2PMPA

Structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from the isoprenoid biosynthetic pathway of arabidopsis thaliana
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
160
structure length
160
Chain Sequence
TLPFRIGHGFDLHRLEPGYPLIIGGIVIPHDRGCEAHSDGDVLLHCVVDAILGALGLPDIGQIFPDSDPKWKGAASSVFIKEAVRLMDEAGYEIGNLDATLILQRPKISPHKETIRSNLSKLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVILLMKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biosynthesis of isoprenoids in plants: Structure of the 2C-methyl-D-erithrytol 2,4-cyclodiphosphate synthase from Arabidopsis thaliana. Comparison with the bacterial enzymes.
pubmed doi rcsb
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
molecule tags Lyase
source organism Arabidopsis thaliana
total genus 50
structure length 160
sequence length 160
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 2pmpA00
3RE3A 1U3LA 1KNKA 1JY8A 1U3PA 3ERNA 3B6NA 3GHZA 2UZHA 3MBMA 3F0FA 3IEQA 3IKFA 3F0EA 1W57A 1KNJA 2PMPA 1VH8A 1YQNA 3IKEA 3FBAA 3P10A 1GX1A 4C81A 3KE1A 5B8FA 3K2XA 4C8GA 4C8IA 1U43A 1IV3A 1VHAA 3F0GA 2GZLA 3IEWA 3K14A 1IV2A 3FPIA 3QHDA 1H48A 1W55A 1IV1A 3EORA 3ELCA 3F6MA 3F0DA 1JN1A 1H47A 3T80A 1IV4A 3P0ZA 4C8EA 4C82A 3JVHA 3ESJA 2AMTA 1T0AA 3Q8HA 1U40A
chains in the Genus database with same CATH superfamily
3LMEA 2HP0A 3B6NA 3CC2F 4BY9D 2Q1XA 1DT9A 2G9IA 4O2BA 2HVYD 1IV3A 5G4UC 5IJ0A 4DRXA 2VAMA 5BMVB 1H48A 4I4TA 4NWOB 5GIOC 4FFBB 5HY2A 1TVKB 2P6YA 2HS0A 2VAWA 3F0DA 3E20B 3HKDB 2Z01A 2Z1TA 2CVLA 2KTUA 2UYPA 1X7OA 2CSLA 4X1KA 3ERNA 2UZHA 3WGLA 3VOAA 3F0EA 3ZP7A 4B62A 1GX1A 4EB6A 4EI9A 4TUYA 3QHDA 3E22B 2HS4A 5CB4A 2RHJA 3CC7F 4XCQA 1PXWA 3NK6A 3OBWA 4TZZA 3VI6A 3CCSF 3UT5B 3D54A 5EB0A 4B46A 3JAWA 4O4IA 3JASB 2LBTA 3VMFB 3MCQA 1PF5A 1SA0A 4M8IA 4YJ2B 2DT4A 1RA4A 4TV9A 1GO1A 4HNAA 1VHAA 2GZLA 4YJ3B 2V9YA 4BVSA 1ZWZA 1KD1H 4O4HB 3PLAC 3CB2A 5EWRA 2OTMA 1RLGA 2VGMA 4YJ3A 3ZP4A 3VOBA 4IIJB 2QTPA 1TUBA 4F6RB 2HS3A 3P0ZA 4O2BB 3N4YA 1W55A 1ODEA 2H8EA 5BMVA 1M90H 4PWTA 2YXZA 4FFBA 1TVKA 4U39A 2LBWA 3TD4A 5HP8A 3IKEA 1FNJA 3FBAA 3NVIB 3CXCF 3HKDA 3CCJF 3HWUA 4G4WA 1Q8RA 2JNBA 3K14A 3LWQC 2BTOA 3S0HA 3JCMM 3C9TA 1VQ7F 3KJKA 1SDSA 1JFFB 