2PLRA

Crystal structure of dtmp kinase (st1543) from sulfolobus tokodaii strain7
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
212
structure length
212
Chain Sequence
KKGVLIAFEGIDGSGKSSQATLLKDWIELKRDVYLTEWNSSDWIHDIIKEAKKKDLLTPLTFSLIHATDFSDRYERYILPMLKSGFIVISDRYIYTAYARDSVRGVDIDWVKKLYSFAIKPDITFYIRVSPDIALERIKKSKRKIKPQEAGADIFPGLSPEEGFLKYQGLITEVYDKLVKDENFIVIDGTKTPKEIQIQIRKFVGELIDNSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of dTMP kinase (st1543) from Sulfolobus Tokodaii Strain7
rcsb
source organism Sulfolobus tokodaii
molecule tags Transferase
molecule keywords Probable thymidylate kinase
total genus 86
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2007-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2plrA00
2YJTD 4GOXA 4CYMA 4GRAA 5CDFA 3OEHA 1N6HA 4K81B 1EXMA 1JALA 4CW7A 4A36A 3SEAA 3EIHA 5JEEA 4KO8A 2H1LA 5TARA 3WHKA 3U3KA 1KI6A 3W8RA 5FH9A 1H8HA 1E9RA 1M7GA 3X1XA 2RHDA 1XCMA 3D8BA 3ZYCA 2FU5C 4QJ3A 1FUKA 2RGBA 4M1YA 3GPLA 3AUXA 4M4SA 5FOSA 2QP4A 3I1FA 5HCIA 2IYVA 5EE3A 2F1RA 4NP6A 4ZI2A 2ZSAA 2IBMA 1IJFA 4KFRA 3QKSB 2BJWA 1L4YA 1UEJA 2EYUA 1E3MA 2QSZA 2V55B 2Z43A 3SHFA 3A1VA 3BC1A 3FHTA 3EPJA 3ZVRA 2VH5R 1G41A 1Z6XA 4Z51A 5FBLB 5CDFE 2QE7A 4TYYA 3IDQA 5AK0A 2PX0A 1KTVA 3OHMA 3U4QB 3ZZUA 5E3HA 1RKBA 1EK0A 3NH9A 3S1AA 1TF2A 3AEZA 3OIVA 4V0LA 4KJZA 3SQXA 2FSIA 1HA3A 1G8YA 3U7FB 1A7JA 5EP2A 3THOA 4Q4AA 3CIOA 3ZLJA 1UEIA 4CIDA 5CK4A 1NKSA 4G5GA 1W7AA 2IHYA 1VECA 5E7JA 3QF4B 2QROA 1ZBDA 5EUQB 1XTIA 3RHFA 4AY2A 1KMHB 3O8BA 3CB4A 1GNQA 1Y3AA 2BMEA 3BRWD 1DAKA 1SXJE 4JT2A 4XTRA 2WJIA 2A5GA 4A92A 3CBQA 5K8IA 3TE6A 2GK7A 1MO6A 3DKPA 4R9UC 2IYXA 4TMZA 1DBSA 2WJHA 3G82C 1U9IC 4C0KA 1UAAA 3QSYA 2ATXA 3AF1A 2KE5A 5IK2D 2B92A 1L4UA 3Q9LA 2WOOA 3L8YA 1Q21A 2QMEA 4JL8A 4P0TA 4V0MA 3IO5A 2V6JA 2GTPA 2AN9A 2V7QA 1UKZA 2WHXA 4ITRC 4EIWA 3BS4A 5L3VA 2BCJQ 2OXRA 4N0DA 4C0BA 1ONBA 3KQLA 1S3SA 4Q7KA 3U44A 1XCPA 2EFEB 3KKQA 4LDJA 4LSGA 3WRXC 2DYKA 2J46A 5SZKB 1BS1A 5J4HA 1RJ9A 4CEHA 2BVNA 2CLCX 1MH1A 4TL9A 3WBJA 4XVRA 1G7CA 1X8KA 2FEOA 3CZPA 2IEZA 3W6OA 2IYLD 4HLCA 2ODBA 3AF4A 2QAGB 4A4DA 2F3RA 3B1VA 2RMKA 3BB3A 4L4UA 2FH5B 2E9SA 3A4LA 2W0MA 4WZBE 1IN4A 3AGQA 4A0HA 2QT0A 3CH5A 4N0EA 5ELXA 1FTSA 2IXEA 5EUMA 3AVTA 1MABB 3NDBB 4RKFA 1G19A 1D5CA 1AS3A 4FMCF 1GM5A 1AZSC 4QOSA 1KK1A 4AWXA 4YC7A 3SE0A 4CEJB 2ZIAA 3QVUA 1JNYA 1U0JA 3EZ2A 5DIFA 4BWYA 1F2TB 1Z6YA 4H9GA 1E2IA 2QQ0A 1QG4A 2BIFA 1CJKC 3H2YA 3LV8A 5IRCD 4JBXA 5DYGA 1E0KA 3AF3A 4MKHA 1E99A 4ESVA 1F2UB 3U3MA 1O3YA 3P26A 4C30A 4BLQA 3KUCA 1LV7A 3FMFA 1X8JA 4O25A 4F4JA 3ZQJA 1KIMA 2V3CC 4OL0A 3FWYA 3ZH9B 2EWVA 3QKRB 2YC2C 5FL3A 3I61A 3MMPA 5JHGB 2IUTA 4XH9B 2D2EA 2E1RA 3SC3A 2AWOA 2GZAA 4OBEA 5G3ZA 3LY5A 4Z8XA 1UBFA 1XEWX 2I1VB 4FMBB 1WQ1R 3RSOA 3U6BA 3UPUA 3AVQA 3K9GA 2XXAB 3ZVLA 1W36C 1N0WA 1ZJ6A 4EPVA 2VF8A 3K09C 5CM9C 3T1OA 4BZQA 4OQMA 5BW8A 1GVNB 1U98A 4WBSA 2C04A 1ZM3A 1HQCA 3C5CA 1E1QA 3SDZA 3QPUA 4LY6A 2D7CA 1GL7A 2HF9A 3HR8A 1WE2A 2X77A 2DWPA 4Q00A 5JLJA 1QDEA 2QT1A 4JVLA 2H18A 4QXAA 3CF2A 4HB3A 3CRVA 2PZGA 1UF9A 3T1TA 1RRCA 2P6RA 2K5UA 2Z83A 4KCGA 4HB0A 1JBKA 1W5SA 4M9QA 2ODEA 5CIWA 1GZSA 1CEEA 4DB2A 3GP8A 5DI3A 3BOSA 2XNDA 3GEHA 4L8GA 3A1UA 2F6RA 5GJVC 4BGDA 3QXCA 4FCWA 4HB4A 5TY0A 2VIIA 4BEJA 4QBIA 4OHWA 1SULA 3MCAA 4D4LA 4B3GA 4DLTA 5L8VA 1ZINA 5FTLA 2RH5A 4PC3A 3BH0A 1T8TA 3A8TA 1II0A 3NG1A 2WPDA 1OKKA 2ATVA 4AIIA 2RGAA 1I2MA 1Z2CA 3IUYA 3TQFA 3PUVA 5JCZA 4CEIB 1RIFA 2AX4A 2WPDD 1JXOA 2F9MA 4LJAA 1MRSA 2ZETA 1XWIA 3B8HA 3PEWA 1MO4A 2FN4A 2OCBA 5LPNA 1NI3A 1F2TA 5BYJA 4B34A 4Z1MA 1DADA 2NO7A 5HZKA 4AKGA 4OHVA 2HCBA 1RC8A 2H16A 2YNMA 5DHAA 3IIMA 3BFKA 5C1BA 3BORA 4QG7A 4PC7A 5CK5A 3ZQ6A 2CL6X 3LH5A 3UXMA 2HDNB 4B6FA 2VTKA 2VP2A 2CCGA 2ZUDA 1K6MA 3KDSE 1IXRC 2ZI6A 2J0UA 1SQ5A 1E9SA 4B71A 2X2FA 2N46A 2R62A 1TX4B 5FR2A 2WV9A 3X1WA 3FGNA 1EWRA 3LDAA 4DLXA 4B74A 3Q85A 5JWOA 3W90A 1DAHA 3HU3A 5ANRB 4TLEA 3E2IA 3T06B 4HLUC 1E1RD 3U7GA 1QG2A 2C8VA 3LX8A 5GVSA 1YR9A 5BYKA 1LF5A 3I5XA 3RRMA 3AUYA 3KFVA 4HATA 3FVQA 3TH5A 1JI0A 3MJRA 1KGDA 4QC2A 2FPKA 2JAQA 3KUDA 1FX0A 1UKVY 3EZ7A 1OHHA 3QEOA 1NMZA 5A0FA 1O87A 3TQCA 3RAPR 4GNKA 4Q19A 3TR0A 5KNBA 2PMDA 2QL6A 2XJ9A 3M1IA 5AWFC 3SR0A 1NJFA 3A1SA 2BKEA 2ZYTX 3MSXA 3DKVA 3ZIAA 2FF7A 5FTNA 5KNCA 2JLWA 4URXR 4MYCA 1L2TA 3NBXX 3C4JA 1HE8B 4GZLA 1JQJC 3VQTA 3CX8A 1ZP6A 3CX7A 4KODA 2BBWA 2QAGA 1A2KC 1E4YA 3WY9A 1EFRD 1ZM2A 2REOA 1N5LA 1GKYA 4PX9A 3IHWA 1DPFA 3LLUA 1SVMA 1Z08A 3DHWC 4DEXA 1IBRA 4C0JA 1N6IA 1N5KA 1ZNWA 2W6IA 5DNYB 2BEJA 1CKEA 2WWIA 2QEQA 4I1VA 2WBLC 3TMKA 3B1XA 5C18A 3NVAA 1XEWY 4TYNA 3PXGA 2PEYA 3LBNA 3NXSA 3QF7A 4M1WA 1SHZA 4AYXA 5KPDA 1E2FA 2Z6VA 2ZM5A 4DLUA 2OBMA 1XMVA 4NYJQ 3AVUA 4CEJA 1R7RA 1CXZA 4Z8YA 4TLAA 3SNHA 1KNXA 1R5NA 4DC9A 1LFDB 2GVDC 2FG5A 4TMKA 4LHWA 3VKGA 5EE0A 2J59A 3E70C 3WBKA 5AR1A 3X2SA 1XXHE 2HLDA 2ZS9A 3KXLA 1KY2A 1EG7A 4B2PA 1OIVA 2ZYWX 5J4KA 2VHQA 3KL4A 1RYHA 3JZAA 1T0HB 5L3QA 1KAOA 2ZI4A 1NF3A 4Q1FA 2XAUA 1Q0UA 2A78A 1VPLA 1U90A 4J0QA 3RRYA 3BXZA 1NSFA 4URWR 2P67A 1P2VA 4UXJA 4QNRA 3WMFA 2FSGA 5JS8A 1I4TD 4Q02A 4LC1A 