2PLSA

Structural genomics, the crystal structure of the corc/hlyc transporter associated domain of a cbs domain protein from chlorobium tepidum tls
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
86
structure length
86
Chain Sequence
SNAVQREDGSWLLDGLIAVPELKDTLGLRAVPEEEKGVYHTLSGMIMWLLGRLPQTGDITFWENWRLEVIDMDSKRIDKVLATKID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CBS domain protein
publication title The crystal structure of the CorC/HlyC transporter associated domain of a CBS domain protein from Chlorobium tepidum TLS.
rcsb
source organism Chlorobium tepidum tls
molecule tags Structural genomics, unknown function
total genus 18
structure length 86
sequence length 86
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2007-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03471 CorC_HlyC Transporter associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2plsA00
4BCAA 2QPMA 2VAOA 3S1FA 3TX1A 1FIQB 3ETRB 3HRDC 1VDVA 4BC9A 4ML8A 4JB1A 2PLIA 1QLUA 5FXPA 5FXDA 5ADZA 2NQWA 2Q85A 2Q4WA 3BW7A 3NVYB 2QKNA 2I0KA 5HQXA 2RK5A 3LAEA 2P4PA 1VAOA 3DQ0A 2VFVA 1E8HA 1SB3B 2W54A 3S1EA 4OALA 1V97A 2YVSA 1WVEA 1ZXIC 2VFTA 1N60C 2R2ZA 1WYGA 3W8ZA 4JAYA 2W3SA 3W8XA 4PYTA 5G5HB 1HSKA 1DIQA 1W1RA 1W1SA 5FXEA 2EXRA 2OAIA 2MBRA 1FFUC 4BBYA 2GQUA 1T3QC 1E8GA 1W1JA 1RM6B 1AHVA 1QLTA 3NVZB 1N5XA 1F0XA 3S1DA 3DEDA 3PM9A 2BVGA 3NS1B 1FFVC 3S1CA 1W1LA 3KJMA 3AN1A 1AHZA 1W1OA 1N62C 2P13A 1W1QA 4O95A 5AE1A 5AE3A 1DZNA 4MLAA 3C0PA 1AHUA 1E8FA 3I99A 5G5GB 2VFRA 1DIIA 2O3GA 4XLOA 1JROA 5AE2A 3JS8A 2R8DA 5HMRA 3NVVB 2P3HA 1MBTA 1N61C 2E3TA 3B9JB 4ZOHB 1WVFA 4HG0A 2W3RA 4BC7A 1MBBA 2PLSA 1N5WC 2BVHA 1W1KA 2AXRA 5HHZA 3AMZA 5FXFA 3AM9A 1UXYA 1E0YA 3LLBA 3NVWB 1W1MA 2VFUA 1N63C 3NRZB 1ZR6A 2W55A 3EUB3 2BVFA 1JRPA 3SR6B 1FO4A 2VFSA 3W8WA 2GQTA 1I19A
chains in the Genus database with same CATH superfamily
4BCAA 2QPMA 5L6FA 2VAOA 3RJAA 3S1FA 3TX1A 1FIQB 5I1VA 2IPIA 3ETRB 3HRDC 1VDVA 2WDWA 4BC9A 4ML8A 4JB1A 4DNSA 2PLIA 1QLUA 5FXPA 5FXDA 2Y4GA 3FW8A 5ADZA 2NQWA 2Q85A 2Q4WA 3BW7A 3NVYB 2QKNA 2I0KA 5HQXA 2RK5A 3LAEA 2P4PA 1VAOA 3DQ0A 2VFVA 1E8HA 1SB3B 2W54A 3S1EA 5I1WA 3TSHA 4OALA 1V97A 2YVSA 3RJ8A 1WVEA 1ZXIC 2VFTA 1N60C 2R2ZA 1WYGA 4PWBA 3W8ZA 4JAYA 2W3SA 3W8XA 4PYTA 5G5HB 2UUUA 1HSKA 1DIQA 1W1RA 1W1SA 5FXEA 2EXRA 