2PMCA

Crystal structure of chey-mg(2+) in complex with chez(c15) peptide solved from a p1 crystal
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
128
structure length
128
Chain Sequence
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGFGFIISDWNMPNMDGLELLKTIRADSAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interaction of CheY with the C-terminal peptide of CheZ.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Signaling protein
molecule keywords Chemotaxis protein cheY
total genus 41
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2pmcA00
2WRZA 3EJWA 1Z15A 3GWGA 4H3HB 2RGYA 3KHTA 4ZMRA 3F6PA 4MPTA 3OO0A 1DC8A 1ZITA 3D02A 2PUFA 2PLNA 1JHZA 1PEAA 3O1IC 4F06A 3CS3A 4MR9B 1ZHHA 3ILYA 1DBQA 1Y1LA 3KJXA 5B3JC 1YS7A 2A9PA 3IP7A 2XDYA 6CHYA 3MQ4A 3HV2A 2E4UA 3RVQA 4HNSA 1FFSA 4XASA 2BGGA 1PNTA 4N0PA 4MLCA 3QEKA 4W5OA 2H3HA 4YV7A 2W42A 1YMUA 1BDIA 4Z4FA 3EULA 3KCNA 3NNNA 2KYRA 3H6HA 3LUJA 5IEBA 4MAAA 2FMIA 2MSLA 4D6YA 1Z25A 4EGSA 4YS6A 3VNBA 2E4VA 1QQBA 3KS9A 5JNSA 3A0RB 5KQPA 3LKVA 3T8YA 1JH9A 3C3KA 2E4XA 4RY0A 2OQRA 3LUHA 3C97A 1QKKA 2YHAA 1Z2DA 5TQ2A 2CHFA 2FN9A 1QQAA 1XWWA 2F8TA 4N47A 3OMWA 2TMYA 3O1JC 5JNWA 3ROTA 4D6XA 2FLWA 1ABEA 3H1FA 4RK5A 4DQDA 5CHYA 1QPZA 3L49A 1ZDMA 1W9HA 4OTZA 1JX6A 4G0MA 1LBIA 3RVLA 3CZCA 4OBBA 4RU1A 3GL9A 4ETNA 4MR9A 4TMYA 2RJOA 1C0EA 3Q15C 2HQBA 3B2NA 3RVOA 4WWHA 5ED4A 1U0SY 2FSPA 2QR3A 4RDCA 5B3JA 4G86A 3KKEA 4W5QA 1CHNA 2A9OA 3C3MA 2FQWA 3KTOA 1W25A 5CNJA 3OQNA 3QLTA 4RK4A 3E3MA 3LUFA 2FEKA 1ISRA 5JNTA 1KRXA 3CTPA 3R0JA 2NZVG 3BRSA 4TN5A 3RQIA 1ZH2A 1OXBB 2ZAYA 1DCKA 4RY8A 4GNRA 2I6FA 1APBA 2JCGA 4N0QA 1DBPA 3EQZA 1BVHA 1TM2A 3E61A 3NHZA 1RZRA 1RXIA 4G0YA 5IBQA 1H9CA 4G0XA 2FN8A 5CNKA 1DP4A 3I5AA 4QICA 5T3YA 3T95A 3IPAA 5IEJA 1B00A 2WJWA 5EWLA 4ZJPA 3N0XA 2IDMA 5TPZD 1DZ3A 4HNQA 1AB5A 4MRMB 5FWXA 2IKSA 5BRJA 3CG4A 4KZKA 4PYRA 1KRWA 3SG0A 2WMYA 4MQFA 4F8JA 3TO5A 1CYEA 3TMYA 3T38A 1QP0A 4NV3A 2IPNA 3F7NA 3HS3A 1SXIA 1DRKA 3K4HA 4RK1A 4HNRA 1QP7A 3H1GA 1RXEA 4MS4A 1ZN2A 2MYUA 2ID9A 3NHMA 2JVIA 2WB4A 4XFKA 2AYXA 3HXMA 1E2BA 1JL3A 1I3CA 2R25B 3I09A 3KSMA 1TVMA 3OLWA 1ZY2A 3LOPA 4LRQA 3OM0A 3KLOA 4Q6WA 3KG2A 1KMIY 3GV0A 5TPZA 2FXIA 4EYQA 2FVYA 3GT7A 3QELA 4O5AA 3GBVA 4WZZA 1Z12A 3KLNA 2Q5CA 3IPCA 4IMIB 3G1WA 1YMVA 3D8UA 1QO0A 5FWYA 4MLDA 1EHCA 4RKQA 5HQJA 5TQ2B 3RVJA 3RVKA 1YK1A 1YIOA 2CHEA 2RJNA 2V0NA 3ILHA 2A9RA 2P4UA 3DGEC 3O2JA 4WXEA 1S8NA 2R48A 1Z13A 2PE5A 1FFGA 3TX6A 4XARA 2FEWB 2JK1A 4IF4A 2M98A 5DKFA 4Z99A 3HK2A 1A04A 3DGFC 5EWMA 5JNRA 5KC8A 3LUGA 3A0UA 3URMA 3BRQA 3N75A 4PZ0A 2B4AA 3TD9A 3SY8A 4ZMSA 4G97A 5HM6A 1D2AA 3LKBA 4EVQA 4Z4IA 1JLKA 3CFYA 1NXTA 5CNMA 3OLXA 5EWLB 4W5NA 1EWTA 4JASB 4WUTA 5TQJA 4JB0A 2CD7A 3JY6A 4Z4EA 5IUJC 4S04A 2A9QA 3O21A 3EGCA 5FBKA 3JPWA 4WT7A 5KQLA 4PE5B 1QP4A 2GBPA 3Q7SA 2JRLA 2QZJA 3EQ2A 4G0ZA 4LE2A 4LX8A 2PUAA 1ZESA 4RK6A 3F6CA 1P6UA 3DBIA 3FFWA 1URPA 3N8IA 5KC9A 3H5OA 1SRRA 1DJMA 4OATA 3M6MD 2LUOA 2R4QA 1QMPA 2HSGA 3N6VA 4M88A 4JAVC 3T6KA 1Z26A 3QLVC 3CG0A 3I45A 3IP9A 4QPJC 1JFVA 3M9WA 4MR7A 2QV0A 3H6GA 4ETIA 2H0AA 4MQFB 1JWLA 3HUUA 1NY5A 3O2SB 3H5LA 3LFTA 3GYBA 1P6QA 4EUKA 3JVIA 1P2FA 4MR8B 4FB4A 5BRAA 4OLBA 4D74A 5FWXB 2ID7A 2P9HA 2M1ZA 3QX8A 3OLZA 2PMCA 5JNVA 2IOYA 1E6MA 1NXPA 1YS6A 3TB6A 1EFAA 1PUXA 5E3JA 3HDVA 3RH0A 2IYNA 4ZPJA 5BR1A 1JFSA 1NATA 3HDGA 2HPHA 5TQ0B 4DN6A 3GRCA 3UK0A 5IULC 3MIZA 4KPYA 3Q7RA 4MQEA 5BQ3A 1FFWA 2L19A 2L2QA 2MYNA 1L5YA 1DBWA 2L17A 3CZ5A 3MYYA 2FW0A 4LDAA 4LE1A 4MR7B 3QEMA 1D1PA 3BBLA 1EWKA 3A3KA 4YCSA 1NXVA 5IUKC 3NNSA 3QK7A 4MQEB 1C4WA 1JFTA 2N9UA 1DCFA 1SXGA 2JVJA 2PKXA 4Q6BA 4IMJB 3ROFA 5IUNC 4KQCA 4S05A 4W5TA 3CLKA 2FLKA 1ZAYA 3EDCA 1NTRA 1USKA 3EAFA 5I4CA 4RS3A 4KQ9A 3QLUA 3O75A 2IPAB 4G0PA 4L4UA 1NXSA 4JA2A 3SAJA 4W5RA 2PL1A 2FQXA 1PEYA 5HKOA 5TPWA 4MS4B 4P98A 1YVUA 3H5WA 2QVCA 2JB9A 3OO1A 3P9YA 4XAQA 1FQWA 1BDJA 1BAPA 3H75A 3UUGA 4NICA 3RVPA 1E6LA 2PJUA 3RVNA 4DADA 2QW1A 4RZSA 2L18A 2VK2A 2LBPA 3OLVA 5JS2A 4Z4HA 1PNRA 2NT4A 1U2PA 4Z0NA 2LIVA 1MIHA 1MVOA 4YP9A 4RXTA 3N0WA 4E7PA 1F51E 2IPMA 5PNTA 4MS1A 1ABFA 4H60A 3CKMA 3JS5A 4F11A 3HEBA 3IP5A 2B1JA 1YK0A 1BA2A 1ZGZA 3BREA 4CBVA 3HCWA 4RXMA 5IC5A 2PAFA 1LBHA 1ZH4A 6ABPA 2GX6A 4RWEA 9ABPA 3RVRA 1LK0A 3C3WA 4MR8A 1MB0A 2HQOA 3MF4A 1LJUA 4UHKA 4RK7A 2MSWA 3NBMA 1A0OA 2GWRA 2VUHB 3HZHA 1P8AA 5JNUA 3SQNA 2F8SA 1XHEA 1GLGA 3SNKA 3O1HB 3OM1A 1D4ZA 4KV7A 1Z16A 3G85A 1MAVA 2QVGA 4YLEA 3QLUC 4F12A 4JP1A 1SXHA 1WETA 1ZGGA 2DRIA 4HYEA 4N03A 4OG2A 3IDOA 3LTEA 3RVSA 1SD5A 5GQSA 5HSGA 1U2QA 4RSMA 5KQMA 1T34A 2NZUG 3LUKA 3QLVA 2X7XA 4MGEA 4ML3A 3KYJB 2AYZA 2JBAB 3H5VA 2JVKA 1DRJA 4KK4A 1OXKB 3CNBA 2VYCA 1D5WA 3JTEA 2GKGA 4Q7EA 4FE4A 1KGSA 5EWJB 2PUGA 1A2OA 1IIBA 2GI4A 4LDZA 4E7OA 1J56A 5JS1A 4PEVA 3Q7TA 1GUDA 1DCMA 4RKRA 1NXOA 1GUBA 3CU5A 5DGCA 5EWMB 3SM9A 1PHRA 1HEYA 1NXXA 1USIA 4NCAA 4O1IA 1ISSA 1FSPA 3HUTA 3O2QB 3QELB 5FBHA 3HO1A 1GCAA 3I42A 1RZRD 1LJLA 4OLAA 1VPWA 4PICA 4QYWA 3OMXA 5DLEA 3BILA 7ABPA 1MB3A 3Q41A 2FEPA 1DG9A 3MMNA 5DTEA 4NQRA 2NUBA 4L85A 3JPYA 3L6UA 2RDMA 