5B64A 1OXTA 1PLKA 4PXAA 4G5OA 3WNDA 4S35A 1FNMA 1II8B 2ZS7A 3GD7A 3TGPA 2YOFA 3EC2A 4XVUA 1HV8A 5FBWB 2ZTSA 4WVFA 1Q3TA 1QHGA 2DY1A 2NO1A 1OFIA 4PSKA 4RKEA 4XTCS 3AM1A 4HUQA 1NVVR 3R20A 4NL4H 3JVUA 3NC1C 1HURA 1IHUA 4ZV4A 3J81k 5P21A 1D2EA 3RNLA 3VKWA 4XJXA 4KAXA 4DBLC 3O8CA 2D2FA 3GLGB 1W2HA 2FFBA 4AURA 1KJWA 4XWAA 1G3UA 5EP4A 1WMSA 3GLIB 4ZIRA 2CJWA 4PAMA 3RS0A 4NCHA 3QKUA 2WJYA 2GHIA 5BN4A 4BFWA 5HPYB 3P4XA 3KJGA 3PG5A 4K8OA 4Q7MB 1OLOA 3K0FA 2B7CA 2YINC 1JQLB 4PQRA 4DUGA 3AVPA 2RGCA 3MGCA 2WOJA 3DL0A 3GJ5A 4TLBA 3A4NA 4WXRA 5FTKA 3U5ZB 2WSMA 4NBSA 4MDFA 5DI9A 4R7ZA 4WXPA 4DCNA 4O3MA 4EJSB 2FEMA 3FE2A 4RZXA 2GETA 2DWOA 3SS8A 2QUZA 5GADl 1U2RA 3QEJA 3B5JA 3W8NA 1G7TA 1QHXA 2GEUA 1E2GA 3MRSA 2XTNA 4G5SA 4TQUS 1TTTA 2R6GA 1CU1A 2JLRA 3QKRA 3LVQE 3GLHB 4DSUA 1FPMA 2ORIA 1C9KA 4A0FA 1FP7A 1OXVA 4LV5B 2AFIE 1Y63A 1ANKA 2F43B 2OUKA 2HXSA 3O47A 3PUZA 4TTPA 3UATA 3VFDA 4C9BA 3ADDA 3CF0A 3KKNA 4LCBA 2XEXA 4I1UA 1LY1A 1BH2A 1OXUA 1XZQA 2VSOA 5F9FA 3BD9A 4OQLA 3WMGA 4MGIR 1E2JA 4RD6A 4Q5IA 1KI3A 1U8ZA 4ON9A 4Y0AA 2IWHA 3WP1B 3IO3A 4YMTA 1SGWA 3B1ZA 1XXHB 2CVHA 3QBVA 3DPUA 4NPHA 1GKUB 2Q9CA 4F38A 4BFSA 2GJKA 2WWGA 2P5SA 3NBZC 1Z22A 5JHHB 2O0JA 2IWRA 1RRPA 2C98A 1U0HC 2DHRA 2ZITA 2XB4A 4GOKA 3EC1A 4EKDA 1QHHA 3IIJA 2KJQA 1Z2AA 1E6CA 2NG1A 3CF6R 2AKAB 2HEIA 2LKDA 2VO1A 2ZRNA 5CYOA 4BFYA 3LNCA 3SJBA 3QPWA 1IY1A 3X1ZA 1GNPA 2PMKA 3AP1A 2BMDA 2XZPA 5JZVA 3N5CA 5JMTA 4TTRA 5FBRB 3KJEA 1GL6A 2OILA 2P0EA 3R9XA 4Q9HA 1ZD8A 2ERXA 4X8LA 1Z0IA 1G1MA 1G8PA 4D26A 1DO0A 5JJLA 2BKUA 3B1WA 4JLMA 3WP0A 4WOPA 3VR5A 4ACAA 2EW1A 2REBA 1E9EA 1U0LA 2J9RA 3SN6A 5GJWC 3CRRA 3VNUA 1VCIA 4BUJA 1EFHA 1HUQA 3HPRA 4ZIRB 3AVVA 1TQDA 5KDOA 1KO8A 3THWB 1JB1A 4PPGA 2JLUA 2VYFA 4JLOA 1E2PA 1T8UA 2IYQA 1GNRA 3PEVA 4Q1BA 2ZROA 4JLNA 4B6EA 1X3SA 5L3SA 3L0OA 1D2NA 3IBYA 2RGDA 1II9A 4A8JB 2PZFA 2G0TA 4URUR 2V1UA 2GJAA 2ORVA 3GCGA 2CMKA 4TMVA 4DDVA 2RGNA 2JLQA 4EFLA 2ZVQX 2J0UB 1Z0FA 1E9DA 4JLPA 1BMFD 1KNQA 1YU9A 1QHYA 4JBWA 2AXPA 2IW3A 2QRZA 2ZRGA 3TIFA 4PPNA 3LRPA 1WBBA 2RGGA 1M7HA 4L15A 4X8MA 3HR7A 1ZUIA 4QHYA 2WIBA 2UVQA 1XTJA 4NTZA 2YZ2A 3TUIC 5JFGA 2QG6A 3VU9A 5JCPA 1U94A 2ZREA 4KV9A 3IQXA 1E94E 4A8JC 2OFOA 3UG6A 4F92B 1XRJA 1JR3D 2OAP1 1TL7C 4MYTA 5FPTA 2FE4A 1COWD 4A2QA 1UDWA 1LTQA 4LJ8A 3OF5A 4BFXA 2ZYUX 2GWHA 2GKSA 2YOGA 4OHZA 2GEVA 2ODWA 4DDWA 3VHLB 4RD0A 5IF9A 2QA5A 4JVSB 4L9WA 1DG3A 2B7BA 2REXB 4GMXA 1WBDA 4GSYA 5EXTA 4L16A 2ZRMA 1Z06A 5FPSA 1N25A 1Z5ZA 2XTZA 1ESMA 1VCMA 2XNSA 3K0EA 1ZAKA 4QHTA 3EA0A 2ZR0A 3P1JA 4I1OA 5L3RA 2GXUA 2W6ID 4YQFA 3MWYW 1JJVA 1CLUA 1OYWA 5F2EA 3ZDQA 4LV8B 2PT7A 2O8EA 4NYMR 3NEYA 4TT3D 4YMSA 1EFTA 3O8RA 2ECKA 3TAUA 4E09A 3NHAA 4M1TA 1KK3A 1ZD9A 2ZR9A 1WDTA 1ZRHA 3C41J 4LX0A 1S4QA 5E4FA 5DYIA 1ZC3A 1E9FA 1YVDA 2W58A 3RS4A 4M8NE 2PCJA 4M53A 4TL6A 1DARA 2QY9A 1R0YA 3QJYA 3ZIAD 1B0UA 1XFAA 2F3TA 5G53C 3ASYA 3THYA 4ZCLA 4HDQB 2NO6A 2VEDA 4EAQA 4Z54A 1TF7A 3DO6A 3BBPA 1DTSA 3AF2A 3QF4A 2ZVPX 4IDNA 1VDZA 3K0AA 3LBHA 4JZKA 1OSNA 2IA5A 4Q03A 3VX3A 1VYUA 3W3AA 1P2UA 3R7WA 1GTVA 1TPZA 1I2DA 4MGKR 3WRYC 5K8UA 2FPMA 1UKYA 5TV2A 3B60A 3IKJA 1MT0A 5J40A 3AKEA 1IN6A 4TN1A 4AKHA 1S1MA 4IFEA 3ASZA 1JR3E 2F43A 2GCPA 2ZU0C 1KI6B 3I73A 4RY2A 3KTAB 4BZXA 3MG9A 1XEFA 1R4AA 1TMKA 2OFXA 6Q21A 3I72A 3MJHA 4TSFD 4TYPA 4QJ4A 5FOWA 5FTMA 3MWLA 4AD8A 2JJ2D 4BECA 4C2TA 4RZUA 1QHSA 1J70A 2RGEA 1P5ZB 1ZMXA 1NLYA 1W4RA 2ZJYA 3HWSA 4S2EA 1LB1B 4M2LA 2YWHA 2DFKB 3LAWA 1P73A 1TEVA 2VQSA 3CWZA 3DM9B 4HAXA 1AK2A 4MUAA 2RHMA 2BEKA 3RS3A 3TNFA 1TUIA 4V0NA 5AUNB 2VHTA 5UKDA 1IONA 3WNCA 4Z1MD 4P33A 4FI3C 2WSSD 2PH1A 4BRWA 2JLVA 3NBFA 4XOIA 4Q9LA 5AJXA 3CRMA 4G0NA 3IILA 1IM2A 4AG6A 5CITA 3M4YA 1IN7A 1QF9A 1Z07A 1TQ2A 3AF0A 2ZJBA 4XIGS 4D4KA 2UKDA 5EXPA 1N6NA 2ZRDA 2AK2A 3PENA 4DSOA 1ZNYA 5H70A 1OJLA 4LRWA 5C4MA 4Q18A 2JJ8A 3QKSA 3TVTA 4PSVA 4D25A 4TTQA 2C9CA 3HPQA 3CM0A 1IXSB 4Q9JA 1W5TA 4XWKA 3SFZA 2ZRPA 4QKQA 3EX7C 4C7OA 3QG1A 1W1WA 3AVYA 1G3RA 1PZNA 2WWYA 4JT4A 1OH8A 5DLQC 2QAGC 2C95A 3GLHA 5B30A 1GSIA 5KSYA 3GFTA 3CH4B 1D9XA 2RKOA 4RSGA 1GDDA 1XD2A 1GWNA 4L9SA 2P6UA 1XPOA 1E0JA 5CB6A 5G40A 3F3YA 2QNRA 2SHKA 4ABYA 3BFXA 4I99A 3UMRA 2R6DA 5BQ5A 2W6JA 5TMPA 1J8YF 3TUZC 1G5TA 1ZCBA 2ZAMA 2JDID 3B13B 4PC6A 3OIWA 3R7WB 1RW4A 3CRW1 2GVZC 1KI8A 4DJTA 4QGFA 5JSZB 3K8YA 5HKKD 3FFAA 3EASA 1XTSA 3B9PA 1E9AA 4LHYA 1QHNA 3NH6A 4WZAE 3TRFA 2C96A 3QNUA 1K5DA 2IYYA 4UJ5A 4IDQA 4FWIB 4B47A 2HYIC 4FMCB 1K5GA 3RWOA 4UKDA 2GDJA 3MLEA 3IPXA 4OI2A 3C5HA 4B3BA 5EJEA 4FN5A 1ODFA 2FJUA 3AGPA 4NHOA 3T15A 3VR6A 3K9LA 2QI9C 4BFZA 4IXNA 3GJ3A 3PFIA 3IBGA 4ILEA 1KJYA 1MABA 2X19A 2QTVB 3C14C 5G3YA 3ZGXA 1EFUA 2OSBA 1XU4A 4Q1AA 4TMWA 1P2SA 1OE0A 3RS7A 1G9XA 2MSEB 2QTHA 4KSBA 521PA 3T1VA 2GK6A 2JA1A 4IOMA 3UMSA 4DKXA 1GFIA 1G291 3Q8XB 5F9HA 1XPUA 3U6KA 4DSTA 2DFTA 4WZ6A 1D2MA 3V9PA 1E0SA 4TZ6A 3ZS9A 1SVLA 5JJIA 3AP3A 2JJ1D 4OK3A 4I1SA 3QBTA 5EZ6B 2AWNA 4DLSA 1F3OA 2O0KA 4RJLA 1HQYE 2C9OA 4LYHA 3EIQA 3EZ9A 2R8RA 1OB2A 1XMIA 2HJVA 1AIPA 3CX6A 2QP3A 3T5GA 3K0CC 3RS5A 1QBKC 3QOFA 4Q4LA 4YDSA 2PLFA 3MWJA 4UXHA 2AFHE 2KBFA 5EE9A 2MMCA 2G83A 1HE1C 