2OAIA 2MBRA 1FFUC 4BBYA 4PVJA 2GQUA 1T3QC 1E8GA 1W1JA 3VTEA 1RM6B 1AHVA 3FW7A 1QLTA 3NVZB 1N5XA 1F0XA 3S1DA 3DEDA 3PM9A 4PWCA 2BVGA 3NS1B 4PVHA 1FFVC 4PVKA 3S1CA 1W1LA 3KJMA 3AN1A 1AHZA 1W1OA 1N62C 4PZFA 2P13A 1W1QA 4O95A 5AE1A 5AE3A 3D2HA 1DZNA 4MLAA 2Y08A 3C0PA 1AHUA 1E8FA 3I99A 4PVEA 5G5GB 4UD8A 2VFRA 1DIIA 2O3GA 3D2DA 4XLOA 1JROA 4EC3A 3FWAA 5AE2A 3D2JA 3JS8A 2R8DA 5HMRA 3NVVB 2P3HA 5K8EA 1MBTA 3PQBA 1N61C 2E3TA 3B9JB 4ZOHB 1WVFA 4HG0A 2W3RA 4BC7A 5L6GA 1MBBA 5AWVA 3HSUA 2PLSA 1N5WC 2BVHA 3TSJA 5D79A 1W1KA 3GSYA 2AXRA 5HHZA 2UUVA 3AMZA 2Y3RA 5FXFA 3AM9A 1UXYA 1E0YA 3LLBA 3NVWB 1W1MA 2VFUA 1N63C 3NRZB 1ZR6A 2W55A 3EUB3 3FW9A 2BVFA 1JRPA 3SR6B 1FO4A 2VFSA 2Y3SA 3W8WA 3POPA 2GQTA 1I19A
chains in the Genus database with same CATH topology
4BCAA 2QPMA 5L6FA 2VAOA 3RJAA 3S1FA 3TX1A 1FIQB 5I1VA 2IPIA 3ETRB 3HRDC 1VDVA 2WDWA 4BC9A 4ML8A 4JB1A 4DNSA 2PLIA 1QLUA 5FXPA 5FXDA 2Y4GA 3FW8A 5ADZA 2NQWA 2Q85A 2Q4WA 3BW7A 3NVYB 2QKNA 2I0KA 5HQXA 2RK5A 3LAEA 2P4PA 1VAOA 3DQ0A 2VFVA 1E8HA 1SB3B 2W54A 3S1EA 5I1WA 3TSHA 4OALA 1V97A 2YVSA 3RJ8A 1WVEA 1ZXIC 2VFTA 1N60C 2R2ZA 1WYGA 4PWBA 3W8ZA 4JAYA 2W3SA 3W8XA 4PYTA 5G5HB 2UUUA 1HSKA 1DIQA 1W1RA 1W1SA 5FXEA 2EXRA 2OAIA 2MBRA 1FFUC 4BBYA 4PVJA 2GQUA 1T3QC 1E8GA 1W1JA 3VTEA 1RM6B 1AHVA 3FW7A 1QLTA 3NVZB 1N5XA 1F0XA 3S1DA 3DEDA 3PM9A 4PWCA 2BVGA 3NS1B 4PVHA 1FFVC 4PVKA 3S1CA 1W1LA 3KJMA 3AN1A 1AHZA 1W1OA 1N62C 4PZFA 2P13A 1W1QA 4O95A 5AE1A 5AE3A 3D2HA 1DZNA 4MLAA 2Y08A 3C0PA 1AHUA 1E8FA 3I99A 4PVEA 5G5GB 4UD8A 2VFRA 1DIIA 2O3GA 3D2DA 4XLOA 1JROA 4EC3A 3FWAA 5AE2A 3D2JA 3JS8A 2R8DA 5HMRA 3NVVB 2P3HA 5K8EA 1MBTA 3PQBA 1N61C 2E3TA 3B9JB 4ZOHB 1WVFA 4HG0A 2W3RA 4BC7A 5L6GA 1MBBA 5AWVA 3HSUA 2PLSA 1N5WC 2BVHA 3TSJA 5D79A 1W1KA 3GSYA 2AXRA 5HHZA 2UUVA 3AMZA 2Y3RA 5FXFA 3AM9A 1UXYA 1E0YA 3LLBA 3NVWB 1W1MA 2VFUA 1N63C 3NRZB 1ZR6A 2W55A 3EUB3 3FW9A 2BVFA 1JRPA 3SR6B 1FO4A 2VFSA 2Y3SA 3W8WA 3POPA 2GQTA 1I19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BCA A;  2QPM A;  2VAO A;  3S1F A;  3TX1 A;  1FIQ B;  3ETR B;  3HRD C;  1VDV A;  4BC9 A;  4ML8 A;  4JB1 A;  2PLI A;  1QLU A;  5FXP A;  5FXD A;  5ADZ A;  2NQW A;  2Q85 A;  2Q4W A;  3BW7 A;  3NVY B;  2QKN A;  2I0K A;  5HQX A;  2RK5 A;  3LAE A;  2P4P A;  1VAO A;  3DQ0 A;  2VFV A;  1E8H A;  1SB3 B;  2W54 A;  3S1E A;  4OAL A;  