2PLSA

Structural genomics, the crystal structure of the corc/hlyc transporter associated domain of a cbs domain protein from chlorobium tepidum tls
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
86
structure length
86
Chain Sequence
SNAVQREDGSWLLDGLIAVPELKDTLGLRAVPEEEKGVYHTLSGMIMWLLGRLPQTGDITFWENWRLEVIDMDSKRIDKVLATKID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of the CorC/HlyC transporter associated domain of a CBS domain protein from Chlorobium tepidum TLS.
rcsb
source organism Chlorobium tepidum tls
molecule tags Structural genomics, unknown function
molecule keywords CBS domain protein
total genus 18
structure length 86
sequence length 86
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2007-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03471 CorC_HlyC Transporter associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2plsA00
2P13A 1W1KA 3LAEA 1WYGA 2R2ZA 2W3SA 1FO4A 1E8GA 1I19A 1N63C 2BVHA 2PLIA 3S1DA 1MBBA 5FXPA 4JB1A 3S1EA 3S1CA 2VFVA 2P4PA 3ETRB 1WVFA 3W8WA 1N5XA 4ZOHB 3S1FA 3NVWB 2QKNA 2BVGA 1V97A 1W1QA 2P3HA 2I0KA 3NRZB 5HMRA 2QPMA 2NQWA 1N5WC 3NVYB 2R8DA 1ZXIC 3TX1A 1W1SA 1W1JA 1N62C 3NVVB 3BW7A 4HG0A 1AHVA 1F0XA 2O3GA 2YVSA 5G5GB 3EUB3 2AXRA 4PYTA 2MBRA 5AE1A 4BBYA 1DZNA 2VAOA 2VFRA 2VFUA 3DQ0A 3LLBA 1W1LA 5HHZA 4O95A 1HSKA 3NVZB 2EXRA 3W8ZA 3HRDC 2VFSA 3C0PA 2Q85A 5ADZA 4OALA 3SR6B 5HQXA 2Q4WA 1DIIA 1SB3B 5FXFA 4MLAA 2E3TA 2PLSA 1T3QC 1FIQB 1JRPA 1AHZA 3B9JB 2BVFA 1MBTA 3DEDA 5G5HB 4XLOA 2W3RA 2VFTA 1WVEA 2GQTA 1N60C 5AE3A 3W8XA 1ZR6A 1E0YA 1JROA 4ML8A 2OAIA 1QLUA 1QLTA 4BC9A 3JS8A 1AHUA 2W55A 4JAYA 4BC7A 3AN1A 2GQUA 3PM9A 1E8FA 1W1OA 3AM9A 1E8HA 3I99A 5FXEA 5FXDA 3NS1B 2RK5A 1DIQA 1FFVC 1UXYA 1VDVA 4BCAA 3AMZA 1VAOA 1W1RA 1W1MA 1RM6B 5AE2A 3KJMA 1FFUC 1N61C 2W54A
chains in the Genus database with same CATH superfamily
2P13A 1W1KA 3LAEA 1WYGA 5AWVA 2R2ZA 2W3SA 2Y3RA 1FO4A 1E8GA 1I19A 1N63C 2BVHA 2PLIA 3S1DA 1MBBA 5FXPA 4JB1A 3HSUA 3S1EA 3S1CA 2VFVA 2P4PA 4UD8A 3ETRB 1WVFA 3W8WA 1N5XA 4ZOHB 3S1FA 2WDWA 3FW9A 3NVWB 4PVKA 2QKNA 2BVGA 1V97A 2Y3SA 1W1QA 2P3HA 4PVEA 2I0KA 3NRZB 5HMRA 2QPMA 2NQWA 1N5WC 3NVYB 2R8DA 1ZXIC 3TX1A 1W1SA 1W1JA 1N62C 3NVVB 2IPIA 3BW7A 4HG0A 4PWBA 1AHVA 1F0XA 2O3GA 2YVSA 5G5GB 3RJAA 3EUB3 2AXRA 4PYTA 2MBRA 5AE1A 4BBYA 3TSJA 