2PLSA

Structural genomics, the crystal structure of the corc/hlyc transporter associated domain of a cbs domain protein from chlorobium tepidum tls
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
86
structure length
86
Chain Sequence
b'SNAVQREDGSWLLDGLIAVPELKDTLGLRAVPEEEKGVYHTLSGMIMWLLGRLPQTGDITFWENWRLEVIDMDSKRIDKVLATKID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CBS domain protein
publication title The crystal structure of the CorC/HlyC transporter associated domain of a CBS domain protein from Chlorobium tepidum TLS.
rcsb
source organism Chlorobium tepidum tls
molecule tags Structural genomics, unknown function
total genus 18
structure length 86
sequence length 86
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2007-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03471 CorC_HlyC Transporter associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2plsA00
3BW7A 5AE3A 1JRPA 4HG0A 1E8FA 2AXRA 2I0KA 1W1JA 3KJMA 1W1QA 1FFVC 2QPMA 5FXEA 1DIIA 5FXDA 1RM6B 2VFVA 3W8XA 1WVEA 3LAEA 1E8HA 3S1FA 3NS1B 2Q85A 1N5XA 1E0YA 1N63C 2OAIA 1ZR6A 4ZOHB 2VFRA 2NQWA 4XLOA 4BC7A 5FXPA 1FIQB 1JROA 5HQXA 2Q4WA 2P4PA 1DZNA 3EUB3 1FO4A 2RK5A 3S1EA 2GQUA 3ETRB 1N60C 2VFUA 4JAYA 2MBRA 1W1KA 5HHZA 1AHVA 3NRZB 3B9JB 2EXRA 5HMRA 2R8DA 2YVSA 1QLUA 2PLSA 2GQTA 2O3GA 2VFSA 4ML8A 1WYGA 2P13A 1W1SA 3W8ZA 4JB1A 2PLIA 1W1LA 2VFTA 3NVZB 1AHZA 2E3TA 3NVYB 2W3RA 2W55A 2W54A 1W1MA 1UXYA 1WVFA 3NVVB 3AM9A 3DEDA 5AE2A 2BVGA 3S1DA 5G5HB 1T3QC 1FFUC 3C0PA 1W1OA 2BVFA 1MBTA 2R2ZA 1N5WC 3DQ0A 1F0XA 1MBBA 2P3HA 1HSKA 4PYTA 3SR6B 4MLAA 1SB3B 1QLTA 1ZXIC 3HRDC 2W3SA 4O95A 3JS8A 4BCAA 1N61C 1V97A 1AHUA 3S1CA 1I19A 2VAOA 4BC9A 3W8WA 2QKNA 3AMZA 5G5GB 4OALA 2BVHA 3TX1A 3PM9A 5ADZA 1VDVA 1N62C 3I99A 5FXFA 5AE1A 1E8GA 3NVWB 1DIQA 1W1RA 3AN1A 4BBYA 3LLBA 1VAOA
chains in the Genus database with same CATH superfamily
3BW7A 5AE3A 1JRPA 4HG0A 1E8FA 2Y3SA 2AXRA 3VTEA 3POPA 2I0KA 1W1JA 2UUUA 3KJMA 1W1QA 5AWVA 1FFVC 2QPMA 5FXEA 1DIIA 5FXDA 1RM6B 4PZFA 2VFVA 3W8XA 1WVEA 3LAEA 1E8HA 3S1FA 3NS1B 2Q85A 1N5XA 1E0YA 1N63C 2OAIA 4DNSA 1ZR6A 4ZOHB 2VFRA 2NQWA 5L6GA 4XLOA 4BC7A 5L6FA 5FXPA 1FIQB 1JROA 3FW8A 5HQXA 2Q4WA 2P4PA 1DZNA 4UD8A 3EUB3 1FO4A 2RK5A 3S1EA 2GQUA 3ETRB 3TSHA 3D2HA 2Y08A 4PWCA 4PWBA 1N60C 2VFUA 4JAYA 2WDWA 2MBRA 1W1KA 