2PMPA

Structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from the isoprenoid biosynthetic pathway of arabidopsis thaliana
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
160
structure length
160
Chain Sequence
TLPFRIGHGFDLHRLEPGYPLIIGGIVIPHDRGCEAHSDGDVLLHCVVDAILGALGLPDIGQIFPDSDPKWKGAASSVFIKEAVRLMDEAGYEIGNLDATLILQRPKISPHKETIRSNLSKLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVILLMKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Biosynthesis of isoprenoids in plants: Structure of the 2C-methyl-D-erithrytol 2,4-cyclodiphosphate synthase from Arabidopsis thaliana. Comparison with the bacterial enzymes.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Lyase
total genus 50
structure length 160
sequence length 160
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 2pmpA00
3B6NA 3IKFA 1JN1A 3ERNA 1U3PA 4C81A 4C8EA 1T0AA 1GX1A 1U3LA 1U40A 3T80A 3Q8HA 1IV2A 3FBAA 1W57A 3QHDA 3FPIA 3EORA 2GZLA 1H48A 3P0ZA 2PMPA 1IV3A 1H47A 3IEQA 3IEWA 2AMTA 3P10A 1YQNA 4C8IA 3F0FA 3F0GA 3JVHA 1VH8A 3K14A 1KNJA 4C8GA 1VHAA 3ESJA 3MBMA 3IKEA 5B8FA 2UZHA 1KNKA 3K2XA 3ELCA 1IV4A 1U43A 1W55A 3GHZA 3RE3A 4C82A 3F6MA 3F0DA 3KE1A 1JY8A 1IV1A 3F0EA
chains in the Genus database with same CATH superfamily
4YJ3B 2FGYA 4R40B 3T80A 1ODEA 3NMUC 1JFFA 4BVQA 1W5AA 3JCMM 1H7MA 3G71F 5J2TA 4E6EA 1W41A 3JAWA 2UYNB 1IV3A 5CB4B 3RYHA 2Z1TA 1FSZA 3I3FA 3P10A 1RQ7A 3VYSC 3CCRF 3N4ZA 2HP0A 4X1YB 4X1YA 1QAHA 5G4UC 2UZHA 5EWRA 1Q8RA 5J2UA 2RB9A 3WPWA 2BO1A 1W5FA 3VTIC 3WPXA 4BT3A 5GONA 2ALEA 5JH7A 1QVGF 3HWUA 2CW4A 4O4LA 4I55B 4DRXB 4I55A 4O4JB 3S0YA 2PMPA 2K1SA 2KGWA 3V4DA 1VQKF 3IMPA 2HVYD 2OTMA 3JASB 4B46A 3UT5B 3QTYA 4U39A 1Q82H 1DT9A 3C8LA 5LP6C 3OBYA 3M84A 5EZYA 2IAFA 3WJPA 1QD9A 1Q81H 3E22A 1KD1H 2IQQA 1VQ6F 3F0FA 3DDNA 5HWEA 1FNJA 5ITZA 4F6RA 1T0AA 4X1IB 3J80M 2BTQB 1IV2A 2VAWA 3TD5A 4BVTA 3KJJA 4ZI7A 3FPIA 4BVRA 2I6RA 1H48A 5EB1B 1Z5VA 1TVKB 4X1KB 1TVKA 5GAPK 1H47A 1NMUB 4BT4A 4ZHVA 2EWCA 1W40A 1FNKA 3I55F 3CB2A 2Z1EA 3IKEA 3CCLF 4ZHQB 3J7AR 1KNKA 1NQ3A 2I6DA 2ZAUA 3CG6A 1IV1A 4LNUB 4LNUA 3ZOPA 1GO0A 5LOVA 3Q8HA 3NK7A 5HY1A 2WALA 4EI9A 2B33A 2DYYA 4B45A 1PF5A 2QI2A 3VIUA 1XV2A 2HS3A 3C9TA 5HY0A 2HS4A 4X3MA 3GYQA 3MBMA 3WGNA 1PXWA 