1DZNA 2VAOA 2VFRA 2VFUA 3DQ0A 3LLBA 1W1LA 3TSHA 5HHZA 4O95A 1HSKA 3NVZB 5L6GA 5L6FA 2EXRA 4PWCA 3W8ZA 3HRDC 2VFSA 3C0PA 2Q85A 2UUVA 5ADZA 4OALA 3SR6B 3VTEA 5HQXA 2Q4WA 1DIIA 1SB3B 5FXFA 4MLAA 3D2DA 2E3TA 2PLSA 3PQBA 1T3QC 4PZFA 1FIQB 1JRPA 3POPA 1AHZA 3B9JB 4PVHA 5K8EA 2BVFA 3FW7A 1MBTA 3DEDA 5G5HB 3GSYA 4DNSA 4XLOA 3FW8A 2W3RA 5D79A 2VFTA 3D2HA 1WVEA 3D2JA 2GQTA 1N60C 5AE3A 3W8XA 2UUUA 1ZR6A 1E0YA 3FWAA 1JROA 4ML8A 2OAIA 1QLUA 1QLTA 2Y08A 4BC9A 3JS8A 1AHUA 2W55A 4JAYA 4BC7A 3AN1A 2GQUA 3PM9A 1E8FA 1W1OA 3AM9A 1E8HA 3I99A 5I1WA 5FXEA 5FXDA 5I1VA 3NS1B 2RK5A 1DIQA 1FFVC 1UXYA 1VDVA 4BCAA 3AMZA 2Y4GA 1VAOA 1W1RA 1W1MA 4EC3A 3RJ8A 1RM6B 5AE2A 4PVJA 3KJMA 1FFUC 1N61C 2W54A
chains in the Genus database with same CATH topology
2P13A 1W1KA 3LAEA 1WYGA 5AWVA 2R2ZA 2W3SA 2Y3RA 1FO4A 1E8GA 1I19A 1N63C 2BVHA 2PLIA 3S1DA 1MBBA 5FXPA 4JB1A 3HSUA 3S1EA 3S1CA 2VFVA 2P4PA 4UD8A 3ETRB 1WVFA 3W8WA 1N5XA 4ZOHB 3S1FA 2WDWA 3FW9A 3NVWB 4PVKA 2QKNA 2BVGA 1V97A 2Y3SA 1W1QA 2P3HA 4PVEA 2I0KA 3NRZB 5HMRA 2QPMA 2NQWA 1N5WC 3NVYB 2R8DA 1ZXIC 3TX1A 1W1SA 1W1JA 1N62C 3NVVB 2IPIA 3BW7A 4HG0A 4PWBA 1AHVA 1F0XA 2O3GA 2YVSA 5G5GB 3RJAA 3EUB3 2AXRA 4PYTA 2MBRA 5AE1A 4BBYA 3TSJA 1DZNA 2VAOA 2VFRA 2VFUA 3DQ0A 3LLBA 1W1LA 3TSHA 5HHZA 4O95A 1HSKA 3NVZB 5L6GA 5L6FA 2EXRA 4PWCA 3W8ZA 3HRDC 2VFSA 3C0PA 2Q85A 2UUVA 5ADZA 4OALA 3SR6B 3VTEA 5HQXA 2Q4WA 1DIIA 1SB3B 5FXFA 4MLAA 3D2DA 2E3TA 2PLSA 3PQBA 1T3QC 4PZFA 1FIQB 1JRPA 3POPA 1AHZA 3B9JB 4PVHA 5K8EA 2BVFA 3FW7A 1MBTA 3DEDA 5G5HB 3GSYA 4DNSA 4XLOA 3FW8A 2W3RA 5D79A 2VFTA 3D2HA 1WVEA 3D2JA 2GQTA 1N60C 5AE3A 3W8XA 2UUUA 1ZR6A 1E0YA 3FWAA 1JROA 4ML8A 2OAIA 1QLUA 1QLTA 2Y08A 4BC9A 3JS8A 1AHUA 2W55A 4JAYA 4BC7A 3AN1A 2GQUA 3PM9A 1E8FA 1W1OA 3AM9A 1E8HA 3I99A 5I1WA 5FXEA 5FXDA 5I1VA 3NS1B 2RK5A 1DIQA 1FFVC 1UXYA 1VDVA 4BCAA 3AMZA 2Y4GA 1VAOA 1W1RA 1W1MA 4EC3A 3RJ8A 1RM6B 5AE2A 4PVJA 3KJMA 1FFUC 1N61C 2W54A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P13 A;  1W1K A;  3LAE A;  1WYG A;  2R2Z A;  2W3S A;  1FO4 A;  1E8G A;  1I19 A;  1N63 C;  2BVH A;  2PLI A;  3S1D A;  1MBB A;  5FXP A;  4JB1 A;  3S1E A;  3S1C A;  2VFV A;  2P4P A;  3ETR B;  1WVF A;  3W8W A;  1N5X A;  4ZOH B;  3S1F A;  3NVW B;  2QKN A;  2BVG A;  1V97 A;  1W1Q A;  2P3H A;  2I0K A;  3NRZ B;  5HMR A;  2QPM A;  2NQW A;  