5HHZA 1AHVA 4PVHA 3NRZB 3B9JB 4PVJA 2UUVA 2EXRA 5HMRA 2R8DA 2YVSA 1QLUA 2PLSA 2GQTA 5K8EA 2O3GA 2VFSA 4ML8A 1WYGA 2P13A 4PVKA 5I1VA 1W1SA 3W8ZA 4JB1A 2PLIA 1W1LA 2VFTA 3NVZB 3HSUA 1AHZA 2Y4GA 2E3TA 3NVYB 2W3RA 2W55A 2W54A 1W1MA 3D2DA 1UXYA 1WVFA 3FWAA 3NVVB 3PQBA 3AM9A 3DEDA 5AE2A 2Y3RA 2BVGA 2IPIA 3S1DA 5G5HB 1T3QC 1FFUC 3C0PA 5I1WA 1W1OA 2BVFA 3RJ8A 1MBTA 2R2ZA 1N5WC 3DQ0A 1F0XA 1MBBA 4PVEA 2P3HA 1HSKA 4PYTA 3SR6B 4MLAA 1SB3B 1QLTA 1ZXIC 3FW7A 2W3SA 3HRDC 4O95A 5D79A 3JS8A 4BCAA 1N61C 3GSYA 3FW9A 3RJAA 1V97A 1AHUA 3S1CA 1I19A 2VAOA 4BC9A 3W8WA 2QKNA 3AMZA 5G5GB 4OALA 3TSJA 2BVHA 3TX1A 3PM9A 5ADZA 1VDVA 1N62C 3I99A 5FXFA 3D2JA 5AE1A 1E8GA 3NVWB 1DIQA 1W1RA 3AN1A 4EC3A 4BBYA 3LLBA 1VAOA
chains in the Genus database with same CATH topology
3BW7A 5AE3A 1JRPA 4HG0A 1E8FA 2Y3SA 2AXRA 3VTEA 3POPA 2I0KA 1W1JA 2UUUA 3KJMA 1W1QA 5AWVA 1FFVC 2QPMA 5FXEA 1DIIA 5FXDA 1RM6B 4PZFA 2VFVA 3W8XA 1WVEA 3LAEA 1E8HA 3S1FA 3NS1B 2Q85A 1N5XA 1E0YA 1N63C 2OAIA 4DNSA 1ZR6A 4ZOHB 2VFRA 2NQWA 5L6GA 4XLOA 4BC7A 5L6FA 5FXPA 1FIQB 1JROA 3FW8A 5HQXA 2Q4WA 2P4PA 1DZNA 4UD8A 3EUB3 1FO4A 2RK5A 3S1EA 2GQUA 3ETRB 3TSHA 3D2HA 2Y08A 4PWCA 4PWBA 1N60C 2VFUA 4JAYA 2WDWA 2MBRA 1W1KA 5HHZA 1AHVA 4PVHA 3NRZB 3B9JB 4PVJA 2UUVA 2EXRA 5HMRA 2R8DA 2YVSA 1QLUA 2PLSA 2GQTA 5K8EA 2O3GA 2VFSA 4ML8A 1WYGA 2P13A 4PVKA 5I1VA 1W1SA 3W8ZA 4JB1A 2PLIA 1W1LA 2VFTA 3NVZB 3HSUA 1AHZA 2Y4GA 2E3TA 3NVYB 2W3RA 2W55A 2W54A 1W1MA 3D2DA 1UXYA 1WVFA 3FWAA 3NVVB 3PQBA 3AM9A 3DEDA 5AE2A 2Y3RA 2BVGA 2IPIA 3S1DA 5G5HB 1T3QC 1FFUC 3C0PA 5I1WA 1W1OA 2BVFA 3RJ8A 1MBTA 2R2ZA 1N5WC 3DQ0A 1F0XA 1MBBA 4PVEA 2P3HA 1HSKA 4PYTA 3SR6B 4MLAA 1SB3B 1QLTA 1ZXIC 3FW7A 2W3SA 3HRDC 4O95A 5D79A 3JS8A 4BCAA 1N61C 3GSYA 3FW9A 3RJAA 1V97A 1AHUA 3S1CA 1I19A 2VAOA 4BC9A 3W8WA 2QKNA 3AMZA 5G5GB 4OALA 3TSJA 2BVHA 3TX1A 3PM9A 5ADZA 1VDVA 1N62C 3I99A 5FXFA 3D2JA 5AE1A 1E8GA 3NVWB 1DIQA 1W1RA 3AN1A 4EC3A 4BBYA 3LLBA 1VAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BW7 A;  5AE3 A;  1JRP A;  4HG0 A;  1E8F A;  2AXR A;  2I0K A;  1W1J A;  3KJM A;  1W1Q A;  1FFV C;  2QPM A;  5FXE A;  1DII A;  5FXD A;  1RM6 B;  2VFV A;  3W8X A;  1WVE A;  3LAE A;  1E8H A;  3S1F A;  3NS1 B;  2Q85 A;  1N5X A;  1E0Y A;  1N63 C;  2OAI A;  1ZR6 A;  4ZOH B;  2VFR A;  2NQW A;  4XLO A;  4BC7 A;  5FXP A;  1FIQ B;  