2PLSA

Structural genomics, the crystal structure of the corc/hlyc transporter associated domain of a cbs domain protein from chlorobium tepidum tls
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
86
structure length
86
Chain Sequence
SNAVQREDGSWLLDGLIAVPELKDTLGLRAVPEEEKGVYHTLSGMIMWLLGRLPQTGDITFWENWRLEVIDMDSKRIDKVLATKID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of the CorC/HlyC transporter associated domain of a CBS domain protein from Chlorobium tepidum TLS.
rcsb
source organism Chlorobium tepidum tls
molecule tags Structural genomics, unknown function
molecule keywords CBS domain protein
total genus 18
structure length 86
sequence length 86
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2007-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03471 CorC_HlyC Transporter associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2plsA00
1N5XA 3EUB3 4XLOA 1V97A 2O3GA 2VFTA 1E0YA 1QLTA 3DEDA 3S1EA 2W3SA 3NVWB 3W8ZA 2MBRA 1W1QA 1QLUA 1FFUC 4PYTA 2NQWA 2W54A 4ML8A 3B9JB 3NS1B 2QPMA 4OALA 5ADZA 1DIIA 3NRZB 1SB3B 3S1CA 1E8HA 5FXFA 1AHZA 1T3QC 1AHVA 5HMRA 1ZXIC 5AE3A 1ZR6A 2BVHA 3C0PA 2OAIA 1MBTA 2BVFA 4BC7A 2W3RA 1E8FA 1W1MA 1JROA 1W1KA 2VAOA 1I19A 2P4PA 2W55A 3AMZA 4JB1A 1MBBA 2RK5A 5HQXA 2R2ZA 3S1DA 1WYGA 2YVSA 2Q85A 5AE2A 2EXRA 1FIQB 3NVYB 1N63C 2VFSA 4HG0A 4BCAA 3TX1A 1FFVC 3I99A 2E3TA 1RM6B 1DZNA 3DQ0A 1DIQA 4BBYA 2P3HA 1F0XA 1VAOA 4O95A 1WVEA 5AE1A 3AM9A 3HRDC 1HSKA 1W1JA 2BVGA 5G5HB 1W1OA 1N5WC 3LAEA 1VDVA 2P13A 3NVVB 3W8WA 1JRPA 4ZOHB 1N61C 2I0KA 2QKNA 3ETRB 1W1LA 3BW7A 1W1RA 2PLIA 1E8GA 1UXYA 5FXPA 1N60C 2R8DA 4BC9A 1FO4A 1WVFA 3AN1A 3S1FA 3KJMA 3LLBA 3NVZB 4JAYA 5FXDA 2VFVA 2VFRA 2PLSA 1N62C 2VFUA 3SR6B 1W1SA 2GQUA 5G5GB 3JS8A 2Q4WA 5HHZA 5FXEA 2GQTA 3PM9A 2AXRA 1AHUA 3W8XA 4MLAA
chains in the Genus database with same CATH superfamily
1N5XA 3EUB3 4XLOA 1V97A 2O3GA 2VFTA 1E0YA 3POPA 1QLTA 2Y3SA 3DEDA 3S1EA 2W3SA 3NVWB 3W8ZA 2MBRA 1W1QA 4EC3A 1QLUA 3D2HA 1FFUC 4PYTA 2NQWA 2W54A 3GSYA 4ML8A 3B9JB 3NS1B 2QPMA 4OALA 5ADZA 1DIIA 3NRZB 1SB3B 3S1CA 1E8HA 5FXFA 1AHZA 1T3QC 1AHVA 5HMRA 1ZXIC 5AE3A 1ZR6A 2IPIA 2BVHA 3C0PA 2OAIA 1MBTA 5L6FA 2BVFA 4BC7A 3RJ8A 2W3RA 4DNSA 1E8FA 1W1MA 1JROA 1W1KA 4PVHA 2VAOA 1I19A 2P4PA 2W55A 3AMZA 4JB1A 1MBBA 2RK5A 5HQXA 3FW7A 2R2ZA 3S1DA 