1N5W C;  3NVY B;  2R8D A;  1ZXI C;  3TX1 A;  1W1S A;  1W1J A;  1N62 C;  3NVV B;  3BW7 A;  4HG0 A;  1AHV A;  1F0X A;  2O3G A;  2YVS A;  5G5G B;  3EUB 3;  2AXR A;  4PYT A;  2MBR A;  5AE1 A;  4BBY A;  1DZN A;  2VAO A;  2VFR A;  2VFU A;  3DQ0 A;  3LLB A;  1W1L A;  5HHZ A;  4O95 A;  1HSK A;  3NVZ B;  2EXR A;  3W8Z A;  3HRD C;  2VFS A;  3C0P A;  2Q85 A;  5ADZ A;  4OAL A;  3SR6 B;  5HQX A;  2Q4W A;  1DII A;  1SB3 B;  5FXF A;  4MLA A;  2E3T A;  2PLS A;  1T3Q C;  1FIQ B;  1JRP A;  1AHZ A;  3B9J B;  2BVF A;  1MBT A;  3DED A;  5G5H B;  4XLO A;  2W3R A;  2VFT A;  1WVE A;  2GQT A;  1N60 C;  5AE3 A;  3W8X A;  1ZR6 A;  1E0Y A;  1JRO A;  4ML8 A;  2OAI A;  1QLU A;  1QLT A;  4BC9 A;  3JS8 A;  1AHU A;  2W55 A;  4JAY A;  4BC7 A;  3AN1 A;  2GQU A;  3PM9 A;  1E8F A;  1W1O A;  3AM9 A;  1E8H A;  3I99 A;  5FXE A;  5FXD A;  3NS1 B;  2RK5 A;  1DIQ A;  1FFV C;  1UXY A;  1VDV A;  4BCA A;  3AMZ A;  1VAO A;  1W1R A;  1W1M A;  1RM6 B;  5AE2 A;  3KJM A;  1FFU C;  1N61 C;  2W54 A; 
#chains in the Genus database with same CATH topology
 2P13 A;  1W1K A;  3LAE A;  1WYG A;  5AWV A;  2R2Z A;  2W3S A;  2Y3R A;  1FO4 A;  1E8G A;  1I19 A;  1N63 C;  2BVH A;  2PLI A;  3S1D A;  1MBB A;  5FXP A;  4JB1 A;  3HSU A;  3S1E A;  3S1C A;  2VFV A;  2P4P A;  4UD8 A;  3ETR B;  1WVF A;  3W8W A;  1N5X A;  4ZOH B;  3S1F A;  2WDW A;  3FW9 A;  3NVW B;  4PVK A;  2QKN A;  2BVG A;  1V97 A;  2Y3S A;  1W1Q A;  2P3H A;  4PVE A;  2I0K A;  3NRZ B;  5HMR A;  2QPM A;  2NQW A;  1N5W C;  3NVY B;  2R8D A;  1ZXI C;  3TX1 A;  1W1S A;  1W1J A;  1N62 C;  3NVV B;  2IPI A;  3BW7 A;  4HG0 A;  4PWB A;  1AHV A;  1F0X A;  2O3G A;  2YVS A;  5G5G B;  3RJA A;  3EUB 3;  2AXR A;  4PYT A;  2MBR A;  5AE1 A;  4BBY A;  3TSJ A;  1DZN A;  2VAO A;  2VFR A;  2VFU A;  3DQ0 A;  3LLB A;  1W1L A;  3TSH A;  5HHZ A;  4O95 A;  1HSK A;  3NVZ B;  5L6G A;  5L6F A;  2EXR A;  4PWC A;  3W8Z A;  3HRD C;  2VFS A;  3C0P A;  2Q85 A;  2UUV A;  5ADZ A;  4OAL A;  3SR6 B;  3VTE A;  5HQX A;  2Q4W A;  1DII A;  1SB3 B;  5FXF A;  4MLA A;  3D2D A;  2E3T A;  2PLS A;  3PQB A;  1T3Q C;  4PZF A;  1FIQ B;  1JRP A;  3POP A;  1AHZ A;  3B9J B;  4PVH A;  5K8E A;  2BVF A;  3FW7 A;  1MBT A;  3DED A;  5G5H B;  3GSY A;  4DNS A;  4XLO A;  3FW8 A;  2W3R A;  5D79 A;  2VFT A;  3D2H A;  1WVE A;  3D2J A;  2GQT A;  1N60 C;  5AE3 