 1P75A 2R6CA 2AX4A 2ZRGA 1KO7A 1NVWQ 3AVPA 1W48A 1AQUA 4MKIA 3EAQA 1AZTA 2GAOA 3SC3A 3TLXA 4RFSB 5BN3A 4A36A 2H17A 3KJHA 4UNNA 1E2HA 4PHTA 1OYWA 2VSXA 4NL4H 4JJZA 5K8UA 4HLUC 2GZDA 3T06B 4GT1A 3HWSA 2HJVA 4DLVA 4QOSA 2IWRA 2Q3HA 1Q0UA 1JALA 3QQ5A 4HATA 4B34A 1LV7A 4HB0A 3I8XA 1QHHA 4PC6A 4B3CA 4LJAA 3UMFA 3JZMA 1E98A 2CHQA 2P6NA 2IS1A 5EUQB 3C14C 1RRFA 4R7ZA 4OJQA 4Q1DA 4OHWA 4FWTA 3O47A 2ONJA 2BKEA 2R65A 3B9PA 1Z0JA 2OFWA 3LFUA 1A7JA 4JBXA 4Q21A 2QBYA 2DY1A 2ZXUA 4BFUA 1VG1A 1P4SA 3A1SA 3HR7A 4V0NA 1S1MA 1GAJA 4IOLA 3WP1B 3C5CA 3EA5A 1BIFA 2L0XA 4WXRA 2ZREA 2QUZA 1W4BA 1Q1QA 1XMJA 1XXHA 3ZZTA 5FPHA 3CLVA 5FUVA 3ADBA 3NDBB 1RZ3A 1Z2AA 3TK1A 5KUTA 2JLVA 1T0JB 2IS2A 2R62A 2OE2A 4TQAA 1NG1A 4YXWD 4M1YA 1KI4A 1E2EA 4TLBA 5JI2E 1T5IA 4A4DA 3CKLA 1NBMD 2A9KA 1P5ZB 5SZJA 4BZQA 5GADl 2XGJA 3NC1C 5EXPA 3SBEA 1CKEA 4NYJQ 1E9FA 4JYBA 3TSZA 5KDOA 1Y63A 3GLGB 1G3QA 1G3MA 1TPZA 5G40A 4U7DA 4MH0R 4RD2A 3T61A 2YC4C 3D31A 1XNJA 4B3BA 4U5XA 2HT1A 3OEHA 2ZE6A 4ZI3A 1LS1A 3H2YA 2VBCA 4CEJB 4HAVA 4AY2A 2GBLC 1M8PA 4M53A 3ADKA 4LBWA 3VNVA 3QPUA 2FFAA 1ZNWA 4BLQA 2YYZA 2ZITA 1Z6YA 2I3BA 1ELOA 5UKDA 3AF2A 3T1OA 3W9YA 2WPDA 4BEJA 4EFNA 3KJIA 4KBFA 2HCJB 2JJ2A 1Z0AA 1N6OA 1AM4D 1XU4A 2WM9B 4A2QA 5FBVB 1UKEA 1PVOA 1CS4C 1N6NA 2PMDA 3BH7A 3IILA 2RGXA 4YDSA 5D3MB 1GDDA 5FPKA 3LBHA 3B60A 1US8A 4BFVA 1DAMA 1IOZA 3ND8A 3AF3A 3U3KA 1ESNA 4QXAA 2DR3A 1GP2A 1QZXA 1XCMA 1KMQA 1P9NA 4KAXA 4NCKA 3TVDA 2XXAA 3VKGA 2YZ2A 4PHFA 1E3MA 3I4LA 4OI2A 2GCOA 2IYSA 2NQ2C 2HJGA 2VF8A 3PG5A 2C03A 4KXFB 5FOTA 4XVUA 2FN4A 2ZYWX 4UNPA 5F2EA 1UBFA 5EE9A 5TV2A 3KQUA 1YR9A 5E7IA 1G6OA 3O8CA 2GTPA 4YMUA 2AFHE 1NJGA 3WYGA 1Z0IA 4V0ME 1E2NA 2QPTA 1TMKA 2FGJA 4HZUA 5EXXA 3RRZA 3D3QA 4BRWA 2OV2A 2X2FA 1NF3A 1NRJB 3R20A 2B7CA 5KO2A 2O8BB 5DNYB 4MDEA 4Q01A 3QVVA 5FL7A 4BPBA 4EPXA 3H0KA 5GJVC 3V00A 1CRPA 1COWD 1FL9A 2QL6A 2XSZA 3L8ZA 1W2GA 4DUGA 3U44B 2OSBA 3FHOA 3U2QA 1UM8A 4ACAA 2Q0HA 3AVVA 3T1QA 4U00A 2FNAA 2J0UB 3GLHE 3P26A 3SJZA 3TW8B 2A5DA 3DHWC 2ZRPA 4LJ7A 4QGAA 2QROA 3K70B 3TR5A 5C4MA 2DB3A 2CJWA 2PZFA 1XEXA 2Q6TA 4TQ9A 3WBKA 4OHYA 3GJ5A 2H57A 3EZ6A 3CO5A 5KNBA 1AKEA 3IIJA 5FOUA 4XWOA 2GVDC 1NBME 3V4RA 2OAP1 2CL0X 1WBDA 3GEIA 3X1DA 2CDNA 4HLUA 3CUEF 4F91B 2ZTSA 1XJQA 1FTNA 5G3ZA 1OW3B 2IYTA 2XZLA 4BECA 4PPGA 2HYDA 1ZINA 3KX2A 1P60A 2GEVA 1H65A 4H1VA 3GLFA 2E87A 5AJVB 1XMVA 3QPWA 1TF7A 2DFNA 2W00A 4M2LA 5E95A 2O8FA 4MYCA 2UZ3A 3OAAD 3KFXA 4DLWA 3H84A 3X1XA 1QG4A 2QM8A 1DBSA 3EX7C 4B47A 4CGZA 2QP4A 2REOA 3I5YA 4G1UC 2BBOA 3FTQA 1CXZA 1S9DA 4OQMA 4ZCLA 1JB1A 1J2JA 1SHZA 2HLDA 3E2IA 4FN5A 3OEEA 5EQTA 1EFHA 1ZIPA 2P5TB 2WJHA 1KHTA 3NEYA 2WSMA 4DEYA 3KTAB 3FHTA 4P33A 4IDHA 3TVTA 4BQSA 1P2TA 4B48A 1W44A 5KYKA 4OHXA 4A0HA 3AKYA 1W2HA 2ZJAA 4MDFA 2RCNA 3TQCA 3QPVA 4DCUA 3LA6A 5DGXA 4DSTA 2RKOA 1PUIA 3UG7A 4JBWA 2O8CA 1FPMA 1WA5A 4BLSA 1XD2A 2X19A 3U4QB 1QVRA 5DO9A 2F1HA 1KIMA 2FZLA 3AB3A 1E99A 2DFKB 2R44A 3PUVA 5J4KA 3RANA 4D2IA 5DH9A 2PLFA 5F9FA 4JVSB 4Q1FA 5CIWA 3U6BA 1JAIA 2Z83A 4O2LA 2GBLA 2VP6A 2ZRLA 3FMPB 4FCWA 4O0MA 3FHCB 2J0SA 2NMVA 2IS6A 3AVTA 1RC8A 1G5TA 4Z8YA 4DC9A 3CIOA 1RJ9B 1ZM9A 1VYUA 3B1YA 1MABB 3RVBA 2ZJOA 1GUAA 1RVDA 2FF7A 4M8NE 2W6IA 2F55A 3GMTA 1R0WA 2RH5A 3EZ9A 1SXJC 3EPLA 1GL9B 2VRWA 2WMOB 2QP9X 3EASA 4DT1A 4P4TA 4O3MA 3IEUA 1LF0A 1MR3F 2P6RA 4JLOA 4EPVA 1N6HA 4QJ3A 2GAAA 1IONA 2WZQA 4JKYA 4B73A 4PHGA 1CBUA 1FTSA 1YZUA 3NH6A 1IY2A 5FOXA 4HAZA 1AQYA 2HXSA 2P3SA 2RAPA 3I32A 1TX4B 4Q48A 4NYIQ 2LWIA 5JMTA 4DBLC 2W2XA 2ZS7A 2EQBA 4DIEA 4BE7B 4DVGA 2V6JA 3NDPA 4CEHB 1TEVA 3HU2A 3VU9B 3UATA 4DKXA 1ZW6A 4PAMA 4DSNA 1VKJA 2GJSA 2NZ8A 2RGEA 2H1LA 5EZ5A 3WYFA 2OBNA 1YZQA 2GKSA 2XTNA 1SVLA 3GLGE 1JPJA 5CJPA 3LW8A 3SOPA 1E2QA 1F48A 1II8B 2CNWA 1OIWA 2ZUDA 3A1UA 4FCVA 2WBLC 4CEIB 4C7OB 4B33A 5BN5A 3X1YA 3THYB 1CJKC 2HEIA 2WWGA 3K0AB 3GJ0A 4YMVA 1CLUA 3RRNA 2R8RA 1FQJA 4A6XA 4LBZA 2WWWA 2YOFA 4A8JC 1BO6A 5LB2A 5KDDA 621PA 3DDCA 1KMHB 3BC1A 5L3QB 4DDUA 4LOAA 1UBGA 