3KYIB 3CRNA 2HQRA 3FMVA 4RK0A 1M2FA 1JDPA 3H1EA 3HJFA 4MYRA 2CWDA 5GOTA 2IPLA 1VKRA 4RV5A 5ABPA 4IRXA 4EVSA 5IX8A 3DLBA 4H3KB 2MSKA 4GPAA 4MS3A 3OQMA 3HSYA 4UHJA 4FE7A 4EYOA 1JDNA 5D2CA 4XLTA 3MM4A 2QSJA 1Z17A 2FTKE 3EODA 4TLMB 4EYGA 4N41A 5TPWB 4MS3B 5TE9A 1CEYA 2QXYA 2FKAA 3N53A 3GA5A 2FMFA 3H5TA 1USGA 4MRMA 2FQYA 4TLLB 5DCLA 1Z2EA 3OQOA 4IILA 3RVMA 3OLYA 2QU7A 1TJYA 2NT3A 3H5IA 5EWJA 2HJ9A 3FFTA 4Y9TA 3DLHA 1U8TA 2E4ZA 1QO0D 1ZVVA 1M5UA 1M2EA 3HM9A 4KFCA 3LUAA 3Q9SA 4KREA 4Z9AA 3QX9A 3FFXA 3LUCA 4KNYA 2PUDA 1DC7A 2E4YA 1XHFA 3DZDA 3W9SA 2ZWMA 1EAYA 3LMKA 5TQ0A 4IGAA 4MS1B 3FGZA 3O74A 4RXUA 2LP4Y 4JB2A 1Z18A 2MYPA 4O1HA 3FDFA 1F4VA 1VLZA 3F73A 4LE0A 3UKJA 2PUCA 1JF8A 4KK3A 1UDRA 4NCBA 3MA0A 2FMKA 4QYMA 1JYFA 5F64A 4EVRA 2OENG 3LUDA 5C5CA 1TMYA 1RPJA 2E4WA 4ZYLA 4G0QA 1VRVA 2MYTA 4RY9A 2YHBA 5C5EA 2WJAA 5CNIA 2R47A 3GBPA 1BDHA 4XXHA 4YR7A 5T7BA 2WWVD 4G0OA 1QNLA 3C6QA 1JBEA 4N76A 2PL9A 1L5ZA 2O20A 4JOQA 4EY3A 2LPMA 3K9CA 4EYKA 1YTUA 1R8JA 5FWYB 3VNAA 4Z4CA 5KWSA 4LZLA 1EWVA 2PUEA 1GCGA 3NNDA 2JBAA 4KMRA 3M9XA 2PUBA 4WXMA 1RNLA 1M5TA 2VUIB 8ABPA 4YRZA 1E6KA 1TLFA 1U04A 4B09A 1D1QA 5KQGA 1K68A 2FMHA 4KVFA 3A10A 4Z9BA 3HVRA 4F3TA 4Z4GA 3JVDA 3N0RA 4YGXB 4YO7A 3S99A 1JYEA 3IP6A 1AB6A 4KRFA 4P1ZA 5KI6A 1NXWA 2WY2D 1K66A 4ETMA 3QEMB 2J48A 4YWHA 3CHYA
chains in the Genus database with same CATH superfamily
1JECA 4JQYA 4FDLA 4BQSA 2WPNA 2YMLA 5AQ1A 4Y1FA 1XVAA 1E7WA 2QUHA 2ZTLA 3F6PA 3HYSA 4MPTA 4MYSA 4UAUA 3RDPA 4ND3A 1ULSA 3AEYA 5KTRA 2KI5A 1PFKA 4BLRA 4EW1A 2R5FA 5FNZA 2DQKA 1XZDA 4DIOA 1CXZA 5KU1A 1BMQA 2Q6LA 4DDKA 1L8QA 1A8UA 3TLKA 5FADA 1VA4A 5FBWB 1ZAYA 3LBAA 3SC2A 2E18A 2VQ3A 4GRAA 2NU9B 1L5GB 1UBJS 4J2HA 1OHHA 4DR3B 1RQRA 2EKQA 4KFSA 1P7ZA 3HCAA 1E8MA 3NXSA 5CLIA 2QE6A 2RGBA 4ZI3A 5B3LA 1ESDA 1E1MA 2CFOA 3B1WA 2UVPA 3PHHA 4CKXA 4C7OB 1ZCAA 2CD9A 3A6GA 4PNZA 3H4VA 3LS2A 4NU8X 3EULA 1BH6A 2VSQA 1IMJA 1P31A 2Y4OA 4BVEA 3L8EA 1MJNA 2R7KA 3IXLA 4XPIA 2DVMA 1LI4A 1RI1A 1ORDA 2A0WA 3LUJA 4L07A 1Z6TA 2P4HX 2BE7A 2XVXA 2BMAA 3TSYA 4BO2A 5JBNA 1GGHA 1V1RA 5DLQC 1Q2UA 2IXDA 3DYIA 3A0RB 4UHBA 4ARBA 5AVVA 1UC5B 3C3KA 5LNK6 2E4XA 3KOUA 4WNYA 4JLJA 4PG4A 3V7FA 3KQKA 5CB6A 2G76A 2EZ4A 3V00A 1Q7BA 3HR8A 4PRLA 5T5QA 4Z49A 1DAGA 2LWIA 3RS0A 3N86A 2QI9C 3DAOA 4KWHA 5IW8A 2MHCA 2WNSA 5CFRA 3IP1A 2XA1A 4DQDA 4R8KA 5JS7A 4O4IB 1NE7A 1DQRA 1ZDMA 2ZI7A 3OSZA 1ZRNA 5F2EA 5I4KA 3R5FA 4UE6A 2OCKA 5KVVA 2HCTA 3VAAA 2VDRB 2BPOA 1W8IA 3LYLA 1M75A 2F1KA 3EXEB 3OY2A 2AFHE 2XBMA 3W3AA 3VH3A 1H85A 3RS8A 5BN4B 1MQ9A 1BCSB 3O4JA 4KOAA 4NKRA 3KZKA 1X8XA 5C9ZA 4HP8A 4W63A 2PZAA 3DVLA 3M2TA 4W5QA 1CHNA 2WAAA 2JAXA 2R00A 1UINA 2AN5A 2GERA 1P2DA 2WT8A 2ANCA 3DC2A 2W22A 3AY3A 2J67A 4H59A 4K5QA 4K9RA 4YC7A 3HJRA 3TQCA 3ZDFA 3GLQA 4MXDA 1YR6A 2WKQA 4FU0A 1REQB 4R1TA 3LPAA 3CE6A 3GZ4A 4CV2A 1EP9A 3IJPA 3IC5A 1U90A 1DEAA 3ZDRA 3GVIA 3MCAA 2YXLA 1ZK4A 2ZAYA 2RI6A 4OGGA 1K3UB 2Q1XA 4J07A 4M7RA 4N0MA 3EQZA 4Y7DA 1U0JA 4WZAA 4RANA 3C1TA 3O4GA 1IJFA 5EJMA 3REOA 1K8XB 2B35A 2RHMA 5TARA 5ADWA 1KSHA 3EPKA 5L6LB 2P0YA 4ZAFA 4RJKA 1TRHA 2C88A 3R7WA 1E92A 3KPJA 3C3AA 1OT3A 3C1AA 4MJ7A 1JH8A 3I2IA 3OWOA 1K4MA 1I2AA 2FUG1 1HT3A 2BEWA 3INNA 3QV2A 4BMPB 4DTIA 3ETCA 2YHSA 3TFQA 4D43A 2FMXA 3EB9A 1UPFA 2X3YA 2FZCA 2IIVA 5EHIA 1Z0JA 3R8CA 3LCUA 4LYJA 3HNRA 4OAOA 5K01A 2DUNA 3K0KA 3QXSA 3CLUD 4GYWA 3MJVA 4DMKA 3AF2A 3OPQA 5AVYA 4GGOA 4UE3S 3NDIA 1IH8A 3N1UA 3FF4A 4MDHA 5JSZA 1Y48E 1YKFA 1YDMA 3HI6A 2C9YA 1GITA 1T0JB 2ZI3A 4IH1A 1R00A 3TYXA 1MH1A 2VL7A 1JL3A 2XYRA 4CI0B 5J2UF 3THOA 1IAVA 2WU0A 1W36B 3GUZA 1BDBA 1MJFA 4G23A 5C8YA 1GTL1 1PZGA 4JBNA 4AAYA 2AJDA 2PD6A 1OU4A 4OQXA 4L8VA 2XGGA 3JYNA 3GLTA 3C70A 4EYQA 4P0PB 4O2AB 1R3UA 2IEZA 3AX6A 3D0RA 4UU8A 4G0VA 2DSNA 2E37A 4GFDA 3KYDB 1J99A 2OKCA 4BGVA 1NF3A 3FAKA 4L5CA 1YIOA 3RVJA 5A7FA 3RR2A 4CKZA 1Z74A 3E9CA 1QGOA 2NAPA 3G2IA 1JEDA 1YONA 3HHEA 1GGJA 2EHJA 1S1MA 2Z4SA 3TCXB 2O5RA 4U7GA 3NXKA 3U37A 2ZSAA 1IVNA 2JHAA 4JC4A 1T6BY 2JRCA 2VDQB 1GTSA 1JMVA 4NQZA 3DHEA 2X2OA 2XA9A 3H4TA 3BRQA 5ALVA 1I10A 1TYBE 5D85A 3TD9A 4E6PA 3V8EA 2QL9A 4FGZA 1FRNA 4AQYB 3QPVA 1XF1A 4C76A 5B6IA 1IXRC 1P3Y1 2EWMA 3HCBA 3AF5A 5EWLB 2C92A 1RRMA 4ZEXA 3BDIA 5CMLA 5K8UA 4KQ1A 4BRUA 2H52A 4KOEC 4XVUA 2PRSA 4LHYA 1N2CE 5K6TA 1RC8A 1BFUA 1VRCA 2QTLA 5JJLA 3THSA 4UDXX 5K6AC 6REQB 1T4CB 1QIDA 4AZSA 2CDCA 2Y6UA 3ZWCA 1G1AA 4MIKA 1SUFA 1H5QA 3K2IA 3OCWA 2W6MA 3UOGA 5CFNA 3N6RA 3RHFA 4IRUB 3OA0A 5KHAA 2IT1A 1BXRA 1T9DA 2IYOA 4M55A 5CLFA 4A23A 1PTKA 2C2BA 3N7TA 3TSCA 3FNHA 4PFJA 4WASA 3K0CC 4AJHA 4JLMA 1FFYA 1RRVA 2X1MA 2ZE7A 4DQXA 4OAPA 2ZRKA 4HJXA 1NLUA 3DBRA 3JQAD 4WHMA 1VQ1A 3DQPA 1CRZA 1H3NA 2BFCB 2X9GA 4IDEA 1DTWB 1BEUB 1VYUA 2EEPA 3ZCSA 3KQHA 1RJEA 2GRJA 3AIOA 2ZPTX 3ND9A 5ECDA 4YUVA 4D3SA 3GPBA 4L27A 4BX8A 4ZYZA 2XPCA 1Y6JA 4K03A 1QJCA 2QRQA 3BXXA 3DEHA 3LL4A 1WPGA 4ZQFA 3L2OB 3EDRA 4N3AA 3LWZA 2GPNA 3IMGA 3R3XA 4ZZ3A 2PMBA 1ICIA 1P8JA 1XEXA 1RHJA 4P58A 2H0QA 4XQEA 1ZIPA 4GGPA 5EMHA 4B6SA 4FMDB 2VKTA 2BFAA 1RQPA 1SC9A 5KTSA 2HV8A 2XKAA 3QIVA 2J9ZB 2BELA 1C9EA 1V9CA 3MN1A 4EKEA 