1V97 A;  2YVS A;  1WVE A;  1ZXI C;  2VFT A;  1N60 C;  2R2Z A;  1WYG A;  3W8Z A;  4JAY A;  2W3S A;  3W8X A;  4PYT A;  5G5H B;  1HSK A;  1DIQ A;  1W1R A;  1W1S A;  5FXE A;  2EXR A;  2OAI A;  2MBR A;  1FFU C;  4BBY A;  2GQU A;  1T3Q C;  1E8G A;  1W1J A;  1RM6 B;  1AHV A;  1QLT A;  3NVZ B;  1N5X A;  1F0X A;  3S1D A;  3DED A;  3PM9 A;  2BVG A;  3NS1 B;  1FFV C;  3S1C A;  1W1L A;  3KJM A;  3AN1 A;  1AHZ A;  1W1O A;  1N62 C;  2P13 A;  1W1Q A;  4O95 A;  5AE1 A;  5AE3 A;  1DZN A;  4MLA A;  3C0P A;  1AHU A;  1E8F A;  3I99 A;  5G5G B;  2VFR A;  1DII A;  2O3G A;  4XLO A;  1JRO A;  5AE2 A;  3JS8 A;  2R8D A;  5HMR A;  3NVV B;  2P3H A;  1MBT A;  1N61 C;  2E3T A;  3B9J B;  4ZOH B;  1WVF A;  4HG0 A;  2W3R A;  4BC7 A;  1MBB A;  2PLS A;  1N5W C;  2BVH A;  1W1K A;  2AXR A;  5HHZ A;  3AMZ A;  5FXF A;  3AM9 A;  1UXY A;  1E0Y A;  3LLB A;  3NVW B;  1W1M A;  2VFU A;  1N63 C;  3NRZ B;  1ZR6 A;  2W55 A;  3EUB 3;  2BVF A;  1JRP A;  3SR6 B;  1FO4 A;  2VFS A;  3W8W A;  2GQT A;  1I19 A; 
#chains in the Genus database with same CATH topology
 4BCA A;  2QPM A;  5L6F A;  2VAO A;  3RJA A;  3S1F A;  3TX1 A;  1FIQ B;  5I1V A;  2IPI A;  3ETR B;  3HRD C;  1VDV A;  2WDW A;  4BC9 A;  4ML8 A;  4JB1 A;  4DNS A;  2PLI A;  1QLU A;  5FXP A;  5FXD A;  2Y4G A;  3FW8 A;  5ADZ A;  2NQW A;  2Q85 A;  2Q4W A;  3BW7 A;  3NVY B;  2QKN A;  2I0K A;  5HQX A;  2RK5 A;  3LAE A;  2P4P A;  1VAO A;  3DQ0 A;  2VFV A;  1E8H A;  1SB3 B;  2W54 A;  3S1E A;  5I1W A;  3TSH A;  4OAL A;  1V97 A;  2YVS A;  3RJ8 A;  1WVE A;  1ZXI C;  2VFT A;  1N60 C;  2R2Z A;  1WYG A;  4PWB A;  3W8Z A;  4JAY A;  2W3S A;  3W8X A;  4PYT A;  5G5H B;  2UUU A;  1HSK A;  1DIQ A;  1W1R A;  1W1S A;  5FXE A;  2EXR A;  2OAI A;  2MBR A;  1FFU C;  4BBY A;  4PVJ A;  2GQU A;  1T3Q C;  1E8G A;  1W1J A;  3VTE A;  1RM6 B;  1AHV A;  3FW7 A;  1QLT A;  3NVZ B;  1N5X A;  1F0X A;  3S1D A;  3DED A;  3PM9 A;  4PWC A;  2BVG A;  3NS1 B;  4PVH A;  1FFV C;  4PVK A;  3S1C A;  1W1L A;  3KJM A;  3AN1 A;  1AHZ A;  1W1O A;  1N62 C;  4PZF A;  2P13 A;  1W1Q A;  4O95 A;  5AE1 A;  5AE3 A;  3D2H A;  1DZN A;  4MLA A;  2Y08 A;  3C0P A;  1AHU A;  1E8F A;  3I99 A;  4PVE A;  5G5G B;  4UD8 A;  2VFR A;  1DII A;  2O3G A;  3D2D A;  4XLO A;  1JRO A;  4EC3 A;  3FWA A;  5AE2 A;  3D2J A;  3JS8 A;  2R8D A;  5HMR A;  3NVV B;  2P3H A;  