2PMKA

Crystal structures of an isolated abc-atpase in complex with tnp-adp
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
243
structure length
243
Chain Sequence
HHDITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKIVEQGKHKELLSEPESLYSYLYQLQSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Water-mediated protein-fluorophore interactions modulate the affinity of an ABC-ATPase/TNP-ADP complex
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Alpha-hemolysin translocation ATP-binding protein hlyB
total genus 73
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2pmkA00
3QEOA 3VTKA 3LBIA 1KDTA 3VU9B 4D80A 1A82A 4U02A 1BOFA 2J3EA 3NBXX 4B74A 1GITA 2F1HA 4US0R 4A8JC 3REGA 4M1YA 3OIVA 4MDFA 2IEZA 1N2CE 2C04A 3AP1A 5JLJA 3P4YA 2GVDC 1S0UA 4U5XA 1RZ3A 1HH4A 2CLDX 5AJYA 3WXMA 4B6FA 4RZUA 4KSCA 4QM6A 3ZIAA 3OAAA 4QBGB 1AN0A 2VPPA 4TMXA 5HR5A 2XSZA 1VYVA 3HWSA 4WZ6A 3DZDA 3ZH9B 2W2XA 4QM7A 3L0PA 2GJ9A 3SEAA 3UWKA 4XTRA 4ARZA 1GKYA 4IXMA 4LHXA 1G6HA 4LJ4A 3K9HA 1AM4D 4Q1EA 5TDHA 4Q47A 1S1MA 1KI1A 2ERYA 1OXVA 1ZNWA 2O8FA 1CR1A 3X1ZA 5HTKA 1AGRA 1A5TA 5FUWA 1EFRA 2QI9C 3QNUA 4HZUA 3Q9LA 1P61B 4IRUB 4FMCB 5JSZA 1U2RA 5FL7D 4P4SB 1KJYA 1RPZA 5L3RA 3ZZTA 1G3QA 3FB4A 2G88A 1VCNA 3K53A 4KODA 2ZYVX 3SDZA 4JJZA 3NBZC 1O87A 1XB2A 3FMFA 4CZ2A 1SVOA 3HJNA 3GFTA 3HYRA 4RVCA 4XH9B 4IOJA 3SBEA 2F9LA 3CM0A 4C3ZA 1XJQA 3UMSA 3CRW1 1ZU5A 3DL0A 2GCPA 2PJRA 1ZNZA 1YR7A 2ZJ8A 4FCTA 4IEIA 3ZS8A 3L8YA 5TXGA 1W0JD 3I62A 1GL7A 4ON9A 2F43A 1P2TA 3I32A 4EPVA 2QRZA 4IVPA 4JLJA 4NYIR 1XU4A 3I4LA 1R0XA 1IXRC 2WSSD 2JA1A 2XGJA 1YU9A 2Z0MA 5LB4A 4C2UA 4DLSA 1W4BA 2NOAA 4QG7A 4CVNA 2FGJA 4A15A 2UVQA 2VH5R 4LJ6A 1W1WA 4M53A 1ANKA 2OM2A 2W58A 3WYGA 4E09A 4XTCS 4ZDKA 3RWMB 5F9HA 1MO5A 1NY5A 1TPZA 4M9QA 4CGZA 2XOKA 1ZYUA 3THYB 1KZGB 4B6EA 1OPXA 1JB1A 2VSOA 5AUPB 2RAPA 3AVVA 4O0MA 3LLMA 1IOZA 1XJCA 2HXYA 1IQPA 1N25A 2ZE5A 1KSJA 5FBLB 1I4DD 3ND9A 4P31A 3U3RA 1G3IA 4QJ5A 5AJWA 1DVRA 121PA 1VG8A 3LW8A 1W5SA 1OV4A 2QT0A 3TVTA 1OYYA 1NVVR 4PQYA 3V00A 4B35A 2EFDB 2WPDA 1P9WA 4TQ9A 4CEJA 2IT1A 3NEYA 3VR5A 4CRWB 4L9SA 1Z22A 1SQ5A 3CKLA 4OBEA 4Q19A 3AF4A 4D81A 1KO4A 1QG4A 2QAGB 4LCBA 3WBKA 1QHHB 5CLQA 3DDCA 1XD2B 2DFLA 4PC7A 2AR7A 1IONA 4PXAA 1SXJE 1E9DA 2GCOB 1R8QA 1P3JA 1HEIA 4GNKA 1NF3A 1P9RA 2FN4A 4Q4AB 4F91B 1G8YA 4OI2A 1Q1BA 3QKRB 1T9HA 4I1UA 1OB5A 2WAXA 4OQLA 1OE0A 1ZC4A 1KK1A 2D62A 4GOKA 4LYJA 4RSGA 2ZSDA 2P6RA 3QF7A 3K70C 1W0KD 1PLKA 1AS2A 1HURA 1TU4A 3IEUA 4FXPA 5DGXA 4WZAE 2CCJA 3JVVA 2VP4A 1W5TA 2CK3A 3AP2A 4HDOB 1E79A 2ZJBA 2YYZA 3AGPA 2ZI5A 1RC8A 1K5GA 1KI7A 4CT4B 1II9A 1NN3A 1TU3A 2IUSA 5FL7A 1FX0B 4GOJA 3GLFE 2ZR0A 2AD5A 1S8FA 3B5JA 3GLFB 2DYKA 2QMUA 3ASZA 4EPYA 3A58B 1IN7A 4Q18A 4EPWA 1EGAA 1JJ7A 2ZXUA 5DLQC 2B21A 3IHLA 3AVYA 4P33A 1US8B 1Z07A 2B6HA 5B58C 5KO2A 4CF7A 2D06A 4OL0A 2H92A 4M21A 2J7KA 1EFRD 2ZUCA 3TMKA 3RLFA 3BORA 3NC0C 4LK2A 1JXOA 2WJVA 3PCRB 1MO6A 2PX3A 3D31A 3VKGA 4OYHA 2OCAA 3SE0A 2VF8A 4FMDB 2OBMA 2G9NA 4N1AA 4PZYA 4G5SA 1E79D 3T1VA 3B1YA 2VRWA 4TZ0A 1EFHA 4LOAA 1UM8A 2IYXA 2O0HA 4H1UA 3CR7A 3CZQA 5C1BA 3AEZA 3FMOB 4E5UA 3AGQA 2CMKA 2V6JA 1Z0KA 3L2OB 3TSWA 1I4TD 1T0JB 1F2UA 2V1UA 1W0KA 2QM8A 4Q7KA 2OE2A 5JJKA 3KKPA 4NL4H 3ZS9A 3AM1A 1N5IA 1N5LA 1OJLA 2YOGA 3P26A 5JEEA 2ZSFA 3FVQA 4Q03A 4R7ZA 1AZSC 4HYYA 2HCBA 5JI3E 1S9DA 3LLUA 3MWKA 2KBEA 3W3AA 4M9SA 2ZRKA 1GKIA 4IVQA 4HUTA 1JR6A 3LO5A 3DO6A 1GDDA 2V4ZA 2BMFA 3LW7A 4BFWA 1ZBDA 4AD8A 2QA5A 2F3TA 3CW2A 4JSYA 4YMSA 3L0IB 3KKNA 3BFXA 3U3MA 5JMTA 2QGNA 4TMTA 4DCNA 1ZM3A 4DLWA 1G8GA 2YWEA 3FKQA 3SJAA 1XD8A 2ORVA 5L3SA 2ZAMA 3P27A 4A8JB 5E95A 2A5JA 4OI0A 1G18A 2IUUA 4NYMR 1ZMXA 3T1QA 4NP6A 3H0KA 2VL7A 3KKMA 4TTRA 3EPKA 4CEIA 2CLCX 4FCWA 4JLOA 1VCMA 2W6JD 1ZNYA 1F60A 4AG6A 4M2LA 2FG5A 4JJKA 1UDWA 2B7CA 3QPVA 4GMXA 2ZRGA 3OIYA 4WW0A 1E98A 2GK6A 1S96A 4PQFA 4ZV4A 3KKQA 4HLCA 3FMPB 1NG9A 2YWGA 1XRJA 3NKVA 1UBEA 2ZI3A 4UNQA 2Z5FA 4NYIQ 5CK5A 3TLXA 3NDBB 1KNXA 1NRJB 1PLLA 4EJSC 2CL7X 1XDBA 2I1QA 4YMVA 4D26A 3QI2A 1U0JA 4DSUA 2C2HA 2H7VA 4TLEA 4YMUA 4L4UA 4Z1MA 2QY9A 3OZXA 4RD2A 4JLBA 1NL3A 5EZ5A 3I61A 3DKVA 1X1RA 4N0DA 2WWWA 2CHGA 4DEYA 3GFPA 4RKFA 5E7MA 4C7OA 1HE1C 1G7CA 4PO9A 1TMKA 3TRFA 4RCZA 2NZJA 4ZDWA 2ZU6A 4OQNA 2RMKA 5TMPA 1HA3A 1AS3A 4ITRC 3BJIC 3PUXA 2QL6A 4MYTA 2PEYA 3N70A 4ZI3A 2JLXA 1D9XA 5DN6D 4A6XA 4HAZA 4ARZB 1CR4A 1KSHA 1AKEA 4UNRA 5K8TA 2KI5A 3A8TA 2P6NA 2VP6A 4W5WA 3GLIB 3LWNA 3BE4A 5FI0B 1HUQA 3W5JA 1NP6A 2GJSA 3M0EA 2Q21A 5CM9C 2VQSA 3R9WA 5C4MA 3IPXA 3TNFA 1E9AA 2LKDA 2GZHA 2PT5A 2UKDA 1NKTA 4XSGA 3TSZA 3GP8A 1R5BA 4V0NA 4DLXA 1AJEA 4PC1A 4AIIA 3U4QB 2JJ1D 2CCKA 1WDTA 1KMQA 2VP0A 1NVWQ 3C14C 4URUR 1W7AA 1E2FA 3EX7C 2XJ4A 3L8ZA 1VG9B 2B8WA 2MMGA 4Q4LA 2O8CA 2BBWA 1YZKA 3K0FA 4M1WA 1JECA 4FN5A 1DEKA 1XZPA 4B75A 4QNRA 3VR6A 1W36B 1FW6A 2D7DA 2ZJYA 3U7HB 4G0NA 1U90A 4XWOA 1XBTA 3B82A 1UEIA 4KLZA 2WWHA 2JLYA 5A5GA 4MGIR 2EYQA 1OXUA 2HYIC 3B13B 2PBRA 4BPBA 1FMLA 2JAQA 4MRVA 4DCVA 1TAGA 1J7KA 3A1TA 5D3MB 3OESA 2BHRA 3QY0A 4FW9A 3CLVA 5K8IA 1K8RA 1OXTA 2OESA 2QPTA 1DADA 2CJWB 5EP1A 4TQAA 3BB3A 2E1RA 