3SBDA 4P4SB 1W47A 2BBOA 3THXA 4D0LB 2FWRA 4JVMA 4A0GA 1NNEA 1T3HA 2ZAOA 2B8WA 1A82A 4IKEA 3VU9B 2JLZA 2NPFA 1DAFA 2VSFA 1NBMA 4DVGA 3T1QA 1CR2A 2XOKD 5D3QA 1G8HA 3U2QA 4TMTA 821PA 3DVLA 3QVVA 4IEIA 3KKMA 1AKYA 5E95A 1PVOA 1JAIA 4RFSA 2DFLA 1KI1A 1G4UR 3ZD7A 4GFDA 3K9HA 4M9SA 4RZ3A 2XXAA 1G6OA 4CF7A 2IHBA 4CT5A 1BYIA 2FFAA 3L43A 2J3EA 4URVR 4D80A 1YZUA 1XEXA 4N3NA 5IK2A 1LS6A 2O8CA 4W5HA 1XF9A 1F6BA 2NGRA 3ND8A 1UDXA 3PUYA 2QBYA 4OJKA 3KXIA 1KDTA 3KFXA 4TYQA 2Q3FA 2PL3A 3CPJB 4RD4A 1EFCA 1OT3A 2H7VA 3EARA 4BLSA 5KOYA 2F1JA 3KJIA 4HUTA 5SZHB 4MRNA 4W7SA 4F4IA 4UNRA 1FP6A 2C9YA 2XZOA 4Q4JB 1P72A 2QP9X 3TVDA 1ZD1A 1NMXA 4YLGA 2HYDA 4XWOA 2IYTA 3SHWA 1SKYB 721PA 1S96A 1F60A 1DO2A 2CL0X 5TB5A 2BHRA 2R6AA 1OH5A 2NZ8A 2ZRBA 3GJ6A 1SXJC 1MO3A 1DE0A 2QORA 4ZO4A 2CDNA 1KO4A 1ZM7A 4M22A 3NIBA 1Q1QA 1A2BA 4AYWA 3D7MA 1MKYA 2MSCB 1RFLA 3UMFA 2WJJA 4HZUA 1E1RA 4JKYA 3EG5A 4M9ZA 1GILA 1TQ4A 4PPFA 4F91B 2O0HA 1TF5A 3HJNA 3I62A 2J7KA 3UK6A 4GZMA 2RCNA 4Q7JB 2QPAA 4GP7A 2UZIR 2NIPA 4DIEA 1S9HA 4A2PA 3B7GA 3OFND 5FOTA 1QZXA 4JL5A 4OQNA 5AJZA 1R5BA 4ASUD 4BE7B 1EESA 4GPTA 1M8PA 2J1LA 2YV5A 3MAAC 1GRRA 4M1KA 2C78A 3W3ZB 1NG1A 1U8YA 4B3FX 3X1YA 3WMEA 1AA9A 1DOAA 1KKMA 2W0SA 3FMIA 1SZPA 2OCYC 2XOKA 1T5IA 2YWGA 5HCNA 3W9YA 2WKRA 3VHXA 3NKVA 2PT5A 1FX0B 1Z83A 2FNAA 2VSXA 3Q72A 1H65A 5L3QB 3Q3JB 3QY0A 4O2RA 4RFSB 2C03A 4MITA 4PQYA 1J99A 1XD8A 4NYIQ 4US1R 3T12A 3F8TA 3OFNA 4Q1CA 3KX2A 3B2EA 2FSHA 3BB4A 2GAOA 2ZJ5A 3DOEA 4US2R 1M34E 1KDPA 3GEIA 2OE2A 4C0HA 5B57C 3QENA 2ZI5A 2G77B 1TEXA 2QM7A 2BOVA 1X8LA 4W5JA 2WWWA 2QQEA 4FXPA 4BZPA 2C5LA 2V9PA 1PUJA 2WTUA 2IS6A 2WWFA 2VBCA 3ADCA 4KHZA 1GL9B 4UQOA 2JDIA 1OFUX 1U9IA 3FFBA 4EQ6B 4EPTA 4G5RA 4UJ3A 1T5LA 3FMPB 3SJZA 421PA 3BB1A 2GA8A 2TMKA 1OYYA 2W6JD 1Z8FA 4LPKA 1YE8A 3W6NA 1P2TA 3MFYA 3LO5A 2ZI7A 1OH6A 1CF4A 2WJVA 3WNBA 2ZJAA 3BGWA 1XP8A 1PV4A 1FNNA 3FKSA 3GLIA 4ARZA 2ZSDA 2GF9A 2H57A 5E7MA 1R8QA 2ZE7A 4CVNA 1Z0DA 1A1VA 4D0NA 1T6NA 1Q57A 1T0JB 4G1UC 4GDFA 2ZUCA 3K0SA 3U60B 4TL8A 2EVWX 4B33A 2A5DA 2ZRLA 2FPLA 3K1JA 3L0SA 4HSEA 5BWMA 3CPEA 2B8TA 2KWIA 2G1KA 3FDIA 3PQCA 4FINA 4EFMA 2FMXA 4LJ7A 4LHVA 1G3MA 1XCGB 2Z5FA 1KZGB 4P4SA 621PA 4M1SA 4LYJA 4M1MA 3FKSD 1IJEA 4KYIB 1SVIA 5FR1A 4X8HA 4MYHA 5E7IA 5DH9A 2WSSA 8OHMA 2MMGA 2JIZD 2F7SA 4MKGA 4DCVA 3HYTA 5K8LA 1IAQA 1RYFA 1E32A 3B1YA 3EPKA 3AKYA 4E03A 3KQKA 3G5UA 2ZANA 2BMJA 3K53A 4JLBA 5KNDA 2VA8A 2Z4SA 2ZI3A 3EIEA 1OF1A 1SXJD 3GLGA 5KO2A 4HLQB 2IS1A 1ETUA 4KU4A 3QXSA 2V8OA 4BLTA 1YR6A 5AJVB 2B21A 2V4ZA 4WW0A 2QGNA 1VTKA 2C2HA 1R10A 1DEKA 3U44B 3RABA 3ND9A 5JRZA 4U02A 1M2OB 2I3BA 4XD7D 2IYZA 5JRJA 5F3WB 5FTJA 4B3XA 2OZEA 4ZI3A 1BIFA 1X1SA 4UNPA 2GXSA 3BH7A 3CR7A 1BMFA 4EQ6A 2WICA 2CJWB 3CR8A 2BV3A 3S1AB 3RSLA 2WZQA 3SJAA 2AKYA 3SZRA 2WJGA 1DG1G 4A6XA 3QXXA 2R44A 2O8DB 1G18A 4NU0A 2RGXA 1G6HA 1KMHA 4KVGA 2ZE5A 1R8SA 2ZRHA 3TBKA 1UM8A 5C46F 5F98A 3NWJA 4C4PA 1S0UA 3W5IA 3I5YA 4G01B 5HE8A 4D6PA 1B23P 3VTKA 1Z47A 1ZU4A 4XVQA 4B3CA 5FUVA 1TAGA 4TT3A 2J45A 1BO6A 1YR8A 1RJ9B 1C1YA 3O8DA 2ANBA 2J0QA 3I8SA 3PITA 3BE4A 3H0KA 2ZR7A 4A2WA 2RAPA 4TQAA 4IDPA 1CULC 4DB4A 1XEXB 1DAEA 2CBZA 3U3RA 1QRAA 2CLDX 1XTQA 3FHCB 5AJWA 1Z28A 3ZS8A 4KFSA 5SZIA 3SOPA 2GXAA 2W2VA 4JLJA 2ANCA 1ESNA 1LF0A 1N6RA 1AQYA 1JJ7A 4CEHB 1KO1A 1QVRA 1XTRA 3QXHA 4MH0R 1Z3IX 3PV0A 3P27A 2VP4A 4LUCA 1E9BA 1VG8A 4OI4A 1XBTA 1HT2E 2EWWA 4XSGA 2D06A 2ZSBA 3A6PC 5SZJA 2ZE8A 2OCAA 3WYAA 3PEUA 1KDRA 3M0EA 4WIAA 4OQFA 1XJQA 4EPXA 2GCNA 3B78A 4E5UA 3L2OB 3X1DA 4B35A 2J87A 1U81A 1JECA 3A4MA 1HH4A 1IQPA 4RZ2A 5CYPA 5LB2A 2D74A 3K09A 2PEZA 2PBRA 5FL7D 3TK1A 4M9XA 4F93B 1IY0A 2O8EB 3F0TA 2GRJA 4DT1A 1FOEB 5HKKA 3NEJA 3LWNA 4LYFA 2YVUA 1KSFX 4QGGA 5DHFA 4KITB 1J7KA 1KI7A 1NBMD 2IX3A 1P3JA 1XX6A 1E2EA 3IIKA 4POAA 2FFHA 4BFTA 2QSYA 4CEIA 3SYKA 1CJMA 1NIJA 3GLIE 3T61A 2FX3A 4OHYA 5HZHA 1UFQA 1VMAA 4ZDWA 1VIAA 1GP2A 1NKTA 2NQ2C 3GJ0A 4V0OA 5DSZA 1F2UA 1VCNA 5EZ5A 3SJCA 1NVWQ 3QUSA 2BDTA 1CJVC 1M6NA 4ZDIA 2JJ2A 1OH7A 4TSFA 3K0AB 2QPOA 3CO5A 4PR0A 3K0CA 4HDCA 4Q66C 2QMOA 2A5FA 4B76A 3IEUA 3LQQA 4IHQA 3KXKA 3ADKA 4W5WA 2QM8A 1D8TA 3GLHE 4QJ5A 2P65A 2ZRFA 2JCSA 2ODNA 3OEED 3PJRA 4JLAA 3C16C 2DBYA 1N6OA 1YHNA 5C4GB 4PFSA 5AUQA 5G41A 2OFWA 3WXMA 3R9IA 1ZYUA 1ZC4A 1CP2A 4LGMA 2O52A 2IXFA 1FMJA 3FTQA 2JLYA 4R2IA 3KB1A 4LK2A 3V4FA 1E0AA 2GF0A 1KK0A 2N42A 1P9RA 2BC9A 1RRFA 1OW3B 5DISB 4F7WA 1EWQA 1ZIOA 1G4AE 2JLSA 5A5GA 5DN6A 4BPBA 2JATA 2A2ZA 4ZKDA 1ZM4A 2CHQA 4OK5A 1QHIA 4H1UA 1CRPA 1WCV1 1ZU5A 2OBLA 5JEDA 5LD2C 5FPHA 5LBIA 4MGZR 1NMYA 3KZ1E 5JS7A 3NHBA 2O8BB 1Q12A 4MRPA 1GIAA 1UJ2A 4KXFB 4D4MA 3GMTA 4PPQA 2DB3A 4LOAA 5EP3A 1LNZA 1ZVQA 1E69A 1P9NA 1JEEA 1FTNA 3JVVA 4HLUA 1L8QA 1S1CA 4MRVA 2H8KA 2NMVA 4P4UA 3LFUA 4QBGB 2FGKA 2J0SA 4LHXA 2CL7X 1AN0A 4RCZA 4UNNA 1Z6AA 1XDBA 1MV5A 4FW9A 4PC2A 3RDPA 3DM5A 2BBSA 3IEVA 4GL2A 1ELOA 1KI2A 1G8FA 1VIYA 5TDHA 4IOKA 3VR4A 4NONA 5B58C 4RVCA 3SU8A 1R2QA 1T3LA 1E2HA 2LWIA 1P6XA 3NBYC 3T34A 1V5WA 2N1BA 1OPXA 4ZDKA 3VR1A 1W4CA 2L0XA 3FYHA 1XD9A 3N2IA 5CIQA 4DXAA 4QFMA 2QMUA 4Q48A 4BEBA 2XGJA 3RLFA 4RD1A 1R0ZA 3UWOA 4B43A 