4CU2A 4J8PA 3U61B 2ZBVA 3KP1A 2H4YA 1M0WA 3S28A 3TCKA 1V26A 2Z3WA 4BPBA 5JYBA 1SELA 1JBQA 2NAFA 2NXEA 3BJZA 4JBXA 4Z0HO 3U81A 3UHOA 1Q50A 5JH7A 4GWGA 2UKDA 5EIEA 1OI3A 2HYDA 5INTA 1H9BA 1II8B 2JVJA 4MSUA 5DM70 1IBMB 4HATA 3ZWWA 4HQ0A 3WIUA 4RKYA 1LBQA 2BGRA 3PF9A 4I1YA 1G8GA 3EXHC 1Y4SA 4L8FA 3CUEF 4IJ6A 3DV2A 2VQSA 4KMOA 3KELA 3IP3A 4JA2A 2WKSA 2XGOA 1YQ9A 3I6QA 3MFQA 3O3OB 4LI3X 2V7BA 1EHIA 1A1SA 2PSSA 1K92A 3H3JA 3SSMA 1Q20A 4B76A 4BBAA 1XD8A 4P3KA 3TJRA 4LDJA 2YW9A 1JJ7A 1YJQA 2FP3A 3BSWA 3CTMA 4H1VA 3QPUA 2Q7DA 4RZSA 4Y98A 5JS2A 5EKUA 2CLOB 2C2ZA 3DOJA 2RCNA 1U2PA 4MP8A 4PAGA 3F5FA 2DU8A 2IDKA 3BK2A 4N6GA 1E6CA 1OU0A 4FGWA 4W82A 5DDIP 5DULA 5A9TA 3GQBA 5P8WA 2A5JA 2ZYUX 5AKYA 5PNTA 3U26A 3KR0A 5KJCA 4P3YA 1KNQA 3H11B 2ERCA 2PPLA 3WL7A 5JPCA 4ZAYA 3E23A 2OY0A 2B4QA 2H4XA 4CBVA 1NURA 3O83A 1RAFA 2G08A 4BB9A 1X2BA 4DPMA 1U80A 3H17A 3UZUA 5REQA 2VNIA 4TMKA 3SE7A 5NULA 5LZ5A 2BR3A 5BSGA 2QTMA 3T3MB 4TV8A 1B0UA 4OQ4A 1U2EA 5CYPA 1YGPA 3RD5A 2IU3A 3FUUA 4M8IA 3ND5A 4RK7A 4YJHA 2BFFA 3R7BA 4H08A 4URUR 5JD6A 3O5AA 1MRZA 3OBIA 3PX7A 2VP6A 1FTNA 4XIIA 2QSYA 1M6NA 2ODPA 2XTAA 2F8SA 4OFBA 3EASA 3QI7A 4CFYA 5FJIA 1R64A 3O1HB 4DV4B 1D4ZA 1NP6A 8AT1A 1EIWA 1HV8A 4YI3A 3DZIA 5G0VA 2CCJA 1NPYA 1N5MA 4IDNA 2AT1A 5CDSA 1CRLA 3IPRA 4ZOBA 2CCGA 2V0CA 1QWOA 3USZA 4XJSA 5IZCA 1WU7A 2B0CA 4ZGBA 1JZTA 4QQKA 1J8MF 1ISMA 5DYGA 1X7YB 2D59A 3GJTA 5KMGA 2HNAA 1VKNA 1T8WA 2JFFA 3VU1A 3PS9A 5AW2A 3WP0A 4XDZA 2AUMA 1CNFA 5KNDD 3KSZO 4C0JA 1TM1E 3CJQA 4GHWA 4B48A 4MVJF 3W1WA 3FPSA 4BY9E 1R16A 3R5HA 4GT1A 2JBWA 2OD7A 1XYVA 3E8MA 3TI9A 5CB8A 1TA4A 5F9FA 4MIOA 2J9GA 3R77A 2X76A 4OP3A 4EB8A 1QHYA 3CF4A 4BECA 4R5MA 5EP2A 2IP2A 4YCNA 4KXYA 2ZBUA 1QK5A 2EIXA 2IF0A 2YWFA 3OSUA 4R1SA 4YUXA 2ZSDA 1POWA 3RT7A 4C4XA 5K4GA 3SM9A 3PI7A 1PHRA 3BH6A 3ETJA 4QUIA 5B1DA 1YOBA 3E58A 1RLJA 4XH9B 5KREA 1Q7RA 2YXPX 1JAZA 4OI4A 4J49A 2WWRA 4R3WA 4KR7A 3UWDA 4TUYB 3EGXB 1KTVA 3PRKE 1NBAA 2P2SA 3IKTA 5AI8A 5AO9A 3IDAA 2YICA 4JOBA 3H9UA 4IR7A 3OZDA 4XGKA 4TTRA 1ZIOA 1X87A 4MUFA 4YUYA 1XA4A 2DCUA 2MT9A 5FWNA 1SCDA 3OQ6A 1WXXA 3H6KA 3I76A 4MWGA 2IL1A 3HU1A 2IXTA 1CJVC 1QS0B 4FT4A 3R0QA 5REQB 5BYKA 1M8PA 1Z36A 4A03A 4D0GA 3NT2A 1EVEA 3ZR4B 2C3MA 5GOTA 3EPRA 1FBNA 5KTMA 4HUJA 1Y3AA 3LK6A 2JLSA 1D6NA 4FYWA 4UUNA 4B5KA 2YZ7A 1NJSA 2VYVA 3OZBA 5DWVA 4W1RA 5LYJA 5JMWA 1LSSA 2HN9A 2P2LA 3W9YA 4Q1VA 4H15A 2I8LA 4MULA 1OZGA 2VSFA 1EVKA 1MJGA 1UXOA 4S0XA 4EFKA 2FEAA 1F48A 1UP7A 2QXYA 2BFNA 4JSYA 3FLAA 1MX9A 4MRMA 4Q19A 1AS0A 2XYVA 3QBJA 3R5XA 4YT2A 3OEYA 3F98A 3LLCA 4Z1MD 2YJTD 2E85A 2E21A 3H4MA 3M4YA 3PLNA 3FVWA 1IY2A 3QHAA 4JWTA 1AUXA 5EWJA 1NQWA 2CMHA 2PVCA 2FJUA 3TZLA 1PL8A 2ZP1A 4AB1A 1E2JA 1L4FA 2PGOA 3IBGA 3EQ6A 2YJNA 4C7KA 4UMDA 2AG5A 3TE6A 1H42A 5JAHA 5KTNA 4KFCA 3VTKA 3JQGA 5KWVA 1SUPA 2QE7A 4Z9AA 3IBFA 5JVDA 3CH7A 5HR5A 2JJ8A 1NLYA 3WJAA 4JQCA 1C1YA 4LAFA 4IH4A 1L3CA 3VOTA 2OVFA 1ZOSA 4Y3UA 3L6RA 3M5PA 5DTJA 2PT9A 2NGRA 4D9GA 1VG9B 1G6Q1 1RXSA 1Z4IA 2XRFA 4RIEA 2W9XA 4V02A 4WKCA 3VAYA 3C24A 2FN7A 2ACKA 2ID4A 4FHDA 1VLZA 4WGFA 4KSBA 1TZCA 4DAOA 4YJ3A 4C1BA 5LWHA 2WT9A 3HDYA 1PF7E 2I7CA 5DWDA 1T3GA 4A8JB 4N5NA 2Z5GA 3I32A 2OYCA 5BMOA 2B1RA 4G36A 2HHLA 2OENG 1OJLA 4OA8A 1LK7A 1H4TA 5CG2A 2BR5A 2OBLA 1TNDA 1XNHA 5FLEX 4DA4A 3BEDA 2QT1A 4JGGA 1CUCA 3ZY2A 3ZWVA 4HH3C 3ZDDA 4A16A 3GBPA 2Y0PA 3IESA 1JZQA 3HBLA 4PWYA 2AHRA 1ZOOA 4YRFA 4NP6A 5F2OA 2HIMA 2YXBA 1OI7A 3BRWA 3ZOZA 3AVVA 3AVXA 1ZUNB 3OJWA 4BZWA 3ZWPA 3BA1A 1T9KA 2H1HA 3EA4A 3C5CA 1MIOA 2YWGA 1RM3A 3VBCA 1XMXA 4B2IA 4DB2A 1M1ZA 3BCHA 3OIWA 1SCKA 1MO2A 4Z4CA 3F67A 4KUGA 4BLVA 1H3FA 4YQYA 4HTFA 5L7TA 5AOBA 4OV6B 2YWXA 2I6QA 1NX6A 1VKHA 4OKSA 2JLUA 3GOQA 2ZUCA 4Q1AA 1E6KA 3QJ5A 5BV1A 1R9JA 1PNVA 4FIZA 2VHXA 1GA1A 2GYWA 4UQPA 3WGNA 1N1EA 4UCXA 1SWVA 4EA6A 1T5SA 2R6DA 1BEEA 3KKQA 4LYFA 4D1YA 4DVGA 2GN1A 4R1UA 1F1BA 3NIGB 4NZMA 3DZCA 2V7QD 5IVDA 1GPBA 4PYNA 1IY8A 1KJZA 1L6IA 2CW5A 2NV2B 4KR9A 3M4XA 1CUXA 4EEXA 3CHYA 4QUAA 4A2QA 4WI1A 2I4MA 1JWBB 2GQ0A 3OO0A 1M8KA 4Q16A 1BCRA 3Q6NA 4HWRA 5FNVF 3WDKA 1U65A 2P2ZA 3CS3A 3E3OA 3FDIA 3HR4A 3MRSA 4IFEA 1N0HA 4Y2QA 4RCZA 5DIZA 1XDBA 3INRA 5DTIA 4ZCLA 4RELA 4JI5B 4DSUA 4P0QB 4LGVA 2C5LA 1L1QA 2GAIA 4OLFA 4TKLA 4YMSA 1S2OA 2A8YA 2VZ0A 4TMXA 2ILTA 4M9QA 2GAAA 3SQXA 1DEKA 2TMGA 3PHLA 4MKZA 4KBGA 3PNVA 4YECA 3HDQA 4MLCA 3PXBA 5IDVA 3D59A 2XLCA 3YASA 3AM5A 3WJ7A 1PRYA 4C20A 5CVTA 2VSOA 3LHIA 5DXAA 5LB4A 5JO0A 1S7GA 3H6HA 3K6KA 2P5YA 4IH9A 5B7PA 5I51A 5IEBA 4RKEA 2OGUA 2VI5A 1YZYA 1V11B 5EIXA 1LDMA 1V8FA 2NVBA 3SYRA 1V37A 3X1JA 4LCEA 3NBXX 5KQPA 2NM0A 1JQ5A 2A5DA 4DCTA 4ON9A 3PNLA 3KYCB 1J1UA 4INAA 1EK5A 3UMYA 5L95A 1UOEA 3CXUA 3E3LA 4YMVA 1RBMA 1LNZA 2FSGA 3NCTA 3ZLUA 4YIKA 1SUAA 4MARA 3WMWA 1UANA 5LQJA 4YRGA 1CEXA 4M0DA 1L7NA 3NM4A 2TMYA 4GEKA 2HU2A 3ZBPA 4FINA 3RIXA 1ABEA 1JXAA 4FJ2A 5CIWA 3UXEA 4R71A 3GAFA 2A5LA 4CM3A 1JLMA 3L49A 4F5DA 5ADHA 3GCWA 4X95A 1N57A 1I1HA 2ZUDA 1LBIA 1YU9A 1GGEA 4DIMA 5FPTA 4TX1A 5AIAA 3QW2A 3D3EA 4QBKA 4TMYA 3ZHUA 1X74A 3FOCA 5IYZA 1NM5A 5DWQA 4TL6A 3ADDA 4LMBA 3NDPA 4LHXA 