5UKDA 1XEWY 3VQTA 3F3YA 5L3VA 1KOFA 4JLKA 1VHTA 4TWZA 2QN6A 4DDWA 1KGDA 221PA 4JL6A 1H8HA 3A1UA 1U8ZA 1EXMA 2ERXA 3EIHA 3AVPA 4XWAA 3Q7PA 4I4LA 2GCNA 4M0LA 4LJ5A 3EIEA 2QE7A 1ONBA 1VCIA 2P65A 1QHNA 5IF9A 2R6FA 3EASA 3C4JA 5IK2D 1MR3F 3WMFA 4ACAA 2GJAA 4JKIA 1XNJA 3PQCA 2IYWA 4GOXA 1NLFA 4EPTA 2EVWX 1E99A 2QZ4A 2OO7A 4WIAA 1CJVC 1HYQA 1C4OA 4QJ3A 2J59A 4QGHA 5J4HA 4HATA 2XOKD 1U94A 4IFEA 3T1TA 3SOPA 3SFVA 1XEFA 3SU8A 1UBGA 1E32A 2ZUBA 4CEHB 3FPAA 3W9YA 1WF3A 1MKYA 4YLGA 2IYQA 4JL5A 3GJ6A 4A82A 3HR8A 1J8YF 1P60A 1R5NA 4LSGA 3ZDQA 1LTQA 3GLGE 4JVLA 3AP3A 1WQ1R 1G3UA 4US1R 3AUYA 5EQTA 4BWYA 3QVVA 5ELXA 1G17A 5H8WA 3SHWA 3EAQA 2YVUA 3PUYA 4RCYA 2W83A 1SXJD 4W9MC 3GPLA 4AKIA 4F7WA 3EPJA 4HUQA 2VP2A 2YOFA 2HT6A 4Y0VA 5FUVA 5KSZA 4D0GA 2GJ8A 1E2NA 3QXCA 4RD0A 1KK2A 3WMGA 3TQCA 4RFSA 3KQKA 4UXHA 2HF9A 2CHVA 1X8KA 3BH0A 4ZCMA 3EA0A 1NMXA 4NYMQ 3ZVNA 1H8HD 3PV0A 4L8GA 3FDIA 5G3YA 3VR3A 2X77A 4LPKA 5LBIA 4D0NA 4KYIB 4BFYA 2XAUA 4ZPXA 1NBME 2IS4A 1E2EA 1CTQA 4D82A 1QZXA 1T5IA 4PPQA 2ZVQX 3L0SA 3Q72A 4KFRA 2BKEA 1MABA 3ADCA 2A78A 2HEIA 2BBSA 1EESA 5J40A 2P5TB 3ND8A 2YZ2A 4LC1A 4CW7A 3IEVA 1ZU4A 3TH5A 4QKQA 2P0EA 1YQTA 3B60A 1IJEA 5J4YA 2OLJA 4PHHA 1NJGA 3SS8A 2JJ1A 1NN0A 3MCAA 1G19A 1KDOA 2OUKA 2OCBA 3C41J 3SJCA 3GLHA 4F38A 5JWRA 3K70B 1T8UA 4KJZA 4HB3A 2V55B 3B2EA 3DM9B 1VPLA 4LGMA 1KI6B 3CWZA 2HJGA 2REOA 3GLGB 3QXHA 3DEFA 4FCVA 4V0MA 4JT2A 3X1WA 2FZLA 4TL7A 4AYTA 5KU1A 3AF3A 1SVSA 2R6DA 5BYKA 4PTLA 2W2TA 1FTNA 1J99A 2IYYA 4EDHA 4CEIB 1JQJC 4I1SA 2VEDA 1Q1QA 3W34A 2ZJ5A 3K09C 4A9AA 4D0LB 1KDPA 1M1YE 2A5GA 1QHSA 4DDVA 4TLAA 4NE2A 2QAGC 3IIMA 4JT4A 2OSBA 4EIWA 2I1VB 3HU3A 5FFMA 1N6KA 4U7DA 4HAXA 2B8TA 1W0JA 2R62A 1UKVY 2ZS9A 3RRYA 5E7JA 5FOVA 5IK2A 4PSKA 4YMTA 1SVWA 5DSZA 2FV8A 4V0LA 1TF2A 4EKDA 3FMIA 5B64A 4LV6A 2IHBA 4UNNA 2EFEB 3PFIA 2LKCA 2Z4SA 4MKIA 1UEJA 4PAQA 4BFZA 4J0QA 2WBLC 3KQHA 1VTKA 3EZ2A 5H1YA 5L3SB 1IM2A 3C16C 1G6OA 2ZRAA 3TUIC 4TSFD 1R5OA 4AG5A 4GSYA 4NTZA 4N0EA 1SXJA 2XB2A 3QBTA 2Q3HA 2OCYC 3MJRA 4Y0AA 1YR8A 1AA9A 3EZFA 2QNRA 4JYBA 4NPHA 1QF9A 3LVRE 4KVAA 4M1SA 2CCGA 2WPDD 1IHUA 2GA8A 3A4LA 2D2EA 4PANA 2FA9A 4IJMA 1EK0A 1EWRA 3FYHA 5KNBA 2JLZA 5FPKA 1ZIOA 2ZYUX 1CRQA 3NXSA 1A7JA 4PZZA 4QRHA 3MAAC 2K5UA 3K0CC 4US2R 3WYFA 2FE4A 2PLFA 1N6RA 1N0UA 3MGCA 3KUCA 3HPRA 1OW3B 4XVQA 4Q4AA 4D4LA 2GRJA 3KXLA 3DOEA 2Q3FA 1BKDR 2JIZA 4DVGA 1GUAA 1XTKA 1TUEA 2NO7A 1TQ4A 2EQBA 3LQRA 2OEPA 4LBVA 3GLFA 5JEDA 2O0KA 3UATA 1DARA 2IUTA 2ZETA 3NVAA 4NDZA 2R6CA 3ASYA 1OKKA 3UG7A 5HZHA 3WRXC 4BZQA 2ASEA 4UNSA 1UBFA 4C7OB 3UG6A 4OHXA 2KBFA 4MRPA 3L82B 1KKLA 5DI3B 4BRWA 1TADA 1P7CA 4TN1A 1GRNA 2JASA 2IW3A 4DLYA 2C8VA 2P2LA 3C5CA 1XTSA 2ZRFA 1Q22A 2DHRA 1U98A 1GNPA 2R6GA 1E0KA 4OJKA 1F5NA 2P3SA 2IHYA 2QP9X 2IS1A 1E2IA 4JVNA 3FWYA 1JPNA 1DAMA 5K8UA 2CNWA 5J5CA 1KIMA 3MUFA 3IGFA 5IDVA 4EUNA 4LZZA 2ZUDA 2EFCB 4A2PA 2YWHA 2VHJA 6Q21A 1Z2AA 1HT2E 4B47A 1E2QA 2A5DA 1D2MA 1ZP6A 2Q3MA 3OAAD 1ZUIA 4MYUA 3UMRA 4XJXA 2HDNB 1COWD 1JAHA 4R9UC 1Z8FA 2VF7A 4I99A 3VKWA 4NZYA 5TV2A 4M1MA 3LH5A 4TL6A 4XOIA 3VX3A 1JBKA 1NVUQ 2AK3A 3E1SA 4IFBA 4M4SA 3SZRA 4A0FA 2CL0X 4RD1A 1XWIA 2QBYA 2ZRLA 4F4JA 4PQRA 1OF1A 1PUJA 1D5CA 4URWR 3IHWA 3F8TA 1SKYB 1S2MA 1BS1A 2DBYA 4H9GA 4XSHA 3TK1A 1M34E 2YKGA 1E9CA 4NBSA 4KXFB 5AUQA 1OKKD 1J8MF 1X3SA 3QJYA 5GJBA 2VP9A 1OLOA 1JEDA 4V03A 4B76A 2WTUA 3X1YA 3SQWA 2BBOA 3PEYA 1VHLA 4Q4HB 3RVBA 1T4GA 2UZ3A 4ACBA 3MJHA 3MWJA 1G3MA 3U3JA 3DZ8A 2CVHA 2R44A 3SYKA 4S2EA 5BYJA 3VR2A 4LV5B 3CRVA 3DKPA 3PUZA 3TE6A 4ESVA 4C0JA 2ANBA 2W0SA 1CP2A 2ZE7A 1LW7A 2Y8EA 2A5FA 4D4MA 1E2KA 4OI1A 1QHIA 1KI6A 1OFUX 2C78A 3LXRA 1OH8A 4V0OA 3EA5A 2ONJA 1E2HA 4TMVA 3THYA 4NCJA 3T15A 4WAUA 1NNEA 2ZQ5A 4PR0A 2VTKA 4Z54A 3NG1A 4ZIRB 1XMSA 3IILA 2WOJA 3EC1A 5JCPA 3KXKA 4JYCA 621PA 4HAUA 1MT0A 2V54A 5TB5A 5KPJA 1SHKA 1M7GA 3TGPA 2ZITA 5J4LA 1XP8A 2E87A 2WSMA 5F9FA 2J0UA 3NBYC 1YKSA 5FOUA 1N6OA 1CF4A 3FKSA 3TJZA 4DUGA 1R8SA 3MWYW 4BQSA 3GJ5A 4X8MA 1KO8A 3SYNA 2O8FB 1DS6A 1L8QA 4RZ3A 3MD0A 4IOLA 1Z0JA 4TTPA 2XXAB 4G5OA 3AVOA 4PC6A 1P6XA 4YXWA 3VHXA 3WNDA 5GJWC 4KV9A 3RS3A 2ORWA 3KJIA 2V7QA 4B43A 2GCOA 2GEUA 2ZI9A 2Z4RA 4TLBA 1XEXB 3GMTA 4C4PA 1KZ7B 1U9IA 3KQNA 3GFOA 4X8LA 5A4JA 2ZSBA 2GETA 2C99A 3QSYA 1U81A 2QSZA 1GNQA 3R20A 2GBLA 1R0WA 2BV3A 3A4NA 4TLDA 4B33A 4EAQA 4D25A 2DCUA 5JRJA 2RGAA 3OE7A 1UFQA 3AUXA 4XVUA 3KFXA 1FMJA 5KDOA 3GD7A 4MH0R 2FSGA 1KDRA 4B73A 3MSXA 1LB1B 3EARA 4ESHA 4B3GA 1D2NA 3M1IA 5FOWA 1G5TA 1XCPA 2C9OA 2QM7A 1T8TA 2C9CA 3R8FA 3HYTA 2MSEB 2ZRNA 1XMJA 1JXMA 3EWSA 4XWKA 1SXJB 3OFNA 1QHYA 2FPLA 4M1OA 1COWA 1YZQA 2H5EA 1XTQA 3BAFA 1W44A 3B9PA 4HLQB 5F98A 4BLRA 3UANA 2X19A 1A2KC 1FZQA 4DUGD 3UPUA 1E9BA 1GIAA 2R8RA 2NPIA 1KI3A 2IYSA 2FEMA 2YINC 3DHWC 4QBIA 2A3RA 2WV9A 1KNQA 3RWOA 3T5GA 1E2MA 2QTFA 1V5WA 2CLSA 5DIFA 4ZDJA 2XITA 3U60B 3AVWA 5BXQC 5B2ZA 1RRCA 5BWMA 1Q20A 3LX5A 2KE5A 1JR3D 4ZKEA 1KK3A 4BLTA 3TAHA 4YDSA 2G6BA 1FPMA 5GADl 3U4QA 2VLIA 3RC3A 3VFDA 2C9YA 1F3OA 2JDID 2OBNA 4R71A 3Q5EA 3ZZ0A 1EG7A 3KDSE 1QHXA 2J45A 5SZHB 3W3ZB 3PUVA 1CJTC 1IAQA 3H86A 1AK2A 1Q12A 1ZCBA 4LUCA 