2C04A 3Q7QA 1AKYA 4KLZA 5L3SA 3SQXA 5HTKA 5E3HA 4TMXA 4ACBA 5A0FA 4JL6A 3QSYA 5KPJA 1KI3A 2J87A 1EGAA 3DZ8A 1R2QA 3HPRA 4LI0A 1S96A 1MO6A 3QUSA 4S35A 2B92A 2ATXA 2A7QA 2G1KA 2BVNA 2C98A 1Z22A 5JHGB 3GLFE 3QBTA 1SHKA 1FOEB 1A2BA 4PPNA 3FMFA 2GESA 2RB4A 4JLJA 1LB1B 4DXAA 3IBYA 1RIFA 1NP6A 1GOTA 4A9AA 4W5JA 3TUIC 2NPFA 1FUKA 1XEFA 4OHVA 1T3HA 421PA 1HEIA 4PZYA 3H86A 1Z83A 4BZPA 2OESA 4DCSA 1XMIA 1JR3A 3OF5A 4GP6A 3AEZA 3T35A 1O3YA 2VP9A 2D62A 5D3QA 1N2CE 3B2EA 4MGZR 1HQYE 2BM1A 4LHZA 1G64A 4OKSA 2WWXA 4B3FX 4F93B 3W8NA 5DN6D 1SVKA 1JECA 4B2IA 1GM5A 1IJFA 2WJVA 2ZROA 2IBMA 4KFSA 1R10A 2V1UA 1VIYA 721PA 4IXMA 3GFPA 1F2UB 1R5NA 1U94A 4EUNA 4ZO4A 3IHWA 1XD8A 2H7VA 1F5NA 4XD7D 3K8YA 2XNDD 3QKSA 1E32A 1J99A 3JZAA 4PAOA 3ASYA 1LS6A 5L8VA 4C7OA 3C8UA 1DADA 1E2JA 1ZNYA 3UMSA 1R7RA 1Z2CA 5DI3B 2BJWA 2MSEB 3LDAA 1MH1A 3O8RA 4GI7A 3WMGA 4LJ9A 5TXGA 4KSBA 1P2VA 3LXRA 1AK2A 4NMMA 1T0HB 2JEOA 4LYJA 1EXMA 2X8AA 4OK3A 4TT3D 1R0YA 4M9XA 2O0HA 2IYRA 2GXSA 3CF0A 4JZKA 4GPTA 1FZQA 1P2SA 1N6PA 3IUYA 2C9OA 1ZNXA 3IBGA 2JLRA 4XH9B 4CT5A 3SFVA 3GLIA 4EAQA 4Q1CA 5DLQC 1P61B 2H8KA 1E4YA 4XWAA 1I4LD 1FMLA 1ZIOA 1K5GA 2XX3A 3FVQA 3MMPA 4Q7MB 1CF4A 1OHHD 2WIAA 4G5RA 1HA3A 3EC1A 1Q1BA 3KKNA 1GITA 2IHYA 5LPNA 4TMVA 4LWZA 5BW8A 5CK4A 4GNKA 3THXA 1HY3A 3C5HA 4R98A 2ZAOA 3PJRA 4A92A 1LFDB 3GEHA 4US0R 1OFUX 4P32A 3L0OA 3QI2A 5KSYA 3LNCA 2IF2A 2G1JA 3Q85A 3T5GA 3B1VA 1D2NA 1MO4A 1N6KA 1QVAA 3B1XA 2FE4A 3A1WA 2D7DA 1XPUA 4DDTA 1DE0A 4H9GA 1W5SA 2ECKA 2OCPA 1A1VA 3E1SA 2ZS9A 5GVSA 5LD2C 4LBVA 5JZVA 2IW3A 1VG8A 1W0JD 3CR8A 4KCGA 5J4HA 2JIZA 4ILEA 1G8PA 5AUPB 1GNRA 3CNLA 2IYVA 3BJIC 2Z5FA 3EZFA 1FNNA 3NWJA 1GVNB 2ZM5A 4NU0A 4DLSA 2AWOA 1Y3AA 2GEDA 2GJAA 2N1BA 2O52A 2R6DA 4HDCA 4AURA 4UKDA 4BLOA 1F3OA 4MGKR 1XJCA 4FW9A 4XSHA 3V9PA 2K5UA 1Z6GA 4QG7A 3GJ7A 4EJSC 4OI4A 3ZQ6A 1G18A 2QTHA 4A2WA 4DLRA 1XF9A 3REGA 3RWOA 2ZRDA 2GZHA 2V4ZA 5ANRB 4Z1MA 3MFYA 1QBKC 2IYUA 4URZR 4A8JA 3N2EA 4GFDA 3I73A 3KUDA 2VEDA 4R71A 2BDTA 1DEKA 5A5GA 2QN6A 3WHLA 1G291 3M1IA 4OQXA 4URVR 1KI1A 1Q20A 2V55B 3KXKA 2BV3A 4RD1A 2P0EA 1ETUA 1KDPA 1UDWA 1TQ2A 3QG5A 3RRMA 3NTUA 2WHXA 3ZLJA 3CB4A 5EZ6B 2J7PD 4E5UA 1P73A 3QXHA 4BZXA 3WMFA 2YVUA 1XDBA 4EPWA 1NVVR 1DAFA 1ZUIA 4TLEA 4A0RA 3K9HA 4CYMA 5J4YA 2GHIA 4II7A 2RGNA 5J4VA 3O8DA 4PAQA 1XJ0A 2X2EA 4BLRA 1OXVA 3WP0A 1R8QA 2WAYA 2NTYC 4D4JA 3I92A 2ZSDA 1C1YA 3OZXA 3EWSA 2ORWA 4UXIA 2KWIA 3N5CA 4DCNA 3Q7PA 2Z4SA 1YKSA 4AK9A 4OK6A 4PQFA 3VMFA 1R5BA 4PSVA 1PLLA 4UXJA 4TMKA 4P4SB 1NMXA 3K0EA 3K09C 2NO7A 4ZPXA 1E1QD 3IDQA 1PV4A 2P6UA 3IIKA 2ORVA 3SHWA 4O25A 4YMWA 3GD7A 4V0KA 4TQUS 4DB4A 4FMCB 5JWHA 3QEJA 2IC5A 3KJGA 4Z8XA 2F43A 2ZR0A 2NO0A 3IQXA 2PL3A 2YKGA 2ZUBA 4TN1A 2NGRA 4TMZA 4TYPA 1J7KA 5KSPA 4L9WA 5F3WB 4NONA 4TSFA 4LV5B 1JEDA 4Q4AA 3T15A 4BLPA 1ZU4A 1TF2A 4YC7A 5FH9A 1M6NA 4EPYA 1GRQA 1M34E 1CJVC 1GL7A 4QM6A 3R7WA 5JEDA 1R4AA 2Z43A 1GRRA 2FWRA 2ZI5A 3AKEA 3BOSA 3FYHA 3AF0A 1IJEA 2VH5R 2I4IA 5B64A 5TMPA 2GDJA 3AUYA 1E96A 2HDNB 2GNOA 2JLWA 4TYYA 5EJEA 3GEEA 1QHHB 2ERYA 2B8WA 1X8LA 4TLDA 121PA 2XTMA 1L7VC 3KXLA 3LXXA 4PX9A 3S1AA 1I2DA 2J41A 4TLAA 3PENA 4KVAA 2V7QD 1FP7A 1R6BX 3P4YA 3AVQA 3EZ2A 1PUJA 3WNCA 1AJEA 3L8YA 4OBEA 3ZD7A 3RDPA 3AKDA 4L9SA 1IN6A 2QBYB 1AS2A 2DWQA 1UAAA 4IW3B 4G0NA 1YR7A 2PLRA 1NN0A 3SJAA 1UPTA 1P9RA 2IA5A 3LLUA 5DHAA 2ZRAA 3F3YA 4W9MC 1RYFA 1XXHB 1S9HA 4G5GA 1K5DA 2R2AA 4AKHA 1Z08A 1DAGA 2OBMA 2XB2A 2UKDA 2RMKA 1OT3A 3EPHA 1X6VA 5H68A 4UNSA 5AUNB 2YJTD 4KV9A 3TKLA 3NBFA 4PSKA 4MKHA 2WICA 4LUCA 3SJCA 1IQPA 4JLDA 1ZC4A 2D06A 1G21E 3NG1A 4KFTA 1ZC3A 4MYTA 4KYUA 1FW6A 3CM0A 4BFTA 2XOKD 3AV0B 4NYJR 2F9MA 2J59A 2VQSA 3U61B 1KDOA 3GJ8A 1JQLB 1W49A 1YZGA 4WOPA 4KU4A 4CDGA 2WV9A 1KK0A 1OF1A 4YMSA 1NKTA 2AL7A 2W6JD 3SI7A 4Q7KA 1Z0KA 5JFGA 4JVMA 3SYKA 4PZLA 1J70A 2BHRA 2VHJA 3T1TA 4HAUA 1X1RA 3RABA 2C8VA 3ZVNA 2A5JA 3NBZC 2YINC 1AZSC 1YR8A 4RD4A 1NNEA 1EX6A 1IN4A 3CZQA 2WWFA 2XNSA 3OIVA 3TAHA 1UEIA 3UK6A 2AD5A 3GJ4A 3RS7A 2XZOA 