2W2XA 1UBEA 4U00A 2FFQA 2Q0HA 1GKIA 1PLJA 4NE2A 5J4VA 3TKLA 2ZJ2A 4P3YA 1JR3A 5HE9A 1Z6TA 1BKDR 3DEFA 4C0AC 3GLFA 4I81A 4FCVA 4B44A 2J0VA 1G16A 1FW6A 3PEYA 1ZNXA 3ZZTA 2GJSA 4B2LA 4PAQA 2EYQA 3OESA 1NY5A 2OESA 2QPTA 3EZFA 3QG5A 4OKSA 4YMVA 1KSHA 4DHEA 5BN3A 1M1YE 4RD2A 4C3ZA 3A36A 2VHUA 4BFUA 1KDOA 2AXNA 1AS2A 2PCLA 2ZSFA 2ZS8A 1A5TA 5FUWA 1BYUA 4B73A 3UKDA 5LDDC 2ZUBA 1J8MF 3GFPA 4HAVA 1N5IA 2IUSA 3AVOA 3LW8A 2XSZD 2V1XA 4Q01A 5H1YA 2A7QA 2LKCA 5C2JB 3CPHA 1W4BA 1YZTA 3A1WA 4NKRA 1II8A 4CGZA 1YQTA 1UBGA 2AHOA 3OAAD 4LJ4A 3H1TA 4ZDJA 3A37A 3L8ZA 121PA 1JAHA 3PCRB 4JJZA 4NYMQ 1NY6A 2WAYA 2O5VA 3RYTC 5KSOA 2G9NA 1NP6A 4OYHA 5EE1A 1G5PA 2KBEA 3OZXA 3RC3A 2XITA 2PLRA 2YYZA 4LJ9A 5LB4A 4QGHA 4JLKA 3LA6A 1IXZA 1NRJB 4IDOA 2CNWA 3TSZA 5IHPA 4H1VA 3ZJYA 2ZRAA 4PSAA 5J5CA 1KY3A 1M7BA 3BWDD 2WWXA 4U5XA 1AGRA 3CKLA 1XMJA 4V0KA 4FMDF 3BK7A 4LI0A 2IYSA 4LWZA 1P4SA 1E2KA 2QZ4A 1HTWA 1E2NA 2OHFA 4KI0A 5IDVA 5B2ZA 1W36B 2O8DA 4LZZA 3SI7A 3WYFA 3NTUA 3W34A 1AGPA 4EDHA 1G8GA 4HUQB 2IXGA 2IK8A 3K0FB 4R2HA 2FV8A 4ACBA 1M74A 3U3OA 5AJYA 1MOZA 2E87A 4AC9A 3VX4A 2ONJA 2XSZA 1SKYE 2BWJA 3HU2A 2GJ8A 2Y8EA 1R0WA 3I8XA 4URZR 4A6PA 4CDGA 2ZRIA 3H86A 2QAJA 4FWTA 2W00A 2WM9B 1IY2A 1SXJB 1OFTA 1VHTA 3CNOA 1KHTA 2NO0A 2WWHA 2ZXUA 3OEEA 4HAYA 1SVSA 1EFRA 1Q1EA 4OK6A 3LD9A 3EPHA 1CR4A 4JMPA 1N0VC 2OO7A 2KI5A 4DIDA 3A1TA 3Q5DA 3RRNA 1G21E 2XNDD 4JKIA 4PHFA 3GQBA 3GLFB 2NO9A 4BFVA 4TLCA 3VNVA 5JSZA 2CVFA 2NZJA 2P6NA 4P32A 2ERYA 4LBYA 1LVGA 2Z4RA 2HLDD 4YONB 4W9MC 3PR1A 4JSTA 2LCFA 4DSNA 4ESHA 4IFBA 3D6TB 4RFVA 1LS1A 2EFDB 3D3QA 4JJKA 4JLDA 1NVUQ 3A58B 1FL9A 4P4TA 3DZ8A 1OV4A 4B3DA 4E07A 3OIUA 1DAIA 2B6HA 3LQRA 2RB4A 1CBUA 1AS0A 3RANA 4I4LA 3EZ6A 2QBYB 4M0LA 4KYUA 2ZSEA 4A15A 1NIPA 5H8WA 3FOZA 4KLZA 1FQKA 3GJ7A 3U7HB 4PO9A 2GJ9A 3F5FA 2QU8A 3HP1A 2RGNC 2XJ4A 4K46A 4IRUB 4AG5A 5JI3E 4EJSA 2IT1A 2H5EA 4NCKA 1COWA 1DAGA 4EFNA 1UBCA 5GJBA 1IN8A 1OFHA 4OI0A 3I32A 4M21A 3IPYA 5FBVB 1YR7A 4MA4A 2AK3A 2O8BA 2XZLA 2DPXA 2EFGA 4M1OA 4X8OA 4QBHA 1HY3A 3P4YA 1FZQA 1WP9A 2GZHA 4Q4HB 5CLQA 4IOLA 1DELA 3ICEA 2XTMA 3ECCA 4RCYA 1G17A 2KSQA 2ZJOA 4PZYA 2VP5A 2J41A 2CK3A 4HLDA 2G1JA 2Q3HA 1FFHA 2R9VA 4ZCIA 1CR0A 1F5NA 2ZEJA 1RZ3A 3ZVMA 2ZRJA 5DGXA 1E98A 2WVJA 4YMWA 3UG7A 4A82A 4PO8A 1T3SA 2GBLA 3C15C 1PLLA 1N5JA 2P5TB 1T4GA 1OXSC 4NCNA 2EU8A 1Z63A 3TUJC 1Q1ZA 4ZPXA 4IW3B 1JPNA 4C0LA 4V03A 3RVBA 2HXYA 5KDLA 4BQSA 1VHLA 3B6EA 4AI6A 1E96A 4D0GA 4QM6A 1XXHA 1EX6A 3NC0C 4Q21A 1P9WA 1WXQA 1SKQA 1WF3A 4PHTA 2EQBA 3I3SR 1NN5A 1P61B 4YDHB 1E4VA 2ZJZA 1G7SA 3CUEF 2VL7A 1Z0JA 5KSPA 2ZRKA 1S3GA 1S2MA 2FSFA 1US8B 1L7VC 4Q4JA 5BXQC 1W46A 3V00A 1KOFA 1OB5A 2IYWA 3Q7QA 4DLRA 5DE3A 1YKSA 4EPRA 1Q3HA 3KQUA 2AL7A 1AKEA 1YZKA 1GITA 3P20A 4ZKEA 5KPJA 3REGA 1N3BA 2HT6A 4JYBA 3I4LA 2UZ3A 3QI2A 5CJ2A 3VR3A 1KJZA 4IXMA 1G3QA 3CONA 4V0ME 2FGJA 5FL7A 1DS6A 3C7KA 2XB2A 4IVPA 4DZZA 2QGZA 1E2QA 3E5HA 2JEOA 2G3YA 4TL7A 4UNQA 3RWMB 4ASUA 4IVQA 1J2JA 2ZI9A 4DWJA 4GP6A 3CRQA 4MRSA 2G6BA 4A8JA 1A4RA 1UPTA 2CCKA 3LVRE 3CLVA 2O8FA 1WA5A 4CZ2A 5KTYA 2GESA 5A4JA 2BJVA 3OE7D 3U7EB 1HYQA 5LD2B 1P62B 1ZCAA 2CLSA 3PUWA 1XJCA 2V54A 1W0JD 3EAQA 3NDPA 4B48A 4O2LA 4A0RA 3BFVA 2OLJA 4ARZB 5KDDA 4E22A 1NSTA 4FD2A 2GCOA 5FI1B 4DCUA 4YMUA 5JECA 1MR3F 3ADBA 4AKEA 3DDCA 2OM2A 1CJTC 1E1QD 1X1RA 2IF0A 2QENA 2VRWA 2WKPA 4MDEA 4DEYA 3ZD6A 1U8AA 2JASA 3L0IB 5M04A 3MUFA 2PJRA 4IEEA 3BH6A 1I4LD 4ZCMA 3AVXA 4MGYR 4RD3A 2CXXA 5FOVA 2BM0A 3QE0A 2YHSA 5J4LA 2IEYA 2R6FA 1W48A 1GRNA 1KI9A 4QL3A 4DUGD 3THYB 4UXIA 1ZUNB 3K9NA 2OXCA 2AD5A 2YOHA 5J4YA 4G5QA 1NLFA 3BIFA 2CCJA 4NCJA 2EFHB 4JVNA 3QPVA 4QGAA 2AR7A 2BCGY 3LXRA 1TADA 3EPLA 4GI7A 1SVOA 1NLZA 4PZLA 5BN5A 4D4JA 1YJ5A 3RRZA 1QVAA 1US8A 1VYVA 5EE5B 3IGFA 4LHZA 4CRWB 4GMDA 1EX7A 2D62A 4GOJA 3TSWA 1OIWA 4DLVA 2Q6TA 3B82A 2GILA 5CB8A 4HDOB 4A9AA 2BBTA 4LJ5A 1Z0KA 5DI3B 1SHKA 2PJZA 4URYR 2OV2A 3SYNA 1BOFA 3CNNA 1XPRA 2W2TA 1AZTA 4C2UA 4IVRA 3AVWA 3CZQA 4MQBA 5CLLA 2I1QA 2D7DA 1RVDA 3BAFA 1TU4A 3B85A 3GFOA 3B9QA 3GEEA 4R98A 3FHOA 2ZJ8A 4OI1A 1YZQA 4HAZA 4LBWA 2OBNA 4KBGA 1E2DA 2JLXA 3G0HA 3WYGA 2ZPTX 2VP0A 4KBFA 1TQ6A 5D3MB 2IS2A 4HZIA 1RRGA 3SQWA 5JJKA 2NTYC 3SFVA 1VCOA 2VLIA 1EGAA 3TSOA 1NL3A 5FBQB 4DDUA 2Q21A 4PQFA 3D31A 2MSDB 4P31A 3Q7PA 3EWAA 2QTFA 3R9WA 1T9HA 1E79D 4Q47A 3U3JA 1FQJA 3MWKA 3W6PA 3KTAA 221PA 2P2LA 5DO9A 1HT1E 2GZDA 2OT3B 3CNLA 2V6IA 3QQ5A 1YZGA 2QE7D 3R8FA 3OAAA 2D4HA 4LJYA 1NVVQ 3T35A 3AQ4A 4N1AA 4LV6A 4C7OB 1OIXA 2AD1A 1E2LA 4WAUA 1XJ0A 2XX3A 2J5XA 2DWQA 4UNSA 2V7QD 1X6VA 1JPJA 1PJRA 1E2MA 2GNOA 4O0MA 1XTKA 2CK3D 1YRAA 1P60A 1XD2B 3AP2A 2IYUA 1W4AA 3TJZA 1T91A 4EPYA 1JXMA 5FFMA 4MKFA 2BM1A 2ZYVX 4PHGA 3ZZ0A 4DLYA 4ERNA 4AK9A 1NJGA 4YXWA 1ZUHA 3KJHA 4LJ6A 1N0UA 4MKIA 3CW2A 1ZNZA 1NN0A 5FUXA 4Q9IA 1SVWA 2FDCA 4TMXA 1G3IA 3KQHA 2CE2X 3M6AA 1G5RA 5JWRA 2J7PD 3GLFE 3EA5A 2HT1A 3FPAA 4TWZA 2GBLC 3PVSA 3FMOB 1KKLA 2A5JA 5EQTA 3K70C 4LYAA 2HJGA 1G20E 4MUBA 1VYTA 1MO5A 4GBMA 4QNMA 5TVKA 4Y0VA 1AJEA 3PUXA 4NYJR 1H8EA 3FB4A 4FCTA 3IQWA 4NYIR 4IOJA 2F55A 1WRBA 4XSHA 4JSYA 5TXGA 3ETLA 4Q4HA 2J7PA 2YWEA 4KFUA 1C4OA 