4MGKR 3OE7D 3LXXA 4RZXA 3K9NA 1Q3TA 1AIPA 4HAVA 2OCPA 4HLDA 3AV0B 1G3RA 1CKEA 4MKGA 2ODNA 1XCGB 1YZTA 2QRNA 1G7TA 3SNHA 2A7QA 3AQ4A 4Q9HA 4W5JA 5DI3A 3A37A 4N3NA 5EJEA 3VU9A 2KWIA 5JI2E 1OT3A 3HU2A 4JS0A 1G5RA 3CONA 1Y3AA 2J5XA 2WOOA 3AB3A 2J0VA 4MITA 2FDCA 2RGXA 5CDFE 2WICA 5CYOA 2E9SA 2V3CC 4JLAA 1E2GA 3S1AA 1OH7A 2WJYA 2BMJA 4BLQA 2QU8A 5D3QA 2V1XA 3MWLA 2W0MA 2G0TA 3THXB 4KO8A 1NJFA 4Q02A 3TIFA 5KSPA 2ODBA 1R4AA 2PX0A 1KMHA 3KZ1E 2IXGA 1SKQA 4ASUD 3BXZA 2CE2X 2IK8A 4O2RA 4IXNA 3RYTC 1M8PA 1OIVA 2W6ID 5FPYA 1KAOA 1XMIA 4TYPA 2ZEJA 2FSIA 1HQYE 1NBMA 3GJXC 2F9MA 3I5XA 4A2WA 5FI1B 1FQJA 4LBYA 1KSFX 2V8OA 2VHQA 4XIGS 3GJ4A 2IF0A 5DYIA 1MO3A 2ZRMA 3ZZUA 2RCNA 2Q9AA 1U99A 1Z06A 3K8YA 4PHTA 2GAOA 3LBHA 4DJTA 1I4LD 5JHGB 3H4MA 4WOPA 1RFLA 1F2TB 1RIFA 3L43A 1W36D 1YHNA 3H2YA 2D4HA 2ZANA 1E9SA 4URYR 3VMFA 4BASA 2NO0A 1P2UA 4OK3A 3ZLJA 1IY1A 1E1RD 1XJ0A 2H16A 4FMBB 3Q8XB 2YJTD 4UQOA 4P4TA 1E2JA 4Q1DA 2OFWA 2QGZA 2FSHA 4I1OA 1PUIA 1Z6GA 2C98A 2XTNA 3KJHA 5AWFC 2ZU0C 4QBHA 4A8JA 2IYZA 2RGNA 1E9RA 5HE8A 2AKYA 1Z0DA 2ZSAA 2H1LA 3O8RA 4JIMA 3U7GA 2D7CA 3KUDA 3KXIA 1AGPA 3GLHB 3A1WA 4G01B 5G40A 4DKXA 1FQKA 2AFIE 3N2IA 2JLQA 2ZJOA 1Z3IX 3GQBA 2HUPA 4BFTA 5FBWB 1PLJA 1T3SA 3QKTA 5AK0A 2QT1A 2C96A 1BYIA 3K0FB 4KFUA 4KVGA 3Q7QA 3ADKA 2WWGA 4JKYA 3MRSA 5KSOA 4QL3A 4LV8B 2XNDD 1AKYA 1P75A 1XFAA 4JLVA 3IKJA 3NTUA 2PL3A 4MUBA 1T3HA 1SVKA 2R2AA 4MA4A 1DG3A 4NKRA 4HB4A 4Z8XA 5KHOC 1MO4A 1PJRA 2GXQA 1SGWA 1FP6A 1V43A 4AK9A 3KFVA 4DLTA 2PCLA 4GP6A 4OHZA 2I3BA 4LYFA 4LYAA 2PMDA 2JJ8A 1D8TA 1Z28A 1E1RA 4DIDA 1TUIA 2SHKA 2BWJA 2XTMA 4B48A 5K8LA 2D2FA 4HB0A 5EZ6B 3SBDA 3VNUA 1XEWX 4DEXA 5DISB 1TQ2A 2G77B 5DI9A 2QTVB 3A6PC 3LX8A 4OHYA 2XZLA 1W48A 2J7PD 4Q21A 1G16A 5HE9A 1Z0FA 721PA 1GKUB 2XZOA 4LJAA 5J4KA 1IXSB 5C18A 3F0TA 4UJ5A 1A2BA 3TR5A 1YRBA 4X8OA 3C15C 3Q85A 2TMKA 5JBQA 1QVRA 4NCNA 2GESA 2YOHA 3IBGA 4OHWA 1NBMD 1NIPA 3T1OA 3AF2A 2ZM5A 2JLUA 3HR7A 4RFVA 3RS5A 2AKAB 2R6AA 3K9LA 1NY6A 5FOSA 1P5ZB 4P32A 1DAKA 1JALA 2WIAA 3FHCB 1G20E 3ZVMA 4KBFA 4Q1CA 2RGGA 4C0SA 2ZRCA 4PPGA 2IYLD 4B34A 5B57C 2IL1A 1N6PA 1E96A 1DAFA 2XNSA 2BOVA 3GEIA 2YNMA 4JL8A 1YR6A 4K81B 1CR2A 2A5YB 1Q21A 1ZM2A 4RD6A 1M7BA 3TUJC 2AHOA 3T35A 4Q66C 1JEEA 2XZPA 1NG1A 4OK5A 1RRFA 2F7SA 1J90A 1BIFA 2ZYWX 1G41A 1X1SA 4LJ7A 5AJVB 3G5UA 1QG2A 4FD2A 1IY0A 1W4RA 4MRRA 4R2HA 1Z0AA 1ZVQA 2CK3D 5FTKA 1E9EA 1OXSC 4HLUC 2N46A 3ONWA 4HUQB 4PAOA 2I4IA 2GF0A 2QROA 1K6MA 2BJWA 1FL9A 1PZNA 2J1LA 4MYCA 4S35A 1R7RA 2ZPTX 4EPXA 4A4DA 4KFSA 4RD4A 1KO7A 1NSFA 3QKSA 3QXXA 4ZKDA 5BW8A 4CEJB 2JGNA 4MRNA 4WBSA 3W90A 2XEXA 1ZD9A 2JJ2A 1TNDA 2ODEA 3TUZC 1R2QA 4Q01A 1TF7A 2IA5A 1UF9A 1BO6A 2QP3A 3U7EB 2Q0HA 3W8RA 4DBLC 2RHMA 4EFNA 5BN4A 1P9NA 4GI7A 4IDPA 4TTQA 2V6IA 5TVKA 4A0HA 2OAQ1 2G1KA 1E2PA 2BMDA 3QKSB 1XXHB 1N0WA 3PIRA 1X8JA 8OHMA 4IOMA 1DO2A 1IN6A 2ZRIA 1X6VA 2IEYA 2ZR7A 2FPMA 1BMFD 1G64A 3I8SA 3O8DA 1EFUA 2VBCA 3CBQA 1M2OB 2DB3A 5FTMA 2WJGA 4L5BA 4MGZR 2AD1A 2R9VA 3KTAA 3B1XA 4RY2A 4DDTA 1YRAA 1G21E 5CIQA 4D4KA 1DE0A 2ZRDA 4DSTA 4EJSA 5CB8A 5HPYB 5JZVA 2J0QA 5FH9A 5FOXA 2ANCA 4QXAA 1Z5ZA 1IN4A 1UJ2A 2ECKA 1Z2CA 4C0KA 3LNCA 4GZLA 3UWOA 2WJIA 3CNOA 1E0AA 2FX3A 2PEZA 1GL9B 3VX4A 3CNLA 4QHYA 2VO1A 3CH5A 4QGGA 1LS6A 4C0AC 1Q57A 1KSGA 2EWWA 4UXJA 1W36C 1ZIPA 3SC3A 1HTWA 4PPFA 5H70A 5CB6A 2QBYB 4F93B 2WWYA 2PH1A 2H17A 2BDTA 2ATXA 2AK2A 5HKKA 3A1VA 1CXZA 3QBVA 2OFOA 1C9KA 2XTZA 5G53C 1M7HA 4JLDA 3QPWA 3ICQB 2J0UB 1W47A 5DH9A 3WRYC 2F1JA 1XD9A 4LBZA 3NWJA 1G1MA 3KJEA 5IHPA 1S4QA 1GAJA 4Q9JA 1Z6XA 2CHQA 4DLUA 2JCSA 4JLMA 2JLRA 1KMHB 4C30A 2FFAA 1W2GA 821PA 3KQLA 3OHMA 4BUJA 3FOZA 1A1VA 5AR1A 3PEUA 4O3MA 2ZYTX 1AZTA 2ZIAA 4IHQA 3THXA 3EWAA 4QGFA 3NH6A 3OEEA 1RRGA 4B2PA 1XD2A 1CLUA 2OXCA 1AQUA 3BH6A 5EXTA 3EPHA 2WKRA 2QEQA 2NO9A 3W8NA 4QNMA 2GTPA 2HYDA 4DIEA 1IBRA 2IF2A 3BERA 3CWQA 5EE1A 1E0SA 4K8OA 1YR9A 2AXNA 5FR2A 2HF8A 3GJ3A 4EJSB 3NH9A 1G8FA 1WXQA 1E4YA 3T06B 5CJPA 1DG1G 4B2IA 5KUTA 2YWFA 1SHZA 3AH8A 4TSFA 1XPRA 3EZ6A 2OFXA 1GILA 1FNMA 2FJUA 3KX2A 4LHZA 3WP1B 5AUOB 5C2JB 2QP4A 1Z83A 1GL6A 2PZFA 2BC9A 4WVFA 1L4UA 2H57A 1LS1A 2ZRPA 4JSTA 1Q0UA 2NTYC 3IQWA 2WMNB 3LFUA 3MLEA 2GBLC 3FTQA 5HKKD 2ZRHA 3K09A 4GPTA 1ZCAA 2NG1A 5DN6A 3B9QA 1GRRA 4PSAA 3RRZA 5EE3A 4DLVA 1QBKC 3CF2A 3THOA 4YDHB 4C0QC 3BB4A 4LY6A 1NMYA 3BOSA 4YONB 2CDNA 4NCKA 2RB4A 3I72A 4QFMA 3U6KA 3O8CA 1BH2A 2BBTA 2CVFA 1UADA 4DB2A 1IN8A 3HU1A 4KYUA 1EX6A 1ZRHA 3DM5A 3Q3JB 4QBFA 5IT5A 3U6BA 3A4MA 3ADBA 2GXAA 2ONKA 4TYWA 2ORIA 2WWXA 3DVLA 3GCGA 3RSLA 4PHGA 4PPNA 3THWA 2F43B 3X2SA 3QKUA 3AKCA 3RS7A 4UXIA 4BZPA 1U9IC 1KO5A 2DFKB 3ZGXA 1CR0A 4QHSA 3BFKA 4A2QA 4HZIA 4KSBA 1RYHA 2RGDA 4Q1FA 4EQ6B 2GHIA 1VECA 1RJ9B 2G1JA 3E5HA 3QENA 3W6OA 5E3HA 1JJVA 3J81k 1G4UR 2HLDD 3EZ7A 2PJZA 2Z6VA 2GZDA 1EWQA 2O8CB 2BVNA 5JS8A 2O8DB 1TQDA 3LD9A 4AYXA 5JS7A 2ZTSA 3ZVLA 2BM0A 1N6HA 3ZQJA 4YQFA 4HAYA 4TMZA 2JLVA 1ZAKA 3UXMA 4DCSA 1LNZA 4UJ3A 5FL3A 1NVXQ 1J2JA 4ZCLA 3FFAA 4IDOA 1TTTA 4L16A 3O47A 1HV8A 4LBWA 2WSSA 2Q6TA 5DO9A 3SN6A 4BFXA 3TBKA 2QSYA 3GLIA 2IS2A 4B2LA 4PSVA 2X1VA 2MSDB 2VHUA 1VCOA 3UK6A 