1S3SA 1QHIA 2ZJ2A 4I1OA 5AR1A 3CRVA 3GQBA 5FL3A 2JLYA 1US8B 4M1KA 3O8BA 2P65A 1JR6A 5JJKA 4QNRA 1FMJA 5JWRA 1GKYA 3MWJA 2D3WA 2XXAB 3ICQB 2PT7A 4GL2A 5JLJA 3VR6A 1DARA 5FOWA 4A15A 4Q02A 2CMKA 4G5SA 4JJKA 3UWOA 2GCOB 2P67A 3QKUA 5FOSA 1G3IA 2QMUA 3MG9A 2JJ8A 4RFVA 1E2DA 5C18A 3FMOB 2IWHA 3UANA 5FTLA 2F3RA 5GJWC 1KK2A 4Y0AA 1X86B 2YHSA 1IXSB 4HSEA 2G88A 4HZUB 3LX8A 2GZAA 1BMFA 1IXZA 1YR6A 4P31A 1P6XA 3UG6A 2IHBA 3ZYCA 4ZIRA 4C0SA 1G9XA 4JSYA 4KO8A 3HJNA 2ORIA 2O5VA 2Q3FA 4AYWA 3RRYA 2Z6VA 2FSFA 3EZ7A 3LVRE 4N0DA 5FTMA 2ZEJA 1UKVY 1W0KA 1S3GA 4EQ6A 3FPAA 5DI9A 1JXMA 1E2IA 1VCOA 2QGZA 5C1BA 1XPRA 2IXGA 1X1SA 2QP3A 1FQKA 4Q7LA 2JASA 2PT5A 3AVUA 2IUTA 2AN9A 5FBLB 5B57C 1CIPA 4IVQA 1QF9A 2ERXA 2B7BA 2CJWB 1NIPA 2HF9A 3AUXA 1XEXB 4FMCF 4DZZA 3QOFA 1U81A 1NN3A 3BERA 1L8QA 2GETA 5FI0B 2IXEA 3BK7A 2QG6A 1EFRA 1W4CA 2CK3A 4BFWA 1SKYB 2ZJ5A 1G8FA 1IHUA 1XEWY 1TAGA 2YNMA 2FSHA 4E09A 1G7TA 4LV6A 4G3XA 4R2IA 3B78A 3M4YA 1YZNA 2F1IA 3VKHA 3M6AA 2C2HA 4A6PA 1M1YE 3GLFB 1H8HA 2O8EA 1E9BA 2FZ4A 2OXRA 3QKTA 4DB2A 1F60A 1U0JA 3ZQJA 1KAGA 4PC2A 3EA0A 3KL4A 3VX3A 3OEHD 3SN6A 2O8FB 4Z51A 2GA8A 1ZVQA 4M9QA 1G8YA 3WYAA 2REXB 3RNLA 4EFLA 5EXSA 3C7KA 2KBFA 1MO3A 2WPDD 2G9NA 4MKFA 1U8AA 2JJ2D 3SQWA 1KNXA 1E9RA 3NIBA 3TSWA 2ZRFA 2DWPA 1Z3IX 3WNBA 4G5QA 2EFDB 4XVQA 1EWQA 3AP1A 5CDFE 2ZSBA 2PCLA 1M7BA 1XTQA 3BIFA 3PCRB 3RLFA 2DCUA 3I1FA 3SBDA 3GFTA 2IEZA 2EYQA 5GVRA 4I81A 4PTLA 2ZVPX 3L0PA 1NL3A 1DPFA 2QENA 2O8CB 4A82A 1XD2B 1W47A 1CJMA 1SZPA 1ZM2A 3QBVA 4PPFA 3K0CA 1KI6A 1VCNA 1HV8A 4NZYA 2QAGA 3CX6A 4LYHA 4WA7A 2YV5A 4A0GA 1G8HA 2VP5A 3R9IA 1KAOA 2AHOA 2AXNA 4JLKA 4PSAA 3VX4A 1SVWA 4US1R 2XITA 4WAUA 4D6PA 4QRHA 1OFIA 3PIRA 3E70C 4QGGA 2ZVQX 2QAJA 3TRFA 1HTWA 4JLBA 3PFIA 2IEYA 1TEXA 3SYNA 4JVLA 4FMBB 5FL7D 2GVZC 2A2ZA 3CF6R 4PXAA 1OH8A 4F38A 3U7HB 1GNQA 4QFMA 2XSZD 4HYYA 3ZZUA 1GL6A 3K9GA 4KJZA 1E1RA 4RY2A 4DUGD 1D2MA 1V5WA 4MYUA 2XB4A 2W58A 3GFOA 1LVGA 2WKPA 4DT1B 2GF9A 4RSGA 4ZDJA 1E0SA 4JBYA 3MWKA 1KI7A 4KI0A 3JVVA 1TU3A 1LNZA 1TF5A 3TSOA 4EKDA 1DOAA 1XXHE 4BASA 2FPKA 1B0UA 1JJVA 2WWHA 4GP7A 4M9SA 2YWGA 2OT3B 4DDWA 1NVUQ 4WXPA 1VHLA 1Z0FA 3I62A 4RZ2A 4TLCA 1W4RA 3NBYC 4CZ2A 3MWYW 4B43A 2D74A 4CVNA 1ZUNB 5HR5A 4RD6A 2ZI3A 4HLCA 4Q9IA 1UBEA 1TTTA 5JRZA 1AN0A 4NYIR 3A4MA 3ZJYA 3A4NA 3HPQA 5G53C 2HUPA 5AK0A 4C0HA 4ZDWA 3VNUA 1WDTA 4U02A 2X1VA 4NP6A 5KPDA 5FPTA 4C0KA 2BBWA 4JL8A 3PXGA 2GXQA 3SU8A 3LV8A 3IO3A 2BC9A 3V4FA 1WF3A 4TL9A 3MSXA 2JDIA 2EYUA 5KHOC 1RPZA 2ZE8A 4AG6A 5BQ5A 1VIAA 1KO8A 5LB4A 3MUFA 3RHFA 1XRJA 1W5TA 5L3SB 2DPXA 3EW9A 4V02A 1VHTA 1YQTA 1WCV1 3L0SA 4G01B 1UADA 3C41J 3OIYA 1WXQA 1ONBA 1OH5A 4GMXA 4B3GA 1OSNA 2OO7A 2VP0A 1NSTA 1KKLA 2HLDD 1P3JA 3OEED 2CE2X 5JWOA 3MRSA 1V43A 2QZ4A 2XEXA 1KI8A 4EPTA 4XWKA 1GWNA 2BM0A 4V03A 4N0EA 2AXPA 5IT5A 2LCFA 3CWQA 4JMPA 2RGAA 3MAAC 3K9LA 4OK5A 2IYZA 5DHFA 5FR1A 2IX3A 4TYWA 3CZPA 1UEJA 1G4AE 1Z6AA 2R9VA 2QRNA 4WBSA 1KGDA 4XVRA 1ZNZA 1MOZA 1ZJ6A 2O0JA 2ZI9A 1G1MA 4WVFA 4JL5A 4TL6A 3PEYA 1HE8B 2Y8EA 2JLSA 5K8TA 3K70D 2CLDX 2VLIA 5FTJA 3TMKA 4C0QC 3TJZA 1PLJA 2BJVA 2FSGA 1Z6TA 1F2TA 3L2OB 1U9IC 4EIWA 4M0LA 4L8GA 2FPLA 2VSOA 4XIGS 4M1MA 2J9RA 4ASUA 4HDOB 2W6ID 1HT1E 1N5IA 3DOFA 4B3DA 3HU3A 3MJRA 3QKSB 1UFQA 3LBNA 1RRPA 2CCKA 521PA 3OIWA 4LJ4A 2QE7A 1ZMXA 2VL7A 3LRPA 4BFYA 2JLQA 2PX0A 2A5GA 5C4GB 3T5DA 1FFHA 4M1WA 4R2HA 2W2VA 3W90A 5EXTA 5BYKA 2AFIE 2PBRA 2GXUA 4JVNA 3ZS8A 3NEJA 3QXXA 4LHWA 3PUYA 4PR0A 5EUMA 1SKYE 1S2MA 4D4MA 3Q9LA 5K8IA 4Q9HA 1HURA 2A5FA 4BGDA 1DTSA 1T4GA 4ON9A 3GLIB 3U6KA 2J45A 4NBSA 2RGDA 4B6EA 1M7HA 3RSOA 5M04A 4XOIA 3UWKA 3FB4A 5J5CA 2CNWD 4TL7A 1DAEA 1GRNA 2NO1A 1SQ5A 2B6HA 1I4TD 2J46A 4PANA 3VHLB 5FUWA 4DCTA 4M1SA 1KSHA 3KUCA 5H70A 5HZHA 3NVAA 3P1JA 1WB9A 2PJRA 3THXB 3ZH9B 5CB6A 1AA9A 1RW4A 4DHEA 2ZI4A 2G3YA 2XAUA 2ZR7A 4TTRA 2NZJA 4Q03A 2F1RA 4AIIA 1TADA 3NH9A 5JHHB 1G7RA 2C77A 2FFQA 4ARZA 5FUXA 1JAHA 4MITA 2FFHA 4W7SA 3TGPA 1Z28A 4F4JA 1KI2A 2FU5C 3MD0A 3GPLA 1VCIA 