1JRO A;  5HQX A;  2Q4W A;  2P4P A;  1DZN A;  3EUB 3;  1FO4 A;  2RK5 A;  3S1E A;  2GQU A;  3ETR B;  1N60 C;  2VFU A;  4JAY A;  2MBR A;  1W1K A;  5HHZ A;  1AHV A;  3NRZ B;  3B9J B;  2EXR A;  5HMR A;  2R8D A;  2YVS A;  1QLU A;  2PLS A;  2GQT A;  2O3G A;  2VFS A;  4ML8 A;  1WYG A;  2P13 A;  1W1S A;  3W8Z A;  4JB1 A;  2PLI A;  1W1L A;  2VFT A;  3NVZ B;  1AHZ A;  2E3T A;  3NVY B;  2W3R A;  2W55 A;  2W54 A;  1W1M A;  1UXY A;  1WVF A;  3NVV B;  3AM9 A;  3DED A;  5AE2 A;  2BVG A;  3S1D A;  5G5H B;  1T3Q C;  1FFU C;  3C0P A;  1W1O A;  2BVF A;  1MBT A;  2R2Z A;  1N5W C;  3DQ0 A;  1F0X A;  1MBB A;  2P3H A;  1HSK A;  4PYT A;  3SR6 B;  4MLA A;  1SB3 B;  1QLT A;  1ZXI C;  3HRD C;  2W3S A;  4O95 A;  3JS8 A;  4BCA A;  1N61 C;  1V97 A;  1AHU A;  3S1C A;  1I19 A;  2VAO A;  4BC9 A;  3W8W A;  2QKN A;  3AMZ A;  5G5G B;  4OAL A;  2BVH A;  3TX1 A;  3PM9 A;  5ADZ A;  1VDV A;  1N62 C;  3I99 A;  5FXF A;  5AE1 A;  1E8G A;  3NVW B;  1DIQ A;  1W1R A;  3AN1 A;  4BBY A;  3LLB A;  1VAO A; 
#chains in the Genus database with same CATH topology
 3BW7 A;  5AE3 A;  1JRP A;  4HG0 A;  1E8F A;  2Y3S A;  2AXR A;  3VTE A;  3POP A;  2I0K A;  1W1J A;  2UUU A;  3KJM A;  1W1Q A;  5AWV A;  1FFV C;  2QPM A;  5FXE A;  1DII A;  5FXD A;  1RM6 B;  4PZF A;  2VFV A;  3W8X A;  1WVE A;  3LAE A;  1E8H A;  3S1F A;  3NS1 B;  2Q85 A;  1N5X A;  1E0Y A;  1N63 C;  2OAI A;  4DNS A;  1ZR6 A;  4ZOH B;  2VFR A;  2NQW A;  5L6G A;  4XLO A;  4BC7 A;  5L6F A;  5FXP A;  1FIQ B;  1JRO A;  3FW8 A;  5HQX A;  2Q4W A;  2P4P A;  1DZN A;  4UD8 A;  3EUB 3;  1FO4 A;  2RK5 A;  3S1E A;  2GQU A;  3ETR B;  3TSH A;  3D2H A;  2Y08 A;  4PWC A;  4PWB A;  1N60 C;  2VFU A;  4JAY A;  2WDW A;  2MBR A;  1W1K A;  5HHZ A;  1AHV A;  4PVH A;  3NRZ B;  3B9J B;  4PVJ A;  2UUV A;  2EXR A;  5HMR A;  2R8D A;  2YVS A;  1QLU A;  2PLS A;  2GQT A;  5K8E A;  2O3G A;  2VFS A;  4ML8 A;  1WYG A;  2P13 A;  4PVK A;  5I1V A;  1W1S A;  3W8Z A;  4JB1 A;  2PLI A;  1W1L A;  2VFT A;  3NVZ B;  3HSU A;  1AHZ A;  2Y4G A;  2E3T A;  3NVY B;  2W3R A;  2W55 A;  2W54 A;  1W1M A;  3D2D A;  1UXY A;  1WVF A;  3FWA A;  3NVV B;  3PQB A;  3AM9 A;  3DED A;  5AE2 A;  2Y3R A;  2BVG A;  2IPI A;  3S1D A;  5G5H B;  1T3Q C;  1FFU C;  3C0P A;  5I1W A;  1W1O A;  2BVF A;  3RJ8 A;  1MBT A;  2R2Z A;  1N5W C;  3DQ0 A;  1F0X A;  1MBB