1TNDA 2X2EA 1D6JA 4Q9KA 2JGNA 4AYTA 1R6BX 3KB2A 1DAMA 5KU1A 1Z29A 3GJ8A 5GVRA 4PANA 4NMMA 1XB2A 5FOXA 2O8FB 1KMQA 2FOLA 2YWFA 2X8AA 3N70A 5D3MA 4C0QC 3LLMA 1G64A 1H8HD 1W0KA 3AV0B 1KI4A 1XNJA 2GAAA 1TUEA 2GEDA 3VMFA 4HB2A 2HUPA 4GT1A 2ASEA 4LBZA 1F48A 3N2EA 4US0R 2WMNB 1UKEA 2WAXA 1CJUC 1K8RA 1OXXK 2CHVA 1ZW6A 1XZPA 1R0XA 3E1SA 3OEHD 1KAGA 4KSCA 4Q4AB 5IT5A 1CIPA 4BLPA 2KB0A 4Q7LA 4Q1EA 5FUYA 5JBQA 1YRBA 3HYRA 3KQNA 4B32A 1R5OA 5AUPB 2CEAA 2NOAA 4PAOA 4LBVA 2OCPA 4DCSA 5KYKA 3EXAA 2QMHA 1E79A 3HDTA 1J90A 2DFNA 3BJIC 1WB9A 2FA9A 2DCUA 3DOFA 2W83A 1GUAA 3L82B 4HI0E 5FOUA 4KLNA 1QHHB 4IJMA 2CE7A 3ICQB 3SYLA 3ZVNA 1VG0B 3AKCA 3AKDA 1YZLA 3P32A 4HEJA 4BLOA 1MRNA 2X1VA 1RPZA 1AQUA 2OG2A 3QXJA 4V02A 3GLGE 5CJPA 2CNWD 2HV8A 3H84A 3FKQA 3REFA 3KKOA 2F1HA 2G0NA 2VP6A 1IOZA 5HR5A 3AB3A 1W36D 4JYCA 2WMOB 4IDHA 2A9KA 2Z0MA 4FMDB 4JIMA 3U4QA 2O8CB 4JLVA 3LBIA 2ZE6A 4II7A 1NN3A 1N6PA 2A5YB 3TW8B 2IS4A 2BMFA 2Q9BA 4JS0A 2A3RA 4PTLA 4DDTA 4DLZA 2VHJA 4LPSA 4QRHA 4MYUA 2IYRA 3THWA 2GCOB 4OQXA 1KYIA 3IHLA 3SBEA 3BERA 3THXB 3KKPA 4EJSC 1AM4D 1HEIA 1NN1A 2C77A 3VR2A 4QM7A 2EFCB 2I4IA 4DT1B 4XD7A 5EXXA 2Q9AA 1FUUA 4KFTA 2P3SA 2R65A 4D81A 1GAJA 2CHGA 3K70B 3TW4A 4EUNA 4PO1A 3LW7A 5JI2E 1NG9A 2H92A 3VAAA 4BASA 3GJXC 4NCIA 1S9DA 3H4MA 3PIRA 2DR3A 2ONKA 2D3WA 2OEPA 1D9ZA 2VPPA 3I92A 4PHHA 1NBME 1TU3A 1JEDA 1N6KA 1P7CA 5KUTA 1GRQA 3WHLA 5L3SB 4D2IA 4EPWA 1FMLA 1U99A 4CT4B 2GXQA 3HU1A 4OHXA 1OHHD 3QKTA 2G88A 4TLDA 4OJQA 5KSZA 3RC8A 1PUIA 4TQ9A 3EW9A 4NZYA 2F9LA 1JR6A 4C0SA 1Q20A 1XMSA 3R8CA 2NPIA 3TLXA 3VKHA 5JWHA 2C99A 1W0JA 1Q44A 1W44A 2OAQ1 1Q22A 3DMNA 3TAHA 2QRNA 3UANA 2QN6A 3T5DA 3OE7A 1GG2A 2PZEA 2IUUA 4TZ0A 1E9CA 2VHCA 3JZMA 1I4DD 4YXWD 1KO7A 1N2CE 1P75A 3ONWA 2WIAA 1W2GA 2IC5A 2ORWA 2JJ1A 1CS4C 4U7DA 1W49A 1KO5A 1NVXQ 4HZUB 4DCTA 1V43A 4NH0A 1SVKA 5AUOB 5K8TA 2ZU6A 3DMDA 4HYYA 2R2AA 4TYWA 5FPYA 1GOTA 5J47A 2IL1A 2WKQA 5DN6D 5FPKA 5HTKA 2OLKA 1S8FA 2HCJB 2VF7A 4AKIA 5EXSA 2PX3A 1CRQA 1KSGA 1UADA 4KVAA 1Q1BA 4HAUA 4LC0A 1KK2A 1RE0A 4PZZA 4Q1DA 5CM8B 4MRRA 5GJCA 4G3XA 3C8UA 1ZM9A 4NDZA 2YKGA 1OKKD 1W0KD 2A30A 2ZQ5A 3W5JA 4BRUA 1G7RA 3Q5EA 2FZLA 3TR5A 1KZ7B 4DRZA 3DZDA 3AH8A 3CWQA 5EP1A 4D82A 4PC1A 4JL6A 4QBFA 3K70D 3RS2A 1Z0AA 1Z6GA 4DLWA 2ZRCA 3UWKA 2IF2A 1ZIPA 3EWSA 1VG9B 1VKJA 2F1IA 2VP9A 2FZ4A 3LXXA 2R6CA 5H68A 1SXJA 5KHOC 3L0PA 2Q3MA 4A1FA 1CR1A 4FIDA 1IN5A 2HF8A 3V4RA 3OIYA 2YC4C 1LW7A 2H17A 3QIAA 1N6LA 4QHSA 1H8ED 4WA7A 1KSJA 4B75A 4BLRA 3UIEA 4F4CA 1CTQA 1DVRA 4R71A 2JIZA 3U61B 3GJ4A 3MD0A 4B2IA 4L5BA 1X86B 4HAWA 4JBYA 5FI0B 3LX5A 1YZNA 1VG1A
chains in the Genus database with same CATH superfamily
4POOA 4AS1A 4HC4A 2PKRA 2YDYA 4CYMA 4GRAA 1T9CA 3OEHA 1N6HA 1TW3A 1UODA 4J0FA 1EXMA 5AW1A 1JALA 4YJFB 2I29A 1P7WA 4QT4A 3UJPA 2IYPA 5JEEA 1PZEA 3AJRA 4JJ6A 4L76A 2HWWA 3ZBUA 5TARA 3WHKA 1J2YA 4TRRA 1FQOA 1BMTA 5EIFA 2IPMA 1E9RA 4ENWA 2R2GA 1QG6A 4CKEB 1M73E 1KBOA 3D8BA 4W9RA 3WOVA 2FU5C 5B6PA 3AB8A 4A8HA 2ECOA 4Y9UA 5K2MA 1SD2A 1H93A 4YLYA 3IT0A 3Q9SA 2CNDA 4OHRA 1W1UA 1JHRA 1Z74A 2FMIA 2V7UA 5A4DA 5EE3A 4BX9A 2XGOA 2IHNA 1MAUA 3CNBA 1O5TA 2J9XB 3QKSB 3WRVA 2H7CA 5SY6A 1SD5A 1Q7RA 5EHGA 1JU3A 4UUPA 3T95A 3EPJA 1G41A 4DNQA 2FQYA 2WE7A 1G66A 2LVBA 3WV4A 4RWZA 1SH7A 4HQNA 4DC1A 1EK0A 4MUKA 2BHTA 5J2UB 3AEZA 4OA5A 2EL7A 2IELA 3OIVA 2H29A 3CC8A 4V0LA 4JOSA 3NHLA 3VV2A 1RM5A 3SQXA 1NFQA 2P4UA 1YQEA 3RAGA 3U7FB 2QOEA 4KXXA 3THOA 4Q4AA 4GM1A 3PQ3A 4DV4B 3ZK9A 1JHMA 4CIDA 1F8XA 1HO3A 1Z7BA 4G5GA 5EUQB 2PQ2A 2R87A 3GVCA 4JOCA 1KMHB 4CNBA 2B0JA 3PCTA 4RE5A 3WA6A 4L3OA 4BB9A 1FBNA 2WJIA 1V1MA 4TXMA 3W2IA 5K8IA 3CBQA 2QLTA 3TE6A 1DBSA 2GPJA 3TG8A 3NHMA 5SV2A 4BMXA 4F2GA 1K6IA 1F0YA 3AF1A 1RAHA 3TZ6A 4EMBA 1XZHA 2B92A 3Q9LA 1PYOA 3IP3A 4KDRA 5A6VA 1A04A 3GNQA 1FSPA 1VBNA 1B16A 1ZN8A 3OCZA 4PQEA 1NLUA 1R27A 3L8YA 1KE1A 2ZB2A 2AUTA 1YB4A 4P0TA 4DIOA 4EJMA 1YASA 4ROSA 1FUYB 1PSDA 2GTPA 4XRRA 4B82A 1P2FA 4O5OA 1LFAA 2RC5A 1GHTA 5L3VA 2BCJQ 3HZOA 1JKXA 5TVGA 4C6RA 4N0DA 4IQ4A 1K92A 1S3SA 4YREA 3QM1A 4B6PA 4ZYTA 4MWZA 4N54A 3HKCB 2DYKA 5SZKB 2Z57A 2VF5X 3TLKA 2BVNA 2CLCX 4CEHA 4L8VA 2XBMA 5BW6B 2RHOA 3M89A 4MWDA 4WOBA 4X97A 3DTVB 2Y71A 1EX1A 1U6KA 1UMDB 1TCAA 4RXUA 4U8GA 4AJHA 3W6OA 1P9OA 3I5AA 3C3PA 5EJAA 4CV3A 2E1PA 5HRUA 3DEJA 1QNLA 4J0KA 1CS0B 2H85A 3H5VA 4CUZA 2O3JA 1M5TA 1KE2A 2G5GX 4NVRA 4HPJB 4K87A 5E9QA 1TMYA 2F3RA 2L82A 3PIIA 5CB4F 1O4WA 3EF1A 2RMKA 1TVCA 4L4UA 4IGKA 3ZTWA 1O95D 3PFBA 4UUQA 3N39C 2ENWA 5LOVB 5I7EA 3OSZA 2QT0A 4BMOB 3ZHTA 2R86A 2VCYA 4YACA 3PXUA 3O6VA 4RAOA 3LFHA 3LL7A 1T36A 4NI5A 4V38A 5HX7A 1AS3A 3MT8A 3PR3A 3FNHA 1UPCA 4FMCF 4MKXA 1PGPA 3O1IC 4XCVA 4EHNA 2ZUEA 1GLVA 5CB0A 2HXGA 4JC4A 4Q3EA 3BIWA 4AWXA 5BNFA 5A2GA 1TA4A 3V48A 1SBIA 1HT3A 3EZ2A 3PWTA 3N58A 2H1OA 1MHPA 4BWYA 3MIIA 2B69A 2EJVA 3R6DA 1EA7A 4HCJA 1RP7A 5A04A 1Y6JA 4FGLA 1CF2O 1KRHA 2C4TA 2PKQO 1X94A 2W6MA 5SY4A 4CQMA 2CYAA 2CKDA 1CJKC 3M34A 2JGRA 2JIBA 1KXZA 2O7VA 4INPA 2C8LA 1CZOA 3G7SA 1Y1KE 3AF3A 3H2SA 2VUUA 4FR0A 1UFVA 2LDBA 2O1SA 4JBHA 4MKHA 4MIYA 3G9ZA 1O3YA 5HF8A 1XDGA 4C30A 3LC1O 1L5LA 4UTNA 3KUCA 