3EIQA 4GRAA 5CYPA 5JRZA 5SZJA 4ABYA 1XMVA 3CF6R 1S9HA 4KI0A 3QIAA 4JBWA 1YZLA 3K9GA 1K5DA 1L4YA 3HP1A 2HCJB 2DWOA 1ZJ6A 4JVMA 1IN5A 2OILA 2ATVA 2IWRA 3ETLA 2OV2A 1CBUA 1NI3A 1W4CA 2P6UA 4BFSA 3W6NA 5FR1A 2PCJA 2ZREA 4A36A 3AVUA 1LFDB 1X86B 2GKSA 3IDQA 3R9XA 4O25A 5HCNA 3TAUA 3BK7A 4LPSA 1CU1A 5CM8B 4DXAA 1O3YA 2G3YA 4F4IA 3QPUA 2EWVA 4TT3A 4UNPA 1P4SA 1TL7C 2BEJA 4Q9KA 2YHSA 4BEBA 2OXRA 4ZIRA 4AY2A 2CEAA 5EP3A 1JQLB 4BLOA 3K1JA 4ASUA 2AWOA 4JBYA 1JPJA 4M22A 4PZLA 2VHTA 2CNWD 2QUZA 3JZMA 4URZR 3NIBA 3LVQE 4PHFA 3LRPA 2WKQA 3TVDA 4C0HA 2XX3A 5HZKA 5GJVC 2XJ9A 4M1KA 2BKUA 4GDFA 2ZRBA 1VIYA 2VSFA 1TQ6A 2NZ8A 3OIUA 3NC1C 4DC9A 3IO5A 3BS4A 3U5ZB 5F3WB 1WP9A 4C9BA 5KSYA 1FUUA 3P32A 2CJWA 4MRSA 5FPTA 3R8CA 5F2EA 4JBXA 1T91A 3GLHE 3CH4B 1M6NA 3VKHA 1E9FA 1G8HA 2PZGA 1H65A 4AKEA 4QGAA 4DWJA 3ZD6A 1GWNA 3DOFA 3AVXA 1ZUHA 2OZEA 4FWIB 3VHLB 2RHDA 1E0JA 3RS4A 4BFUA 2GJKA 2V7QD 1Q1EA 1NVVQ 1D9ZA 4ERNA 1DAHA 1I2MA 5LPNA 4CEHA 1DELA 4RD3A 3QXSA 1JNYA 2FGKA 4DSNA 3B1ZA 1E2DA 1QDEA 1W2HA 2ZJ2A 4OJQA 3VR4A 1CRPA 1OH6A 1SVIA 4D4JA 4G5GA 1H8EA 2QMOA 1F2UB 4M8NE 1C1YA 3D8BA 5KDLA 4M9ZA 4ZO4A 1S1CA 4G3XA 2ZE6A 3T12A 1N3BA 1R0ZA 3T34A 4TMKA 2XSZD 1F6BA 4BLPA 3GLIE 2L0XA 3KJGA 1XPOA 1AS0A 4I81A 3DPUA 3B78A 2X2EA 3Q5DA 1ETUA 2GEDA 2WWFA 3CIOA 4KLNA 1N6IA 1BMFA 1W46A 4R98A 4Q9LA 5EXSA 1GZSA 4CIDA 1UPTA 2C03A 4HDQB 5KNDA 3RNLA 3SR0A 4TYNA 1SULA 1XTRA 4TL8A 1LY1A 1I2DA 3A1SA 3D3QA 4LRWA 4BEJA 3M6AA 3UMFA 3T5DA 4BLSA 2WKPA 4Q7LA 1U8YA 4TZ6A 5KTYA 2ZJZA 3FFBA 4K46A 1FP7A 5EP4A 3RHFA 2J41A 3CX7A 5C46F 4KU4A 5JJLA 1RVDA 1RKBA 3RRMA 1P73A 2D74A 1GP2A 1N0VC 3CNNA 1ZINA 4KITB 4Q00A 2LWIA 2DR3A 3WY9A 1B23P 2WWIA 1VG1A 1UKYA 3K0SA 3BB1A 4OKSA 1MABB 1KJWA 1N6NA 3P4XA 2FFQA 4BGDA 4UKDA 3I73A 5EE0A 3SI7A 1VYTA 1OIXA 3BRWD 3WHLA 1HY3A 1DAEA 521PA 5FBVB 1E3MA 2DFNA 3BIFA 2FOLA 4Q1AA 2IBMA 1G8PA 1ZM9A 3RANA 1YVDA 2MMCA 4PFSA 3SJZA 3LBNA 1M74A 1GM5A 2MSCB 2JEOA 3B7GA 1AQYA 3CRMA 1VIAA 2GAAA 4GBMA 4A1FA 2FSFA 3QQ5A 1NN1A 4Q4HA 2BEKA 4AURA 3CRRA 3U2QA 1KI4A 2V9PA 3GEEA 4LI0A 4FWTA 5FTJA 1T6NA 2D3WA 3NBFA 2BCJQ 2Q9BA 1ZM7A 1RW4A 4RKEA 421PA 1LF0A 4JZKA 1G7RA 2KSQA 4YC7A 2F55A 4MKFA 4TLCA 3VR1A 1KY2A 2FU5C 2P67A 1VDZA 3LAWA 4Q4JA 4NHOA 3GJ8A 4MQBA 3C5HA 1ODFA 5IRCD 2WMOB 1P72A 2N42A 5KNCA 4OQFA 1NLZA 2EYUA 4Z51A 4LDJA 1TEXA 3OFND 4NH0A 1E1QD 1R6BX 2ZAOA 3ZYCA 2J9RA 3K0AB 3OIWA 5L3QB 2W6IA 4BE7B 4CT5A 2BJVA 3LA6A 3PVSA 4ZI2A 2OLKA 4FINA 3AF1A 4G5QA 4TL9A 5TARA 2HXSA 5G41A 1JR3E 3SHFA 1P2SA 4LX0A 4TYYA 3TW4A 5LB2A 3KKOA 5H68A 3V4RA 4OK6A 2AXPA 2N1BA 2PT7A 2CXXA 1NIJA 2F1IA 2WVJA 1DPFA 2GF9A 4G5RA 4MKHA 1RJ9A 1E69A 3LDAA 4LJ9A 4AI6A 3IUYA 4P3YA 4IW3B 4W5HA 3U44B 3U61B 5J4VA 1T5LA 2YC4C 2IYRA 5FUYA 3EW9A 3DMDA 2QPOA 2VSXA 3O8BA 2A30A 3RS0A 1KI2A 1TF5A 3JVUA 2IS6A 3V4FA 4KHZA 3WP0A 4NYJQ 4D2IA 1KO1A 2F3RA 4H1VA 5CIWA 3U3OA 3F5FA 4YXWD 5LD2C 3THWB 1MOZA 5C4GB 2O8BB 3QG1A 5DE3A 5CK4A 2ZI4A 2CBZA 4I1VA 2R65A 2DWQA 2G83A 2NPFA 4EFMA 1ZD1A 3AVTA 3QF4A 4G1UC 1HE8B 1OHHA 3PR1A 4FMDF 4DDUA 4M1TA 2ZROA 1JI0A 1KI8A 2RH5A 4V02A 4NCIA 1NSTA 4MUAA 1KHTA 3GJ7A 4IOKA 4URVR 2GWHA 3E2IA 2GDJA 5E4FA 3R9IA 2PMKA 3KB2A 5FTLA 5BN3A 2GZAA 1YE8A 2JLSA 2O52A 1WBDA 4GZMA 4P4SA 3RAPR 2FMXA 2W6JA 2AFHE 2REBA 5A0FA 5EUMA 3R7WA 3RS2A 3RDPA 4A6PA 3ZQ6A 1WRBA 1VYUA 5FBRB 1L7VC 3T61A 3BC1A 1IJFA 4PX9A 1DAIA 2WHXA 3W5IA 3CPEA 4B3DA 4F4CA 3CX6A 3TQFA 2Q9CA 3P1JA 1YZGA 3UIEA 4XVRA 4IDHA 1XTIA 1OYWA 4DB4A 2VP5A 4QOSA 2EFHB 2OT3B 3IIKA 2LCFA 3QKRA 4HSEA 3SYLA 4Z1MD 3RSOA 4B3CA 1OB2A 2J46A 3EC2A 1F48A 1KTVA 4ZCIA 4FIDA 1Z63A 1SXJC 2X8AA 1Z0IA 4GFDA 1Q3HA 4HLUA 2JATA 1U8AA 2GXUA 2J87A 2WJHA 4MDEA 2B7BA 4DT1B 4KAXA 4E07A 1R10A 1Z29A 4DRZA 4IEEA 2OHFA 2JDIA 1E1QA 1ESMA 5KOYA 1CIPA 1UKZA 1SVMA 4AKGA 4KCGA 1WBBA 1YZNA 2FFBA 3NHBA 1G7SA 1ZUNB 3ADDA 4F92B 3ECCA 3FKSD 3HPQA 2A9KA 3WYAA 3CRQA 4KBGA 1J70A 3NDPA 2RGEA 3QOFA 1EFTA 1JR3A 4NCHA 2OBLA 2IXFA 5G3ZA 4XD7D 2ODWA 1G291 2IWHA 2BCGY 3ICEA 5LDDC 1CEEA 4DCUA 1OFHA 2CE7A 4QHTA 1GG2A 4PO1A 1Q1ZA 3EPLA 4Q5IA 1LV7A 2AL7A 3QVUA 4TYQA 5JWOA 4IDNA 3QF4B 2QAGA 5KDDA 2F1RA 2O8EB 1W49A 2FH5B 5L8VA 1CJMA 1T3LA 3K0EA 1EFCA 4IKEA 3OEHD 2YC2C 4M9XA 5SZIA 2W2VA 4QJ4A 1UAAA 4BZXA 4B32A 2QTHA 2QAJA 4MYHA 4DCTA 1PVOA 2GXSA 4Q4JB 1NMZA 3SQXA 4EQ6A 4O2LA 5EXXA 4P0TA 4NONA 1W4AA 1OHHD 2GNOA 4B3FX 4GL2A 3LY5A 1QHHA 2WM9B 1E2LA 1SKYE 5JWHA 3UKDA 2ZI6A 1XEXA 1TEVA 4Q48A 1KAGA 3QUSA 5DNYB 1FUKA 1A4RA 3RC8A 4URXR 2J0SA 2F6RA 5FUXA 5HCIA 2BM1A 3QXJA 1L2TA 1NKSA 3EZ9A 3WMEA 4DT1A 5KYKA 2FNAA 3C8UA 4D6PA 1KJZA 4FMCF 2RGBA 1D2EA 2FEOA 2HV8A 4R2IA 4II7A 2KB0A 1N5JA 3QEJA 2WAYA 5M04A 3FHTA 2P5SA 3GEHA 3EXAA 1G5PA 1LVGA 3M4YA 1OSNA 1IXZA 2AWNA 2GVZC 4HAWA 4HI0E 4Q7JB 5JCZA 5DHFA 2HJVA 4JLPA 1MH1A 4NYJR 2O5VA 3OEHA 2REXB 5DYGA 5JSZB 2IXEA 4RZ2A 3G0HA 4Q9IA 1FFHA 3X1XA 2VA8A 4AKHA 4ILEA 2QPAA 2EFGA 1OXXK 1WB9A 4QC2A 5P21A 1SVLA 1NLYA 1UBCA 4JVSB 3IBYA 3RRNA 5CDFA 1U0LA 1E6CA 3NEJA 3WBJA 3CUEF 4OQXA 3ZJYA 3S1AB 3HDTA 4AC9A 4ZDIA 2QE7D 1TX4B 1MV5A 4XD7A 2OG2A 1RE0A 1WMSA 3C7KA 4Q7MB 5CITA 1LF5A 2C77A 1YZUA 2BIFA 2IX3A 2XXAA 3P20A 