5L6GA 3RJAA 1WYGA 2YVSA 3TSJA 2Q85A 2Y4GA 5AE2A 2EXRA 3D2JA 1FIQB 2WDWA 3FW8A 1N63C 2VFSA 3NVYB 4HG0A 4BCAA 3TX1A 1FFVC 3I99A 2E3TA 4PZFA 1RM6B 2Y08A 1DZNA 3DQ0A 1DIQA 2Y3RA 4BBYA 2P3HA 4PVKA 1F0XA 1VAOA 3HSUA 1WVEA 4O95A 4UD8A 5AE1A 3AM9A 3HRDC 1HSKA 1W1JA 4PVEA 5I1VA 2BVGA 3TSHA 5I1WA 5G5HB 1W1OA 1N5WC 3LAEA 1VDVA 2P13A 5AWVA 3NVVB 3W8WA 1JRPA 4ZOHB 1N61C 2I0KA 2QKNA 3PQBA 3ETRB 1W1LA 3BW7A 1W1RA 2PLIA 1E8GA 1UXYA 2UUUA 5FXPA 1N60C 2R8DA 4BC9A 1FO4A 1WVFA 3D2DA 4PVJA 5K8EA 3AN1A 2UUVA 3S1FA 5D79A 3KJMA 3LLBA 3NVZB 4JAYA 4PWCA 5FXDA 2VFVA 2VFRA 2PLSA 3FW9A 1N62C 2VFUA 3SR6B 1W1SA 3VTEA 2GQUA 5G5GB 3JS8A 2Q4WA 5HHZA 4PWBA 3FWAA 5FXEA 2GQTA 3PM9A 2AXRA 1AHUA 3W8XA 4MLAA
chains in the Genus database with same CATH topology
1N5XA 3EUB3 4XLOA 1V97A 2O3GA 2VFTA 1E0YA 3POPA 1QLTA 2Y3SA 3DEDA 3S1EA 2W3SA 3NVWB 3W8ZA 2MBRA 1W1QA 4EC3A 1QLUA 3D2HA 1FFUC 4PYTA 2NQWA 2W54A 3GSYA 4ML8A 3B9JB 3NS1B 2QPMA 4OALA 5ADZA 1DIIA 3NRZB 1SB3B 3S1CA 1E8HA 5FXFA 1AHZA 1T3QC 1AHVA 5HMRA 1ZXIC 5AE3A 1ZR6A 2IPIA 2BVHA 3C0PA 2OAIA 1MBTA 5L6FA 2BVFA 4BC7A 3RJ8A 2W3RA 4DNSA 1E8FA 1W1MA 1JROA 1W1KA 4PVHA 2VAOA 1I19A 2P4PA 2W55A 3AMZA 4JB1A 1MBBA 2RK5A 5HQXA 3FW7A 2R2ZA 3S1DA 5L6GA 3RJAA 1WYGA 2YVSA 3TSJA 2Q85A 2Y4GA 5AE2A 2EXRA 3D2JA 1FIQB 2WDWA 3FW8A 1N63C 2VFSA 3NVYB 4HG0A 4BCAA 3TX1A 1FFVC 3I99A 2E3TA 4PZFA 1RM6B 2Y08A 1DZNA 3DQ0A 1DIQA 2Y3RA 4BBYA 2P3HA 4PVKA 1F0XA 1VAOA 3HSUA 1WVEA 4O95A 4UD8A 5AE1A 3AM9A 3HRDC 1HSKA 1W1JA 4PVEA 5I1VA 2BVGA 3TSHA 5I1WA 5G5HB 1W1OA 1N5WC 3LAEA 1VDVA 2P13A 5AWVA 3NVVB 3W8WA 1JRPA 4ZOHB 1N61C 2I0KA 2QKNA 3PQBA 3ETRB 1W1LA 3BW7A 1W1RA 2PLIA 1E8GA 1UXYA 2UUUA 5FXPA 1N60C 2R8DA 4BC9A 1FO4A 1WVFA 3D2DA 4PVJA 5K8EA 3AN1A 2UUVA 3S1FA 5D79A 3KJMA 3LLBA 3NVZB 4JAYA 4PWCA 5FXDA 2VFVA 2VFRA 2PLSA 3FW9A 1N62C 2VFUA 3SR6B 1W1SA 3VTEA 2GQUA 5G5GB 3JS8A 2Q4WA 5HHZA 4PWBA 3FWAA 5FXEA 2GQTA 3PM9A 2AXRA 1AHUA 3W8XA 4MLAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N5X A;  3EUB 3;  4XLO A;  1V97 A;  2O3G A;  2VFT A;  1E0Y A;  1QLT A;  3DED A;  3S1E A;  2W3S A;  3NVW B;  3W8Z A;  2MBR A;  1W1Q A;  1QLU A;  1FFU C;  4PYT A;  2NQW A;  2W54 A;  4ML8 A;  3B9J B;  3NS1 B;  2QPM A;  4OAL A;  5ADZ A;  1DII A;  3NRZ B;  1SB3 B;  3S1C A;  1E8H A;  5FXF A;  1AHZ A;  1T3Q C;  1AHV A;  5HMR A;  1ZXI C;  