4BFUA 4WINA 1OBFO 4KSYA 3T4PA 5JSZB 4YJGB 3QY9A 1DIOB 1PGOA 4LJKA 4KEAA 2XZPA 4IHJF 2ZLBA 1UR5A 2X9VA 2P8JA 5EP4A 4CIAA 2PKQP 2XH8A 3JATB 1UMKA 4GI2A 1MO5A 1J8QA 1GIAA 2ZATA 4C2BA 3VJRA 3QNWA 3A32A 3K5PA 3CZAA 2VJOA 3VDMA 4GNRA 1M2NA 2JCGA 3SJ7A 4OPMA 1E5LA 1A7AA 4ZEWA 1YNOA 3ADOA 5BN4A 1X3LA 1NW3A 4KBFA 1VE7A 3G5TA 1XMJA 2GCOB 5B1IA 2JLAA 1ZK2A 3A6HA 3GI1A 4D4JA 2B92A 1PJTA 4RA6B 4WK6A 3KCQA 2H51A 2ICAA 2WJWA 4NU6A 4PSAA 3SS8A 1U9CA 3MELA 3ZJYA 4AZ3A 4GVLA 4M60A 4GU5A 4KAXA 3Q3GE 4RZQA 4CR7A 3PDHA 3CX6A 5AK4A 2Q3BA 2VBFA 4DCGA 4EGAA 5L9AA 1P2BA 3TZEA 1BX0A 3EMVA 1WP4A 2CEAA 1PD1A 4IZOA 4OFZA 3T38A 5JDCC 4LSWA 3V4OA 2RK4A 4EA7A 1XLWA 1ISPA 3NBAA 4HB2A 4EZEA 2RHBA 2P75A 5K0TA 1N5JA 3FKSA 2FWNA 4M76B 3ZQUA 5LQMA 4XWGA 3DMFA 4FEAA 5EHGA 4BBZA 2EGGA 2QVBA 1XPJA 4P9NA 1G7SA 3DT9A 4IIJB 5HKBA 4F84A 2RD2A 3E53A 2EFEB 3UA4A 2VHEA 3SE0A 2R87A 2WF5A 3B48A 4XIJA 1G0NA 5EXPA 2R25B 3UMJA 2A9JA 4HVLA 5JD4A 5AVKA 3OM0A 4Q6WA 1S1CA 1I6WA 2FW7A 2DFPA 2Y1KA 3IV6A 4GI5A 3GT7A 2JATA 2QTFA 3QELA 4OREX 1U0EA 5DVZA 3L05A 3QVWA 2B2CA 2A14A 2Q5IA 5FO0A 5CYFA 5BNFA 3CUYA 3O4HA 3MTGA 4F4DA 1NAIA 2QD4A 1POXA 4WZBE 4YFVA 2C8VA 4RW0A 4LYAA 5IT0A 5I7EA 3ETGA 3WL4A 2AZXA 1VOTA 2ZIEA 5KYWA 3PFIA 1JEQB 1ZSVA 5AJUA 2HNKA 1CHDA 4C04A 3WGZA 3I1YA 4CF4A 2E89A 2FGKA 1HOXA 2IYYA 4FZRA 1YQWA 3EIHA 1CD5A 4D8UA 1P5RA 1EFCA 3UK7A 1VE6A 5LQKA 4MVJE 4G4JA 1SUCA 4NH0A 4IVNA 5MGBA 4U5QA 3D4LA 2E87A 1LDNA 5BQXA 4M0KA 1KOJA 2MINB 3E2IA 1II9A 4JL8A 3E1KA 3OU2A 2PZEA 3RAPR 4IXDA 1O7JA 4JASB 1H65A 4QYIA 2EFCB 1CY4A 4JSRA 2A0KA 2QLTA 3OZ7A 3MYRA 3GZNB 1QP4A 2VPPA 4NYMQ 4UMVA 5GGXA 1MC1A 4P81A 2X4DA 3JD0A 5J63A 2ZTMA 1WZCA 1Z6QA 3FFWA 1WTCA 2GESA 3H5OA 1WXDA 4DCCA 2ZBFA 2JIZD 3A25A 2QN6A 5K3AA 1OE0A 3P32A 3PXUA 4JLKA 2NU6A 2FWRA 3SMVA 4YP0A 7GPBA 1UAAA 2DF8A 2WU3A 4QPDA 5HCIA 1ZK0A 1BS1A 2OCGA 2EP5A 4NE7A 4X45A 5AK0A 4DRXB 4ZEOA 2Q99A 1Z6PA 3H5LA 1ZCFA 3OZSA 4IDFA 1DI0A 1P6XA 3M8KA 3N2YA 4J0EA 4WK0B 4XM0A 4KDRA 1P2FA 3T5MA 4CLDA 2ZRIA 1Q1GA 2B94A 2ZIXA 4H77A 4KN6A 4DIKA 2EF0A 2Q45A 4ZT2A 1HYBA 4QOIA 1BJKA 1TGVA 3AI3A 3U3OA 1TQ2A 1L4NA 1Z75A 4R2XA 2IHNA 3G2HA 2Z9DA 4PY2A 1M2HA 2QD1A 4LSGA 3JQ7B 1K3FA 1OT5A 2LV8A 5ALMA 4XYLA 5IKXA 1Q3TA 2XMRA 5FI3A 1C8VB 3QYJA 5E3JA 4ZARA 4PINA 1MOPA 4QGHA 3EFOB 5CB0A 4I55B 3PTLA 2I34A 4EW2A 1VGVA 3P0FA 1Y5MA 1Y7HA 1U7TA 2DX7A 4BE7B 2FR0A 3D8NA 2MYNA 1SQFA 3LO5A 4JI0B 4A8HA 2G83A 2GAJA 2Q4EA 2EQAA 1OC2A 1DAFA 3VSAA 1PK8A 1N6OA 3A3KA 1GADO 2VF4X 4UARA 2D1YA 2FPPA 3JSXA 4YJHB 4JYAB 3CH4B 3FR7A 4UPDA 1JQ3A 4P83A 1C7ZA 4R7TA 4RLSA 1R0CA 1FE8A 4DDUA 3HB7A 4ZOQI 5BV8A 2FDRA 1NVFA 3NALA 4KV9A 3A1CA 5DI3B 1E20A 1NTRA 3F3MA 3SZOA 1V95A 3MJ4A 5E3HA 2IP1A 1MB2A 2HIAA 3V8VA 2C7OA 3VVMA 4JYPA 3EG9A 5GAJA 2ZBGA 3LCRA 3IALA 1QGYA 2W6PA 2X0FA 1TEVA 4PSKA 3ZEIA 3FD8A 3G5AA 3CZQA 4LF5B 2WFLB 3H2IA 5TPWA 1YVUA 4RJ2A 2I2XB 1ZS9A 3P9YA 4GLFA 4F38A 1B8NA 4DA0A 1KYZA 3R44A 1K6JA 4Y6PA 1ZNYA 2X5JO 1V9SA 3BMOA 2XHZA 4GPZA 1D2HA 2IW3A 3SIPA 5FL7D 2IRWA 4MJLA 4YXWD 1CULC 1NBHA 5SZJA 3DLIA 3DVSX 4M87A 3AV0B 3PJEA 4LDQA 3D1JA 3BL6A 3N0WA 4F45A 5FX2A 4YAJA 3ADKA 3R9WA 2G63A 2LE0A 4HB3A 4IJ5A 2C3PA 2OORA 1JIKA 1QGZA 1AZSC 2QQGA 3MB5A 3ORSA 3IFSA 5FRDA 1VBNA 2C4KA 3MCTA 1Z4PX 2IPXA 1T2EA 3RUCA 3ZU2A 1R3DA 1SBCA 4J2TA 1EM8B 2WBLC 3RJMA 1QIJA 3QUCA 3WV5A 1PT8A 2WKWA 2VHZA 4N5MA 3PJRA 1IBRA 1PKXA 1ZH4A 2BFFB 2JJMA 3FIUA 5ALGA 3IT2A 4LV6A 4GP7A 2WD7A 3OZGA 4OHUA 4OI0A 4JGBA 1YD7A 3GMIA 4RFSB 3FTDA 1B1AA 3MF4A 1YR1A 3RC8A 4AKHA 5LN1A 1M34E 4QODA 1B0ZA 2QG9A 1W93A 1V16B 1PLJA 2NVOA 4W1PA 3PXGA 1CZLA 1XL0A 5IK2D 5FUWA 2GFIA 5ADUS 1S4MA 3ZZNA 1A9XB 1CJSA 2WYUA 3AY0A 3LC1O 4OL9A 1OGJA 3DVAB 4MB0A 1ID1A 2EERA 3AVTA 3UTDA 4II3A 3GB9A 4E07A 1JQDA 1YS4A 2QVGA 2P6UA 1KL7A 4J94A 4L5JA 3ZWXA 3EUWA 2C83A 1P1RA 1T1EA 2QGNA 1RI5A 3MCVA 5MFZA 1ZI6A 2JZCA 4E46A 5BNTA 2XD4A 1ZVJA 1IPHA 4YRSA 2KE5A 2E2WA 1G41A 1NT2A 3LIPA 5BMVA 4FLMA 4A0FA 1PTJC 3KTAA 3QF4B 1VXRA 4M0MA 3BAZA 5AJZA 1W73A 2GEDA 3OPYI 3V2HA 1WMBA 1EINA 3KYJB 1GG2A 1OX5A 1IU9A 4RJTA 4V1CI 2UZ4A 1QR2A 2OMKA 1DRJA 2V97A 3T4UA 4PGGA 1U0BB 1WCV1 2AFRA 1ZM4A 3I52A 2VYCA 3KZVA 3TM4A 4EW6A 5CJ2A 4I4TA 4LDZA 4GPTA 3E4DA 3HJAA 4J03A 4E2YA 3RS5A 1EFKA 5KNBA 4XSVA 2O7RA 3IVAA 2W2OA 4RKRA 1GKLA 1OZ0A 3OT1A 4LZJA 2WMNB 3FPGA 2VK8A 1PYOA 5LNK1 4YMTA 2VH5R 4MCIA 5CFMA 4IDOA 1CNMA 1J9GA 1L4EA 4PZAA 4TUYA 5AVRA 5HF6A 2JKZA 3B1ZA 1UBFA 2YS6A 2WF6A 5DNDA 1XMVA 1V7CA 2ZUVA 4P35A 3QYFA 4XX0B 4MWTA 2FWPA 4F9GA 4QZVA 2CV0A 1CQJA 4WMLA 1KBQA 3UC9A 4LSZA 5CDTA 1Y80A 1DB3A 5ELLA 4Q3BA 2W8BA 1L8XA 3FSRA 1LFDB 5G1OA 4BBPA 1SCNE 1Y4AE 3J81A 2C97A 2VTVA 2VNAA 1KP2A 2ZE8A 4G1BA 4O2RA 1IY0A 1GV1A 1MU0A 2V7WA 2ZPUA 3F6RA 3IKVA 4I3FA 1UQRA 5E6RA 2V7VA 3VJLA 3KYIB 4AJ4A 5KYYB 4D8WA 4L9RA 3KEOA 4MWCA 4EQ6A 4X1YA 1H2AS 5FPSA 1V5EA 1LLDA 2XQKA 4LXGA 1OWOA 2GZ1A 3F9IA 3CX7A 2QX8A 4RNCA 2O7VA 4BMSA 5DM4A 5C53B 3EQ8A 2PYZA 1FFDA 4MV0A 5TEWA 4EY8A 3WLFA 2XGJA 3UO8B 3UBTA 1CV2A 2DLDA 3X1MA 1C30A 1KZ7B 2A7XA 4GP6A 2QQEA 3LYAA 1OR8A 2GK6A 3M6LA 3GN2A 4UM7A 5DN9A 1SR8A 5IYZF 3HBFA 5B55A 1GNQA 