1XBIA 2FC3A 3HTNA 4C8EA 3WGJA 3VYSC 5GANK 3RYFA 5HWEA 3HKBA 3E22A 3F0FA 5CB4B 3O85A 1W57A 4R40B 2F9ZC 1UFYA 3UT5A 3CYPB 5HY4A 3LDTA 3WJPA 1NQ3A 5EB1B 3CCMF 3LFOA 5LA6B 5EZYA 1NJIH 5JH7A 1JN1A 4YJ2A 4NQ3A 3NMUC 2IQQA 5IYZB 2AMTA 4HNAB 3OW2F 3CC4F 1W581 3HKEA 4BT5A 4O4HA 5LOVB 1K9MH 2Q1YA 3GHZA 3RA6A 2ZODA 4NUTA 1T0KB 1X25A 1IPAA 4C81A 4IIJA 4F6RA 1TUBB 2HX0A 1W3EX 2KTVA 3CYQA 3M84A 1Q86H 1X7PA 1IV2A 3C9UA 3HKCB 3M1XA 5LP6C 4X20B 1W5EA 2GVIA 2KG4A 3N2GA 5GIPC 3ELCA 3F6MA 2DYYA 1H47A 4B5CA 4U3JB 3MDOA 3LWVC 1T0AA 3P4EA 1NMUB 2CHSA 4BVTA 4WBNA 2AIFA 3CMAF 3G4SF 3IKFA 3RYCB 1YGYA 4X3MA 1JFFA 4BVQA 5KMGA 1U43A 3S0WA 3J80M 1CK2A 5GINC 4LCKA 3RYFB 2Z1UA 3V7QA 3HKBB 3OONA 5LYJB 1Q7YH 3ZO8A 3CCRF 3RA5A 3CMEF 5GONB 3SIVA 3D00A 2HRYA 2H6LA 3CCUF 1JY8A 2ZF8A 4X3LA 4ZOLA 3S0YA 1COMA 5LA6A 2I6RA 4BT7A 5EZYB 1VH8A 5G4VC 4BT3A 1VQLF 3P10A 5JH7B 1YJ9F 3MQWA 1Q82H 1VQNF 4C8IA 3VIUA 3TD3A 5IYZA 5JVDB 2W8BC 3C9RA 5IT9M 1YHQF 1JD1A 3HKEB 5LOVA 3JATB 5MN5A 5C8YB 1VQMF 3EORA 4BVRA 3S06A 2IAFA 2CWJA 3E1YA 3Q8HA 3L7QA 3CCQF 3LWPC 1U3LA 5CA1B 2Z1FA 4G4XA 1GO0A 3HKCA 4RQOA 4X20A 5IJ9B 3N2GB 1YITF 2CZWA 3I55F 3G71F 3K0TA 2RHLA 3K2XA 4EI7A 1XV2A 3I3FA 3S03A 4U3JA 3F0GA 3IEWA 3QTYA 5J2TB 2WALA 3WGNA 3CCLF 2CW4A 4WBNB 2R6R1 3CD6F 2UYNA 3VCZA 3RYCA 1CLIA 2OTJF 3KHNA 3PAFA 5JQGB 1RQ7A 2AIZP 5KMGB 5J2UB 1U3PA 1H7MA 3U0OA 2RB9A 3JAKB 3KIZA 3MBMA 2RHOA 5LYJA 1QVFF 1W5BA 1YQNA 3ON1A 3N4ZA 5MN4A 5GONA 1YIJF 3JARA 2HRUA 4O2AB 5HY1A 5JCOA 3BYQA 4BW0B 5GAPK 2L26A 4G88A 3CCEF 1VQ4F 3WJQA 4ZOLB 2LCAA 2ZAUA 3JALB 1N8RH 3VYTC 3T80A 4G4VA 1VQ5F 5JVDA 1W5AA 2OTLF 1U40A 4I50B 1VQKF 2BTQB 3S02A 3JATA 5MN6A 1XHOA 5C8YA 2PMPA 2ZVYA 4ZK7A 5LP6A 2VAPA 1X52A 2RHHA 3VYUC 3GYQA 4O4LA 5FNVA 5B8FA 5LXTA 3CPQA 3FPIA 5CA1A 5EYPB 4X1IB 5FJ4C 2N48A 3OBYA 5ITZB 5IJ9A 3TD5A 4G4YA 3C9SA 1VK3A 1CN7A 2OZBA 1QVGF 1OFUA 5J2TA 2YYEA 2Z1EA 3WXMB 3G6EF 2ALEA 4B45A 2UYNB 3RYIA 2MQEA 3WGKA 1ONIA 4I55B 3HJWC 3DC2A 1VQPF 4IHJA 5JQGA 2UYJA 4ZI7B 1YJNF 2QI2A 4ZHWA 5J2UA 5DCVA 3JAKA 4KWEA 4O4JA 5EO3A 3SIUA 1J7HA 1DBFA 4ZHYB 4LNUB 3C8LA 2IG8A 3NK7A 1FNKA 3JARB 2VGNA 3LWOC 3V7EA 4O2AA 1QAHA 5HXUA 1JJ2F 1VQ8F 1KNJA 3JALA 1FSZA 2NMUA 3LYBA 3WGMA 4BT4A 4ZHQB 2PHNA 3FD6A 