3R8CA 1U8YA 1RRGA 1ZCAA 2B21A 1E69A 3LW7A 1FX0A 1A5TA 1E2FA 2QM7A 4XTRA 1NN5A 1ESMA 2GEUA 1FP6A 3A1VA 4KSCA 4IEEA 5HCIA 4LJ5A 4IDNA 4WIAA 4J0QA 2F6RA 3BB4A 1XEWX 4H1UA 4AKGA 4MRSA 3B5JA 1JR3D 2F9LA 4B2LA 1DO2A 3CRQA 3KFVA 1VDZA 2FEMA 2CVHA 4DLUA 1MO5A 2Z4RA 3QG1A 4WZ6A 3SE0A 4A8JB 1E9DA 5DYIA 2W0SA 4O2RA 4QBHA 4GMDA 1G3RA 2EFEB 5JCPA 1GILA 3OE7A 4LYAA 4BLTA 5CYOA 5EE1A 2YWEA 4QGHA 1D8TA 3I72A 3FDIA 5AJZA 1Z07A 4NTZA 3PUXA 4ZI2A 2G0TA 3CH5A 4Q66C 4ZV4A 3EIQA 2C78A 2IK8A 4HLDA 4Q4JA 3WNDA 1GTVA 5FFMA 4IRUB 3C4JA 3VKWA 5H8WA 5E7MA 2OCYC 3X2SA 3THWA 5B2ZA 2QQEA 3TW4A 4FXPA 1L4YA 3CPEA 4N3NA 3UPUA 1E0AA 4QJ5A 1SXJA 1TUEA 1U2RA 2PEYA 2AKAB 4URWR 3SJBA 3K53A 1YZTA 2GJ8A 1GKIA 1TU4A 2VPPA 3QNUA 1TQ4A 4GOJA 2OCBA 2JLXA 2OUKA 4PFSA 4Q9JA 821PA 3GJ3A 2Q9AA 4Q4LA 4FD2A 2V54A 2WOOA 2GJ9A 4FINA 2DWOA 1ZD1A 2ZRIA 4PQYA 5JRJA 2YOGA 1E6CA 4QC2A 3WHKA 2F43B 2YWHA 5C2JB 2EVWX 1SVMA 3RS4A 2V3CC 1ODFA 3G0HA 2VIIA 1QHXA 4MRRA 4AWXA 4Q4AB 1XX6A 4I99A 3P27A 2ZJBA 5JEEA 1XTSA 3ICEA 2W83A 3R7WB 1A82A 1CR2A 2QPOA 3DL0A 2EFCB 3CRRA 3DZDA 2QT1A 5AJXA 3FOZA 3VHXA 1KSJA 3FFAA 1FUUA 1ZU5A 3C16C 2OEPA 3LH5A 4F7WA 1T9HA 3THOA 1T5LA 3BH6A 5BYJA 1OH6A 2CLSA 5DE3A 5KSZA 4Q00A 1NY6A 2F1JA 3B7GA 4X8MA 3VTKA 4ESVA 1YVDA 3ECCA 1W36B 1AIPA 3QVUA 2BCJQ 1IY0A 2Q9CA 1F6BA 1XD9A 2TMKA 2GK6A 4PPQA 1S0UA 2HCBA 1G20E 4UJ5A 2I1VB 2BBSA 3DPUA 3D7MA 3R9WA 4AKEA 2JIZD 3S1AB 2JJ1A 4F4IA 1N5JA 1UF9A 2W2TA 2DFLA 4W5WA 3U3MA 2ZUCA 3B8HA 3QEOA 2FOLA 2ZSAA 4FCTA 1R5OA 1X8JA 1Q3HA 5EP2A 3QXCA 4QJ4A 1JR3E 4HAYA 1EWRA 1U0LA 4Q9KA 4D25A 1RYHA 2CL6X 2MMCA 4MA4A 1G7SA 1E79A 3W34A 4L15A 3ZIAA 1N5KA 2MSCB 4Z1MD 5C46F 1XTRA 2AK3A 2QQ0A 3W3AA 1QDEA 3Q8XB 4XJXA 4B44A 2QI9C 1CR1A 2WJIA 4WZBE 1AS3A 1CU1A 1SVSA 4GOXA 2IF0A 1OFTA 4C0BA 4POAA 2Z0MA 1NSFA 1E0JA 2OBLA 3KXIA 4CIDA 1JQJC 3K0SA 1SVOA 1OLOA 3IHLA 3W8RA 4MKGA 1DELA 2ZYVX 2ZJYA 3REFA 2FJUA 1H8EA 3SHFA 2QMHA 1U90A 1OKKA 3DM5A 4TTPA 3UIEA 4CF7A 1II0A 1JJ7A 1X3SA 4JIMA 3CW2A 2O8DA 2CLCX 3DM9B 5JCZA 4RCZA 2BOVA 4IDQA 5IK2A 3RS5A 3GLIE 3T34A 1QHNA 1Z5ZA 4LPSA 2J0QA
chains in the Genus database with same CATH superfamily
2EF0A 1LJUA 2FPGA 4L5AA 5B6IA 5IM5A 4UUNA 3NS7A 3ECAA 3R0XA 4AD8A 2XT0A 3W78A 3ZQKA 2AKYA 2HT6A 1TVKA 3TL3A 3CUKA 4Y6RA 3WLKX 5TVKA 1THGA 3G9XA 1ZYUA 5D3ZA 5DYNA 4EW1A 2XYRA 2YJ5A 2NAFA 3IFSA 4D5GA 2HU7A 3TUZC 3GVPA 2A0FA 2AC2A 4IQ4A 1F0PA 2CE7A 4J1SA 3MTQA 1DQYA 1JXQA 1Z6XA 2WYIA 4KPFC 4IHQA 3UAZA 5KOIA 3VR4H 4RVHA 2XMBA 1E2GA 1E1CA 1TQDA 2HZBA 3FKSA 1ZGAA 5AK3A 5HKKA 5LMZA 2WZBA 3LYAA 1OGIA 2CJXA 4ZAXA 4BUCA 3KXPA 4B8YA 1OIVA 3AP2A 4JBNA 3LY9A 4PIMA 3UT5A 4EZEA 3WTCA 2XEDA 2EFGA 1WNTA 4CRWB 5FRDA 5TVGA 3RBXA 5CB4B 4F84A 3HXQA 2ORED 2IHKA 4Q4DA 5I7RA 2IITA 3MJDA 3INRA 3FROA 5LMNB 1W36D 1Q7RA 2CLEB 4J16C 1GZ4A 1NGSA 1PJ4A 4ZCMA 1TXGA 1QGED 1VECA 2OILA 4WINA 3V7YA 1LWNA 1B8UA 5IBCA 3VTZA 4Y9RA 1P0IA 4AZ0A 3DNMA 1PWXA 5TQ0A 1PJBA 1NY5A 3BA1A 1JDBC 3W2TA 3EGIA 4RD0A 4CM8B 4DIDA 3SXUA 4NENB 3ZX5A 1M2FA 2Q9BA 2GZMA 2WIBA 4IGFA 2R48A 5A0VA 4NU5A 2FRDC 3GV0A 2QJRA 4ZVPA 1ORHA 1EESA 1SAYA 1OB5A 3Q9UA 3TRJA 4WY5A 4ITUA 3CLSD 4JENA 1LBHA 1THTA 3W0LB 1PS0A 3DBIA 3ZV5A 2PWYA 3OBBA 2I5PO 5DK4A 4Q93A 4KKVA 4XW2A 1E59A 4WCDA 5CM9C 3TEMA 7ABPA 4OI0A 2I71A 2DC1A 1A4XA 4CIBA 2PRIA 2HWKA 1ZA2A 2VUSA 3R3WA 4YAIA 5JNTA 2FQ1A 3HJAA 1WCWA 4YS6A 2AFHA 4PTYA 1GYRA 4JYPA 4OB7A 4RH1A 1MVNA 1D4ZA 1LJLA 3H42B 3MC1A 4RABA 1V7PC 2HW8A 1BXKA 1O95C 4HN4B 4OHKA 4GR5A 1ZKDA 1DG3A 2X42A 3WYCA 5JCOC 2CLHB 1HX7A 4C4XA 1DP4A 1HDZA 4YFYA 3QWAA 2A4MA 2QPLA 1SUBA 2GO1A 1AT1A 3ENQA 4KOAA 5DTJA 2CL7X 5T4HA 5EKUA 3CTMA 5F5NA 4B7XA 3IODA 1WZUA 5EGNA 2O7SA 1CVIA 1T3GA 1ZAYA 4B6GA 3KOZA 4F11A 5LDDC 1EVJA 1BD3A 1DWUA 1MNAA 2A1UB 2BSAA 2CFRA 4OGLA 1XK7A 4PZUA 5AXBA 3RJZA 1J97A 1SGWA 1JLRA 1UOEA 2KS6A 1QVWA 4AC9A 4BDTA 5A4IS 4JLMA 5BSEA 1P2FA 2YVLA 4NDZA 1D2AA 3G49A 1V1MB 2ANCA 3I4FA 2PSDA 4Z3DA 2YXNA 1ZW1A 2A9VA 1I7PA 5IANA 3BE4A 1TQ8A 3PJFA 3I2HA 3KKOA 5HE8A 