3O0DA 4U2KA 2I7TA 2ZSJA 3JALB 1EWYA 4ENSA 1Z2PX 3N39C 3COPA 5DCYA 1SCAA 2XWSA 2C0CA 5IJ9A 1C3OB 3I0ZA 3O8BA 1MJGM 1SKYB 5I47A 2XGMA 1QG6A 1YKSA 3ICPA 2HJSA 3OHPA 3RFXA 4L02A 4LJ7A 4EM6A 3HYNA 3MUNA 4IIEA 2DP4E 4UREA 5A05A 1SOUA 3GRPA 3RC2A 4U00A 1FMFA 3EDYA 1E9DA 3GJ5A 5KNCD 2XKJE 1G9TA 4XVQA 4GH5A 3S0JA 4KMMA 2VPQA 1WDMA 4BFYA 2XVAA 4AKIA 2UUBB 1ZKMA 2V5AA 5TT1A 3NW9A 3RS3A 3G1UA 2HLNA 1F8FA 3L7OA 1F7UA 3DOCA 1XVTA 5BQ5A 1S8FA 1UM9A 1UDRA 4PBSA 2HCJB 1HFEL 5G1PA 2GZSA 3LK7A 5THXA 2F1HA 5EG5A 1GPYA 5BT8A 1GKYA 3MGCA 3TQHA 1G18A 2QJTA 4Y2UA 1XQ1A 5GZ6A 3DLAA 4E5SA 4Q7QA 1SMKA 2HPAA 2XOXA 2ZG6A 3LUBA 4I4IA 1F0YA 4NJEA 3HACA 1PAUA 2HSEA 5DJ5A 4IF6A 4N5LA 1CWUA 3V8BA 3CH5A 3JQ6A 3H9GA 2QN9A 2ZU0C 3R9IA 4Q37A 1L2TA 1H2ZA 4P3PA 3NEYA 4FILA 3QG1A 3DYVA 2Z9CA 1ZX1A 1IYZA 1DKUA 3F1LA 1NJ6A 1KJQA 2JFQA 1SXJD 1JHPA 3K6RA 3L7JA 2WP0A 5EKDA 1KS9A 4K9OA 1D4OA 5JPIA 2O20A 3KQYA 2ZZKA 1UBNA 4D5GA 1YBFA 3ZHQA 1PEDA 4RQTA 5AW4A 2XNSA 3MJFA 4LZLA 4Q3NA 3EFEA 1XLTA 4Q1EA 1I9CA 3L92A 3PQ6A 1B6RA 5A3RA 4QJ4A 1J8DA 1YDGA 1Z47A 3D7SA 2VA8A 1MKYA 4U1RA 4F4HA 4M86A 2I4LA 4PTLA 4GSLA 4RZHA 4J1NA 5A2GA 4YBZA 1ZH6A 1JIIA 5T4HA 4B9AA 1PV4A 3EPPA 4XJXA 2VATA 5CT8A 4YO7A 1JYEA 1XTTA 3ANTA 2W58A 4NEGA 3VZPA 1EP3B 3M7IA 1GR0A 3QEMB 3QUSA 2J48A 3CT4A 1P0CA 2QB5A 4YWHA 1GEGA 4QO8A 5IBCA 1O8BA 3B6IA 1A5SB 3IUNA 3SJCA 4DLTA 4IIHA 3UWSA 1BMFD 4JJFA 5FNVB 2IYFA 4DFDA 1PL6A 4EKGA 3AUUA 3BJMA 3LKDA 1G8HA 3AEQA 4CJXA 1JHMA 1X8JA 4UZSA 3ETEA 4DCMA 2ZXFA 5IYZB 3IPYA 2XE4A 3ONVA 3P9ZA 3I8SA 3PUHA 5B3JC 2DYKA 1OGYA 4JQZA 2FU5C 1TYDE 1GFWA 4AI6A 4KRGA 3AK4A 2AW5A 4HNSA 1DEHA 1JG6A 3N0VA 4OP2A 3A9TA 5C37A 1RKUA 3QEKA 1AHHA 4KU4A 4K1LA 4X9XA 3L01A 2A84A 2G0TA 1ZCBA 3MMSA 4FIDA 2AVDA 4MIYA 4B32A 3NNNA 1G4HA 5LP1A 4NPCA 4DWJA 4MA4A 5IH7A 2Q3MA 3WKBA 3NTXA 2FFJA 4MAAA 2QM7A 3RJ9A 1WXEA 3ESBA 3I4CA 2D1RA 4CL3A 5KPDA 1GZUA 1XZEA 3GQVA 4OK6A 1X38A 3V4RA 4AWXA 1WE2A 2HBYA 1C7QA 1QKKA 2J7KA 5LZ7A 2GPJA 4D42A 3F0TA 1YQTA 1XCGB 3PEEA 1F17A 3U39A 1OFHA 2XAUA 1GDDA 1SOWA 3EGIA 3A9SA 3OMWA 1KDZA 2X86A 2B34A 5GV7A 3WADA 3VR2A 2PX0A 4RM3A 1XU7A 4B6QA 5K0FA 4J1QA 4EJFA 4I36A 1CJUC 2CZCA 4MVJP 1V7ZA 4LZPA 1OWMA 1Z0SA 1M6YA 3ROTA 2D4HA 3OH8A 5K8CA 4ZJUA 2C58A 3G9ZA 2CSUA 3DV0B 4OTZA 2I4RA 2ZU6A 3ZY5A 2YL2A 4P31A 4IGKA 5IKMA 3HZZA 1T5LA 2QBYA 2QNRA 1GQYA 4MB2A 1NF9A 3DMYA 3PHBE 3FKJA 1VLQA 1WG8A 1EFVA 1XI2A 2Y9MB 4Q4LA 4CHGA 3AQ4A 5FPKA 3P0IA 1O6BA 1QVVA 1WP9A 4ZAWA 2ZR0A 5JFGA 4MYDA 1RCUA 1S2DA 2FFQA 2GRAA 3FDJA 3HB9A 3C3MA 3K1AB 2PGJA 4DDWA 1M5RA 4LY3A 4GXQA 1IWBB 1QQ6A 5CXUA 4Q3OA 1BD4A 2J41A 3U2QA 2GBLA 2JGEA 5KX5F 3QY0A 3W5AA 1SIUA 2WPDA 3DCNA 1OXXK 1EK0A 2BM0A 3CTPA 1QGUA 2Y1LA 3DLCA 3QXGA 2ATCA 2G1JA 4A6PA 2X1VA 1PWXA 3NGMA 1HLDA 1YJXA 2GHRA 2IYAA 3FYCA 1DBPA 3LO8A 4R4JA 3QG5A 3W6NA 1SG0A 3CO5A 1C29B 2H5EA 3EOAI 4PONA 5IBQA 5BN5B 1E2HA 1KFKB 5CNKA 3ZNOA 2O2GA 1CUBA 1E2PA 2TYSB 3KU1A 4H7IA 5A4FS 1JIUA 1U2ZA 1AE1A 4BUZA 1C2TA 4BMCA 2JFHA 4PO1A 4AS3A 1DZ3A 2ZBQA 3FZYA 1DNPA 4C7BA 1IUOA 1QG4A 4ZAVA 3VZQA 1KRWA 2OM6A 1N7HA 3PXCX 1Q14A 2WMYA 3SLGA 2NYUA 3I2YX 3TMYA 1CQJB 3IQXA 2SHKA 3S5UA 3IDQA 3NVDA 3NDJA 1NBWB 1T4MA 4MV7A 1U94A 3ZIDA 3E7WA 1SQ5A 1DRKA 1QDEA 3CLSD 3KSDO 3QTTA 2PXCA 4KLNA 2H7CA 3NHJA 2EYQA 4ZODA 4I2NA 3L4BA 1QHIA 1XQYA 3W5SA 1KS2A 2WSLA 3ZWKA 5D6OA 2DHRA 4XFKA 1IQRA 3QPAA 5IM4F 1GWNA 4PFKA 4CVNA 5JQGF 3CEJA 1GA4A 1C3LA 2W8BB 4Z3DA 3WO0A 3PDIB 2C0PA 4DEVA 3ROZA 1AZWA 1I3MA 4ZK2A 5JASA 2XXJA 4XYGA 5I01A 2ZRDA 3VSDA 3WRXC 2BR4A 1PT5A 1BE1A 2AFIE 4EX7A 1DZIA 4BNGA 1OBOA 2XEDA 1XZBA 2PFSA 2EWWA 4ZT5A 2B8JA 2AWNA 2CE2X 1YVEI 1AS3A 3GA0A 4RKQA 2J0VA 3HB5X 2P6NA 2JJ2A 3W90A 2B0JA 2A5GA 1FRVA 3JVUA 5C51B 1KYQA 2P4UA 2ONYA 3NH9A 1TT7A 1P81A 4XQGA 3JQ8B 4GYJA 4W5WA 1WHTB 1Y3IA 3PEFA 1GZ5A 2PE5A 3DLPX 2RHWA 3LYUA 3RRFA 2F2TA 1CQPA 2Z3VA 2PSJA 2BM8A 2JEZA 3PG5A 5BURA 4U3JB 2C42A 5E1OA 2HHHB 3RC3A 2NADA 5HE9A 3GLIB 1O4VA 1XZGA 1TF7A 3NPMA 4B4OA 1HWYA 4BO0A 3GG9A 3V1YA 1JXOA 1XROA 4PHTA 2AX3A 2ZE6A 3RBAA 3TOCA 4LJLA 1MPTA 3GCXA 2PHZA 3F78A 3QJYA 2DG2A 3OLXA 4OB8A 1OX4B 5TQJA 4BJ3A 3ZJ4A 3U4DA 3QOFA 4S04A 3RGGA 4EY6A 1VKJA 2A9QA 3EY9A 2WF9A 4RJIA 4PE5B 3WGJA 3FYDA 4HDCA 3V9PA 2X4LA 3EQ2A 4G0ZA 5CVCA 3DMTC 1EVZA 3BM5A 3NM5A 4HQFA 4NI5A 4AVYA 4Z7OB 2BV3A 2VJDA 2VYQA 4P54A 3VHXA 2BLLA 2O2CA 1AV6A 4BYGA 2DWPA 1TJ4A 2CJXA 4OXNA 1MZVA 3CF6R 3KT0A 1J5XA 3LY9A 3ABSB 3GUUA 2HMUA 3FJOA 2QN2A 3O9VA 4K0RA 2H0AA 4KW7A 3VH4A 2P90A 1CRPA 3ZOKA 3JQCA 4DR5B 1PK7A 2C59A 4FLFA 2VDVE 3HP7A 3VI3B 3ZHTA 3QSYA 1P6QA 3MTEA 3TIIA 3VO2A 4RNDB 4QBIA 1I4WA 1WVMA 1WZEA 2AX4A 5G4LA 4C4RA 2H4ZA 4LDPA 4UXIA 1NM5C 3SIRA 4CG2A 4HDSA 1RMQA 3M4NA 4L7QA 1MRSA 4K6KA 3I72A 1DC4A 2I91A 3PXDA 3U80A 3WLSA 1EKXA 1JYSA 4J0JA 1DPFA 1NC3A 4KQ2A 3RM3A 3PDIA 4F5YA 3B9RA 3FHLA 1WBJB 2A88A 1K8QA 3K8YA 2C94A 3RH0A 5BR1A 5CLGA 1M8JA 2WD8A 3I2FA 3GMDA 3JQEA 4GWKA 5EE3A 1BHO1 3VKUA 3OQ1A 1O5TA 3GT3A 3MIZA 4Q4HA 1FFWA 5ADVA 2VDNB 4NZ9A 3TTYA 4LRYA 3ZQ4A 2GKOA 4XIGS 1Q7EA 1A4IA 9ATCA 4YUZA 1FYEA 1OTYA 3BBLA 3ENWA 3KV1A 3U4IA 3MTIA 4Q03A 2IYXA 4YCBA 3VNQA 