5K8E A;  1MBT A;  3PQB A;  1N61 C;  2E3T A;  3B9J B;  4ZOH B;  1WVF A;  4HG0 A;  2W3R A;  4BC7 A;  5L6G A;  1MBB A;  5AWV A;  3HSU A;  2PLS A;  1N5W C;  2BVH A;  3TSJ A;  5D79 A;  1W1K A;  3GSY A;  2AXR A;  5HHZ A;  2UUV A;  3AMZ A;  2Y3R A;  5FXF A;  3AM9 A;  1UXY A;  1E0Y A;  3LLB A;  3NVW B;  1W1M A;  2VFU A;  1N63 C;  3NRZ B;  1ZR6 A;  2W55 A;  3EUB 3;  3FW9 A;  2BVF A;  1JRP A;  3SR6 B;  1FO4 A;  2VFS A;  2Y3S A;  3W8W A;  3POP A;  2GQT A;  1I19 A; 
#chains in the Genus database with same CATH homology
 4BCA A;  2QPM A;  5L6F A;  2VAO A;  3RJA A;  3S1F A;  3TX1 A;  1FIQ B;  5I1V A;  2IPI A;  3ETR B;  3HRD C;  1VDV A;  2WDW A;  4BC9 A;  4ML8 A;  4JB1 A;  4DNS A;  2PLI A;  1QLU A;  5FXP A;  5FXD A;  2Y4G A;  3FW8 A;  5ADZ A;  2NQW A;  2Q85 A;  2Q4W A;  3BW7 A;  3NVY B;  2QKN A;  2I0K A;  5HQX A;  2RK5 A;  3LAE A;  2P4P A;  1VAO A;  3DQ0 A;  2VFV A;  1E8H A;  1SB3 B;  2W54 A;  3S1E A;  5I1W A;  3TSH A;  4OAL A;  1V97 A;  2YVS A;  3RJ8 A;  1WVE A;  1ZXI C;  2VFT A;  1N60 C;  2R2Z A;  1WYG A;  4PWB A;  3W8Z A;  4JAY A;  2W3S A;  3W8X A;  4PYT A;  5G5H B;  2UUU A;  1HSK A;  1DIQ A;  1W1R A;  1W1S A;  5FXE A;  2EXR A;  2OAI A;  2MBR A;  1FFU C;  4BBY A;  4PVJ A;  2GQU A;  1T3Q C;  1E8G A;  1W1J A;  3VTE A;  1RM6 B;  1AHV A;  3FW7 A;  1QLT A;  3NVZ B;  1N5X A;  1F0X A;  3S1D A;  3DED A;  3PM9 A;  4PWC A;  2BVG A;  3NS1 B;  4PVH A;  1FFV C;  4PVK A;  3S1C A;  1W1L A;  3KJM A;  3AN1 A;  1AHZ A;  1W1O A;  1N62 C;  4PZF A;  2P13 A;  1W1Q A;  4O95 A;  5AE1 A;  5AE3 A;  3D2H A;  1DZN A;  4MLA A;  2Y08 A;  3C0P A;  1AHU A;  1E8F A;  3I99 A;  4PVE A;  5G5G B;  4UD8 A;  2VFR A;  1DII A;  2O3G A;  3D2D A;  4XLO A;  1JRO A;  4EC3 A;  3FWA A;  5AE2 A;  3D2J A;  3JS8 A;  2R8D A;  5HMR A;  3NVV B;  2P3H A;  5K8E A;  1MBT A;  3PQB A;  1N61 C;  2E3T A;  3B9J B;  4ZOH B;  1WVF A;  4HG0 A;  2W3R A;  4BC7 A;  5L6G A;  1MBB A;  5AWV A;  3HSU A;  2PLS A;  1N5W C;  2BVH A;  3TSJ A;  5D79 A;  1W1K A;  3GSY A;  2AXR A;  5HHZ A;  2UUV A;  3AMZ A;  2Y3R A;  5FXF A;  3AM9 A;  1UXY A;  1E0Y A;  3LLB A;  3NVW B;  1W1M A;  2VFU A;  1N63 C;  3NRZ B;  1ZR6 A;  2W55 A;  3EUB 3;  3FW9 A;  2BVF A;  1JRP A;  3SR6 B;  1FO4 A;  2VFS A;  2Y3S A;  3W8W A;  3POP A;  2GQT A;  1I19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...