2EFJA 3TF5A 3TZQA 4IEIA 3O73A 3EQ8A 2C5FA 2E4ZA 4KO3S 3RNOA 3GUZA 3QJYA 3QKRA 3ZBTA 2HO5A 1CEEA 2DQ4A 1NBMA 1DCKA 2FPRA 1C7QA 1OX4B 1FRFS 1G16A 3VSBA 2M2IA 2ZSEA 3WL4A 3ZE0B 5K8CA 1AHHA 1JIXA 3D7KA 4B74A 4ENVA 2WG1A 1U6IA 2RFLA 1I2MA 5CNKA 3K09A 1XLTA 3LMKA 4URXR 4LRQA 1FFBA 3O74A 3PWZA 1EKXA 3WGTA 4BRSA 3T1HB 3U7GA 4WASA 3H5OA 5DT9A 3WBBA 3WXMA 3CH7A 3ORRA 1XRRA 3RIEA 1E9EA 1RPNA 2ZE5A 1UK7A 1KSGA 3RSCA 4FIDA 4YJ2B 4C6SA 4CQLB 4ZI5A 1E2MA 2J3IA 3IVGA 4KQ1A 2PZKA 4ZDIA 3AVXA 1IN7A 4KVGA 2QR2A 5JI3E 1JZQA 2FPPB 1R0LA 3E7FA 1VPLA 4UM9D 1ISMA 2ZRKA 4IDAA 4IIJB 4HK4A 4DLXA 3SC6A 2E4WA 3CJQA 3JARB 1VJDA 4TMWA 3DMPA 1QRRA 2BDUA 1XHLA 3UHPA 5K2OA 2H2GA 1V2HE 1V37A 2J3QA 2PYIA 4RTOA 4QYMA 3K8QA 3A9TA 1WB6A 3NAQA 13PKA 3NI2A 3PKIA 2YYYA 4P7GA 1CULC 1IAVA 3CKYA 4GDFA 3HWWA 2HAEA 1D6NA 3HNOA 1X1DA 2FV8A 3OD5A 3T9CA 1RR6A 1MTZA 4HQRA 1BXZA 5CNMA 3U5ZB 1U0RA 2FW9A 3GROA 2ALJA 5M2QA 1JFSA 5JJLA 4QL3A 4RFSA 4I2NA 1W0KD 3K0HA 2WG0A 2UYCA 1EP3B 1M2GA 2V8OA 2XNJA 3PDIA 1T24A 2JJQA 3M70A 1X8KA 4KFUA 4TWZA 3WNVA 3V8MA 4BMDA 1JFFB 1K7FB 3LUHA 5F51A 3SS8A 2PKWA 5CBPA 1VBMA 1FJGB 2X15A 2EHDA 5D8DA 4TX1A 1BU8A 1DX9A 3JQDA 3QU9A 1KVUA 3GAMA 5KQGA 1I3MA 3PFCA 4GD3Q 4TZ6A 2QJWA 3QTBA 1GTL1 2O07A 1UODA 2RGGA 3I0ZA 4QPNA 5B5SA 1E0KA 1A5SB 4A91A 1EFRD 1BS9A 1RE0A 1S02A 2Q2NA 2CK3D 3ABRB 1PI3A 3AETB 3JQAA 4GDMA 3VZPA 2I54A 3WDKA 3HKEB 1OV6A 4KAJA 3RWMB 4D44A 4I55B 1HYGA 1NVXQ 1UKBA 5BYBA 4AJPA 4UNIA 1OBCA 1YRQA 1ZXBA 1MRSA 1Z16A 4QLAA 3D2AA 3KQNA 4AJNA 4BRUA 1YONA 3S3TA 5EJ5A 3DDSA 2E1PA 2XWSA 1WDWB 3KETA 2PBFA 3E9RA 2YWCA 4N40A 6ADHA 5AUQA 5F98A 3USZA 4PFKA 1E9AA 3A6HA 4BVHA 1Z0UA 2ZPTX 3RYCB 3KEGA 5AM4A 3S70A 4JI5B 2FPIA 5BVGA 3WK9A 3DMHA 5HNKA 3UY4A 2Z6QA 4CFSA 4QOGA 3MWLA 4YJ2A 1YS4A 1BMDA 2JS7A 2IH4A 3AYZB 3G8YA 4KAFA 5KNBH 1OZAA 4X20B 1G9TA 3HVHA 4LZJA 2FPPA 1VSUA 4FX5A 1OB2A 3RJ5A 3SZUA 1VMKA 2AV6A 2EP7A 2VKTA 5BNZA 1ZCBA 2WNSA 4A5SA 3C6KA 1EX1A 3G0GA 3ROZA 4DS3A 3KU1A 5ERXA 3JSXA 3J80A 2XNHA 3QYAA 1N6IA 2VHTA 4NBTA 4MHSA 3PNBA 3Q5EA 1ANKA 1QU3A 2W22A 1ZRSA 1EE1A 4IXNA 2ZR9A 5E6RB 5C7IO 3C6XA 2B25A 4I9NA 1YUNA 5FPYA 3FR8A 3F7NA 4RMIA 3O82A 4TS4A 1CP2A 4QNNA 3CONA 3JQ9C 4M1TA 4Q1EA 2IHZA 5TPWB 1N33B 4PZCA 4RESA 4CQJA 1D1TA 2OCKA 2OK7A 4JI8B 3WDLA 1ZM3A 2XMDA 2IYYA 4I9FA 4AUKA 2A30A 2CLKB 3KQQA 1BQ4A 1NKSA 1RQRA 2VT7A 1DX6A 4NJEA 4HNGA 2JATA 3Q1KA 3DL4A 3BDAA 4KDFA 3HKCB 2FG5A 2P90A 4QJBA 1EBBA 2BZGA 2QT0A 2RD2A 1GGFA 3N1UA 1T2NA 4NE7A 1B0AA 4KYTA 1MT0A 3VYWA 4S04A 1Y7HA 4YYZA 1YL5A 4QQNA 5LQDA 4QYXA 4ILKA 2E48A 5IKOA 1CS0B 4QU8A 1T9DA 4IVPA 4EYGA 3KJQA 2R85A 5BXQC 5JIBA 2RHRA 5D3MA 1JDUA 2EJTA 4IOKA 1BEZA 1RKBA 1O94A 5B58C 1RWNA 4C05A 2HNKA 3IKLA 4MK4A 1LPOA 1Q7BA 1PJ8A 4ZYUA 1VSVA 5DM4A 1E1MA 1ZM7A 2QR3A 4A8TA 4F92B 2DT8A 1I8TA 1D09A 4P7KA 4UM7A 3PEUA 2CXUA 4R6XA 1L7MA 4HAWA 3FY4A 2UZ1A 3ZY2A 2ZAMA 4P4UA 1EFDN 3JYHA 4MVJP 1PNVA 4R54A 5F4ZA 3GLKA 2GCPA 2IZ5A 3F3KA 1OWLA 4ALNA 3EWAA 3I3SR 1P9LA 2X0NA 4GS5A 2BHSA 3CU5A 1PJTA 3FF1A 3OTWA 4TQGA 2IPLA 2IDZA 3TQQA 1JBEA 1RM4A 3W5IA 1RPJA 3N6VA 3WGIA 1VCMA 4M7PA 1W5EA 5CURA 3PFWO 5LQKA 3N3BC 1ENYA 2BMEA 1X80A 2YWFA 4XPIA 1A9SA 2HU8A 1KGSA 3LT5A 3QUTA 3RK1A 2P1DA 4BFCA 2PGIA 3R44A 4J4TA 5JCXA 3SJUA 5TLSA 1U4SA 4NYMR 3MEQA 5IF3A 1C3EA 4WOJA 3ZLUA 1YJQA 1MXHA 2X7JA 2EU8A 3U44A 4CV1A 3L02A 3D6TB 4WSOA 1N1EA 5K09A 1UQTA 4Y67A 4YUVA 2ZRJA 3KT3A 3J81k 2OZEA 2CSUA 1J8FA 2ZBRA 1HDGO 1WD5A 2BISA 2GILA 1E3WB 1GVHA 1HPLA 2J3EA 4IIHA 4LJSA 4K26A 3Q9NA 1WXDA 1WE2A 5EKSA 2X2OA 1QOQB 3CX3A 3G79A 1RYZA 1VSTA 3G5TA 5SV2A 5TS2A 1E7RA 3DAYA 4ZYTA 4DTCA 2WVJA 4OAPA 3ZU6A 4XVCA 1ZH6A 5DLEA 4DG8A 4HBZA 1P1JA 4N03A 4H2DA 3R76A 5DMXA 3NONA 2XB8A 3PXCX 1I1HA 1OC4A 3Q5DA 4I4LA 4Y1GA 1V8BA 2E9SA 3PXBA 1SO8A 1MB3A 3QPDA 5K0LA 2OA0A 3AKZA 3BVPA 1KDTA 1RWKA 3QPAA 4OATA 5ALZA 1PFQA 2ZJZA 1T9BA 3Q8KA 3L7AA 1QQ6A 1HNNA 2H1RA 4GH5A 4JVOA 4W63A 3VKVA 5HDBB 2OFOA 4ZOLA 4PU0A 5EMLA 2FSUA 1AKTA 4D81A 2WU8A 5EINA 5JBNA 1H3NA 4N7MA 