3WWOA 2Q4BA 2UZ3A 3AB8A 2XVYA 4BGEA 1JFTA 1FW6A 2I8AA 3GP5A 3DZKA 1WPXA 2R60A 4IJVA 5LL6P 4MDFA 3AW9A 3D7KA 3EZ2A 1J4AA 3GJRA 4O4LB 2Y76A 5DSTA 5TS2A 3MJDA 1R4MA 3WSVA 2WM9B 1J0DA 2ZUWA 2X9LA 3UJ8A 4ECAA 4IUBS 1JQJC 4RMIA 4I4TF 3AWIA 4FMPA 4RVNA 5HFAA 4YMLA 1QBKC 5HIKA 4XJTA 2C5FA 1SEPA 2CGEA 1K2WA 3JQFA 1S89A 2NUAA 2ZJ1A 2Q8PA 3P9RA 3S1AB 4EDFA 3D8RA 2CBGA 3ASUA 1AVTA 2HXYA 3HB4X 1GO2A 1T35A 2RGNC 5EXSA 4C78A 1WF6A 1QRTA 1XUOA 4MICA 2P4QA 4EUFA 1YKGA 1QIHA 3WRXA 2HOQA 2VYND 3FFBA 5IVIA 3E6AA 3GLHA 4CT0A 2Q27A 1CIPA 2Y1FA 1GSOA 4BX3A 4ZHQF 2IHUA 2QJOA 1L9XA 2EKZA 3DZHA 4H60A 3DFZA 5EXEA 3CMCO 5BQPA 3UMFA 2NZ8A 1FRZA 3AZOA 3FB1A 4TYNA 3PBKA 3R74A 3BREA 4BO3A 4G26A 3FPHA 1I7NA 1X0XA 2R6R1 2OLEA 3CISA 4Y2PA 2CXQA 2G8NA 3TUZC 3U44A 3RVRA 1J22A 5DV9A 3TVDA 1MB0A 3G6KA 2HQOA 3INGA 1DAIA 1W87A 4ZT7A 2GA8A 3LNCA 5TMBA 5HIJA 2BZGA 1KR2A 5CUQA 3RW9A 4D9IA 1YCGA 5F2KA 4KQXA 4X64B 2WSIA 2VUHB 2CL5A 3HCOA 4QFMA 5BT9A 4IJWA 4FMDF 1QVZA 4L22A 2B21A 3G2PA 3HKCB 2IXBA 1CZHA 1ZUIA 3P96A 2BGWA 3B7PA 4Q3DA 2BBOA 4PCVA 1ZW6A 1TYAE 2ETVA 1DAKA 3DDHA 4MMZB 2VT2A 4KQWA 2ZVQX 2GHIA 1BN6A 3FW1A 2VAPA 1IJBA 1ENYA 3BHNA 3PWZA 5F78A 4F4IA 1EDDA 3GROA 3OJ0A 3BJIC 5GQSA 4XD7A 2AGVA 2P5UA 1QTQA 3W05A 3SICE 5HQTA 4JC8A 3C0KA 3KETA 2F1JA 2QBYB 1EYZA 3PUVA 5EGSA 2PX3A 2PUJA 1J21A 1TEHA 4QNRA 1T24A 2IZZA 1CLEA 3IERA 4LGCA 3ZV4A 3CR7A 4UNSA 2DLCX 4YN3A 4RF4A 1SUDA 4K6FA 5H9WA 1EFPA 4IYJA 3PVCA 4OQYA 1XCJA 1FDUA 2FUEA 2P27A 4OHOA 5KAPA 5TNXA 3ST7A 3T52A 5AW6A 1DCMA 2VHJA 3I9KA 5IABA 5HBRA 2WU8A 1BCRB 1QDLB 4JNCA 1IUPA 4IIGA 1R1DA 4RFVA 3KUKA 1WXQA 5D5HA 3ZE0B 3U7HB 4NCHA 1EBFA 1QC5B 1WB5A 1KH2A 1USIA 3H05A 4YK7A 1V0JA 2V6FA 5D3MA 1SCQA 4II7A 2H16A 2Q3LA 2Q6KA 1XTQA 3O2QB 1RBQA 3HO1A 4PLCA 3QMWA 2OE2A 1XDUA 4OLAA 5FDFA 1ZC4A 4G5QA 2QPTA 3FHCB 2MSEB 5KYKA 4GI7A 5U1PA 4PN3A 2V55B 1IZ7A 2YZKA 2XOKD 1PKEA 1Q0HA 2FEPA 5CCEA 3OHSX 5KYYA 3HL4A 3E9RA 2J09A 4LJ6A 5DTEA 3WK5A 1Z7WA 2YCLA 1JR3A 1CDOA 2OQ2A 4ZVVA 4JX9A 3OF2A 2R1VA 3EWNA 5D3KA 3QXCA 5ALYA 5CK5A 3A4VA 1KZ9A 4OQZA 2ZJ4A 4ZI7A 3EHDA 5BWNA 3KOYA 3QIAA 3HCEA 3SHTA 3H2BA 1OLOA 2RC5A 2ZETA 4MRSA 3HGMA 4AS1A 2XKBA 1NOIA 2MSKA 4H35A 1O89A 3LQ4A 4Q1BA 3T3DA 3R9XB 1QFZA 2POCA 2HGZA 4UHFA 2IFTA 3BE8A 4X94A 5ALRA 5FPQA 4MS3B 4C87A 2CNKA 1E0SA 1XYYA 1L7DA 2FKAA 1V7PC 2RGGA 1QS0A 2OILA 3NRJA 4PZ9A 3X3HA 4C4TA 5H83A 1QZUA 1BA3A 1M76A 3AXSA 4PX5A 5AM4A 1ADFA 2FEOA 1OWLA 5FORA 5DYWA 3Q8MA 1RI2A 2D1SA 4HWPA 3Q8WA 1G2OA 1PSWA 2NT3A 2O1WA 2AE1A 1H0HA 3RS9A 2GVNA 4D5EA 4BQEA 2XMDA 5KKNB 2D00A 4WZBB 1E32A 3DOUA 3FA2A 4AP5A 5EGNA 4Y0AA 3JAKB 2RHDA 3LDFA 2A0FA 1GUZA 1TL7C 3P9PA 4QRDA 5IDQA 4DQKA 5EQJB 3RSGA 4CYMA 2JHPA 2UDPA 2VP9A 3PFKA 4WFJA 1JPJA 4C05A 3N6XA 4YTEA 5KYNA 3CYFA 4U3JA 1Z38A 3QFHA 2GK4A 1L5HB 1WUIS 1EXWA 1JKIA 1XAIA 1NGSA 2IJGX 4TMTA 3WMFA 1YF3A 3NEPX 1LPNA 3TAXA 2H85A 1EUCB 2C9OA 3RRZA 2VQFB 2AE2A 4MINA 4O1HA 5AKZA 2B1IA 3W8FA 1Z82A 1LQTA 1DBRA 2GDZA 1WLYA 3WIVA 3ENQA 1KMCA 1TF2A 4ZOLA 4G9EA 2PK3A 1JF8A 2A33A 1EA5A 2QRNA 2ZRLA 3HWWA 4R69A 5T6BA 4F5ZA 2XAAA 4EG3A 4Q1FA 1KSJA 3D5EA 1FXSA 3RU3A 1O94C 2IZ6A 2GPYA 4DJDC 2PR2A 2PLFA 3NIWA 3T1TA 1VSQA 2ZIFA 2XDAA 2YQ4A 3BK1A 3V4ZA 3L4BC 1SBYA 1H1LA 5FV7A 4KXVA 4REQA 3VH2A 3T7EA 5IAJA 1R0ZA 3ZK9A 2QA5A 2VZLA 1SBIA 3E05A 3EHEA 3H0CA 1RRKA 4CLRA 1RD4A 5KJ1A 1N32B 1E2LA 4V38A 3GJXC 1K63A 2JASA 4DSNA 4F8EA 1J0BA 1YJBA 4FDVA 4XGRA 3ES9A 3ROMA 1M83A 1XTPA 2IHVA 4YP5A 2EFYA 2WM8A 2UYQA 3ZYCA 5TC4A 4DYVA 2JZNA 3STHA 4E2ZA 3DMGA 2ID8A 4V0KA 2XUDA 1VKZA 3EC1A 1ZXLA 3KVRA 3LRPA 4DSZA 4DJJA 3COYA 3IUJA 3N87A 3T9CA 1C50A 2CXTA 4RF3A 4A6DA 4YT4A 4HEJA 2QAIA 1YFKA 3RREA 4J7UA 3V1NA 2QMHA 8ABPA 1YZNA 4B45A 3RROA 1B3RA 3AESA 4J0FA 2OUIA 5FOWA 5DCUA 4PC1A 5M34A 4AN1A 1EE2A 1YJ8A 4IV8A 2A0YA 2IEYA 3M1YA 1UQUA 1EFRD 2RG7A 1L3IA 2QX6A 3TLYA 5E6SB 2Q0SA 3CH6A 3L8GA 3OFJA 5KI6A 3ESDA 2D5CA 2X6QA 4I5EA 3S40A 2I2BA 3H1PA 4RVUA 1J6UA 4M1EA 2ZI9A 5AOVA 3O7WA 4JU8A 1FFEA 2OHJA 1VE9A 1Z15A 4AO8A 1GAQA 2OBXA 1JV2B 2JNWA 1GYPA 4OKIA 4Q82A 3ZZ1A 4X93A 4JBWA 1FP4B 1DKPA 5FD8A 4D3DA 3RFCA 2GM3A 4PBTA 2H4JA 5IZ4A 2SCUB 2BIFA 4IO0A 4G5HA 3BULA 1QK3A 1MCZA 1AZLA 3IUQA 2A9PA 1EFVB 1PZNA 3D4PA 2EDCA 3UFXB 1WZIA 4YXFA 2G0AA 4QOGA 5CA0B 1EM6A 3C48A 2XUHA 1Y3FE 1W5SA 1P5HA 4RM2A 1BTOA 1C14A 3EDQA 3GGCA 4IVRA 4PGFA 4HX9A 3U1VA 4WBSA 4DCJA 4PX9A 4IL5A 1KA9H 4NWIA 4C21A 2X5XA 1TPYA 3ORQA 2BP7A 3KCNA 4G6ZA 2KYRA 2WQ7A 3HI4A 1PT9A 1HC7A 1OYWA 2YJZA 3AYZB 3TLGB 2MSLA 3INYA 3TLBA 3JD4A 3K4QA 3ZHCA 2CXHA 4BFVA 4UTNA 5HWSA 2D2FA 3CVUA 2XDQB 1QFXA 1DKOA 3DE0X 2K6GA 3LKVA 1WB9A 4M99A 1NLMA 2OYRA 3OCYA 4RACA 5DP1A 3NTOA 4U2GA 1NVUQ 5A4JA 1EB8A 1M2VB 2FN9A 1PGJA 2E1RA 3GNQA 2YW2A 1MLDA 1ODFA 2GNOA 4DR7B 1UBSB 2R6AA 2WUGA 2YZMA 4ZDIA 5JBIA 1Q7GA 1QPZA 5DBGA 2H9YA 5KYXA 1SKUA 1DKRA 4XWTA 3ZXUB 3NUZA 4G0MA 3RVLA 5DSXA 4UQOA 2ZBRA 1D6JA 1U28C 2ZDQA 4M7WA 1EX1A 3WQQA 1Z35A 3MMZA 2ZIWB 3KNZA 4QLAA 1AN9A 2WAOA 4DM7A 3SJBA 4OK3A 4YMUA 3SX2A 2HFJA 3O73A 3MJCA 1AURA 1NYTA 3KKEA 2A9FA 3Q7PA 2GSDA 1B6SA 1P1HA 2PCLA 4TYPA 5CNJA 1GNLA 2VQ6A 1Q2XA 