5AE3 A;  1ZR6 A;  2BVH A;  3C0P A;  2OAI A;  1MBT A;  2BVF A;  4BC7 A;  2W3R A;  1E8F A;  1W1M A;  1JRO A;  1W1K A;  2VAO A;  1I19 A;  2P4P A;  2W55 A;  3AMZ A;  4JB1 A;  1MBB A;  2RK5 A;  5HQX A;  2R2Z A;  3S1D A;  1WYG A;  2YVS A;  2Q85 A;  5AE2 A;  2EXR A;  1FIQ B;  3NVY B;  1N63 C;  2VFS A;  4HG0 A;  4BCA A;  3TX1 A;  1FFV C;  3I99 A;  2E3T A;  1RM6 B;  1DZN A;  3DQ0 A;  1DIQ A;  4BBY A;  2P3H A;  1F0X A;  1VAO A;  4O95 A;  1WVE A;  5AE1 A;  3AM9 A;  3HRD C;  1HSK A;  1W1J A;  2BVG A;  5G5H B;  1W1O A;  1N5W C;  3LAE A;  1VDV A;  2P13 A;  3NVV B;  3W8W A;  1JRP A;  4ZOH B;  1N61 C;  2I0K A;  2QKN A;  3ETR B;  1W1L A;  3BW7 A;  1W1R A;  2PLI A;  1E8G A;  1UXY A;  5FXP A;  1N60 C;  2R8D A;  4BC9 A;  1FO4 A;  1WVF A;  3AN1 A;  3S1F A;  3KJM A;  3LLB A;  3NVZ B;  4JAY A;  5FXD A;  2VFV A;  2VFR A;  2PLS A;  1N62 C;  2VFU A;  3SR6 B;  1W1S A;  2GQU A;  5G5G B;  3JS8 A;  2Q4W A;  5HHZ A;  5FXE A;  2GQT A;  3PM9 A;  2AXR A;  1AHU A;  3W8X A;  4MLA A; 
#chains in the Genus database with same CATH topology
 1N5X A;  3EUB 3;  4XLO A;  1V97 A;  2O3G A;  2VFT A;  1E0Y A;  3POP A;  1QLT A;  2Y3S A;  3DED A;  3S1E A;  2W3S A;  3NVW B;  3W8Z A;  2MBR A;  1W1Q A;  4EC3 A;  1QLU A;  3D2H A;  1FFU C;  4PYT A;  2NQW A;  2W54 A;  3GSY A;  4ML8 A;  3B9J B;  3NS1 B;  2QPM A;  4OAL A;  5ADZ A;  1DII A;  3NRZ B;  1SB3 B;  3S1C A;  1E8H A;  5FXF A;  1AHZ A;  1T3Q C;  1AHV A;  5HMR A;  1ZXI C;  5AE3 A;  1ZR6 A;  2IPI A;  2BVH A;  3C0P A;  2OAI A;  1MBT A;  5L6F A;  2BVF A;  4BC7 A;  3RJ8 A;  2W3R A;  4DNS A;  1E8F A;  1W1M A;  1JRO A;  1W1K A;  4PVH A;  2VAO A;  1I19 A;  2P4P A;  2W55 A;  3AMZ A;  4JB1 A;  1MBB A;  2RK5 A;  5HQX A;  3FW7 A;  2R2Z A;  3S1D A;  5L6G A;  3RJA A;  1WYG A;  2YVS A;  3TSJ A;  2Q85 A;  2Y4G A;  5AE2 A;  2EXR A;  3D2J A;  1FIQ B;  2WDW A;  3FW8 A;  1N63 C;  2VFS A;  3NVY B;  4HG0 A;  4BCA A;  3TX1 A;  1FFV C;  3I99 A;  2E3T A;  4PZF A;  1RM6 B;  2Y08 A;  1DZN A;  3DQ0 A;  1DIQ A;  2Y3R A;  4BBY A;  2P3H A;  4PVK A;  1F0X A;  1VAO A;  3HSU A;  1WVE A;  4O95 A;  4UD8 A;  5AE1 A;  3AM9 A;  3HRD C;  1HSK A;  1W1J A;  4PVE A;  5I1V A;  2BVG A;  3TSH A;  5I1W A;  5G5H B;  1W1O A;  1N5W C;  3LAE A;  1VDV A;  2P13 A;  5AWV A;  3NVV B;  3W8W A;  1JRP A;  4ZOH B;  1N61 C;  2I0K A;  2QKN A;  3PQB