1O58A 3K0KA 3M5PA 1LGYA 3KLBA 4YP5A 2CGEA 4AMZA 2V3CC 2ET6A 4BMDA 4AKTA 3HCNA 2GAIA 4I1IA 4J0IA 2QVBA 4QQNA 3ZY2A 4X5OA 1O2DA 5G3ZA 3LY5A 3BSSA 4MOWA 1TC2A 1KOJA 2WYVA 4MV8A 3VSBA 2NSJA 1EUQA 2LIPA 3U6BA 3NDRA 3RK0A 4MRAA 2XE4A 3UPUA 1VE6A 3AVQA 3BMQA 1KPIA 2B4TO 3E5RA 1W36C 1HETA 1N0WA 5CVCA 4JI5B 2ZDQA 4X3OA 5ESDA 3WG9A 3N7AA 3T1OA 4BZQA 1MGOA 5BW8A 1SOMA 3WGYA 3COPA 4JT9A 5KOHB 1HQCA 3D1VA 2QVYX 2WJAA 1E1QA 3KR2A 1QYXA 3QPUA 2OAEA 3MIZA 3KT0A 1H1TA 2O5EA 1H6CA 2FLVA 4FLMA 3CF2A 3FGPA 4K7JA 2RSLA 2C2YA 1ECGA 1ISIA 3R3ZA 1UF9A 3R0VA 4GOND 4OHMA 2CD9A 2EERA 4Y98A 1DHRA 3E27A 3FCOA 1R9NA 3T0FA 3KSAC 3HCDA 4HB0A 4BGEA 5LQNA 2NU9B 1PYDA 3LQ1A 1I7PA 4TROA 2X13A 2ARKA 3OT1B 3VSEA 3CKKA 3V8QA 3QJGA 2FZEA 2UXCB 4DB2A 1QS0B 4EUFA 3DJYA 3FHLA 4L8GA 4OLAA 5TR9A 3QXCA 4HB4A 4JI4B 3D8RA 5TY0A 2VIIA 4HEHA 4BEJA 4QBIA 4C4OA 4D9BA 3JRXA 4M8KA 4YFVA 1JWAB 1LK5A 1SULA 3KDPA 4G4JA 4B3GA 4DLTA 5L8VA 3DZBA 2G80A 4JT8A 2RH5A 4BQFA 2B0CA 1II0A 4COOA 1LRKA 3LP6A 4QEZA 2GR9A 3VNRA 3VPFA 1OKKA 1WXEA 2ZTLA 4KWIA 13PKA 2AE2A 5HYVA 1OU4A 3E18A 5EQFA 2PL1A 4IIYA 5FA8A 3K4QA 2VDNB 4YRGA 5JCZA 3TDNA 3IAAA 1HXHA 1RIFA 3O4HA 1XQ9A 3CLTC 5HQTA 5IAJA 2W5UA 3PEWA 1XGKA 1MO4A 4PIMA 2OCBA 4ZOLF 1NDHA 1KEZA 4OU5A 5BYJA 4B34A 2IUYA 3EXG2 4ZEMA 1T8WA 1CZKA 4AKGA 1QG0A 3WAKA 3ZCVA 2AVDA 4UOQA 2PAAA 2OBBA 2B5OA 1ZA2A 3Q15C 5LCXA 4PC7A 5CK5A 5BUQA 3CZ5A 1B6TA 2CL6X 3ABIA 3LH5A 4V2UA 2VYQA 3HA7A 4B6FA 5BOSA 2VTKA 3PHHA 3M5WA 2ZUDA 3OPYA 4N0MA 4MXDA 3ZHCA 3ORSA 2VPZA 4G0MA 3KDSE 1AF7A 5DRYA 3FXAA 4HF7A 3SS9X 2XE8A 3TB6A 2X2FA 4B71A 5K3EA 2BGWA 1CDEA 1PJCA 3R1IA 2VAPA 4JBGA 4MYRA 2WV9A 1U5BB 3Q8WA 2CF5A 3FGNA 2XNJA 3O3NB 4U7JA 3ELDA 1MMFB 5BV7A 4G2NA 1X9IA 1U1EA 2QNIA 3KL2A 3PGMA 3CLKA 1ZGZA 4MW9A 3WTBA 4NBWA 3RSZA 1RZRA 2WFLB 2D5CA 2PSHA 3HU3A 4E5SA 5IUNC 4AZ0A 3DVSX 3FR7A 2X9QA 4FFBB 3ZWMA 1E1RD 1NBWB 2M6SA 2XGGA 3U7GA 2MT9A 1MQAA 5F2OA 5GVSA 4L4XA 2Z04A 2B2CA 3GZTB 4Q1VA 4E1VA 1LF5A 5JAOA 3KFVA 5CPBA 3FVQA 4AJLA 2Y2VA 4X1IB 4QWWA 1XRNA 2BM9A 1CJCA 2FPKA 3AFIA 3F9CA 4ZT6A 2P7HA 1J06A 2YMPA 4JWKA 1OHHA 1ZJYA 4EZBA 3QEOA 5A0FA 3KYDB 3D2CA 1P2DA 3NB0A 3M1IA 2C7GA 1K5PA 1RZUA 2LTAA 4M98A 4GPIB 4H1HA 2EHJA 2G82A 4NICA 3I09A 1GXSB 5FTNA 5KNCA 3EG9B 4PZCA 4URXR 1H2AS 1P19A 4C7MA 6NULA 4NMHA 3NGXA 1VA4A 3CX8A 5E9AA 3KB6A 2C4NA 1A8UA 1R37A 5AESA 3HXPA 2QAGA 1ZOOA 1DBIA 1EFRD 3DE2X 1FDSA 4ZYVA 1YNOA 4FYJA 2XMDA 5E7QA 1GKYA 1PNVA 2EP8A 3LLUA 3OA2A 4IHAA 3D4IA 1Z08A 2XYHA 3BXXA 3DHWC 5EKXA 3RROA 4Z7OB 3WICA 1EG2A 3ZKAA 4ERXA 4IM7A 2DFPA 4YJ2F 1NU8A 2W6IA 2AJTA 3JX9A 3AJ9A 3HVKA 5TPWA 4WOCA 2WWIA 3NATA 2XOEA 2KLBA 4YRCA 2EEPA 3OZDA 3OLVA 1CY0A 1FU8A 1CYDA 1VB5A 2VT2A 3P71T 4K9NA 4NECA 4PS1A 4KHPB 1JDNA 3PXGA 1NQ5A 2PEYA 1FCJA 2JF0A 3LBNA 3QF7A 3RSFA 4Z53A 1THZA 5A6SB 4G1BA 2AG8A 2Z6VA 4DLUA 4KE7A 3UXHA 4KL8S 3W4JA 1MEOA 4FFVA 1N75A 2F1OA 4GOMD 4N0QA 4CEJA 3RREA 3AVUA 1WUHS 3U7RA 1KNXA 1E6UA 2ID9A 2I66A 2Q8PA 1IYZA 1LFDB 2XUJA 4XKJA 1P5HA 1PEAA 2KHZA 3I6ZA 1ODIA 3PC2A 4LN1A 4FYWA 5A3VA 3V4ZA 3E70C 1C3EA 3A7EA 1NPTO 1NULA 5AR1A 4EUHA 4OMCA 2ZYGA 5DLDA 3IAFA 2AFIA 5AVKA 2ATIA 1ULAA 3CEJA 2A0UA 2MYTA 5L7TA 1OIVA 4M0EA 3E9DA 2PHZA 1YE3A 1ZN2A 3KL4A 3WDKA 1U9CA 1T43A 5LLSA 2RGUA 5FNVB 4MR9B 1WVIA 3ROZA 4RQBA 1TI7A 3CHYA 2A78A 1J49A 1VPLA 2IE0A 2NNWB 2R1TA 4NSNA 1NSFA 2CEKA 2FDXA 5K0NA 3U26A 4F84A 1RI3A 3WMFA 1SBYA 4Q9DA 3S4YA 3ZZNA 4BBPA 5JS8A 1I4TD 2JW5A 4TYMA 4LC1A 5JROA 1M1YB 5KEIA 4AZ0B 3KJFA 3S81A 3F6SA 4K6OA 4RH0A 4GYKA 4K6CA 2E4WA 2P0YA 4KXQA 4Q39A 1AMNA 4OX9Y 3JYHA 4G1VA 3BWXA 1B8PA 3FCXA 3O2NA 3TGPA 1L4MA 1NM5C 2P9EA 3L7OA 2RH8A 4RKEA 2DY1A 2NO1A 1ZS9A 3BGOS 2RG1A 4ZYWA 3T7SA 1O6ZA 4MGEA 3BT7A 4NL4H 1FUEA 2DUMA 1SBNE 1PJ4A 1D4OA 1HURA 1YC5A 3NC1C 2ABWA 4HX9A 4WNIA 3KZCA 1U0OC 3SZLA 4P2BA 1JQ5A 3ENKA 2BR4A 2WB2A 3O75A 3G2OA 4R8RA 5DHSA 3M4XA 4DNXA 2O5CA 4N3BA 4XWAA 3LJKA 1NWCA 2EJBA 1EUZA 1WMSA 4TX1A 5K3AA 1JFTA 2CJWA 1J1UA 5BN4A 3PG5A 1RCFA 3PPIA 4OJYA 4Q7MB 2POCA 3SYTA 2P9FA 3WX0A 1X14A 2R8XA 4HX2A 3U5ZB 1V2HE 1YCHA 4WXRA 3UZUA 3WBBA 2WSMA 4EJSB 2FEMA 4H0NA 1A1SA 3B2QA 3KE9A 2Z2ZA 1JR4A 3ZE8A 1L9XA 1G7TA 3MRSA 4RHXA 3HO8A 3PNBA 1YOVB 3DHEA 2XADA 3R6TA 1CU1A 2JLRA 2JFGA 3EVEA 1CDOA 1YA4A 1FPMA 1E89A 1C9KA 2ORIA 4AQ7A 1FP7A 1T5OA 4OX9B 1SUEA 2EZUA 3QTLA 5M04A 3V2UA 4AJ9A 4ZT5A 4FVTA 4AU1A 5BNWA 3LOUA 4TTPA 2AHRA 2OUKA 2PZKA 3PE4A 3UATA 4C9BA 3OJFA 1ZL2A 1JDZA 1OFUA 3CF0A 4I1UA 1LY1A 1M2JA 3BN3A 4XM0A 3K94A 1XZQA 3GLTA 1O0SA 4WV3A 4AJ1A 1Z7GA 1KI3A 2IWHA 5TNXA 3IO3A 2GBPA 1EYZA 1T3GA 1YZHA 1XXHB 3B1ZA 4I08A 1YAHA 1RYNA 3HMQA 4M38A 4NPHA 5E4TA 2FN7A 5I9BA 5CDUA 4GBGA 2OD2A 3RTCA 1GTZA 4F38A 4FZRA 4QUBA 5IBQA 4BNFA 1BCSB 4M99A 2QLFA 1RHRA 3V4VB 1HNXB 2G40A 3BE8A 3PICA 1KFKB 1PEKE 4GOKA 5B5SA 1JA1A 2C5FA 2QXTA 1EUYA 3BTUA 3HSSA 4GX5A 1N4AA 1Z2AA 5CU7A 4CIXA 3WGIA 2LKDA 4YVFA 5AJUA 2ZCUA 1KQGA 2EW2A 2OMKA 4XASA 4BVKA 4CM4B 3IDZA 4FT2A 5HQ3B 1I5RA 2JAPA 1GNPA 3A9UA 1K0FA 1R50A 3CPSA 1VLVA 2BMDA 4E21A 1JILA 1O5OA 1V7PC 3N5CA 1R4NB 5SYMA 4ZGGA 5JMTA 1U7UA 1PIWA 1T2AA 4QQ8A 4YLEA 1GL6A 2OILA 4N03A 3RJTA 1FS4A 1HRDA 