1ANKA 1W25A 2FPPB 2XI4A 4I14A 2Y0DA 3HYTA 3NYWA 2CLLB 2OOKA 1AY0A 1AMOA 1SXJB 4FX5A 1VL8A 3HRHA 5JDIC 1T4BA 1YFLA 3R0JA 3SPXA 3A05A 3QFFA 3QKRA 4XRGA 1U0NA 3H2KA 1PW5A 3ITEA 3KLBA 3RQSA 4U7PB 4QWWA 4BB5A 4HFNA 4KWEA 1A9XA 1SULA 1U0FA 3ZXXA 1HG1A 1H0KA 2CLFB 1KPIA 3H1TA 1A98A 4C03A 2H48A 5B7QA 2XCSB 3JQPA 4ZV9A 5GJVC 2GO7A 2FN8A 3QA9A 3UT5A 2Q2NA 2YY7A 1Z2NX 5MFPA 5KS2A 5F2NA 2OV6A 3LGAA 4X1KA 3BMCA 3W78A 2IDMA 4GPBA 2WNIA 3H9BA 3WQBA 1Z6AA 3WBFA 1SCIA 2PVPA 1YDEA 3SG0A 4MQFA 4LQCA 4KE8A 3OFSA 4IOKA 4W9NC 1TKAA 1NP7A 1VXOA 4E94A 4F8JA 5K8TA 1CYEA 1VZ2A 1KDPA 2BI7A 3QQPA 5H82A 3TSAA 4AK9A 2F90A 2ATIA 2WPDD 4NCJA 1BOOA 4CMAA 2BTOA 3F7NA 4OYRA 1SXIA 3T5PA 5D3MB 4FYIA 5FLYA 4RIFA 2NYRA 4IHJA 4B6EA 1PIWA 4EHBA 5EA2A 5I6DA 3R7NA 3OTHA 4MS4A 4XUDA 5L3RA 5CFQA 2C1EA 3NFYA 2WSSA 2WTBA 1SHJA 1P2VA 2ZB2A 2QZSA 4CM9A 4ERXA 2VTKA 1FUUA 1QWSA 4RCVA 1E2BA 4FGUA 4X7BA 4O2BF 2AOUA 2GUWA 3KSMA 3P9CA 3R6DA 3W4KA 3CLTD 5P21A 1WBDA 1O6GA 3H42B 3DSRA 3JRNA 4HQRA 3U19A 4W1SA 3ZD9A 4KGXA 3ANNA 4PG5A 3K09A 4RD6A 3CN7A 3AVYA 1HLFA 3DZJA 4BMOB 4KYTA 1FMCA 2Z2IA 3JQ8A 2W2LA 4DRZA 1PUIA 3B53X 2P91A 1RW4A 3K2BA 3TCNA 4J9UE 5CU7A 3ELUA 1PR3A 4IOLA 3VX4A 1ZD2P 2Z1NA 4KX5A 3W9UA 2BJHA 3I9NA 3RTAA 3VTAA 1LGYA 1E0JA 4IGIA 1O0CA 4XARA 2OFWA 4ZPXA 1EUDA 4WCDA 5AH0A 3OEED 4B34A 3I4FA 2GD1O 2P9JA 1N3BA 2CMGA 2YMPA 3FSEA 4HX5A 4V2IA 5KAMA 1H9AA 2HZBA 4WZBA 3MAAC 3QVKA 3E18A 3TKAA 4NATA 1U5AA 4Y2JA 3X0DA 1SOMA 3GX1A 2P3QA 4A7PA 3NFRA 1OAAA 3WGKA 4BVJA 2V7UA 3NH6A 5HQ3B 1D7AA 4Z4EA 4B71A 2ZJFA 4U9UA 3BE4A 3CX4A 4R0MA 3JQQA 4D4HA 2QPLA 3L93A 3MGKA 4FQ5A 2IHZA 1VKOA 5CVDA 3W2HA 3U3ZA 4R2IA 3L6EA 3K0CA 4UZEA 3UAVA 5KC9A 3N8IA 3AFMA 4HZGA 421PA 4XWWA 1CF4A 2FG7C 3GJ6A 4OATA 2QRPA 4HO1X 1F5NA 3IP9A 1N2EA 2P8SA 4KMSA 1RI3A 1YA6A 3WY9A 4JBLA 1LH0A 1NX9A 2F1OA 2ODAA 2RSLA 1C3VA 3BHJA 2G1AA 1BXRB 2QGFA 5JYDA 3K09C 4EYEA 2AF4C 5IFLA 2IUTA 2W6OA 1MEJA 1QYDA 3AFIA 3MWEA 4PHHA 2EDAA 1NVAA 4MR8B 3STWA 3U3DA 5EJ5A 4BV9A 2SKCA 4GVPA 1QVAA 3PYMA 4JJ6A 3RIGA 1V8BA 1XU9A 3S1AA 4C5BA 5I5EA 2JD0A 5HF5A 3IVMA 3THXB 2OEPA 4MWOA 4OI1A 3X2EA 4RTKA 3PR1A 4AULA 3WYFA 4CM7A 5A6VA 4L95C 1FTQA 4X1IA 5EOVA 5JZ9A 3JWJA 3VPHA 3FCEA 3F2VA 4U0KA 3NKFA 2V6BA 3TPCA 3UW1A 2NP6A 1YR2A 4H7FA 4PTZA 1D9ZA 1ORVA 2OAEA 1L5HA 5IULC 1NMQA 1WO8A 2R66A 5BQ3A 1G55A 4O29A 3FKSD 4KXWA 3SYTA 1DBWA 3DM5A 4I1UA 1MH9A 1U1FA 3IURA 2WOJA 2IBSA 1ZG3A 4MR7B 3U1TA 1D1PA 4FCCA 1YZLA 1HQCA 2CL0X 1AA9A 1PJQA 1XMIA 3OZIA 3L7CA 1X7ZA 4ZYYA 2B3DA 2AZMA 2G67A 5ENVA 2JCYA 5FB3A 3VKFA 1KEPA 2C82A 3RPEA 3UJNA 3D2BA 3TEMA 2JIDA 4K2AA 3D7LA 2ZR8A 3F3SA 1XF9A 3KVVA 4J4TA 4DMGA 1OQAA 1TXGA 4HWTA 1PJSA 3WWCA 2ACWA 2R1TA 3MS2A 4XW2A 3SAJA 4DLYA 3DH0A 3QGMA 2PL1A 4GEGA 3PL5A 1EFDN 3CO0S 2B8WA 3MXTA 4E70A 4P98A 4RWZA 5CGZA 4D8VA 4D9EA 1GGKA 4TYWA 4GM4A 4I4LA 2DEUA 1IUNA 4NBKA 1KI9A 4ZU6X 4FK8A 1B41A 5A4MS 1ZN9A 1H23A 2Q4RA 1MG5A 2VHVA 5I3ZA 5A4DA 1WUJS 3F71A 3VISA 1B0PA 2XMZA 2P9FA 4JI7B 3MWLA 1MIHA 3QMMA 1N8NA 4MCAA 4WY2A 2V58A 3WRWA 1A8PA 2XV1A 3ET4A 4KRYA 4CIBA 1GA6A 2ZI5A 4DJTA 3MJTA 1PG5A 3P4UA 1H6AA 1USVA 3ORYA 4XUEA 1T9ZA 2AUNA 4QTYA 3IVXA 1VECA 2VQDA 4HGQA 1V39A 3HEBA 3PEWA 1RWBA 3GEGA 2VQEB 1X2EA 2OAP1 2GX6A 3TTSA 2X5NA 1MR3F 2CVHA 2AC7A 1MB4A 2W2NA 3EFBA 4I3GA 1LJUA 2WWXA 4UHKA 2FF5A 1XKTA 3PI6A 2ENWA 1V3UA 2J0EA 4X54A 1CB7A 1JG7A 3CR8A 4YRMA 2CVQA 4Q15A 1P8AA 4KUEA 4ERNA 3NIDB 2G1PA 4DE5A 5A9SB 2R1ZA 3L46A 4MKXA 2HK7A 3DEZA 4JUCA 3SOZA 2C7PA 4QM7A 3DMDA 5ED0A 2XB8A 3P27A 1LEHA 4O33A 3VU9B 5KTPA 1ECLA 1MENA 1YFZA 3B36A 4GM1A 5DASA 2DPMA 1SXHA 4DDVA 1QE3A 1J1IA 2B2XA 4CI9A 2X7JA 4BFCA 4BXOB 4FC6A 5HGJA 2FHPA 1DX9A 2FFAA 4N03A 3VPCA 4E15A 5BWBA 2CVFA 5EZ5A 3H9JA 3QVGA 4DUGD 5HSGA 1G4UR 3CUSA 5LA6F 4QPNA 1COZA 3VOAA 4P5PA 4ALJA 4D8TA 5HZHA 1J33A 2JJ1D 2PEZA 4IDBA 1UBEA 1PSZA 1V2GA 3JWIA 1CUSA 2X7XA 3DYBA 4MH0R 2NO5A 2FW6A 2XE8A 3N7AA 4ISBA 1FFXB 4HUQB 1PE0A 3A6PC 3LRTA 3LBIA 4MW2A 3AF3A 5TJHA 4MGKR 4DRYA 1A5AB 5ALOA 3U7FB 3T5AA 4A8PA 4LC9A 1LI7A 4TGLA 3I6IA 2B5OA 3GRZA 1FJGB 4YR9A 1OIWA 2ODQA 3CSDA 1JDUA 3AEQB 4GRIA 4KIGA 5EWMB 1CUDA 2G09A 4JEUA 3CNEA 3ONWA 4H1UA 2RHOA 2Y2VA 1QH8A 5U4XA 1TTHA 2IQIA 8LDHA 2QY9A 1DEXA 4LZNA 4IVPA 2F43B 1TYEB 1QV9A 1X1QA 3OMXA 3EUFA 4PYMA 3O3CA 3LX6A 1FLNA 4O8CA 4YT8A 4EEZA 3KLMX 2BGTA 3SQMA 3Q8LA 3WYCA 3AETB 4CKBA 4S1OA 4I7EA 2YVQA 4KQFA 3RS4A 1J0CA 1WTAA 3DEJA 5B53A 2VKQA 3WB2A 2HM7A 4J75A 5K0SA 3NHRA 4I5FA 1C81A 1IQPA 3PQ2A 2UU9B 1CETA 2CYAA 2DFDA 1OF1A 2BI8A 4ZDKA 2BJVA 1XRPA 4NK4A 4ZOLB 1ZJJA 4QDOA 3D3JA 2YJ3A 3EWSA 3DOFA 3TIVA 4GE3A 4UVEA 3A2LA 1DVRA 2D2EA 3G88A 2D5BA 4HYTA 1O8CA 1IJKA 4IQGA 4PIPA 2HCRA 1L7AA 1MFPA 1K0FA 2C8JA 3BJRA 1FYDA 2Y71A 1XCMA 1KIMA 3PC6A 2B5VA 1E1LA 3DBOB 4MRPA 4DDHA 1VJCA 2EX4A 3MWFA 3C98A 1ZMBA 3OLYA 3FUTA 5H80A 2W2MA 4BNYA 5BSVA 3DLHA 3ODGA 5AWFC 2OQVA 1KEEB 4CQMA 2PH1A 4YASA 3ZCRA 5B57C 3HU3A 4RVCA 2H00A 1NC1A 2GO1A 2I87A 1GGMA 3LUAA 5G0TA 1ZONA 1IVSA 1XNRB 3IR6A 3VNVA 3AFHA 1XJQA 4CN8A 4DJ5X 2X40A 4R0NA 1G3MA 3RRXA 1LVUA 2A35A 4EHFA 1RLIA 3FVVA 4GOOD 3AVQA 5K0BA 1A9PA 3Q5GA 1I2BA 