A;  3ETR B;  1W1L A;  3BW7 A;  1W1R A;  2PLI A;  1E8G A;  1UXY A;  2UUU A;  5FXP A;  1N60 C;  2R8D A;  4BC9 A;  1FO4 A;  1WVF A;  3D2D A;  4PVJ A;  5K8E A;  3AN1 A;  2UUV A;  3S1F A;  5D79 A;  3KJM A;  3LLB A;  3NVZ B;  4JAY A;  4PWC A;  5FXD A;  2VFV A;  2VFR A;  2PLS A;  3FW9 A;  1N62 C;  2VFU A;  3SR6 B;  1W1S A;  3VTE A;  2GQU A;  5G5G B;  3JS8 A;  2Q4W A;  5HHZ A;  4PWB A;  3FWA A;  5FXE A;  2GQT A;  3PM9 A;  2AXR A;  1AHU A;  3W8X A;  4MLA A; 
#chains in the Genus database with same CATH homology
 1N5X A;  3EUB 3;  4XLO A;  1V97 A;  2O3G A;  2VFT A;  1E0Y A;  3POP A;  1QLT A;  2Y3S A;  3DED A;  3S1E A;  2W3S A;  3NVW B;  3W8Z A;  2MBR A;  1W1Q A;  4EC3 A;  1QLU A;  3D2H A;  1FFU C;  4PYT A;  2NQW A;  2W54 A;  3GSY A;  4ML8 A;  3B9J B;  3NS1 B;  2QPM A;  4OAL A;  5ADZ A;  1DII A;  3NRZ B;  1SB3 B;  3S1C A;  1E8H A;  5FXF A;  1AHZ A;  1T3Q C;  1AHV A;  5HMR A;  1ZXI C;  5AE3 A;  1ZR6 A;  2IPI A;  2BVH A;  3C0P A;  2OAI A;  1MBT A;  5L6F A;  2BVF A;  4BC7 A;  3RJ8 A;  2W3R A;  4DNS A;  1E8F A;  1W1M A;  1JRO A;  1W1K A;  4PVH A;  2VAO A;  1I19 A;  2P4P A;  2W55 A;  3AMZ A;  4JB1 A;  1MBB A;  2RK5 A;  5HQX A;  3FW7 A;  2R2Z A;  3S1D A;  5L6G A;  3RJA A;  1WYG A;  2YVS A;  3TSJ A;  2Q85 A;  2Y4G A;  5AE2 A;  2EXR A;  3D2J A;  1FIQ B;  2WDW A;  3FW8 A;  1N63 C;  2VFS A;  3NVY B;  4HG0 A;  4BCA A;  3TX1 A;  1FFV C;  3I99 A;  2E3T A;  4PZF A;  1RM6 B;  2Y08 A;  1DZN A;  3DQ0 A;  1DIQ A;  2Y3R A;  4BBY A;  2P3H A;  4PVK A;  1F0X A;  1VAO A;  3HSU A;  1WVE A;  4O95 A;  4UD8 A;  5AE1 A;  3AM9 A;  3HRD C;  1HSK A;  1W1J A;  4PVE A;  5I1V A;  2BVG A;  3TSH A;  5I1W A;  5G5H B;  1W1O A;  1N5W C;  3LAE A;  1VDV A;  2P13 A;  5AWV A;  3NVV B;  3W8W A;  1JRP A;  4ZOH B;  1N61 C;  2I0K A;  2QKN A;  3PQB A;  3ETR B;  1W1L A;  3BW7 A;  1W1R A;  2PLI A;  1E8G A;  1UXY A;  2UUU A;  5FXP A;  1N60 C;  2R8D A;  4BC9 A;  1FO4 A;  1WVF A;  3D2D A;  4PVJ A;  5K8E A;  3AN1 A;  2UUV A;  3S1F A;  5D79 A;  3KJM A;  3LLB A;  3NVZ B;  4JAY A;  4PWC A;  5FXD A;  2VFV A;  2VFR A;  2PLS A;  3FW9 A;  1N62 C;  2VFU A;  3SR6 B;  1W1S A;  3VTE A;  2GQU A;  5G5G B;  3JS8 A;  2Q4W A;  5HHZ A;  4PWB A;  3FWA A;  5FXE A;  2GQT A;  3PM9 A;  2AXR A;  1AHU A;  3W8X A;  4MLA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...