1FDTA 1ZD8A 2HSDA 2JZOA 4G4SP 4S1OA 1Z0IA 4X8LA 1G8PA 1CC1S 1DO0A 3M6VA 3WL7A 1QQBA 1A9XB 5EHXA 5JJLA 1V1RB 1WB6A 3OM1A 3VR5A 1JU9A 4ACAA 4WX2B 4DIFA 4P53A 3PPWA 2V97A 3EVZA 3IAEA 1VJGA 1IMOA 4BCDA 1RWOA 1TIKA 3WLIA 1J07A 4FFDA 3QU4A 1EFHA 3HPRA 4J4TA 3IAXA 2H8GA 1C4WA 5KDOA 3S8EA 1I7DA 1HR0B 1R3UA 3G17A 3MWGA 2VYFA 3W05A 2CWDA 2I8CA 1VXRA 1LK7A 1E2PA 1V0JA 1CZLA 1Q0ZA 3DVRX 4NFYA 3GQVA 3HJBA 2GD6A 2RGDA 1II9A 2Y93A 4DMFA 2O7SA 4URUR 5HIAA 2Q5EA 3GCGA 3NI2A 4DDVA 2JFOA 1NW4A 3GRZA 3F4KA 1MU0A 3WWOA 3KZNA 2N75A 4CV1A 1TC1A 1G5HA 2AE1A 1RU3A 1QHYA 1YU9A 1QK3A 1MLDA 2MSLA 3EWNA 3G8CA 3O82A 2H4WA 4JBWA 4MEAA 3G5TA 4KV7A 4Z9AA 2IW3A 3ZCSA 4D4GA 3VI4B 5BT9A 2AEMA 1H1DA 3GRAA 5KHAA 2RGGA 2XGMA 3TIFA 1EBBA 4NBVA 4XWTA 1ZUIA 2YMLA 4QHYA 2C00A 2OKGA 2WIBA 4BV3A 4EARA 1AQLA 1RKQA 1XTJA 3ZTYA 4UHDA 1Y9JA 3I30X 1GZDA 1M1NA 2EFYA 1FQWA 2YZ2A 5DCUA 1YVEI 2Q50A 3DR3A 2CJXA 4KH1A 3C5EA 3UOWA 1W2WB 4ZT4A 3B51X 4MV6A 4U39A 5JCPA 2HL6A 5KTSA 1QP0A 4DJ5X 3I8OA 1D04A 4KV9A 3T7DA 4CTKA 2OFOA 4F92B 1VB3A 2GVNA 1FLNA 2BGJA 4MYTA 4RJ2A 3SP1A 1B76A 1VA5A 2W93A 1WNTA 5AM5A 1Q95A 3E9ZA 3MINA 3BGSA 1TZCA 2GWHA 4ZVPA 4F6CA 6REQB 3HLYA 3TQTA 3V7NA 3GAMA 2ZFUA 1XRQA 1T9AA 1NNI1 5IF9A 3ZXUB 2VJPA 2QA5A 5IDYA 4C06A 4L9WA 1F17A 1Y5LA 1EFLA 1GEEA 2PLAA 3IE2A 3ESYA 1WBDA 1A9OA 1Y6RA 5EXTA 2ZRMA 1ADJA 4AUMA 3DBLA 2PWZA 3F5QA 4ETIA 4C01A 3V8MA 5JJ5A 4H7DA 4B84A 1KZ4A 3FF4A 2Z4TA 2XNSA 5HRCA 1WDLA 1MQ9A 5L3RA 4PZPA 3T5BA 2GXUA 2W6ID 3HNOA 3HU5A 3MWYW 1JJVA 1CLUA 5F2EA 4CF4A 4MVJH 1MJGM 1FYXA 1ATZA 2AZDA 1RWMA 3TB4A 3GJSA 4DABA 5K03A 3GJTA 4J0DA 3O8RA 4E09A 3MWEB 1KK3A 1TKBA 1ZD9A 5G0VA 1C50A 4JEIA 5HFAA 3SFTA 4YAFA 1WP4A 1ZRHA 3C41J 5ICGA 5JMWA 2OO5C 4ILKA 3ZTTA 5E4FA 2O2IA 3Q7EA 1ZC3A 1YVDA 2HZBA 2E6UX 2PCJA 2JFXA 1G9TA 1CY1A 2FPPB 3ZC3A 2QY9A 1R0YA 3Q0EA 1H05A 1HG0A 1BTOA 3RBAA 2QM0A 2QE6A 3QJYA 3LT2A 1B0UA 1XFAA 5A02A 1X7DA 2F3TA 2SCUA 3THYA 2VEDA 2FWPA 2DF8A 2NACA 4BMNA 2VDJA 1DIGA 4JR2A 2LCIA 3QLTA 4CLOA 3HC7A 2Q6KA 3LCCA 2Q7XA 4H7FA 1X7WB 1DTSA 1PJSA 4DCJA 1VDZA 2PVCA 3K0AA 4O8ZA 1OSNA 3VA7A 5KX5F 4ND2A 1TYBE 2VYVA 4JQSA 3C3WA 4W1RA 4BNKA 5HW0A 1GTVA 4MGKR 2ZSJA 3EVBA 4N3CA 3WRYC 2Q0XA 4OUDA 8LDHA 5JSYA 1H5UA 1UKYA 3PQ5A 1KVSA 1WL8A 3JATA 2QUIA 1MT0A 4QLAA 5J40A 3QUCA 1J21A 1UOPA 1FIUA 3L40A 3FTFA 1S1MA 4TGLA 2H31A 4MAFA 4CG2A 2F43A 4RK7A 2Z98A 3ZXIA 1AQNA 3G6WA 3KTAB 2RH9B 5M34A 3MG9A 3KSDO 4Q05A 4TWIA 2AV6A 6Q21A 4QJ4A 1O6FA 3MWLA 4C2TA 4RZUA 2J48A 3WDSA 5B1YA 1J70A 2BTEA 2RGEA 1IEQA 4I55F 3SMQA 3FGZA 3ME5A 1LPAB 2Y0PA 3WFZA 5KVVA 2VNJA 1LB1B 4M2LA 2XCTB 2YWHA 4MRMB 2ZTMA 1P73A 4J0HA 1TEVA 3ULKA 3CWZA 1DC4A 4GSLA 4OTZA 4MV7A 1AK2A 1ST2A 4MUAA 1NOJA 1AQ6A 1QGUB 1TUIA 4GNRA 4JMLA 4UPDA 5UKDA 3K15A 2OCLA 2WSSD 1JG2A 4QXPA 1XOIA 4XOIA 3DEZA 3VVLA 2FTKE 3CNQS 4DJJA 3OO0A 1INLA 5K0FA 4H2DA 4AG6A 4PYMA 2W9XA 4D4KA 1TQ2A 3PIDA 1KDZA 4CG1A 1U8TA 3C3BA 1DAOA 1VGVA 3PENA 4PG6A 1KARA 1OJLA 2OGSA 1JJBA 2QYHA 1WUKS 2G9QA 2JJ8A 2RBKA 3QKSA 1QSGA 4UUAA 4W5QA 4LF9B 3RYFB 1YIAA 2PZJA 4IUBS 1Q77A 2BGGA 2C9CA 4KNWA 3CM0A 4ZYUA 1J42A 1P3Y1 3PX2A 1W5TA 2J3LA 4YR9A 3SFZA 5HM8A 4BJ6A 5L4LA 2R8ZA 4QKQA 3EX7C 4RL4A 1A7AA 4N39A 1RHKA 2AMLA 3PUKA 3ZH2A 3KQOA 5AVUA 2HRBA 1CDZA 3FCSB 5JNRA 3AO0B 1M6VA 3JRNA 3PQFA 4HGZA 4IMRA 4Q4DA 4DIUA 4DR3B 2CVOA 3GLHA 1IY8A 4GGOA 5KSYA 4BNVA 3E7XA 2X4GA 3OHSX 2O5RA 3CH4B 1PEYA 3ER8A 1D9XA 3VI3B 4BAGA 5KX5A 4KMOA 1Q0TA 3AEKB 4UZFA 1XD2A 2OTCA 4LDZA 2MIIA 3ZW9A 2QZ9A 2VWPA 3F3YA 3ZWBA 4I99A 3UMRA 4AKSA 4IBOA 1RAEA 1TVMA 2R6DA 2VNKA 2YHIB 1UT5A 2W6JA 3N6RA 5BQ5A 2YJGA 4E4YA 4PSUA 1G5TA 1WHTA 1GU0A 1ZCBA 3KOMA 4L4YA 2OYRA 5DXJA 3B13B 3EGOA 5KOJA 2RD2A 3OIWA 2XTAA 1CVIA 4FYKA 4ARVA 1ULBA 1Z5OA 4J16C 1KI8A 3P9KA 3A7DA 3PGKA 5TMBA 2UUPA 3C2QA 5K09A 1E9AA 1SXHA 4LHYA 4LMRA 2CUZA 3T7RA 3TRFA 1UJ6A 2B1IA 2C96A 5B36A 3ETNA 5D85A 3QNUA 4TTVA 1K5DA 3WL4A 5L4SA 4D3ZA 4QOJA 2IYYA 5EGSA 3IBCA 3SSAA 3DNPA 4ER3A 2I80A 1TUBB 3L8GA 4FMCB 3TS1A 4GIBA 5LQCA 4YRBA 3RWOA 1N5DA 3EGWA 4MULA 3BMQB 1NZJA 2Z9DA 4PYIA 4UKDA 2GDJA 3MLEA 3IPXA 4EX7A 3C5HA 4V39A 1K3UB 2H2HA 4KXWA 1A9SA 2P9HA 2XWSA 4O5AA 3SXPA 3T15A 5CGZA 2JHFA 4HQ6A 3CH7A 2XRZA 3QW2A 2QTGA 4G23A 1DFHA 2XCUA 3LXUX 1OFGA 4NENB 4BFZA 3AR7A 3ESRA 3HUEA 5ALLA 4F2HA 1WXFA 5I8PA 2GPAA 3T4EA 3WGZA 5K2OA 3CJRA 2VKQA 3DTTA 5A9RA 3OFSA 1PQUA 4WZBA 3C14C 3ZGXA 1EFUA 1Y8RB 2OSBA 1CR6A 4KIWA 5CBPA 3DLPX 1QYVA 4Q1AA 4TMWA 5AVZA 2GH1A 4JOQA 4BNJA 1F2DA 1G9XA 3PDHA 5E6SB 2YUTA 1QTIA 4KSBA 3N2GA 4V0QA 1AK9A 3VYWA 1KP3A 1P1CA 2OVFA 4IOMA 5CW1A 1GFIA 4DKXA 4G89A 1QIHA 3H75A 2LUOA 1P18A 4N6GA 4DSTA 5JYCA 4WZ6A 1E0SA 3WJAA 5EG5A 2H6EA 5HKLA 3ZS9A 4R1OA 1C8VB 4E7OA 2DLCX 4TZ6A 1SVLA 3I2YX 2IYAA 5JJIA 3UQYS 3ZY4A 4DOMA 5IH7A 3T1NA 1PDWA 4LRQA 4OK3A 2EGGA 2FMHA 4FFRA 1M2HA 1QQ7A 3ZUGA 3U09A 1J24A 4HBGA 3VOSA 1HQYE 1JDSA 3DZKA 4JD5A 4U7WA 3W7BA 5LP1A 3AL3A 1DRJA 3GVIA 4RACA 4O59O 1FVFA 2R6R1 3WQHA 4ID3A 3TZHA 3T5GA 3F90A 2GFHA 1X1BA 1TECE 3K0CC 3WLFA 4CPDA 2HN9A 4E33A 3G5MA 3QOFA 3RUEA 3TTTA 4BNWA 1U4OA 3U9SA 3MWJA 2XQIA 1ZNQO 4CMIA 1PF7E 2K6GA 5EE9A 2ZIWB 3PDIA 5JISA 5AI6A 