1IBCA 4HZIA 3R7SA 4EUKA 3PXAA 4H4EA 5C81A 2L42A 1YGYA 2ZTMA 4JOBA 2ILVA 2YY7A 1ULAA 2PZJA 3GX1A 1U0EA 2FKAA 3TVYA 3PR1A 1W5FA 3CG0A 5DASA 3EC2A 3GLRA 3UKJA 1GFSA 2D0DA 4NESA 3OTIA 4LC1A 1G0OA 3VYUB 2D6FA 3KQYA 1AUVA 3OPQA 4LHVA 2COKA 3G5AA 1UWCA 4JT2A 3UPTA 1A2KC 3FYSA 2W6NA 5FI1B 2D2FA 2KBEA 2N3ZA 1C8LA 1KJZA 3LQQA 3ND6A 4LQDA 3AONB 1Q7TA 4YA6A 2HQOA 4AY5A 4LMPA 4LF7B 1P4GA 4WL0A 4NYMQ 1WQ1R 4LHYA 3AKCA 1TMGE 3RH0A 3ZQUA 3Q2OA 1UJ4A 4WD3A 2PXHA 2CXNA 4WDRA 3WLLA 3UENA 1ODCA 5P21A 4EJ2A 1GZSA 1I2BA 3E82A 1PZNA 4J7CA 5REQA 2WYOA 5CB8A 4JZYA 4PYQA 4J0GA 2F8SA 3LQFA 5B3KA 2O06A 1L7EA 1SVIA 3M1AA 4OQFA 4Q4JB 1E9SA 1LK7A 2PN1A 1LUAA 2YS7A 3RAPR 2V5AA 5K51A 2JHPA 1PHRA 2OFXA 3NKVA 4E5YA 2XCUA 2YJ3A 4HNSA 1DQSA 1XZBA 4IFBA 4A8PA 2O7RA 4EBFA 4EHIA 5ICSA 4R1PA 3CR7A 2V97A 3CE6A 3MS4A 3M3DA 4FR5A 4B4DA 4JXJA 2OCAA 3KAKA 3R0VA 3ZHOA 1CTQA 3QOYA 3DVLA 3AMVA 3HJFA 3AGQA 1GSIA 3DOJA 4IJ5A 1UP6A 1I7DA 2WKRA 1RJ9A 1KQPA 1GTSA 1FEZA 1JDNA 3BRWD 1MABA 3KB1A 4J2TA 2IBTA 1O08A 2RHLA 3GXBA 5IAGA 1KWKA 4TS9A 3NHJA 3C3PA 3IIMA 3V6LA 2OHXA 1EM8A 3L3BA 4YUYA 6AT1A 2ZUFA 1PT6A 2BAGA 1IMJA 1NXOA 5EKDA 1RTTA 5AO9A 2XBLA 4HNVA 3GRYA 1CE8A 4KVFA 1XB2A 4UNQA 5EPOA 1NQUA 3FW1A 4I14A 2Q6OA 4EHBA 1KKUA 1GZ3A 1IHOA 2CFTA 2VA8A 4KHZA 2NPIA 4AKSA 3FZYA 3CNOA 3KL2A 1RNLA 2YASA 5ICEA 1ONPA 3AF4A 3QIAA 1TAUA 2DHDA 4D4LA 4Y2HA 3DE0X 2VKQA 4LOIA 4RZSA 2Q8PA 3RC1A 2AFVA 3ZOKA 3ROQA 1FFXB 1BVRA 3B85A 3OC6A 3OT1B 4WECA 1OLXA 2G83A 3DYVA 1G3UA 4QBGB 3VHXB 2P9EA 2JA1A 2ZU0C 2DU8A 3GT0A 2R4QA 1S2NA 1PO7A 2QMOA 4K9LA 3AM5A 4YRGA 2CHFA 5KJ6A 2GEBA 1SOAA 5A6VA 3H2KA 5KTNA 3S8EA 4LY6A 2AB0A 1ONSA 5K3AA 4CEHA 4LWOA 3RVMA 3SYLA 3A36A 4CTMA 4BNDB 4IR7A 4ONEA 4D9IA 5DBEX 2XMGA 2GLXA 5JZSA 4RZ3A 2ZYTX 3DMNA 4II2A 4XDHA 3KZ1E 4WFQA 4BEBA 3DVSX 4CEIA 1OHHA 3ZD8A 4DLPA 4O2BA 3ZLVA 1RWVA 3F71A 7REQB 4CKZA 4CKWA 3PFKA 3SOZA 4QNMA 1YBVA 2RHTA 3K0AA 1DLIA 2OC9A 2XGSA 4FOPA 2EX1A 3WNZA 3GJ6A 3TNFA 4QO8A 3OPVA 2A9PA 2R97A 1JHRA 1C0LA 1KHHA 2IEIA 4BQIA 3QU4A 1Q16A 2R7MA 2ONZA 4KP7A 5HF6A 3QPBA 2WZCA 4L0MA 1N5LA 5A02A 2XYQA 2BI8A 4EL5A 5CA0B 2DUWA 5BRJA 5K3OA 3PEEA 4LOHA 1SCUB 4W1PA 2V0GA 1JNXX 4HG2A 1BCRA 4DQLA 5MFPA 1TD9A 2M32A 2Y77A 5HF9A 1D1QA 3B5EA 3FCXA 5J47A 3I61A 4ZHQB 4XWTA 1VI5A 3EY4A 3NZEA 3INYA 3ZHTA 3I45A 1KY3A 4C3OB 3N0WA 1NYTA 1DLJA 1L6IA 3C3BA 3C3XA 2A1TS 4FQ8A 5GP1A 4YR7A 1CJSA 1UBJS 2WQZA 2ZIZA 5HJEA 4ISCA 2P2ZA 2ZUTA 1G8GA 1D2CA 2Z4TA 2ZFUA 4JJ7A 3IAM1 4FT4A 2ECOA 1H6CA 3V1YA 3LTNC 1HRDA 3H2JA 3LVQE 1M1ZA 1O9BA 4TYQA 2WIGA 5HQ3B 1CHDA 2ZDHA 2J9GA 4LMAA 4X8HA 2FAXA 1AZLA 3KZOA 2I66A 1WKBA 4I6JA 4ZJPA 3CVWA 5CYPA 4IHJF 5ER6A 3AM1A 1U9IA 3E15A 5J2TF 3RYTC 4RDCA 3UXEA 3HCRA 1ZGBA 2BTQB 2PEZA 4LRUA 4YWHA 5ITZB 1Q57A 1YB2A 3L84A 4ND8A 4K1LA 5ES4B 4YAWA 5LZ4A 3IBTA 4BMXA 1ZH8A 3VHRA 4PHHA 4NXNB 5GOZA 3WIVA 2PSFA 4RDHA 6Q21A 2EKQA 3H16A 3O8QA 4F12A 3A1DA 1L2TA 1TZMA 4RVCA 1G6HA 2QX9A 1FFXA 4ZT6A 1SXJD 5IYZF 3SQLA 3MB8A 4NNOA 3TBFA 4ZJUA 2GFHA 3PNPA 1JUDA 3SD7A 2CEAA 5JBQA 2CMDA 3PQFA 4NPHA 1JMVA 5IT0A 4HGRA 2II6A 1I5OA 3TE6A 1F2UA 4UHDA 2QD1A 3I2KA 5HUJA 2R6AA 3BWMA 3M0EA 3NBMA 1MZPA 2X58A 4IX9A 2EZ4A 3JY6A 3IQWA 1YA4A 3I9MA 3QW2A 1KAMA 4KREA 4K8RB 3OZIA 2EGUA 2X5KO 4G65A 5A71A 2H18A 4KQHA 3W6NA 5DI3A 1AKRA 2E89A 2AJ8A 2XZTA 4FUQA 5YASA 4FOLA 2VJDA 1QHEA 1KZGB 2VYFA 1QHGA 2BDEA 2AZDA 1CIVA 4FGWA 3R4CA 3KPYA 5CT5A 4OQNA 5F12A 2DETA 4HQLA 4LJ8A 4X62B 4JB0A 1TKRA 2YUTA 1N1GA 1TT5A 2ZWIA 1GNSA 1VOTA 2C7BA 3LK7A 4LY3A 1YAHA 1GIAA 1OTHA 4DARA 2I4LA 2DHRA 3RKSA 6ABPA 1E1QA 3EIEA 4PCVA 4WLNA 2NAPA 4JAVC 2WINI 1OVMA 1RP1A 1S1CA 1M5TA 4QQ8A 2W48A 1H94A 3MUEA 3EQZA 4LRWA 3ZEAA 4F60A 4MS4A 1BYIA 4EUFA 1IUOA 1OD6A 1GRVA 1IVYA 5G02A 1DC8A 5LN1A 3O26A 1QH1A 2N46A 3IP8A 3F5FA 1K6IA 2V58A 1G19A 2ZI6A 3VTAA 2EW8A 3JCZA 1SZDA 3DEZA 3G2PA 3ASUA 1GEEA 3M7IA 4MJLA 3SHTA 2W9XA 4JEUA 2ETVA 5A4MS 3C0KA 1B7GO 1GCAA 1UIRA 2B8NA 1RI2A 1PJRA 4PZPA 3FTDA 8ATCA 2G7ZA 3PEFA 1VLJA 4BWVA 5KSOA 