4PO8A 4WA7A 4X8HA 4BECA 5JFGA 3GJ0A 3WNCA 1GRQA 3AVQA 1GTVA 4AWXA 2C95A 3KB1A 2JLWA 5BQ5A 2AX4A 2QQ0A 2WZQA 3BH7A 3FHOA 3IIJA 2RKOA 2FZ4A 4LC0A 5JECA 2EU8A 2NQ2C 3B1VA 3BFVA 2O8DA 2DWPA 1XZQA 1QRAA 2ZS7A 1SZPA 3BWDD 3U3KA 1E4VA 2DFTA 3PJRA 4LHWA 4MGYR 4OI4A 3KQUA 3CR8A 1ZNXA 5EUQB 3I3SR 4GT1A 2ZI7A 2C5LA 4FI3C 1DAGA 3LQQA 2ZR9A 1DO0A 4PC3A 2A2ZA 1N6LA 3N2EA 1ELOA 3OEED 1ZC3A 2QMEA 3BBPA 5AJXA 4E22A 2O0JA 1XCMA 3MFYA 1VMAA 1XTJA 1CJUC 1Z08A 3AKEA 1KI9A 3CB4A 3ZVRA 5JHHB 1EX7A 4LHYA 1KKMA 2YV5A 2WIBA 5TY0A 3KTAB 3U7FB 1B0UA 5FPHA 3H84A 1U0HC 1HT1E 2G0NA 4TQUS 4GP7A 4A0GA 3PENA 2FFHA 3CPJB 1WE2A 2RGNC 4LHVA 2O8EA 5FOTA 2FF7A 1II8B 2J7PA 1Z6AA 5D3MA 3IQXA 3X1DA 5GJCA 4HEJA 3EG5A 4EFLA 2KJQA 1Z6TA 1H8ED 3E70C 2IYUA 4YMWA 3IO3A 3LV8A 4KFTA 2WJJA 3AKYA 1XXHE 4P4UA 4HZUB 1S3GA 3I1FA 2ZVPX 1GVNB 2DY1A 4CDGA 3B6EA 3PUWA 4C2TA 3JZAA 3OF5A 4W7SA 2ZS8A 3AKDA 1KY3A 3WNBA 5AJZA 2B92A 3GLGA 3AF0A 4C0LA 3RABA 2XNDA 1US8A 3N5CA 3R7WB 2ZJAA 2NO6A 3FE2A 4LJYA 4NU0A 3PEWA 1G9XA 1CJKC 4PAMA 2HLDA 3D7MA 4RJLA 1N5KA 1ZD8A 5J47A 2UZIR 3ZD7A 3PG5A 2NMVA 2FPKA 5FPSA 3CPHA 1FX0A 3H1TA 5FTNA 4EPRA 5GVSA 1T0HB 5EE9A 4LWZA 5EXPA 1OIWA 1Y63A 3G82C 4WZBE 5DHAA 1ESNA 4JLNA 3CZPA 3MG9A 3TR0A 4IVRA 3TSOA 1NN5A 5FBQB 3K70D 2BMEA 4U00A 4C0BA 5AUNB 1RYFA 2JJ2D 3TW8B 2O8BA 3KL4A 1OH5A 2Z43A 1DOAA 1GNRA 3MMPA 1GFIA 1KK0A 3PXGA 5CJ2A 3B85A 3B1WA 3I8XA 1WA5A 1BYUA 3I92A 3WHKA 4B3XA 2H8KA 4RFSB 1D6JA 2NIPA 5ANRB 4AYWA 3REFA 3K0CA 1P2VA 1R0YA 3CF0A 4Z8YA 5EE5B 4DLRA 3BD9A 2OAP1 2ZRJA 1XF9A 4PC2A 5E7IA 3V9PA 5B30A 1DBSA 1Z6YA 1FTSA 4LJ8A 1PV4A 3CX8A 2ZSEA 1CS4C 2EW1A 1Q44A 4E03A 2PLRA 3PEVA 4V0ME 4A92A 2VHCA 3L0OA 4DSOA 1II0A 1KYIA 3I5YA 2Z83A 2IYVA 4BFVA 1JAIA 2GEVA 1Z47A 3K0AA 5L3QA 1FOEB 5SZKB 3W6PA 3D6TB 3BGWA 1DTSA 3PITA 4LYHA 1GSIA 2H18A 1HQCA 1X8LA 4OQMA 4BRUA 2IYTA 2NO1A 2GK7A 2QENA 1XPUA 4TMWA 3TKLA 5CLLA 4OHVA 3CO5A 3QE0A 1G4AE 4B71A 4V0KA 4A0RA 5JJIA 3SFZA 5LD2B 2X2FA 4NMMA 3A36A 1XXHA 3NHAA 4HDCA 3VAAA 4TT3D 1FNNA 1QHGA 2QORA 2HT1A 5KPDA 2W00A 5GVRA 2ZE8A 1XX6A 2PZEA 5BN5A 5EP2A 1OFTA 1MRSA 1ZW6A 1CULC 4CYMA 3DMNA 4JMPA 2XB4A 2CL6X 4L9WA 4DLZA 2NGRA 1S3SA 4WXPA 1ZM4A 1VG0B 4B44A 3QG5A 1OFIA 1UKEA 3ZIAD 4DZZA 2QMHA 4HB2A 3U44A 3VNVA 4L15A 1F2TA 1P62B 4GMDA 1GOTA 2DPXA 4Q1BA 1E94E 1WCV1 4POAA 2VIIA 1VKJA 2QQEA 1QVAA 1UDXA 1II8A 4B3BA 1YJ5A 4IDQA 1IY2A 2GILA 1RRPA 2FWRA 2QG6A 2VYFA 4DHEA 2JIZD 2AN9A 3B8HA 3IPYA 3FGNA 4WXRA 2IC5A 1MRNA 3SJBA 2RGCA
chains in the Genus database with same CATH superfamily
5FI3A 3QEOA 1D3AA 2WF5A 5EYPB 1GPNA 2GJ4A 1VL2A 2X14A 1R4NA 3W0LB 4A8JC 2I91A 3HFSA 2J9XB 1CDDA 4K6MA 5LM3A 3OF2A 3HSKA 4YRBA 3HLKA 4BO4A 1Q1NA 4P5PA 5KMGB 1YB2A 4TTIA 1Z35A 3OUTA 5JG7A 1HH4A 2AYZA 2CLDX 3FD8A 5AJYA 2AF4C 2GK3A 4JUCA 4QM6A 3LZ6A 3CLKA 2I65A 1L4LA 1QG6A 1JA1A 4OIFA 1ONPA 1NXXA 3AY6A 3F67A 3FWHA 4INAA 5K3BA 2P8JA 2O2SA 3DZDA 1U3WA 3VYWA 2W2XA 4CIBA 4PG8A 1ZH8A 3BGDA 3L0PA 1EK2A 4R2LA 3OJFA 3EQ8A 2FRVA 2EEPA 3AR9A 2VOEA 3A9SA 3QWFA 5ITSA 3DMHA 2FZGA 4I4NA 3K9HA 4I55F 1DAOA 1H2AS 3T9BA 2B5OA 3WK4A 4TUYA 3NOOA 4YTEA 2O8FA 1ZMOA 1FSPA 3IR5A 2AC2A 5BT9A 5HTKA 1SUAA 2VDOB 3B51X 4HUJA 3WYBA 3ZE9A 1VMIA 1XZFA 2QI9C 4J94A 4RMJA 4C7KA 1MLDA 4OQPA 3Q9LA 1FFDA 5JSZA 1U2RA 4MW0A 2XLBA 4OFWA 1NKVA 5FL7D 2QTNA 1O9GA 4XCQA 2QLFA 4E4RA 1RPZA 3KOYA 3RASA 3C1OA 1G3QA 2IIQA 3FB4A 3K53A 3ZTYA 3NRJA 4CKWB 3ZKWB 3ZXYA 1O87A 1XB2A 2YUTA 2F8TA 3AB8A 1UBRS 3GFTA 3HYRA 4RVCA 2PVSA 3SBEA 1XJQA 4MJLA 5DW3A 3MUNA 1VBNA 2Z5GA 2PGOA 1ZU5A 3DL0A 1U1CA 2GCPA 3K0BA 3MJDA 1M1ZA 3P0FA 3ZCSA 2PJRA 5KC9A 2ZJ8A 3MWFA 1GRVA 2RK3A 1G98A 3I09A 5ALZA 4E5DA 1HWYA 2G63A 3NV9A 3ENKA 3NYIA 1KAHA 1NWCA 3T7AA 2JFNA 1C3OA 4LVOA 3T3DA 1IXRC 5I4KA 1Z5WA 3ABOB 3H65A 5IM4F 2G40A 3GC6A 1DQYA 3ICWA 1XL0A 1U1IA 4C2UA 4DLSA 4DCOA 2Q2QA 4RVOA 3VBEA 3SVTA 5K6TA 4UTOA 5JYCA 5FADA 1XVIA 3ZGNA 3TZEA 3ITDA 1CZHA 3O75A 4CVNA 4A15A 4L74A 1OA0A 4M53A 1OPRA 2OM2A 5H59A 3QEAZ 3OC6A 4DA4A 3FLEA 2VLBA 4K9KA 1PFGA 1H6DA 3F5SA 3FPKA 4I9GA 3WYGA 4AF7A 4ZDKA 4OQDA 1MO5A 2NSJA 4WX2B 1ZI9A 2ZBFA 4YRRA 5EHNA 3K71B 4CGZA 2QM0A 1JQDA 1KZGB 3KV1A 4B6EA 1JFVA 4XAQA 4N41A 1YRHA 2VSOA 3FYCA 1U5CA 1WXFA 3BTSA 2B98A 2FW6A 3IT0A 4O0MA 3LLMA 1IOZA 1XJCA 3AERA 2VDNB 3AG6A 3D2CA 2ZE5A 3KYCB 2Q8NA 5FBLB 4N7BA 3ND9A 3H2SA 3LDHA 2HHJA 3S0JA 4B6OA 4BFCA 4H0FA 3KPWA 3PU6A 5EWLA 1W5SA 3RF6A 3VR5H 1OV4A 2QT0A 4KZPA 3V00A 2VPTA 1YT5A 4I7EA 4PQYA 1JT9A 1AGYA 4ALIA 3RYHA 1FJ2A 3GLTA 1D4ZA 2AQHA 3Q0TA 4MQ4A 1YC5A 1QGOA 1SQ5A 4OBEA 1O6FA 2BEWB 3UKJA 4D81A 1SHJA 5HKOA 2QAGB 1QHHB 5CLQA 3DDCA 5E3JA 4LMRA 1XD2B 5B7PA 4U6QA 5FNVA 4EECA 2XPCA 1ZLYA 3OEYA 2W22A 3DMYA 1TYAE 1E9DA 2GCOB 3VYTB 1R8QA 1ZOIA 2AQIA 1P3JA 1ZVVA 1HEIA 4HC4A 4MPJA 5BQOA 1INLA 1XCJA 3T9DA 4EX6A 2JH8A 1S8OA 3H6HA 4XPIB 2BMVA 1BMQA 1Z5UA 2GA9A 1AZWA 1ZBQA 3UQZA 1GQQA 3QKRB 3DEHA 5HJ2A 4OQLA 1GG8A 3R41A 1QQ5A 2N0SA 3DTVB 4GOKA 5LQUA 1JU3A 1I9GA 4LOJA 4A8PA 2P6RA 1Z25A 4JJ6A 2H7XA 3CRNA 4ALNA 8LDHA 1AS2A 1C3XA 4FXPA 3IEUA 3E81A 3QHQA 4B85A 1YVRA 4RKWA 3H5WA 3GBPA 3JVVA 2VP4A 1W5TA 2CK3A 3LUBA 3DHVA 3HB4X 1NYRA 