A;  3W8X A;  2UUU A;  1ZR6 A;  1E0Y A;  3FWA A;  1JRO A;  4ML8 A;  2OAI A;  1QLU A;  1QLT A;  2Y08 A;  4BC9 A;  3JS8 A;  1AHU A;  2W55 A;  4JAY A;  4BC7 A;  3AN1 A;  2GQU A;  3PM9 A;  1E8F A;  1W1O A;  3AM9 A;  1E8H A;  3I99 A;  5I1W A;  5FXE A;  5FXD A;  5I1V A;  3NS1 B;  2RK5 A;  1DIQ A;  1FFV C;  1UXY A;  1VDV A;  4BCA A;  3AMZ A;  2Y4G A;  1VAO A;  1W1R A;  1W1M A;  4EC3 A;  3RJ8 A;  1RM6 B;  5AE2 A;  4PVJ A;  3KJM A;  1FFU C;  1N61 C;  2W54 A; 
#chains in the Genus database with same CATH homology
 2P13 A;  1W1K A;  3LAE A;  1WYG A;  5AWV A;  2R2Z A;  2W3S A;  2Y3R A;  1FO4 A;  1E8G A;  1I19 A;  1N63 C;  2BVH A;  2PLI A;  3S1D A;  1MBB A;  5FXP A;  4JB1 A;  3HSU A;  3S1E A;  3S1C A;  2VFV A;  2P4P A;  4UD8 A;  3ETR B;  1WVF A;  3W8W A;  1N5X A;  4ZOH B;  3S1F A;  2WDW A;  3FW9 A;  3NVW B;  4PVK A;  2QKN A;  2BVG A;  1V97 A;  2Y3S A;  1W1Q A;  2P3H A;  4PVE A;  2I0K A;  3NRZ B;  5HMR A;  2QPM A;  2NQW A;  1N5W C;  3NVY B;  2R8D A;  1ZXI C;  3TX1 A;  1W1S A;  1W1J A;  1N62 C;  3NVV B;  2IPI A;  3BW7 A;  4HG0 A;  4PWB A;  1AHV A;  1F0X A;  2O3G A;  2YVS A;  5G5G B;  3RJA A;  3EUB 3;  2AXR A;  4PYT A;  2MBR A;  5AE1 A;  4BBY A;  3TSJ A;  1DZN A;  2VAO A;  2VFR A;  2VFU A;  3DQ0 A;  3LLB A;  1W1L A;  3TSH A;  5HHZ A;  4O95 A;  1HSK A;  3NVZ B;  5L6G A;  5L6F A;  2EXR A;  4PWC A;  3W8Z A;  3HRD C;  2VFS A;  3C0P A;  2Q85 A;  2UUV A;  5ADZ A;  4OAL A;  3SR6 B;  3VTE A;  5HQX A;  2Q4W A;  1DII A;  1SB3 B;  5FXF A;  4MLA A;  3D2D A;  2E3T A;  2PLS A;  3PQB A;  1T3Q C;  4PZF A;  1FIQ B;  1JRP A;  3POP A;  1AHZ A;  3B9J B;  4PVH A;  5K8E A;  2BVF A;  3FW7 A;  1MBT A;  3DED A;  5G5H B;  3GSY A;  4DNS A;  4XLO A;  3FW8 A;  2W3R A;  5D79 A;  2VFT A;  3D2H A;  1WVE A;  3D2J A;  2GQT A;  1N60 C;  5AE3 A;  3W8X A;  2UUU A;  1ZR6 A;  1E0Y A;  3FWA A;  1JRO A;  4ML8 A;  2OAI A;  1QLU A;  1QLT A;  2Y08 A;  4BC9 A;  3JS8 A;  1AHU A;  2W55 A;  4JAY A;  4BC7 A;  3AN1 A;  2GQU A;  3PM9 A;  1E8F A;  1W1O A;  3AM9 A;  1E8H A;  3I99 A;  5I1W A;  5FXE A;  5FXD A;  5I1V A;  3NS1 B;  2RK5 A;  1DIQ A;  1FFV C;  1UXY A;  1VDV A;  4BCA A;  3AMZ A;  2Y4G A;  1VAO A;  1W1R A;  1W1M A;  4EC3 A;  3RJ8 A;  1RM6 B;  5AE2 A;  4PVJ A;  3KJM A;  1FFU C;  1N61 C;  2W54 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...