2I34A 3L49A 1RD4A 3FTFA 3QY9A 1SCKA 2VO1A 2HHHB 2BYTA 2G36A 1UDBA 4RSHA 2ZLBA 2FDCA 4E31A 1C7RA 3G6WA 3WQHA 4UVEA 5HS6A 3CEMA 5HE9A 5D86A 4O2AA 3OIUA 3ACCA 2E3JA 4ZQBA 4C7JA 3KLNA 2RDMA 3OP1A 4H7PA 4JUAA 5FTKA 3JTEA 2ZRNA 3LP6A 1NUPA 4J29A 5GMOA 2F8MA 3UAXA 1QG0A 4EJSB 3IVRA 3G0OA 4RSMA 3UICA 3F97A 2D1SA 2XR1A 3B6EA 5HIKA 2JHAA 2Q5OA 5BPHA 1E2BA 2CHEA 2J9FB 3G2QA 1QX4A 3AQ4A 4R3UC 1F1JA 3D02A 4F6LA 4MS3B 3BAFA 1XJWA 2G0NA 4KR9A 1NUQA 4HLQB 1HFWA 4PO9A 4MWGA 4C0LA 4R2XA 2OV4A 2IXFA 3GLHB 2P35A 4G36A 1U7DA 1CVLA 2Y0EA 1EHIA 2FZVA 1Y8RA 4BVKA 1FMCA 1V9SA 2A8YA 4HRYA 2JI6A 2F17A 1IK4A 4PYMA 4Q34A 2C0PA 3GQVA 5DCYA 4OQDA 3H5LA 5FKJA 4BMZA 2L69A 4MKXA 1PYDA 1N2XA 4MV9A 3C6BA 4ZAYA 4IKEA 4RO0A 1CG6A 5B4VA 4G86A 2JLAA 1BXRA 2DBRA 3AFOA 4WCFC 1DDGA 3QM1A 4EJ6A 1CUEA 4HGNA 3BE5A 4OHBA 4WADA 1II9A 3OCXA 4Z4IA 3P2KA 3CX4A 5CDUA 1S5PA 3FTEA 1MV8A 4IVRA 2PMCA 3L8GA 1M1YA 3LUGA 4CMJA 4DCVA 4OREX 2L82A 4XWYA 2Q0SA 1JHUA 3Q8WA 5FULA 3ACBA 4QRDA 5K6RA 1X9HA 3AIKA 4G81A 2R87A 1GLVA 2PY6A 4ESHA 2CLMB 3PPYA 3WFJA 3ZWQA 3RC8A 2DHCA 2HH9A 3D6NB 2H6EA 5BWBA 1CZOA 4ZYXA 1U6JA 4MTCA 3SAJA 4D26A 4EDHA 2VN8A 2W2KA 1AUQA 3V4SA 2NSYA 2WSSD 3C98A 4ZGWA 4FONA 1XF1A 3ZTTA 1LDEA 2CCJA 2V96A 5IVIA 1U2DC 2SCUA 4DY6A 2GJ4A 1TM5E 3G2JA 3T0GA 3ETGA 2C95A 3L1KA 4L4SA 5PGMA 3QLTA 1L7PA 1Z4QA 1C8BA 1NBIA 4C6TA 1T3TA 3I6YA 4HGQA 4TL8A 5IKXA 4M0UA 1R3UA 1EWKA 1SIOA 5CXXA 1A2QA 1RBMA 1USUA 5C32A 4MZDA 1DWOA 2GJKA 3ND5A 3F0TA 3K0CC 3DFIA 4EFMA 5BR8B 4HDQB 4LK2A 2BMJA 1LD3A 2COUA 1OROA 1NP3A 1E0DA 2ZJ8A 4IOJA 1YCGA 4K6HA 1V47A 2R6CA 3AVPA 1X70A 3CSDA 4YJHA 4N76A 5LXTA 2NM0A 1AQUA 3RI3A 3SC3A 1PN3A 3Q5GA 3VR4D 1ORTA 2Q5IA 3ANSA 3CEAA 2F8LA 5IVDA 1E2HA 1T9CA 2I6FA 1GYPA 1BVUA 4JJZA 4NL4H 4MR8B 3SYMA 4HLUC 2GZDA 3KWLA 4UTVA 2FWBA 2HJVA 3MOGA 2WNIA 5TR9A 2IWRA 4DLVA 4B34A 5A4AA 4HATA 4PONA 4HB0A 3BWEA 3QV2A 4UM5A 1C8VB 4NZOA 4JUFA 4Z9XA 2K2WA 4B79A 3I2GA 1RBZA 1KYQA 1PL8A 3II6X 4PC6A 1XCBA 5TJHA 3OOYA 4D92A 1VBKA 1E98A 2XH8A 3JZMA 3GMDA 3HCCA 2G1UA 3N8KA 4PZ9A 3C14C 1L5FA 2CMHA 3OQJA 2AYZA 5FWDA 3ZCSA 3T4XA 1JG3A 3DTVB 2VQFB 5EJ2A 2ONJA 1U0NA 1K3TA 5AVRA 3OJXA 4EG1A 3B9PA 3UQYS 5EJ7A 4HWPA 1TC1A 2V5UA 1A7JA 1FRVA 4U7HA 4LEIA 4LCJA 3GT3A 4HH0A 5D5PA 1P4SA 3A1SA 4P4LA 1E77A 1JLHA 4HZGA 4V0NA 3UFXA 5IT9A 1GAJA 1Q95A 3IAAA 3CINA 3EYAA 1FQWA 3H6HA 4GW3A 2LPMA 3JATB 4U7TB 3ZZTA 1E92A 3CLVA 3FRHA 4N4AA 4PX2A 5FUVA 1RHQA 2FEPA 1Z2AA 5CH3A 3TK1A 3TS1A 4EGCB 3NASA 5JAHA 3QFFA 2IS2A 1FE8A 2R62A 4ESEA 4FHGA 1L5SA 2P9YA 4TQAA 1L3BA 1KYYA 2W2QA 4CF6A 1JSZA 3DMFA 1NVDA 2OCIA 2XQFA 3MWEB 1M6YA 2FLWA 4TLBA 5JLAA 4A4DA 4OQEA 2GFIA 5JI2E 4BNWA 2XGJA 2GSDA 3KFLA 3PX3A 4EY5A 3C97A 2DT5A 1PSZA 3SBEA 1WUHS 4X61A 3WJ1A 5JV5A 1JEYB 4AN0A 3H05A 3HEAA 4FFBA 1Y63A 3FFXA 3PXXA 1HE3A 3GLGB 4UATA 2HZ7A 4UFNA 1G3QA 2DJ5A 3D8TA 1TPZA 5G40A 5JPDA 1L7RA 3ABZA 1J25A 4MH0R 3H6GA 4RD2A 4BJHB 5L40A 3IJPA 4XR9A 4WESB 5FJJA 1P6QA 5LC1A 2HT1A 4PVCA 3OEHA 1LS1A 1RWXA 5TMEA 2GB4A 4V1CA 4CEJB 2N1MA 1M8PA 1ZHOA 2UU9B 1N9GA 1UP4A 4IQ8A 3DCNA 2JRLA 3LT1A 1ZNWA 3WYNA 2YYZA 2I3BA 3AF2A 4EY4A 3VVCA 1T6YA 4KMRA 1BOOA 3L7IA 4K9PA 4L6IA 5IAJA 2HCJB 3CLTC 3FNGA 1QLHA 2Q3JA 4R5MA 3Q98A 1AO3A 1J8QA 5FTWA 1X14A 5A3SA 2I9KA 2B1GA 2EG5A 5AVZA 1C9NA 4FYHA 1DRVA 1DXOA 3NJRA 3F73A 1XZMA 3BH7A 1N6NA 2H4HA 2PMDA 2B34A 2RGXA 7MDHA 1ZSNA 2TMYA 5J58A 1YMQA 4LHEA 4CQMB 1U3VA 2E4VA 4LQ4A 4JHXA 3U3KA 2OO5A 4OLHA 1QZXA 2H5LA 5GIOE 4MA5A 2P4HX 4WI1A 3P9KA 4PHFA 2D5IA 4UOZA 4OI2A 2NQ2C 2AN3A 3OE4A 4XM0A 3K6KA 3O4GA 1GPKA 4QFCA 3D0OA 1O4WA 1S89A 2A7XA 2ESRA 3F3SA 5EE9A 5TV2A 2Z2JA 4L72A 1KRWA 3OJ0A 5E7IA 1FUIA 3C85A 2QYTA 4A1OA 4KACA 2GTPA 1JQAA 1Z0IA 4GPIB 4TTIA 2WLTA 2NVUA 1E2NA 2CY0A 1YZYA 4BBPA 5EXXA 2HI0A 3D3QA 1NWCA 1XTVA 2OV2A 2FEWB 1NF3A 2Q7XA 1NRJB 3IKVA 3R20A 3B3FA 4I4TF 4UE2A 4B7AA 2XODA 3KJXA 5JY1A 1YU6A 2O8BB 4EP1A 1YDWA 5DNYB 4Q01A 3ABSB 3QVVA 1CYEA 4ZTUB 1OAOA 4BP3A 4CM3A 2Z2YA 5H80A 3NHRA 3V00A 3ZE9A 1FL9A 1COWD 