1QD9A 4I50A 2H8CA 1VQOF 3R0PA 1UI9A 1YJWF 2LBXA 2VXYA 5LP6B 3MCAB 3FFMA 5KX5B 3CCVF 4O4LB 5FNVB 3GTZA 4ZHVA 5LXTB 1S72F 1VQ9F 3RYHB 5CA0A 3DDNA 4E6EA 5EYPA 2OHWA 4X1IA 1Z5VA 4RHAA 3IEQA 3KJJA 1FFXB 5ITZA 3WPXA 3LWRC 3N2KB 1SZQA 3VTIC 3IMPA 3ZOPA 5HY0A 1Z5WA 1VQVA 4TV8B 4X1YB 2CHTA 3NVKE 2HP0B 5FLXM 1IV1A 2K1SA 1VQ6F 3RYIB 4I55A 5EAZA 4BT6A 3CPWF 2ZVZA 1K73H 3AGKA 1E7KA 3K12A 1IV4A 4IHJB 1Q81H 1XRGA 4DXDA 4ZI7A 3RE3A 4DRXB 5IJ0B 1YI2F 1KNKA 1QU9A 4I4TB 1GZ0A 1RQ2A 5EIBC 5HXZA 5EIBD 1W40A 3WPWA 4O4JB 3V4DA 3QUWA 4C4WC 1W42A 4LNUA 2ZOVA 4C8GA 3J81M 3HAXD 1OAPA 4BT2A 2BTUA 3M4SA 4X1KB 1W5FA 1M1KH 1RLUA 3JAMM 2BO1A 5A2QM 3D01A 2R751 2HQSC 4EB6B 2QA4F 4TUYB 2UYKA 3ESJA 4ZHQA 3I56F 1KQSF 1W41A 2GLZA 3VO8A 5HP7A 1W2BF 1W59A 3IR9A 1KC8H 3KE1A 5KX5A 1K8AH 2FGYA 2I6DA 4G4ZA 4ERHA 3RYHA 2EWCA 3JAWB 4O4IB 3JASA 3V3TA 5CA0B 1R1MA 3J7AR 3FD5A 1FFXA 4X1YA 4EI8A 1SA0B 3N2KA 5AVMA 2KGWA 3I7TA 2QEXF 4TV9B 3WJRA 4C82A 3CG6A 5JCOC 3JVHA 4TV8A 2B33A 2HP3A
chains in the Genus database with same CATH topology
3RE3A 1U3LA 1KNKA 1JY8A 1U3PA 3ERNA 3B6NA 3GHZA 2UZHA 3MBMA 3F0FA 3IEQA 3IKFA 3F0EA 1W57A 1KNJA 2PMPA 1VH8A 1YQNA 3IKEA 3FBAA 3P10A 1GX1A 4C81A 3KE1A 5B8FA 3K2XA 4C8GA 4C8IA 1U43A 1IV3A 1VHAA 3F0GA 2GZLA 3IEWA 3K14A 1IV2A 3FPIA 3QHDA 1H48A 1W55A 1IV1A 3EORA 3ELCA 3F6MA 3F0DA 1JN1A 1H47A 3T80A 1IV4A 3P0ZA 4C8EA 4C82A 3JVHA 3ESJA 2AMTA 1T0AA 3Q8HA 1U40A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RE3 A;  1U3L A;  1KNK A;  1JY8 A;  1U3P A;  3ERN A;  3B6N A;  3GHZ A;  2UZH A;  3MBM A;  3F0F A;  3IEQ A;  3IKF A;  3F0E A;  1W57 A;  1KNJ A;  2PMP A;  1VH8 A;  1YQN A;  3IKE A;  3FBA A;  3P10 A;  1GX1 A;  4C81 A;  3KE1 A;  5B8F A;  3K2X A;  4C8G A;  4C8I A;  1U43 A;  1IV3 A;  1VHA A;  3F0G A;  2GZL A;  3IEW A;  3K14 A;  1IV2 A;  3FPI A;  3QHD A;  1H48 A;  1W55 A;  1IV1 A;  3EOR A;  3ELC A;  3F6M A;  3F0D A;  1JN1 A;  1H47 A;  3T80 A;  1IV4 A;  3P0Z A;  4C8E A;  4C82 A;  3JVH A;  3ESJ A;  2AMT A;  1T0A A;  3Q8H A;  1U40 A; 
#chains in the Genus database with same CATH topology