A;  4PVE A;  2P3H A;  1HSK A;  4PYT A;  3SR6 B;  4MLA A;  1SB3 B;  1QLT A;  1ZXI C;  3FW7 A;  2W3S A;  3HRD C;  4O95 A;  5D79 A;  3JS8 A;  4BCA A;  1N61 C;  3GSY A;  3FW9 A;  3RJA A;  1V97 A;  1AHU A;  3S1C A;  1I19 A;  2VAO A;  4BC9 A;  3W8W A;  2QKN A;  3AMZ A;  5G5G B;  4OAL A;  3TSJ A;  2BVH A;  3TX1 A;  3PM9 A;  5ADZ A;  1VDV A;  1N62 C;  3I99 A;  5FXF A;  3D2J A;  5AE1 A;  1E8G A;  3NVW B;  1DIQ A;  1W1R A;  3AN1 A;  4EC3 A;  4BBY A;  3LLB A;  1VAO A; 
#chains in the Genus database with same CATH homology
 3BW7 A;  5AE3 A;  1JRP A;  4HG0 A;  1E8F A;  2Y3S A;  2AXR A;  3VTE A;  3POP A;  2I0K A;  1W1J A;  2UUU A;  3KJM A;  1W1Q A;  5AWV A;  1FFV C;  2QPM A;  5FXE A;  1DII A;  5FXD A;  1RM6 B;  4PZF A;  2VFV A;  3W8X A;  1WVE A;  3LAE A;  1E8H A;  3S1F A;  3NS1 B;  2Q85 A;  1N5X A;  1E0Y A;  1N63 C;  2OAI A;  4DNS A;  1ZR6 A;  4ZOH B;  2VFR A;  2NQW A;  5L6G A;  4XLO A;  4BC7 A;  5L6F A;  5FXP A;  1FIQ B;  1JRO A;  3FW8 A;  5HQX A;  2Q4W A;  2P4P A;  1DZN A;  4UD8 A;  3EUB 3;  1FO4 A;  2RK5 A;  3S1E A;  2GQU A;  3ETR B;  3TSH A;  3D2H A;  2Y08 A;  4PWC A;  4PWB A;  1N60 C;  2VFU A;  4JAY A;  2WDW A;  2MBR A;  1W1K A;  5HHZ A;  1AHV A;  4PVH A;  3NRZ B;  3B9J B;  4PVJ A;  2UUV A;  2EXR A;  5HMR A;  2R8D A;  2YVS A;  1QLU A;  2PLS A;  2GQT A;  5K8E A;  2O3G A;  2VFS A;  4ML8 A;  1WYG A;  2P13 A;  4PVK A;  5I1V A;  1W1S A;  3W8Z A;  4JB1 A;  2PLI A;  1W1L A;  2VFT A;  3NVZ B;  3HSU A;  1AHZ A;  2Y4G A;  2E3T A;  3NVY B;  2W3R A;  2W55 A;  2W54 A;  1W1M A;  3D2D A;  1UXY A;  1WVF A;  3FWA A;  3NVV B;  3PQB A;  3AM9 A;  3DED A;  5AE2 A;  2Y3R A;  2BVG A;  2IPI A;  3S1D A;  5G5H B;  1T3Q C;  1FFU C;  3C0P A;  5I1W A;  1W1O A;  2BVF A;  3RJ8 A;  1MBT A;  2R2Z A;  1N5W C;  3DQ0 A;  1F0X A;  1MBB A;  4PVE A;  2P3H A;  1HSK A;  4PYT A;  3SR6 B;  4MLA A;  1SB3 B;  1QLT A;  1ZXI C;  3FW7 A;  2W3S A;  3HRD C;  4O95 A;  5D79 A;  3JS8 A;  4BCA A;  1N61 C;  3GSY A;  3FW9 A;  3RJA A;  1V97 A;  1AHU A;  3S1C A;  1I19 A;  2VAO A;  4BC9 A;  3W8W A;  2QKN A;  3AMZ A;  5G5G B;  4OAL A;  3TSJ A;  2BVH A;  3TX1 A;  3PM9 A;  5ADZ A;  1VDV A;  1N62 C;  3I99 A;  5FXF A;  3D2J A;  5AE1 A;  1E8G A;  3NVW B;  1DIQ A;  1W1R A;  3AN1 A;  4EC3 A;  4BBY A;  3LLB A;  1VAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...