4HZGA 1P0FA 4F9TA 5EHXA 5HVNA 3MS4A 4HR7A 2YYZA 4R1UA 5ALQA 2ZI5A 3ZV7A 2R6ZA 2PGJA 3D4IA 4Z4GA 1N3LA 4K88A 2OHJA 1LPBB 1XTUA 3AF5A 4RXTA 3FJYA 3TZBA 2QAIA 2H00A 4RQTA 3RU2A 2Q5CA 1ZLXA 3C6MA 1QPGA 3JQAB 1S8FA 2QUKA 3B5JA 3VJLA 2DYKA 2QMUA 3ASZA 1YIAA 4UAGA 3A58B 4B83A 1ZHOA 1CJSA 3UGKA 1OWMA 1U8EA 1JJ7A 3VI3B 3DZIA 4Y9SA 2ZSUA 4EVRA 3AVYA 1FSZA 5IUJC 2EZUA 2ECFA 1EZ4A 1RQLA 1WB4A 4QOFA 5BOSB 3UJHA 2MINB 1DBQA 3ZDZB 4LXGA 3OZTA 2JG3A 3RLFA 1XNHA 2VRCA 4JI8B 1H6CA 1L5HA 5KQGA 4ZEWA 4CLXA 5DNCA 1MO6A 3VKGA 1NGSA 4KR2A 2PD3A 3MLAA 4BATA 2X5KO 4UMFA 1XNGA 1YC2A 2RDMA 3O8OB 4HS4A 4LJKA 1Z4PX 3A2NA 5EUBA 2LV8A 2VA9A 2Y76A 4LE0A 4PZYA 2G9NA 3ZCTA 1BVUA 4BB5A 2EARA 1E79D 5CH3A 3T1VA 1PU2A 2R8EA 4RTMA 2VRWA 4L4SA 2IBSA 2Z9CA 2IEBA 4MLDA 5I7RA 5BQPA 1LZLA 4KUHA 1QAOA 3W2TA 4D42A 1K68A 2VYCA 4G23A 4RU1A 5C1BA 1V9SA 4B8YA 3STYA 4WH0A 1K5HA 1WEHA 2Y6VA 5CA0B 1T36B 1CUHA 4RIGA 2V1UA 1W0KA 3I1JA 3FOBA 3IQHX 5A7GA 4NL4H 4NE9A 1ZN2A 4IKPA 1H5NA 1SA0A 1TJ4A 2A1UA 4QOIA 3WHPA 1W6UA 2YOGA 3P26A 4BUCA 4QYTA 2XT6A 2ZSFA 1C2YA 1U7TA 4HX2A 3QITA 3ZWVA 1RC0A 4J6FA 4FX2A 3KOOA 1C8VB 4MVJE 2JA2A 4LAFA 4YHHB 3IDZA 1U28C 3VR2D 4C6SA 3GH3A 1XRMA 2KBEA 3A0RB 4UBJA 1YHYA 4TVBA 4JCOA 1GKIA 4LJSA 4IVQA 4QUAA 4RVFA 4KOEC 3DO6A 4HUTA 3ONVA 2V4ZA 4IYJA 3IVAA 4PS1A 4YJFB 3ELUA 4HRVA 1KP2A 3ACBA 1GZ5A 1NU8A 2MR6A 4JSYA 4C29A 1MF7A 1VGRA 4JXKA 4TMTA 5LZ7A 1MPXA 1CRWG 2IYEA 3ORSA 1MZVA 3QNMA 4F84A 2YHAA 3WA7A 2ZAMA 4W1PA 1CUJA 2GRAA 2YYSA 3RYIB 3V2GA 3MIIA 4F5DA 2YZKA 3HSSA 4I5GA 4OI0A 4UAVA 3Q4GA 5EUCA 3G9ZA 3BZUA 2NV2B 2Q1SA 3H0KA 1B74A 4RIFA 4U7PB 1M2JA 2X86A 4A27A 1ML4A 5A02A 5HKBA 1JI3A 4JQOA 4Q12A 5I5EA 2HMTA 4YFVA 1VCMA 3ABSB 1ZNYA 4KPGA 4ZVQA 1F60A 2IY7A 2FG5A 1ZMTA 2BGIA 3QPVA 4C87A 1GEEA 4S0ZA 4WW0A 4RV9A 1KYWA 1S96A 5ALSA 2LGJA 2YWBA 4PQFA 5BWOA 1XMPA 4ED9A 3A4YA 3LA8A 4HLCA 1NG9A 3KKLA 1C7RA 1XRJA 1V96A 1UBEA 3KNZA 3NKVA 3O3CA 4KK3A 4MRMB 2WHRA 1KYYA 1UOEA 1A4UA 2Z2YA 4J0JA 1CVRA 4NC9A 5DP2A 5IC4A 1QRTA 2AUNA 1IUKA 4NYIQ 2C42A 5CK5A 3M9WA 4X60A 5K0BA 1LNQA 2DOKA 4IUCS 1KNXA 2XE7A 3CLHA 3ON5A 3CLRC 5DHPA 2C2HA 2NU8A 2NW6A 3V8MA 1JHVA 1U6KA 3A3NA 3CV3A 4K6HA 5CLGA 4RD2A 4DNOA 4JLBA 3C8ZA 1BEEA 1HDOA 4BYMA 2DHQA 2WWWA 4PONA 2XRMA 2XCUA 2FFJA 1FVHA 3HCCA 3OCCA 1FMCA 5GZ1A 1C7FA 3CLUC 4D96A 1EUYA 3LQFA 2BM9A 4PO9A 5J59A 1JEJA 1TMKA 4ZA2A 2ZU6A 2H4XA 3N0XA 3KOMA 3RADC 2HJ9A 1TZKA 3H9BA 3IE0A 1BU8A 1A77A 1HTBA 2QL6A 2PEYA 2FRXA 3N70A 2JLXA 1I3LA 4H16A 3UJ6A 1TJPB 1WW3A 3ICVA 1KF0A 1AKEA 3E9NA 4HN2A 4AWBA 1UJ4A 2KI5A 2P6NA 2VFAA 3FTNA 4IJUA 3GLIB 1A8UA 1NP6A 4KPUA 2GJSA 1JKMA 1LPAB 4H6VA 2ISQA 2X6TA 3M0EA 2RC5A 5CM9C 1PJSA 4A0SA 1YBFA 2O3UA 2VQSA 3PKZA 4QELA 4XSGA 4PYNA 4LWQA 2DF8A 3N86A 1KWGA 3VKFA 1AJEA 4AIIA 2XTJA 3C0KA 4GF5A 1Y4ZA 2Q4DA 1I3CA 5FUBA 1NVWQ 3C14C 4URUR 4UZFA 1VKOA 2MMGA 3RRJA 1YZKA 1DEKA 1GUZA 1TU0A 4BMPB 1KFBB 2VQEB 3P9PA 1U65A 4CCWA 1U90A 1Y5IA 2JAHA 2TYSB 3SQMA 4XWOA 2CBXA 4YIHA 1WXIA 3KKKA 1KQNA 2REQA 4J0EA 3F1KA 2GZ1A 4DQDA 4MCAA 5A5GA 5JSUA 1WZNA 2JL1A 4Y2RA 1JAYA 4DCMA 2ALJA 3ADOA 2PBRA 3TECE 5EPEA 3GMIA 2XMQA 3K7EA 4IO1A 3WGUA 3IL2A 3RTEA 2H2GA 1OXTA 2OESA 4UCWA 1BGWA 1UP4A 3F8WA 4L28A 3BB3A 2Y1WA 2E1RA 2ORYA 4PVDA 1PSZA 3F3YA 3VQTA 5L3VA 1KOFA 1EEHA 1VHTA 3GOHA 4N7RA 3ZBTA 2XECA 1A5BB 5KYYA 1TM2A 4JL6A 3CEJA 3VU3A 3H9JA 3P0RA 3TKAA 2ZDHA 3E5MA 1H0RA 2B4QA 4Q82A 1BXGB 2J9YB 2VT6A 3PRHA 4LJ5A 2QE7A 4M0LA 4GR4A 4P7GA 2HREA 1VCIA 2P65A 1UIRA 3DEAA 1QHNA 2ZWPA 4ZOCA 4HGPA 4ACAA 1C1DB 5D51S 4JKIA 1XNJA 4HWSA 5THKA 3L1IA 1NLFA 3VI4B 1CUEA 2EVWX 2I99A 3C45A 5AVVA 2OO7A 3WTCA 3OJCA 1Q7CA 1QORA 1WULS 5JZ9A 1CJVC 4JDPA 4IIHA 1UK8A 4TV9F 4RNCA 4K3VA 3WKBA 2FPIB 3M70A 2PQ2A 4QFDA 2F8SA 3EMBA 5B1YA 4TKUB 2HA6A 4DZRA 4KWEA 3B5IA 4P8RA 3E35A 3UH1A 2MSNA 3QI7A 3M4ZA 1E32A 3FPAA 3ZE6A 4A82A 4YLGA 3UICA 4JL5A 3PGA1 4KKXB 2YL2A 3ZBUA 1MGPA 4Z4HA 1J8YF 1LLUA 1ZY2A 1O94A 2I7VA 2Q4EA 3DFFA 3DF7A 1P1BA 1R5NA 3K35A 4I8DA 5FWYB 3GLGE 4JUDX 1KE2A 1NDQA 1WQ1R 2DUNA 1G3UA 3AUYA 3DLCA 2I6FA 3V34A 2OD2A 5FIUA 4BWYA 1F4PA 1NF9A 3EAQA 3UFXA 1GV0A 2UAGA 4BP9A 3LYHA 4G9BA 4W9MC 1AUXA 1N8SA 3KO8A 5EZYA 4ENRA 4HUQA 5FUVA 2SKEA 3A26A 2EL9A 2AOXA 3R0ZA 4Q9AA 4CQMB 3MMZA 3JQBA 2FETA 3LUJA 1F8UA 1KK2A 2WNSA 3VVLA 3WMGA 2V9ZA 4KVZA 4D43A 1ISJA 4DIBA 3Q12A 1BGXT 1X8KA 1BKYA 2J08A 3BH0A 4J75A 3KSBC 1QCYA 1NMXA 1UT6A 3CEMA 3EA0A 1H8HD 3ZVNA 4KXYA 3U3XA 3C3AA 4XI9A 3KP1A 4O4JF 5DHQA 5C51B 1CUAA 4BFYA 1S3IA 2VDWA 4ZPXA 5F73A 1E2EA 4BQEA 2H4WA 4L2IA 3D4LA 4PIMA 2I2CA 4QUKA 4K3UA 2QZZA 5DHRA 1W25A 2A78A 3W04A 1N75A 3O95A 3PEEA 2BBSA 3BJZA 3QX3A 2AG1A 3I1IA 1X9GA 3UJ9A 2WFLA 1V35A 3L1VA 4QYWA 1J21A 4IGAA 4M1QA 4YY3B 2HBRA 5DNVA 1E63A 5HA5A 4ERXA 3V3TA 2EZ8A 2JGAA 4RLQA 1RI1A 5DTIA 4RM3A 5LJLA 1B6RA 4FOOA 2OLJA 4CM3A 3P9IA 2VS1A 3QMMA 2VNKA 3LP6A 2XY4A 2JJ1A 1BZYA 2ZWMA 2OUKA 1USIA 2OCBA 3JCZA 1ZI6A 2JBAB 4KJZA 1F8XA 2ZIWB 3H1AA 3JSAA 4I55B 4YGYA 1WDWB 5HR5A 4Y98A 1YDMA 3GLGB 5BMOA 2G04A 3DTYA 1O97C 4Z4CA 4Q7QA 4Z5XA 1BDBA 4V0MA 3X1WA 1USWA 4TKVA 4HWKA 4REMA 3HO8A 3DZHA 2QD4A 2E85A 5L7WA 1HFJA 4PTLA 1J42A 