 3LME A;  2HP0 A;  3B6N A;  3CC2 F;  4BY9 D;  2Q1X A;  1DT9 A;  2G9I A;  4O2B A;  2HVY D;  1IV3 A;  5G4U C;  5IJ0 A;  4DRX A;  2VAM A;  5BMV B;  1H48 A;  4I4T A;  4NWO B;  5GIO C;  4FFB B;  5HY2 A;  1TVK B;  2P6Y A;  2HS0 A;  2VAW A;  3F0D A;  3E20 B;  3HKD B;  2Z01 A;  2Z1T A;  2CVL A;  2KTU A;  2UYP A;  1X7O A;  2CSL A;  4X1K A;  3ERN A;  2UZH A;  3WGL A;  3VOA A;  3F0E A;  3ZP7 A;  4B62 A;  1GX1 A;  4EB6 A;  4EI9 A;  4TUY A;  3QHD A;  3E22 B;  2HS4 A;  5CB4 A;  2RHJ A;  3CC7 F;  4XCQ A;  1PXW A;  3NK6 A;  3OBW A;  4TZZ A;  3VI6 A;  3CCS F;  3UT5 B;  3D54 A;  5EB0 A;  4B46 A;  3JAW A;  4O4I A;  3JAS B;  2LBT A;  3VMF B;  3MCQ A;  1PF5 A;  1SA0 A;  4M8I A;  4YJ2 B;  2DT4 A;  1RA4 A;  4TV9 A;  1GO1 A;  4HNA A;  1VHA A;  2GZL A;  4YJ3 B;  2V9Y A;  4BVS A;  1ZWZ A;  1KD1 H;  4O4H B;  3PLA C;  3CB2 A;  5EWR A;  2OTM A;  1RLG A;  2VGM A;  4YJ3 A;  3ZP4 A;  3VOB A;  4IIJ B;  2QTP A;  1TUB A;  4F6R B;  2HS3 A;  3P0Z A;  4O2B B;  3N4Y A;  1W55 A;  1ODE A;  2H8E A;  5BMV A;  1M90 H;  4PWT A;  2YXZ A;  4FFB A;  1TVK A;  4U39 A;  2LBW A;  3TD4 A;  5HP8 A;  3IKE A;  1FNJ A;  3FBA A;  3NVI B;  3CXC F;  3HKD A;  3CCJ F;  3HWU A;  4G4W A;  1Q8R A;  2JNB A;  3K14 A;  3LWQ C;  2BTO A;  3S0H A;  3JCM M;  3C9T A;  1VQ7 F;  3KJK A;  1SDS A;  1JFF B;  1XBI A;  2FC3 A;  3HTN A;  4C8E A;  3WGJ A;  3VYS C;  5GAN K;  3RYF A;  5HWE A;  3HKB A;  3E22 A;  3F0F A;  5CB4 B;  3O85 A;  1W57 A;  4R40 B;  2F9Z C;  1UFY A;  3UT5 A;  3CYP B;  5HY4 A;  3LDT A;  3WJP A;  1NQ3 A;  5EB1 B;  3CCM F;  3LFO A;  5LA6 B;  5EZY A;  1NJI H;  5JH7 A;  1JN1 A;  4YJ2 A;  4NQ3 A;  3NMU C;  2IQQ A;  5IYZ B;  2AMT A;  4HNA B;  3OW2 F;  3CC4 F;  1W58 1;  3HKE A;  4BT5 A;  4O4H A;  5LOV B;  1K9M H;  2Q1Y A;  3GHZ A;  3RA6 A;  2ZOD A;  4NUT A;  1T0K B;  1X25 A;  1IPA A;  4C81 A;  4IIJ A;  4F6R A;  1TUB B;  2HX0 A;  1W3E X;  2KTV A;  3CYQ A;  3M84 A;  1Q86 H;  1X7P A;  1IV2 A;  3C9U A;  3HKC B;  3M1X A;  5LP6 C;  4X20 B;  1W5E A;  2GVI A;  2KG4 A;  3N2G A;  5GIP C;  3ELC A;  3F6M A;  2DYY A;  1H47 A;  4B5C A;  4U3J B;  3MDO A;  3LWV C;  1T0A A;  3P4E A;  1NMU B;  2CHS A;  4BVT A;  4WBN A;  2AIF A;  3CMA F;  3G4S F;  3IKF A;  3RYC B;  1YGY A;  4X3M A;  1JFF A;  4BVQ A;  5KMG A;  1U43 A;  3S0W A;  3J80 M;  1CK2 A;  5GIN C;  4LCK A;  3RYF B;  2Z1U A;  3V7Q A;  3HKB B;  