1FDOA 2XSZA 1PGJA 5JXHA 4DUGA 2BF4A 1L1QA 2VOEA 3ETDA 3F4BA 1AB5A 1UDAA 3FHOA 3JS5A 4R2WA 4MS1B 4ACAA 3A2NA 2F8TA 3AVVA 2FSVC 2CVQA 1RXUA 3GLHE 4MPPA 3SJZA 3TW8B 3WMXA 4K3VA 4EG5A 4BGEA 3NALA 3I52A 1U2QA 1U31A 1RLOA 2RC6A 2OO3A 3DULA 1QB8A 1JPVA 3NVMB 4JP3A 2EZ9A 4C4OA 4ZZIA 5C4MA 1QWSA 5LU9A 2P2NA 4FYWA 1TYDE 4ALIA 1MJNA 1QK4A 3IIJA 1JLKA 2DLCX 3TLKA 4MAMA 4JB3A 1ICEA 2P6PA 3CA8A 3C3MA 2CL0X 3I34X 4X1KB 1OXMA 2M1ZA 3ENKA 3SX2A 3BXFA 3CUEF 3FSGA 1JJBA 3T4EA 3QX7A 4OHMA 1ECPA 3EH2A 4PPGA 4JHLA 4BO5A 3KX2A 4CFZA 1P60A 3SJ7A 4BECA 5BMVF 3HGQA 2YWDA 2GEVA 3DEYX 3GLFA 1D4FA 4G63A 2E87A 3MINB 4FGUA 1L6RA 4IIYA 4PBTA 3WA6A 3NHWA 4L08A 4YGXB 3H8WA 1WHSA 3HN2A 2WHPB 5EHQA 2YL2A 1HF3A 1JZSA 1ZG3A 4M2LA 4UVDA 4QBTA 2R66A 4YRDA 4G37A 4BNFA 4MQEA 3RUHA 1LQ2A 1TO2E 1YZVA 5KNCA 2HMAA 3PLRA 1V3TA 3OAAD 2YZGA 1GU0A 1DFGA 3TQTA 3LECA 1EA7A 1QG4A 2QM8A 3OMWA 4ZCRA 2QLFA 3IAUA 5I8PA 3AEUA 3FTPA 2BBOA 1CXZA 1S2DA 1QUEA 2Y68A 4YXFA 1JB1A 3D4PA 1SHZA 4G4IA 2HLDA 1E89A 4FN5A 4J94A 4NFSA 5JNVA 1ZIPA 2D2XA 4RA6A 1XDWA 2BRUC 2R6JA 2WSMA 3KTAB 3T7IA 3G2OA 3VO9A 4BAZA 1TD1A 3PHIA 1U28A 1W44A 2UVPB 1J2TA 4C6HA 1W2HA 3FOFC 3H9CA 3QGMA 2V59A 1NP7A 4C4TA 3VSEA 4DCUA 4POOA 1O57A 4G07A 4MEBA 3QA3E 1WA5A 3CR3C 5K4GA 3W5CA 2X19A 4GP9A 4QARA 5FD8A 1WTCA 3I42A 1QVRA 3WQSB 1ZHFA 3V2IA 2FZLA 1KIMA 1OVGA 2HO4A 3AB3A 3M6LA 1ZCZA 1N34B 4K6GA 1C9YA 3B89A 1TVCA 3RANA 3WSWA 2YCLA 1E7SA 1EI9A 2JFYA 3B6ZA 5DH9A 3JRNA 4RVOA 5KYYB 4JVSB 3LOUA 2Z5GA 3U6BA 1JAIA 2DMRA 2R86A 3U7QA 2Y3IA 4O2LA 2YUIA 2DGDA 2FPUA 3W2HA 1Y3IA 4HFNA 2RAFA 4GZ5A 4IDGA 3ZDEA 3MWGA 3CQ9A 4PG8A 1KTIA 3AVTA 2IS6A 3FRJA 3PKJA 2E37A 3EIXA 1VYUA 3MOIA 4Q24A 2DM6A 2FW1A 3W2IA 3WK6A 3TGLA 2HRCA 1K7CA 1KR5A 2ZJOA 4FW8A 1WDMA 4S1VA 1KH3A 1GUAA 1RVDA 2FF7A 3I5UA 1BW9A 3NBAA 5BNWA 2XCRB 2PLNA 1M8FA 3LJKA 3O2QB 5DTMA 4KR3A 3EZ9A 1W35A 4FX2A 1D5WA 4KWTA 3VU8A 1PZFA 4R5HA 3IEUA 1MR3F 4RMGA 3L0BA 3VTFA 1CZNA 1RQPA 4ZTBA 1WEHA 3UJ6A 4CKBA 1PJLA 2GAAA 2C7GA 1E18A 3F4KA 4JKYA 2C8LA 5D1NA 1LU9A 5BV1A 4G9EA 3HZHA 2AOWA 1ESDA 2DLDA 3AI7A 4HNAA 5ALFA 4B0PA 4DNXA 1FTSA 1KJQA 1ZOSA 3NH6A 5AHRA 3VR3D 1QQ5A 4D4HA 2RAPA 1E64A 1I3OA 1TX4B 3DC7A 1BMQA 4HKTA 5TGTA 2JGJA 1Z8HA 3VO2A 2PBZA 2JKZA 2ZS7A 5TT0A 2NXEA 4CMEC 2QLTA 2AXEA 4RK4A 4PAMA 1UJNA 4D9NA 3NIWA 1ARZA 2RGEA 3CLKA 4WKPA 2OBNA 3JQBA 2GKSA 2XTNA 3WYFA 2A1IA 3GLGE 1SZCA 3HADA 3OC0A 2QTTA 1Y4ZA 2CNWA 3JAMA 4AG3A 1E3JA 1EB9A 1BFKA 2WBLC 5LUBA 3X1YA 3THYB 2V7GA 2HEIA 2QMQA 3B3JA 4ZV9A 4KQKA 3QEAZ 4KV7A 5E6SB 4CT0A 4NJMA 4A6XA 4PINA 5TNXA 4LBZA 2WWWA 4Q9AA 4LFCB 3DDNA 5DCLA 3CJTA 2QJFA 2O14A 2VAWA 1O8BA 3L7DA 5CHEA 4DDUA 4LOAA 4PS1A 1QR6A 1TTQB 3N58A 2ABWA 3ZBPA 2XIJA 4GX0A 3OY7A 5A5EA 3RIYA 5E3HA 1XMQB 4F97A 1L5YA 2Q3LA 4JL6A 1J0DA 3AWIA 5KPJA 3WYEA 4B6RA 2YZNA 1KL7A 2GA9A 4DQKA 1KI3A 1HEYA 3G68A 5K01A 1R2QA 1K8ZB 2I78A 3HGTA 3MFQA 1S96A 5BR1A 2AQHA 3FNIA 4S35A 5JYDA 4FJ1A 2ATXA 2QU7A 1VJ1A 2ZG6A 4WY2A 5JHGB 3GLFE 5HP4A 3LVFO 4FLEA 4RTJA 1X7XA 4DKJA 3IELA 4HDSA 3DFFA 5JFOA 1FOEB 1BWQA 2VBGA 3OZ7A 2C7QA 4JLJA 3AL3A 3CIFA 3EVTA 4J0IA 3TINA 5BO5A 3IQIX 3HSYA 4RK1A 4W5JA 2AW3A 2Z2IA 1FUKA 4L85A 4DXDA 3CLUC 1T3HA 4B46A 2UXDB 4RJ2A 1OWPA 2FN9A 4H7JA 3KB6A 3H86A 3S1SA 5AVWA 4FR2A 1K8QA 4DCSA 1XMIA 1NZJA 3AEZA 3IDSA 3KZVA 1PK9A 2GTIA 3THSA 4YUZA 3DAOA 1G64A 1W9HA 2WWXA 1EGHA 3I2JA 4B3FX 4F93B 1LGYA 1ID1A 3C4QA 4B9AA 1UXJA 4B2IA 4F3RA 1QO7A 4A5OA 2LIPA 4M0MA 4JEMA 2VTBA 4FFRA 4JBGA 4ZOLF 2I4OA 1OY1A 4CLDA 4DJ5X 2RKWA 2WB4A 4KFSA 3WC4A 2OENG 1U0OC 4ENSA 3GFPA 4NS4A 3CVOA 3L7YA 1IC6A 2RHCA 3NAGA 3ORYA 4R2LA 4BO2A 4HXFB 4EUNA 5HX7A 3NT5A 4FFWA 4D6XA 4N54A 1XD8A 1LBIA 2H7VA 2W6MA 4JC8A 5FA8A 3GLVA 3K8YA 2ZIUB 4TKVA 1H9CA 2QL5A 1J99A 4UBNA 5KTTA 1NXQA 3ASYA 4KR6A 1E2JA 4DGQA 2YJNA 3UBTA 1J49A 2PQ2A 1R7RA 4PRKA 3UMSA 2XADA 2C2OA 3O8RA 1R5JA 2I8AA 2XDQA 4MQ5A 4XUEA 4LRSB 4XDGA 3ZGNA 2PRJA 2SKEA 4GL4A 2W2LD 3IUBA 3N3AC 4HWKA 4KSBA 2GK4A 5TXGA 2O9JA 1P2VA 3LXRA 4ETIA 2JEOA 2JGIA