2HAEA 1J99A 1TVKB 1F12A 1BHQ1 2J5KA 3QVWA 2OGSA 3ETJA 4I1SA 4XSHA 5FCDA 2ZJ5A 5DW0A 3EFBA 3SC4A 3ELBA 4ZQEA 2P41A 4R68A 1EAMA 3BSFA 3LOPA 1YGYA 3IIMA 5F76A 1LCIA 5BR4A 2JW5A 2OSBA 4BN0A 4U7DA 1X7HA 2WI8A 4G1MB 4MICA 2BR4A 2PLWA 4BMOB 4K9PA 4RVSA 1HT0A 1PJ8A 3TIGA 2R62A 1UKVY 4P3KA 3UUGA 4JUFA 5FOVA 3JPWA 4J16C 4O1HA 2ATEA 3NHJA 1ILEA 2AI2A 1DJLA 4P93A 3L4BC 4QFCA 3SY8A 3RT7A 3T7IA 3T7DA 3CF4A 3X43A 4LVCA 3IOEA 3P2JA 4JC5A 3R4CA 2LDBA 2QR3A 3FMIA 4DCGA 2IHBA 4UNNA 3A2MA 2VUTA 4OHFA 1FVXA 3AUSA 4EF6A 3L8FA 3T41A 3KQHA 1H66A 1ODTC 1ZH4A 2BTEA 1JFSA 1NXVA 1G63A 1IM2A 3QZUA 3TLAA 1E1LA 4YJ3F 1JEOA 1R5OA 1JHAA 1T0BA 4FS8A 1PL0A 4GSYA 4TV8A 5LU8A 2WU1A 1MT3A 3AIOA 3P5SA 1SXJA 4XW2A 4DIUA 3TD2A 1X80A 1R74A 3DCJA 3QBTA 1KMMA 3TGLA 4OBXA 4NSNA 5CFZA 3AKZA 5DYWA 3I53A 5ECYA 1YJCA 5CFMA 1EEXB 3A9WA 3K73O 5NULA 5DM60 4OQEA 2Q5LA 3EZFA 3BWYA 4BNJA 2QNRA 4YR7A 1QF9A 2KQUA 1A9XB 2FDRA 3RSCA 2UVPB 2Z3WA 5C8YF 2WPDD 1IHUA 4QRIA 1ONSA 2D2EA 4PANA 4P4GA 4L3WA 4B6GA 3X1JA 1VI2A 1EK0A 1QE3A 2C84A 3UT6A 4BS9A 4WWHA 5FPKA 1F1JA 1P31A 1ISSA 1J8VA 1KZ6A 2XRYA 3MRXA 4QUHA 4XGNA 4PZZA 1EHYA 1K9VF 2JGFA 2K5UA 3HWWA 5JIBA 1P4GA 1X7YA 2CMDA 2PLFA 4X90A 1N6RA 3V8PA 3HXTA 4J4BA 3WO0A 4V39A 4Q4AA 3KXLA 3HXPA 2JIZA 3ADPA 3PIDA 1WMDA 3GLFA 1F2DA 1JWLA 4F3TA 3VOTA 4I50A 1QIGA 1SK8A 5DVZA 3MJEA 4NDZA 3ASYA 1OKKA 3NATA 4MS3B 1AE1A 3O1HB 1LQUA 3O9VA 1H1LB 2KBFA 2GD6A 4MRPA 3E5NA 2HA4A 3HKDA 4IMPA 1W85B 3TDMA 4Y2TA 2VQFB 1RQ7A 4TN1A 4ZCSA 2JASA 3MQ4A 4L4ZA 2FP4B 1QFJA 1TUBB 3R76A 3V8BA 1A8QA 3C5CA 1QH1B 1XTSA 2PKCA 2VR1A 1AKRA 3EG9B 2ZRFA 4N03A 1P5HA 5LUBA 3UAZA 2DG2A 1F5NA 1ODSA 3LSYA 1AUQA 3R3XA 2O50A 1M1YA 1NQUA 1JPNA 1TJNA 3TOVA 3TR6A 4BKOA 1WSBA 2YBEA 4JZYA 5AW0A 3MUFA 1BFDA 4QAJA 5REQB 4CHTA 2ZUDA 2EFCB 2V6GA 2DWUA 3VDNB 3I39X 1HT2E 3K32A 3H1FA 3LUPA 2E5FA 3AXSA 3E27A 2PRJA 3B1FA 2Q62A 2HFJA 2GBIA 3OAAD 1ML3A 3UMRA 2AA3A 4XJXA 2IGBA 3U4DA 2VF7A 4I99A 1L5WA 1WF6A 1OVMA 3V7NA 4JASB 3MJSA 5TV2A 4E14A 3OEWA 1F3LA 3LH5A 4XOIA 3JWHA 3K92A 1M2GA 5KNCH 3QVGB 2YWRA 1XYVA 4O4LB 3VC3A 2HRCA 4M4SA 3SZRA 4CR7A 2CL0X 3HU5A 4LZOA 3F6SA 2BTQA 3MINB 1GGKA 4GL4A 2QBYA 2H2HA 1XZBA 4ER3A 1TYBE 2ZRLA 3E4CA 5LYYA 1OF1A 1D5CA 4GIBA 2YFQA 3PLNA 4EGAA 4KPYA 1R9GA 4TTVA 2RIRA 5FHQA 4BPRA 4TQGA 2YKGA 1E9CA 4NBSA 3CE6A 4NJMB 4GSLA 3QJYA 5FPPA 3TFQA 2VP9A 4I1PA 3NPAA 3HY4A 3A6EA 4X41A 2DQSA 2SECE 1PNQA 2CL5A 4Z9YA 3SQWA 3H8VA 2BBOA 3I6YA 1N1MA 3PEYA 4RE6A 4RIHA 4UUAA 3DZJA 4MWGA 4Q4HB 2B99A 3WGTA 4N48A 5LIRA 4KQ6A 4DR1B 1N2JA 1G3MA 4WTOA 3TZCA 3LIPA 3N9IA 2AG6A 3DZ8A 5D87A 4S2EA 1K8QA 2NZUG 3BIWA 3MMXA 3O9MA 4QPJC 3RBXA 1YUMA 2I4LA 3L4BA 4LDPA 1Q0LA 3WIOA 2H1WA 2ANBA 2W0SA 3N3BC 2ZE7A 4HXYA 1DKMA 2QTRA 4D4MA 1I1HA 1OFVA 2QN9A 1UC8A 1E5TA 3D3JA 4IJ6A 3P7MA 3HA3A 1D6MA 2VBIA 4MV5A 5M3BA 4JOCA 4ZREA 1G20B 4A7PA 2RG1A 2ONJA 2PJUA 1WL8A 2I87A 3Q9SA 4KR7A 5F7ZA 3WI7A 1SRRA 4NCBA 3DBHB 2GPYA 3GPIA 3PHHA 1PDVA 1EX9A 1MJ5A 4PR0A 2VTKA 3L05A 4P9NA 4PS0A 4W7HA 5BRAA 3IILA 4DR2B 3EC1A 3NKLA 2YDXA 3D6JA 5CVEA 3BJMA 4MEBA 3KXKA 4JYCA 2C00A 3CTMA 2Z95A 5JAOA 3L7JA 5AOBA 4YAGA 1M7GA 3TGPA 2LCIA 1U7WA 1YMVA 3DEJA 4IICA 1EM8A 2E87A 4IWYA 1WUTA 3D5TA 5FQNA 2D3TA 2J0UA 1YKSA 5JXIA 5LFAA 4CMCA 4EYEA 1CF4A 3FKSA 1Y9DA 1ZK2A 2H0QA 2C5GA 2YXNA 3GJ5A 1AMOA 1RYEA 4KQCA 4YPFA 4KXVA 1X1QA 2Q8QA 2WWVD 5C8XA 1Z0JA 3DHNA 2J4DA 4ZOLB 1ICIA 2EJUA 2P7IA 2VK8A 3NORA 2WD8A 1Y1KE 3AVOA 4YXWA 5ILOA 2E4AA 1G6Q1 2AFHB 5GJWC 1BHO1 4CKEA 3GJYA 1Q0SA 3AV3A 3RS3A 5GV8A 4E5MA 4EO7A 3DWGA 3KJIA 2GEUA 4ECEA 1DL5A 3GK3A 5HBGA 3PQ2A 3Q7EA 5KQSA 4FI3F 2O1SA 1JZTA 2PR2A 2VDVE 1B41A 1E60A 3V3KA 2BFFA 3KQNA 1FUIA 4WNIA 5EJAA 2GETA 2C99A 3MPOA 3PKIA 1PR2A 4XSVA 1CC1S 2I6TA 4CPDA 4ALMA 1U81A 1TCCA 4HNAB 2PX6A 1ECFA 3T5MA 1JQ3A 2BV3A 3A4NA 4TLDA 4YT5A 4DWWA 2X9LA 4EAQA 1XTPA 5JRJA 1WHSA 3OOSA 1UFQA 1RLMA 3KELA 3KFXA 3BXGA 3ZWXA 1TTQB 2FMUA 1L1FA 5JW6A 4NNPA 5B53A 1O6GA 1LB1B 1EP3B 3FNRA 4HTAA 4B3GA 2AXEA 5L6MB 4PTZA 2WYWA 1G5TA 2Z3VA 2QM7A 2C9OA 2OENG 3Q1KA 4FFPA 1IY9A 2BF4A 5L45A 2MSEB 2ZRNA 1XMJA 2A67A 1JXMA 1EXDA 1RYDA 2EKDA 3WB1A 3HJAA 4OPMA 1R0KA 2YS7A 2VNHA 3HB7A 1C14A 1M8GA 2HA7A 3EN0A 4EK9A 1KVQA 1QHYA 1UMBA 2DKNA 3K6RA 3OM8A 3SSNA 5BV1A 1LXCA 3TDNA 1UUFA 4DC0A 3UANA 1ZG3A 2X19A 1A2KC 3CEAA 3PXUA 4QBIA 1CX9B 2R8RA 2IYSA 4OQQA 1PWHA 4X7BA 2WF9A 3HK2A 1E2MA 1SUSA 1D0VA 3HVKA 1JN0A 4C20A 1X9HA 2W43A 3U60B 5ABPA 5B2ZA 1JJFA 5EERA 4F3RA 2GERA 1RRCA 3IQFA 5TPWA 4DARA 2KE5A 4YLYA 1EXVA 5EXDA 1HYGA 3CIFA 4TXMA 3OU7A 2DWCA 5AI5A 1OAOA 3TAHA 2G9RA 3WRYA 5AI8A 3GA0A 5KS2A 2G6BA 5IPFA 1FPMA 3BZWA 4P7JA 3I04M 3BL5A 1VLMA 1K4MA 1SXGA 2DFDA 3DPSA 3LCJA 1YULA 1ZX1A 2GHTA 1C1DA 3Q5EA 2GASA 3RJTA 1QHXA 1UBMS 5SZHB 1J8DA 5J23A 2V3WA 2QTZA 2AQKA 2HK6A 2ZJ4A 2XMBA 4G0MA 1LBTA 1IAQA 3O1IC 3H86A 4KXLA 4LXTA 1KRHA 1AK2A 1QK3A 1OWPA 4WN9A 2HRBA 4ETIA 3LXXA 2B1QA 1GZ7A 2FZWA 1EPUA 2IS6A 3K9NA 3MTAA 2XYPA 2Z1NA 3EF0A 1ISIA 1F0KA 2OCPA 3NNSA 4OF4A 3JQPA 5BUQA 1N33B 4MKGA 3NT2A 2WB4A 4J9UE 5KYXA 1SPBS 3FZEA 1SBQA 2JVKA 3VZRA 1I7NA 2Y1DA 1HDCA 4Q9HA 4ZT6A 1BXRB 2C5HA 1W85A 2CWDA 1X7WA 