3OON A;  5LYJ B;  1Q7Y H;  3ZO8 A;  3CCR F;  3RA5 A;  3CME F;  5GON B;  3SIV A;  3D00 A;  2HRY A;  2H6L A;  3CCU F;  1JY8 A;  2ZF8 A;  4X3L A;  4ZOL A;  3S0Y A;  1COM A;  5LA6 A;  2I6R A;  4BT7 A;  5EZY B;  1VH8 A;  5G4V C;  4BT3 A;  1VQL F;  3P10 A;  5JH7 B;  1YJ9 F;  3MQW A;  1Q82 H;  1VQN F;  4C8I A;  3VIU A;  3TD3 A;  5IYZ A;  5JVD B;  2W8B C;  3C9R A;  5IT9 M;  1YHQ F;  1JD1 A;  3HKE B;  5LOV A;  3JAT B;  5MN5 A;  5C8Y B;  1VQM F;  3EOR A;  4BVR A;  3S06 A;  2IAF A;  2CWJ A;  3E1Y A;  3Q8H A;  3L7Q A;  3CCQ F;  3LWP C;  1U3L A;  5CA1 B;  2Z1F A;  4G4X A;  1GO0 A;  3HKC A;  4RQO A;  4X20 A;  5IJ9 B;  3N2G B;  1YIT F;  2CZW A;  3I55 F;  3G71 F;  3K0T A;  2RHL A;  3K2X A;  4EI7 A;  1XV2 A;  3I3F A;  3S03 A;  4U3J A;  3F0G A;  3IEW A;  3QTY A;  5J2T B;  2WAL A;  3WGN A;  3CCL F;  2CW4 A;  4WBN B;  2R6R 1;  3CD6 F;  2UYN A;  3VCZ A;  3RYC A;  1CLI A;  2OTJ F;  3KHN A;  3PAF A;  5JQG B;  1RQ7 A;  2AIZ P;  5KMG B;  5J2U B;  1U3P A;  1H7M A;  3U0O A;  2RB9 A;  3JAK B;  3KIZ A;  3MBM A;  2RHO A;  5LYJ A;  1QVF F;  1W5B A;  1YQN A;  3ON1 A;  3N4Z A;  5MN4 A;  5GON A;  1YIJ F;  3JAR A;  2HRU A;  4O2A B;  5HY1 A;  5JCO A;  3BYQ A;  4BW0 B;  5GAP K;  2L26 A;  4G88 A;  3CCE F;  1VQ4 F;  3WJQ A;  4ZOL B;  2LCA A;  2ZAU A;  3JAL B;  1N8R H;  3VYT C;  3T80 A;  4G4V A;  1VQ5 F;  5JVD A;  1W5A A;  2OTL F;  1U40 A;  4I50 B;  1VQK F;  2BTQ B;  3S02 A;  3JAT A;  5MN6 A;  1XHO A;  5C8Y A;  2PMP A;  2ZVY A;  4ZK7 A;  5LP6 A;  2VAP A;  1X52 A;  2RHH A;  3VYU C;  3GYQ A;  4O4L A;  5FNV A;  5B8F A;  5LXT A;  3CPQ A;  3FPI A;  5CA1 A;  5EYP B;  4X1I B;  5FJ4 C;  2N48 A;  3OBY A;  5ITZ B;  5IJ9 A;  3TD5 A;  4G4Y A;  3C9S A;  1VK3 A;  1CN7 A;  2OZB A;  1QVG F;  1OFU A;  5J2T A;  2YYE A;  2Z1E A;  3WXM B;  3G6E F;  2ALE A;  4B45 A;  2UYN B;  3RYI A;  2MQE A;  3WGK A;  1ONI A;  4I55 B;  3HJW C;  3DC2 A;  1VQP F;  4IHJ A;  5JQG A;  2UYJ A;  4ZI7 B;  1YJN F;  2QI2 A;  4ZHW A;  5J2U A;  5DCV A;  3JAK A;  4KWE A;  4O4J A;  5EO3 A;  3SIU A;  1J7H A;  1DBF A;  4ZHY B;  4LNU B;  3C8L A;  2IG8 A;  3NK7 A;  1FNK A;  3JAR B;  2VGN A;  3LWO C;  3V7E A;  4O2A A;  1QAH A;  5HXU A;  1JJ2 F;  1VQ8 F;  1KNJ A;  3JAL A;  1FSZ A;  