4DLKA 4PBRA 3E15A 5LYJB 3PWTA 4E3ZA 2Z5VA 4JR0A 3E5MA 3LBFA 4TTPA 2VPZA 1I7DA 1LS1A 3F73A 4RABA 3LQKA 3L6BA 3OFVA 3CPHA 1T8RA 4LE0A 5BYBA 2PX5A 3UKJA 2GXSA 2MMGA 2ZE5A 3FPCA 2JH3A 1OI2A 4DBLC 3H8WA 1T9BA 2F17A 2YNMA 4ZJZA 3KKKA 2JGLA 4G5RA 1JYFA 2OHIA 2VOJA 4LBVA 4BIIA 1OAKA 3HKBB 3PLAE 1GQSA 4CQLA 4GKVA 1NL3A 4RZXA 1JJBA 4DA7A 4H1TA 1H2RS 2B7BA 1MEEA 1XDWA 3OU6A 1VRVA 1MFZA 1OXTA 3ZYZA 1O9HA 2EJCA 3EZFA 1HETA 2Z6VA 4A73A 1EJ6A 4EJSC 4AL4A 1IEVA 4YJ3F 2JAOA 4UJ5A 2ZUTA 3ZBUA 1TZKA 3CCFA 4C6TB 4FSXA 2VHWA 3TLXA 3MWEB 4IQ0A 3KZMA 3C6QA 5AKLA 5LR6A 4CCAA 1WEHA 5BN3B 1G8FA 1HO3A 1M2GA 5I45A 1CUZA 3LFUA 3VR6A 5TS3A 4G01B 3VNAA 2YHIA 1ENPA 2WIGA 4MEBA 3VZRA 5K6RA 4HJRA 3WYGA 3F4LA 5KOIA 3T7KA 3D43A 1XT6A 1ADCA 3F5QA 4PLTA 1EWVA 2OR3A 1GCGA 1XDGA 3GFFA 5E4JA 3ERCA 1M5TA 3CNQS 4WLFA 1XTSA 1W6UA 2NO9A 3EVTA 2CLDX 3U4MA 3M1IA 3BGIA 3IYLW 4KACA 5JSFA 4C9BA 4DZTA 1JA9A 4EHLA 4AWBA 2O4UX 3F2IA 1TUIA 3JVDA 4PV7A 2Z98A 2QORA 3GUHA 4Z9XA 3WK4A 5JATA 3THYB 3JASA 4YCAA 1H8HA 1W2GA 4B82A 3NHPA 1AB6A 3ZZMA 2I2CA 2X58A 2WY2D 3KR9A 3CLHA 1GZ7A 4MQBA 4IIUA 4LWQA 3O94A 4N12A 4FNMA 1GCOA 1U5CA 2ZM5A 2QN3A 4J6EA 2RHTA 3OT4A 1IHYA 3DL4A 3ZD6A 5DGIA 1VI5A 1C0PA 1ZQ9A 1VGRA 3VNRA 5BR4A 2PUFA 3VXKA 3MUOA 2V98A 1PQUA 3SSAA 1Y1LA 1XCOA 5E6UA 2EBWA 1PR2A 3PNMA 4H9GA 3FPLA 1E1CA 5K09A 2WI8A 1E4VA 3OUUA 2E4UA 3DF7A 5DLDA 3BMNA 4IFBA 1T6YA 1E3IA 4P2GA 4X1IB 3SJAA 3IP8A 1HNWB 2ABWA 1O95C 3AUFA 2HWKA 3CLUC 4PQEA 1JG4A 1R0WA 2FKNA 3WMRA 4ARCA 3HXPA 2R85A 2WJZB 2YR0A 3QOXA 1KJ8A 1GZ6A 2OZEA 1X1DA 2QP4A 4ABTA 4JJEA 3P4XA 1IBLB 1VMEA 2I2AA 3T7DA 4RKWA 2IU6A 4ARZA 2J5KA 2W4QA 2X4IA 3ENNA 3KJZA 4MLPA 3J80A 4EGSA 4UM8B 2EBHX 5BQFA 2EF1A 3HHPA 4YRCA 3UPUA 3Q7IA 3T8YA 5DN6D 4XZ3A 1GOTA 4DG5A 4KG7A 3TH5A 2H54A 4PPFA 2VP5A 1BWSA 1G3IA 1IB6A 3QLEA 2AN4A 3X2SA 4ZVKA 1KIFA 4D97A 1P7PA 3RU9A 3IB3A 4RMJA 4EFMA 1QRRA 3GD7A 3L0CA 1E1RD 2D4AA 4C0HA 5BVHA 1OLSA 5KVCA 4BNMA 1HNXB 1SO8A 4P80A 1MC5A 4WBNF 2EVWX 5F76A 3WWZA 1I01A 5T4EA 4DWWA 4NYIQ 2AOWA 4LRSB 3MUEA 3NHFA 1CQWA 4E21A 3OJEA 1H5UA 1Y1SA 3V7YA 5L3QA 3W4JA 4MK4A 2CJYA 2I8CA 3ACCA 3ANYB 3LP8A 2CZQA 3NASA 1USUA 3DFFA 4XSGA 3ZHZA 3VKGA 3G2JA 4I55F 4L16A 1BQ3A 5BUSA 3RTGA 4CMEC 4HQLA 4Z0PA 3ZLVA 3ZCPA 4DIFA 2RBGA 2PXXA 1NR1A 3DAYA 3KVYA 4WFKA 5F9HA 1SXJA 5FR1A 4CZ2A 3GDOA 3T9BA 2O54A 1PS8A 2IEGA 4BBJA 4POAA 1R6AA 3DS8A 1Z0ZA 4HB0A 1WCWA 4GL4A 4F3CA 3I6BA 4MVJG 1O4WA 4PC6A 4A0RA 1N1DA 1V8DA 2DR2A 3DMNA 3F97A 3MUFA 1L6RA 4EJSA 4HV4A 4IWYA 5JCOA 1N3LA 5KNDA 4MCJA 1M9NA 3N0TA 1WUKS 1X7GA 1TE2A 2I6FA 1A9OA 3R24A 4NK5A 3SMQA 4ZCIA 5AXAA 5JARA 3UC5A 1R6TA 3A6DA 3UV3A 4RESA 2HTEA 1SIOA 2WK1A 1TO1E 1XQXA 2BBWA 3M83A 4OHZA 2B30A 3WK9A 3ZDEA 1VBMA 1MXFA 1WNTA 4Y2YA 4BJ1A 5CD9A 3WX0A 2IV3A 1OXUA 3BMNB 2IYTA 2WHQA 1E7QA 2Y77A 3NHYA 3RUPA 5JZOA 1AB5A 1G291 1DKLA 1NJGA 1OD6A 1UMDA 3GPIA 1CY2A 2DY1A 4UPVA 5GONA 4C6HA 4AMUA 4EMBA 2PJRA 5DM60 4BLUA 2IGBA 1C1DA 1CKEA 1WSAA 4B33A 4RF2A 4BGDA 2XZTA 3BFXA 2NQTA 3LT5A 2Q3CA 3VSEA 3HTXA 2P6MA 4M9UA 2EJUA 4JP3A 1HR0B 2GF9A 1DX6A 3OWXA 3DCJA 2KLHA 2O8EA 2ZQ5A 3P5SA 3AW8A 5I7SA 5FUYA 5DHFA 1EXMA 2BHNA 2AEFA 1HYQA 4QTUB 1E89A 2PXHA 3G7UA 4Q3EA 1TB4A 2PANA 4RD4A 4Z6KA 3QEBZ 1HRKA 5E0KB 3WLKX 1Z5NA 1K2VN 1NUHA 2PEYA 2MMCA 4CMHA 1PV1A 3AMVA 2WYOA 4QOFA 3RT1A 3KXLA 1DBVO 4FEYA 4F6RB 3LQRA 4CKBB 2Q5HA 1HT2E 2IOHA 1VIDA 1LZKA 2QN8A 3O4FA 1JDBC 1SVUA 4MI3A 5FI1B 1L5FA 4OUDA 3O8QA 1TC1A 1H94A 1X8KA 2ZJ7A 1Z5VA 1QOZA 2ZBDA 2QR5A 3EBLA 4MLDA 4ROSA 1NI4B 2IIBA 5HQJA 4CQNA 1YK1A 5E95A 2WWIA 4CCSA 2PSDA 3R75A 2DXIA 2XYPA 4O02B 5L53A 1WU8A 1YI0A 2V4UA 3AP2A 1M0SA 2GPWA 2CEKA 3L0DA 3HY3A 2EL9A 4ND7A 3KQNA 3B6JA 5U9CA 1TZJA 1Y7PA 1COWA 2BSQA 3NEAA 3DB2A 4NAVA 4PYKA 4WNAA 1N9GB 2LCQA 3DVAA 2VUTA 3RSHA 3O8DA 3PPWA 5C7IO 1N5RA 1ZCJA 4EVQA 3NHBA 2G0NA 5K03A 4QOSA 4YCCA 1W88A 3SC4A 3EUAA 1Q92A 2WUDA 4H7JA 4TKUA 5IUJC 2IITA 4WQMA 3G68A 3RK0A 4F2WA 2OVBA 1M6VB 2J33A 2OFPA 2YOGA 4OJYA 5CDUA 4IIYA 1ZESA 3RIMA 4QUBA 3KL2A 1NMYA 2ONKA 2OXFA 5HKKA 3Q3IA 1GZHB 3DHYA 5E9JA 4JI1B 4CMKA 5A1TA 1Y9ZA 4G89A 2WYWA 4S1TA 2DUUA 3M70A 2PRIA 4BNZA 5AVWA 3NOXA 4CTNA 3H2GA 2JD1A 3E22A 1QHHB 3LVQE 4QGFA 4KRXA 5DXJA 3RUEA 5J5AA 3TUJC 3GEDA 1SVOA 1LDYA 5EVJA 2KLBA 4IX9A 5JAOA 1Z63A 2VIIA 3UHJA 3R3HA 1PVOA 4IEEA 5M29A 5K8VA 2XUKA 5KDLA 1C9KA 1EX6A 1V5WA 2GJ9A 3JVIA 3BL5A 4EPTA 5JC1A 1HL3A 1O6CA 2QENA 1J0XO 4U6QA 4CKEB 2NW6A 3VGJA 2G06A 1RJWA 1ZNZA 3GOHA 4IUCS 3F4KA 4RV4A 3PD1A 1Y1KE 2IWHA 2H2GA 3WLTA 4CTOA 1KEEA 3VFDA 1HE1C 1YS6A 5I48A 1VM6A 1SURA 3FTCA 5C31A 2G5CA 3BIFA 2GLTA 2GZDA 3HFGA 3V33A 4DLLA 5JRDS 1UODA 3U7EB 3LFHA 4P6VF 4XEUA 1Y81A 1I5OA 4YCJA 5IAGA 3BXGA 3RSSA 1DIGA 5CB4A 5AW3A 3FH0A 2VOEA 2WJPA 2BISA 3UK0A 3PX3A 2OV1A 3UK2A 4KPYA 1U9IA 3FRHA 2L2QA 5A3SA 2HTFA 4P4TA 2XTMA 5K3EA 2NZXA 4GOJA 5AD1A 3G0DA 4MWDA 1TJ3A 3LXUX 4EQ6B 4YB8A 2I3AA 4QVGA 4RH1A 2O3QA 1YZVA 2R6ZA 3N2KB 4AN4A 3JAWA 2R4UA 3UHAA 4C3VA 9LDBA 3B6EA 1ODSA 4EPRA 4ZANA 1MZPA 2BUBA 4PWZA 1CFZA 3D7NA 4OHRA 3A31A 4Y1EA 1PJRA 5EESA 2OXTA 3OQHA 3UB4A 4OXKA 3L77A 1E2EA 3DOIA 3ZKWB 5J4YA 1L7MA