4QPPA 1Z3CA 4O5AA 1Z56C 3C43A 3ROZA 3HU2A 3I45A 3UMMA 2EJVA 4JS0A 3NP7A 4E32A 3SJ7A 4Z86A 3E5RA 2J5XA 3AB3A 1F7VA 4MITA 1P45A 2R00C 3K05A 1ZL2A 4GW3A 1XZGA 4I50B 5IWCA 1IWPB 2YJ4A 4PG7A 1EFLA 3C3KA 3IJRA 2QU8A 2VPQA 3H8WA 1K6EA 1VJ5A 2FG7C 2XNJA 1XHFA 3A9TA 2V1XA 4PNZA 5ALHA 3T38A 2W0MA 4BMCA 4EL5A 5ADUS 3WYDA 1T9BA 5I7OA 3MLBA 2ODBA 4G1EB 4XFKA 3LTNC 1SD2A 2PX0A 4JN6B 1L4BA 2YH2A 2YXBA 4KZKA 1XDWA 1SKQA 2D0IA 4ZQFA 2AKEA 4O2RA 4IXNA 4X93A 3RROA 3WBBA 3ZHOA 4Q1VA 2VXYA 3RKUA 2VYVD 2W6MA 4MQ5A 4BGIA 1HEUA 2J9FB 4HGOA 4AY5A 3GJXC 1HQYE 1NBMA 3OJ0A 2F9MA 2IOFA 5AIBA 5FI1B 4BVEA 1I1QB 4GHWA 4LBYA 1YVUA 4U0JA 4EYKA 2QLTA 1N77A 2IF0A 1U0TA 3ESXA 4PCUA 1QVZA 1QFZA 2BMAA 1MO3A 5JH7F 3GVHA 2ZYRA 3AUFA 4IIXA 1JNXX 2GAOA 4CMIB 3LBHA 3PL5A 4IWNA 4J7XA 3ZCXA 5JC8A 2II6A 3VHRA 5HUHA 1F4LA 2O06A 5GTDA 3M5CA 3Q8WA 4X64B 2XRZA 1O03A 3JZFA 4EGQA 4OB6A 5FWNA 2X0KA 4URYR 3VMFA 3JQFC 4TV8B 1P2UA 4F45A 5FFFA 1ZCFA 3BWXA 1L4EA 1M8JA 3ZLJA 4D4HA 3FZNA 2H1HA 3C97A 4LGYA 1G2PA 2BFMA 4MVJM 4FMBB 2HIMA 3Q8XB 4L4YA 4ROSA 1XVUA 3UT5B 3TTUA 3RFXA 5KYUA 1Y6JA 1E2JA 4Q1DA 2GAIA 1TPYA 2QGZA 3LHKA 1KPGA 1KR2A 1L7DA 2FSHA 2PWZA 5EIWA 3EXHA 4I1OA 3TSCA 3VR0A 2HZBA 1P0PA 2VPYA 3QU2A 1Z6GA 4GR9A 2IPNA 4WECA 3T7TA 1NT4A 2BI8A 3PDHA 4E03A 2DVMA 2RGNA 2Z30A 4AROA 4KPEC 3QQPA 1A9TA 4ZOBA 5A4AA 3NHPA 3SGLA 3ETNA 3NR2A 4MVYA 1XQ9A 3OWHA 4I3FA 5K3AA 8MHTA 3ORRA 3U4CA 1CERA 5JAIA 3KJNA 4Z4EA 1LJ8A 2VNSA 2Y0EA 3RYFA 3GLHB 2PT9A 2BYTA 3U7QA 3PFKA 5KTRA 3STHA 5IC5A 2QPLA 2WPNA 3ZE8A 1PYOA 3SM9A 3BILA 2HUPA 1ZDMA 3GAMA 3SP1A 1JHMA 3D0RA 4C03A 3WNZA 4C4ZA 4P0PB 1PLJA 2AJCA 5AVUA 1VJDA 4O4LA 1FDWA 1BYIA 2RK6A 1ZD3A 1P91A 2RJNA 2YICA 3Q9UA 3K0FB 2R1ZA 3OTWA 3G5AA 4KFUA 4WOCA 4D3SA 3ADKA 2I8LA 1M0TA 3D8HA 1WTCA 2F48A 4IJVA 5LKRA 2Q7XA 5KSOA 1RLIA 4QL3A 1VE3A 5GIOE 4EUHA 1AKYA 1P75A 1XFAA 2J07A 3TIFA 3MS2A 4MUYA 3RK1A 3O7MA 2PL3A 3RG2A 4NKRA 1DG3A 4KQXA 1O1YA 4Z8XA 3P0JA 5AM1A 1PJRA 3ZHQA 4RTJA 2OQRA 3S4YA 1PK9A 3BZBA 4AFNA 4ZO8A 4IFIA 4OHZA 3AXTA 3G9UA 2OTCA 5LYJA 1TUIA 1XN1A 3WHIA 3QLVC 4L4RA 5K3DA 1R5JA 4OSOA 4R54A 5K0CA 5BURA 3N28A 1FP1D 4CUJA 1AHPA 4HB0A 5EZ6B 1FFAA 4PZDA 1W5AA 4CRWB 3PUKA 3MRTA 2NSYA 1TECE 1RZVA 3QVMA 2G77B 4YJHB 3TLJA 3MGAA 2QTVB 1ZK0A 3DF9A 4RNDB 1FDIA 3QK7A 3GGOA 2P3OA 1YMQA 2B37A 2ZTUA 1GPUA 3OJXA 4F46A 5L6LB 1YMUA 2QVBA 3EXFA 3NEAA 1ST3A 3OETA 3C3BA 3PLRA 4C04A 4QICA 4ZZ3A 1Z0FA 4AJIA 4LZNA 4WY8A 5EJ9A 2I03A 4LJAA 3KWLA 4J1SA 1KGSA 4IUBS 3FIUA 2WT9A 2ONCA 3F0TA 3TR5A 4I3HA 2YY6A 3P9SA 3PPXA 2P6MA 2Q4TA 3PWSA 1V8OA 4BMYA 1HQDA 1KETA 1L7NA 2QRJA 1UFKA 3UCXA 2JLUA 1DFIA 2DT8A 2MYTA 4NBKA 5GM1A 4BAUA 4RFVA 1GDTA 2R6AA 1NY6A 3O8OA 4IIUA 3O26A 4MVWA 4P32A 3HJCA 3Q7RA 1LI5A 2WIAA 3DMTC 2JFFA 1FRNA 1JVBA 1PN3A 2RGGA 3ZHRA 3VU0A 5KNDH 4C0SA 1GCUA 2ZIFA 4C22A 2IL1A 2VAXA 1N6PA 1V3TA 1DAFA 3HN7A 1BE6A 4MQ6A 5J2UB 3IIEA 2YNMA 5H16A 4JL8A 3NP9A 2GNAA 3TUJC 4ZV9A 3WRVA 3T35A 3OZFA 5FPQA 1JEEA 3BQNB 3SS7X 3M9LA 1J90A 2QTVA 1G41A 2BHTA 2XUFA 3OO0A 3S8MA 5JROA 1GJRA 2JJQA 5GONF 4MRRA 2QYHA 1T9CA 1V1JA 1F38A 4IGIA 2V7EA 2JFYA 4M0UA 4RY9A 2FPIA 3VO9A 1M75A 1KZ1A 2I4IA 3V1TC 1YCHA 3WKCA 4JYAB 1TDJA 5CBPA 2DFPA 1J1ZA 4ER5A 3T3IA 4ZCRA 4LTMA 4MYCA 4EPXA 2ZPTX 4ND8B 3WIUA 3RRXA 4A4DA 1IOLA 4LRXA 4TXHA 4RD4A 4GZ5A 5JTTA 4KHPB 4ETNA 5MFZA 1V39A 3WOHA 3ZHCA 4C43A 3PBKA 5C7YA 5HILA 4WBSA 1PVOA 3W90A 2FPOA 4BCCA 1RXCA 2JJ2A 4TTJA 4DM7A 3TUZC 3UOGA 3UK0A 2ADFA 1IUPA 2I2XB 1ZONA 1W8IA 4N8DA 4R8SA 4EFNA 1P9NA 1WUIS 2V98A 5KWSA 2AEFA 2EC5A 2QMQA 3H2GA 4DVJA 4YPOA 1MBZA 1A7UA 4KQEA 1BQ3A 1SNYA 5DWVA 4JJGA 1UM9B 4A0HA 1UC4B 4R0MA 2FMHA 1Y6QA 4EY3A 3WZLA 2IKQA 8OHMA 4KIGA 4TGLA 4HEA6 5C7LO 3WA6A 1X6VA 2ZR7A 2G9ZA 2Q3BA 3JRWA 3NALA 5KEIA 1BMFD 3CNEA 1NXOA 2HSZA 3Q2KA 2Q0QA 2DB3A 4GXNA 4R1LA 1OX5A 2YZ7A 5C0OE 4MGZR 2P2DA 3ZY5A 1KRWA 3DVAA 1WIWA 1HT3A 3FYUC 1CNMA 2ON6A 3JWEA 1OFUA 2VJBA 4NAUA 3AL3A 3AWIA 4ARIA 4EG8A 3MERA 4FC7A 2R9VA 5JNUA 4MTLA 4TM7A 4RY2A 1NUTA 3OPNA 1YRAA 1G21E 4D4KA 1Y8RA 5CT6A 5JZVA 4QYMA 3DVSX 5KTOA 5FOXA 3I34X 1K08A 2PK3A 4QVKA 5HIAA 4HH0A 1NVKA 1Z2CA 3FA2A 4K9RA 1VOTA 2WJIA 3UWOA 3CNOA 1GAQA 2F3SA 2PEZA 3PYMA 1P1CA 4G0XA 5CDTA 1GGHA 4BE9A 4QHYA 3CH5A 2LBPA 1XHLA 3WGNA 1DP4A 4LKRA 5DYTA 1W36C 1ZIPA 3JWGA 4C08A 3EZLA 3UXEA 4QDXA 1JFLA 2I4TA 3BMQA 3BRQA 5H70A 1K6JA 2QBYB 4OP1A 4N12A 4R16A 1ESZA 2BDTA 5BSEA 2NU7B 2ATXA 3BXEA 3L3BA 5BUZA 4DMLA 3S5UA 3LHIA 1ZGAA 4W1QA 3IUJA 1O7JA 3HCRA 4H4DA 2Y6UA 4RGYA 2M98A 3SHTA 4E2WA 4X20B 1GZ4A 4UC0A 2R7LA 3WRYC 3IC5A 3OQIA 2F1JA 2HLNA 2F67A 1XD9A 4BQNA 1PT8A 4U7JA 5E6RA 1G1MA 1DTEA 5KQRA 2PQ6A 1PD1A 3MMNA 1S4QA 5IN5A 1L5SA 3D6VA 5ER6A 1Z6XA 5JLAA 2CHQA 3U19A 3P96A 2UYGA 1ADJA 2BFCA 3IVGA 1USGA 4C30A 4S05A 3OHMA 1A1VA 4WNYA 3ZDXB 3K8ZA 4UTXA 4O3MA 4FHCA 2ZYTX 2ZIAA 3FOEC 2JAPA 2VK4A 3ETHA 3HR4A 2VZ9A 1GZUA 3C5VA 3M2PA 4XB1A 4LG1A 3RCBA 2XUKA 1OU4A 4Y2UA 4MYDA 5LZ5A 4XRGA 3HN2A 1T6XA 3EXG1 5LWHA 2HCRA 3G8YA 3HWRA 1JV2B 1OLUB 1Q2XA 2FUCA 3K1AB 2QEQA 3QIVA 2ZR8A 3T5AA 5IT0A 2CT8A 5M29A 4OFZA 3CLTC 5ITZB 2FPGB 2HYDA 1NVBA 4RETA 3RH0A 3TZKA 2FEPA 3Q87B 4J43A