1PZXA 1DZ3A 3L0YA 4YT8A 4JVMA 3N3AC 2NZVG 1T3HA 4A0GA 2PJDA 2ZAOA 5DYNA 1KQFA 2VK4A 1A82A 2TS1A 4IKEA 5LM3A 2OFFA 2JLZA 2VRNA 5HOEA 2VSFA 1NBMA 2NVBA 3WSTA 3T1QA 3IXMA 1W8IA 4Q3DA 4E3ZA 3RTBA 1SOAA 2AEEA 3QZUA 4S24A 4KX3A 3DVLA 3QVVA 4FGUA 4IEIA 4C05A 5BSKA 821PA 5HKOA 1AKYA 1XG5A 1SPBS 3NOVA 4V0RA 5DVZA 3MTQA 3W3AH 1XQXA 3OQIB 1PVOA 3K0BA 4RFSA 1PNTA 5CVVA 1KI1A 4YB8A 1G4UR 5AOAA 5FX2A 4QATA 1L5SA 4AY3A 2VDOB 4O2AA 3O74A 3L43A 5DM70 1R5JA 4EB8A 1IHOA 5IK2A 4U7TB 2X0DA 2IXAA 2QRVA 1F6BA 1ZI9A 3PUYA 2QBYA 3WK8A 1ZO8A 4PONA 3DDWA 5CXQA 5GZ6A 4QQKA 4EYSA 2PL3A 3N0RA 5EZQA 4TRMA 3EARA 2H7VA 5B58T 4R7GA 2YHAA 5AXAA 5SZHB 3R7BA 1Z2OX 1FP6A 2C9YA 2V6FA 2VSNA 3NWBA 1H5NA 4FDMA 4YRTA 1P72A 1ZONA 3ZDEA 4RZIA 4ZQBA 1F20A 3O84A 1YULA 2V4MA 721PA 1BX1A 4KTVE 1EXWA 2AEFA 3IKVA 3DF9A 2X1MA 4KQKA 1UQTA 5TB5A 2P91A 2OGTA 4QE3A 5HIIA 2E49A 3MJTA 4Z2AA 2QLBA 1MO3A 3UWSA 2P9ZA 3R2JA 5JSFA 2QORA 1JHZA 1E3EA 1BN6A 1T0PA 3FSJX 1QP8A 2F8TA 1YJCA 4MVJA 4I4TA 2QTCA 3BHIA 1KMIY 1SHTX 1A2BA 3PVZA 4P92A 2MSCB 3CZAA 3DO5A 5JU6A 1GYQA 1YFKA 4NWIA 4HZUA 1E3LA 1E1RA 2IZ1A 2R4UA 4HFJA 4M9ZA 2GEKA 4FC6A 3ZZ1A 1PJTA 4YYZA 4F91B 5JW6A 3CEHA 2JFYA 5FB3A 3KS9A 4ZARA 3ETDA 1O57A 4WPGA 1FJGB 4WFJA 4E5DA 1QUEA 1X7YB 2CXRA 4LHSA 3SQDA 2Y1FA 3DVQX 4OV6B 2TECE 2UZIR 4GP7A 1ARZA 4A0SA 3DFKA 1H42A 4UDYX 2N0SA 5E2BA 4KYVA 2X4IA 3P2MA 4CQJA 5MFPA 4DF3A 2VJQA 4JL5A 2XDYA 1XDZA 4OQNA 3UMJA 4IDCA 4RPLA 8ATCA 2ORED 2X1HA 1X7XB 1EESA 3V4LA 5JTTA 5HK9A 3LY7A 4BZWA 5BQOA 3FNFA 4H59A 2ST1A 2GN0A 4DWWA 5C9ZA 2QR2A 1PX0A 1MZPA 5FULA 4YRIA 1LPNA 3WMEA 1AA9A 1HFKA 3HCWA 3GGSA 3ZHXA 3OQMA 2XYRA 3RRBA 2JCGA 2HWXA 2VF4X 4FOOA 3PFNA 4FFPA 4JP5A 3VHXA 4YMHA 1ILWA 1DIOB 3E9RA 3GP5A 1NI5A 1Z83A 5AKGA 4LE0A 1BHO1 2C2GA 2O2ZA 1J5PA 2XMRA 3GUCA 3LIPA 1BE8A 2SKCA 3Q72A 2EBFX 2JFQA 4L5JA 1EFPA 3SXJA 4B7AA 5L3QB 5D8DA 3A1NA 1Z15A 3Q3JB 3QY0A 4M7PA 3KT3A 4O2RA 4Y2RA 1YVRA 1ABFA 2QQ5A 1N2CA 4PQYA 1J99A 4MUYA 1XD8A 4NYIQ 3F5DA 4EA8A 4UFPA 1HZZA 1QVVA 3I4CA 4M37A 5M3BA 4O6VA 3INYA 2FSHA 3BB4A 4LTDA 2GAOA 4HDRA 3DOEA 4BQEA 4US2R 1JVBA 1M34E 5TLSA 4B3RB 3H8WA 5F7JA 1E5DA 3GEIA 4UQPA 5CXUA 3G2KA 1QWOA 5KTNA 5BV2P 3TRHA 3QSGA 5AVTA 3T3NA 1YBFA 3AZOA 1JDTA 4W5JA 3K2EA 4QTTB 1NNLA 3D6MA 1AUOA 2V9PA 3FVTA 1ULSA 5EIBD 1V45E 4C4ZA 2D3TA 3JTMA 2C3OA 4GM0A 2IS6A 2IU3A 1NXVA 2ONYA 1ZHHA 4CIVA 3SYMA 1HORA 4UQOA 2JDIA 3FFBA 2IV3A 4JI6B 3SJZA 3OLQA 4EM6A 1ZCJA 2W6JD 3T9FA 1Z8FA 4E32A 4YCAA 4N6NA 1P2TA 3GPDG 1CF4A 1A3CA 3R5TA 3TLBA 1OH6A 1GUDA 4LRSB 5AK5A 3IR6A 3QVMA 4AULA 2XMGA 2RFLA 2ZSDA 2UYCA 3FUCA 2H57A 4R1UA 4RY0A 5E7MA 4K6FA 4KDCA 3O7MA 3FLBA 1K68A 3QITA 1NVEA 1QONA 1G6Q1 2PS9A 1XZDA 2XF2A 3DC7A 5JZ9A 3MXOA 3KAKA 3TRIA 4YJ2B 3IUNA 2AFIB 2EVWX 4YP6A 4B33A 1G5FA 2JIRA 5GIPE 1UPAA 3O4IA 1NUAA 3BICA 4UOZA 2Z2YA 2VAMA 1I2ZA 3L0SA 4QPDA 1CX9B 5ESWA 5T41A 3ZVKA 2WT4A 5I8WA 1BQ3A 3Q7RA 1A9TA 3QWHA 1AKRA 1M2GA 4J94A 4OMDA 2XDQB 1DFGA 1FDVA 4LJ7A 2PIDA 4LHVA 2PUHA 1EEHA 4KQJA 1NI4A 2CUKA 1UWVA 1UWKA 2C9ZA 3C6MA 1QXSA 3BPSA 3HY3A 4EEXA 1Z12A 1U80A 2DR0A 4PIPA 4DMRA 1AK1A 4IDFA 3PEEA 5IM4A 4W8OA 1GKLA 1SVIA 2W8BB 3DMGA 4X8HA 3U16A 1C9YA 4MYHA 4NOMA 3WKAA 4PO3X 8OHMA 4CUKA 2FZVA 4D8WA 2F7SA 2PWPA 5BN5B 1ODCA 3BWVA 3P9CA 4M83A 3MMZA 4BP8A 5KI6A 3I01A 1RYFA 5JSUA 3AKYA 2ILVA 3UHOA 2OB2A 2X0RA 3TSYA 4Z3KA 3K53A 3N8HA 4JLBA 1BCSA 3C74A 1QOQB 2GZ1A 1SK8A 3OKAA 2BFCA 1KOLA 4QYIB 2ZI3A 1OF1A 4DNPA 3C98A 5EJGA 3GLGA 3L5KA 4MAAA 2IS1A 2FJPA 2C54A 3C7TA 1KYVA 3UN1A 3I04M 1YR6A 2FR8A 2LD4A 2YX1A 3PNYA 5BOVA 1V47A 5A7FA 3LT0A 3OIFA 3HJUA 2AMYA 3Q4GA 3RNOA 1VTKA 2PQMA 3ZY3A 3M1YA 1R10A 1DEKA 5IABA 4I9FA 3U44B 3IKLA 3ND9A 3G2MA 1SR8A 4MPTA 3SIWA 3GLVA 1MX1A 1HYBA 2HAEA 2C2ZA 5A9SA 5EFZA 4XD7D 5F3WB 4BJHB 5FTJA 4ZI3A 4GICA 3R0QA 4FHEA 1ST3A 3FZGA 1BIFA 1X1SA 4IIHA 3E9NA 1RS0A 1WR8A 2X6QA 1C3LA 3H11B 4KGZA 4EQ6A 4JCCA 1PD1A 1UCFA 5EGNA 2CJFA 4PIVA 2BV3A 4F4HA 5DNCA 4L75A 5F9MA 3AR3A 3KU4A 4QDUA 4LGYA 3RSLA 3TXXA 4EG1A 2AKYA 4L8YA 1EVJA 4UZSA 2H7XA 4CM5A 5F35A 2LGJA 4WEQA 3OWOA 4TVBA 4Z4EA 5AKJA 3GCZA 3QXXA 2R44A 2YXEA 3LHIA 5AK4A 4WK0B 2O8DB 4Y6RA 3BMXA 3V8VA 1G18A 2JK1A 4NU0A 1VRVA 1GCIA 1ZRMA 2HRRA 4TRNA 1P0CA 3L7JA 2ZE5A 3DXYA 3EEBA 4IIDA 1G21B 3T9AA 4JJFA 1S0UA 3D0QA 3LTEA 3KSRA 3W5IA 4D6PA 1TVEA 3VTKA 2Q7DA 1ZU4A 2VHWA 3AFGA 2MINB 2Q0SA 4MA5A 2QTRA 5CLJA 4B3CA 1ZJZA 1T8PA 4HTFB 2A1IA 4FFSA 1TAGA 3SS7X 1N2HA 3GZ4A 1LRJA 3G3EA 4J16A 4ZV9A 3ILSA 3DMPA 1VOTA 1CQIB 1G2QA 2ANBA 4YWHA 4AO7A 4B4UA 3UPTA 3PITA 1RYBA 1HYHA 2CL5A 1UR5A 4A2WA 3BF7A 1I3OA 3SSOA 3X44A 5B3JA 4M88A 5I9MA 1NF2A 3RQIA 4IDPA 1CULC 5FUQA 1XEXB 3STUA 4FCCA 3ILYA 1IM8A 1KJNA 3QH4A 4X61A 1TMOA 2C92A 1WU8A 4GEGA 4WY5A 5TF4A 3ZS8A 1U3FA 1PJ2A 1JAXA 4MDHA 3TKAA 1KR2A 1YBMA 3KRTA 3PWSA 1ESNA 1R9MA 1N6RA 3R41A 5BPFA 1KZHA 1CUHA 1D2RA 4EKIA 2O3RA 3K1AA 1I0IA 4O3FA 1IZZA 4JX8A 3QXHA 5GOTA 1Z3IX 3PV0A 3R4CA 3NUGA 2VP4A 3P27A 4XUGB 5K01A 1VRCA 4LUCA 5JYBA 4D3DA 2CFOA 5DU2A 1EE1A 5KQSA 1HT2E 4N7BA 4GQBA 4XSGA 2YXPX 3LRTA 4HEQA 2ZSBA 3A6PC 1Y7PA 2BFFB 3QOYA 1WV0A 3DF7A 1TLTA 1XAJA 1F0KA 1Z7EA 2P0AA 3WYAA 3SLKA