2NMU A;  3LYB A;  3WGM A;  4BT4 A;  4ZHQ B;  2PHN A;  3FD6 A;  1QD9 A;  4I50 A;  2H8C A;  1VQO F;  3R0P A;  1UI9 A;  1YJW F;  2LBX A;  2VXY A;  5LP6 B;  3MCA B;  3FFM A;  5KX5 B;  3CCV F;  4O4L B;  5FNV B;  3GTZ A;  4ZHV A;  5LXT B;  1S72 F;  1VQ9 F;  3RYH B;  5CA0 A;  3DDN A;  4E6E A;  5EYP A;  2OHW A;  4X1I A;  1Z5V A;  4RHA A;  3IEQ A;  3KJJ A;  1FFX B;  5ITZ A;  3WPX A;  3LWR C;  3N2K B;  1SZQ A;  3VTI C;  3IMP A;  3ZOP A;  5HY0 A;  1Z5W A;  1VQV A;  4TV8 B;  4X1Y B;  2CHT A;  3NVK E;  2HP0 B;  5FLX M;  1IV1 A;  2K1S A;  1VQ6 F;  3RYI B;  4I55 A;  5EAZ A;  4BT6 A;  3CPW F;  2ZVZ A;  1K73 H;  3AGK A;  1E7K A;  3K12 A;  1IV4 A;  4IHJ B;  1Q81 H;  1XRG A;  4DXD A;  4ZI7 A;  3RE3 A;  4DRX B;  5IJ0 B;  1YI2 F;  1KNK A;  1QU9 A;  4I4T B;  1GZ0 A;  1RQ2 A;  5EIB C;  5HXZ A;  5EIB D;  1W40 A;  3WPW A;  4O4J B;  3V4D A;  3QUW A;  4C4W C;  1W42 A;  4LNU A;  2ZOV A;  4C8G A;  3J81 M;  3HAX D;  1OAP A;  4BT2 A;  2BTU A;  3M4S A;  4X1K B;  1W5F A;  1M1K H;  1RLU A;  3JAM M;  2BO1 A;  5A2Q M;  3D01 A;  2R75 1;  2HQS C;  4EB6 B;  2QA4 F;  4TUY B;  2UYK A;  3ESJ A;  4ZHQ A;  3I56 F;  1KQS F;  1W41 A;  2GLZ A;  3VO8 A;  5HP7 A;  1W2B F;  1W59 A;  3IR9 A;  1KC8 H;  3KE1 A;  5KX5 A;  1K8A H;  2FGY A;  2I6D A;  4G4Z A;  4ERH A;  3RYH A;  2EWC A;  3JAW B;  4O4I B;  3JAS A;  3V3T A;  5CA0 B;  1R1M A;  3J7A R;  3FD5 A;  1FFX A;  4X1Y A;  4EI8 A;  1SA0 B;  3N2K A;  5AVM A;  2KGW A;  3I7T A;  2QEX F;  4TV9 B;  3WJR A;  4C82 A;  3CG6 A;  5JCO C;  3JVH A;  4TV8 A;  2B33 A;  2HP3 A; 
#chains in the Genus database with same CATH homology
 3RE3 A;  1U3L A;  1KNK A;  1JY8 A;  1U3P A;  3ERN A;  3B6N A;  3GHZ A;  2UZH A;  3MBM A;  3F0F A;  3IEQ A;  3IKF A;  3F0E A;  1W57 A;  1KNJ A;  2PMP A;  1VH8 A;  1YQN A;  3IKE A;  3FBA A;  3P10 A;  1GX1 A;  4C81 A;  3KE1 A;  5B8F A;  3K2X A;  4C8G A;  4C8I A;  1U43 A;  1IV3 A;  1VHA A;  3F0G A;  2GZL A;  3IEW A;  3K14 A;  1IV2 A;  3FPI A;  3QHD A;  1H48 A;  1W55 A;  1IV1 A;  3EOR A;  3ELC A;  3F6M A;  3F0D A;  1JN1 A;  1H47 A;  3T80 A;  1IV4 A;  3P0Z A;  4C8E A;  4C82 A;  3JVH A;  3ESJ A;  2AMT A;  1T0A A;  3Q8H A;  1U40 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...