2HRYA 1OAPA 5G4VC 1W5EA 4G4YA 5IJ9A 1X25A 4TUYB 3VI6A 3CCJF 3LWQC 5EYPB 3PAFA 5EO3A 4C81A 5GIPC 4I50B 3FD5A 4C8EA 3CMEF 3V7EA 3GTZA 4B5CA 2CHSA 4YJ2B 3N4YA 3CCVF 2VAPA 3OONA 4M8IA 4ZHWA 3HKDB 3HKDA 2N48A 3HKCB 1N8RH 5AVMA 1YQNA 3LMEA 4LCKA 3NK6A 1VQ8F 5LP6B 1E7KA 2KTUA 5HXZA 3CC4F 2Z1UA 3K2XA 1J7HA 2DT4A 2ZVZA 1TUBA 3ERNA 1U3PA 4IHJA 3V7QA 4TZZA 1GX1A 3D54A 3VYTC 2PHNA 3VOAA 1JFFB 3N2GA 4BT6A 5J2TB 3JAWB 3LWPC 1Q86H 5HP8A 3RYHB 1VQ9F 3CCQF 1FFXB 1FFXA 1KNJA 2MQEA 4C8GA 1YITF 4I4TB 4I4TA 2HP0B 3SIVA 4C82A 4EI7A 3D00A 4TV9A 3WJQA 1VQMF 3AGKA 1K73H 5J2UB 4ZHYB 3F0EA 3WGJA 3HAXD 3TD3A 5GONB 1GZ0A 3RYCA 5JH7B 3N2KA 4O4LB 1RLUA 3P0ZA 4ERHA 2HQSC 1X52A 3E20B 3L7QA 2ZF8A 3DC2A 3K14A 4G4VA 5IYZA 2CWJA 5JVDB 5JVDA 2KG4A 3ON1A 3ESJA 3WGMA 3WGLA 1ZWZA 1W55A 1SA0A 5EAZA 5EZYB 3E22B 3RYFA 3JATA 1VQ4F 1T0KB 2VXYA 3C9RA 1GO1A 5ITZB 4F6RB 3JARA 5CA1A 5MN4A 4BW0B 4ZI7B 5HP7A 5CA0B 5CA0A 3I56F 5GIOC 3OBWA 1XBIA 2P6YA 3JVHA 2Z1FA 2NMUA 3VCZA 3JAKB 4G4WA 3CYPB 3JAKA 1XHOA 5IJ0A 2BTUA 5JCOA 1KC8H 4C4WC 3LWVC 2UYKA 1IV4A 2RHLA 5KMGB 5KMGA 4EI8A 3S03A 5EIBD 3I7TA 1YHQF 5LXTA 5FNVB 4FFBA 5FNVA 1VQOF 1X7PA 1ONIA 3HJWC 5LOVB 3OW2F 3HKEA 4BT5A 3JALB 3JALA 2QA4F 1JD1A 3O85A 2AMTA 3BYQA 4C8IA 3CYQA 1M90H 2GLZA 3G6EF 2OTJF 2LCAA 1S72F 3J81M 2CHTA 3SIUA 1VQVA 2H6LA 3D01A 2G9IA 2R751 5IJ9B 5KX5A 2OTLF 4U3JB 4U3JA 1OFUA 2HS0A 3MCQA 1VQ7F 1UFYA 3MDOA 3RYIA 5A2QM 1K8AH 1U3LA 3K12A 3QHDA 2CVLA 1W2BF 4ZOLA 2HX0A 2YXZA 2RHOA 2QTPA 4WBNA 4BT7A 4B62A 3WXMB 1VH8A 2LBWA 3KIZA 5MN6A 3CC2F 4TV8B 1VQLF 4TV8A 3MQWA 5JQGA 1QVFF 4O2BA 4RQOA 5JCOC 1YJWF 3KHNA 1X7OA 1U43A 2KTVA 3F6MA 3LYBA 3C9SA 3KE1A 2OHWA 1TUBB 2ZVYA 2F9ZC 4IHJB 1COMA 1KQSF 1DBFA 5LA6A 3WGKA 1W57A 4O4IA 2HP3A 3N2GB 3P4EA 4HNAA 3IEWA 4NQ3A 2RHHA 3FFMA 3S02A 2JNBA 4IIJA 3ZP4A 1CLIA 3C9UA 1W581 3ELCA 1VQNF 1K9MH 4TV9B 5EB0A 1YGYA 4EB6B 4PWTA 4YJ3A 5C8YA 4EB6A 5C8YB 3CCEF 3LFOA 2QEXF 4NUTA 3RYCB 2FC3A 3EORA 3N2KB 3CXCF 1YJNF 2UYNA 4ZK7A 5CB4A 4DXDA 1QU9A 1NJIH 3CCMF 3FD6A 1UI9A 3VYUC 2IG8A 3JAMM 5IYZB 3S0WA 3LWRC 1YJ9F 5FLXM 2H8EA 3M1XA 1CK2A 3KJKA 5B8FA 5MN5A 1CN7A 1SA0B 3F0DA 2GVIA 5GINC 2OZBA 1JY8A 3RYFB 3JATB 1JN1A 4BVSA 2LBXA 3CD6F 3ZO8A 3JARB 4DRXA 3U0OA 2H8CA 5CA1B 4O4JA 2GZLA 3S06A 2AIFA 5GANK 3NVIB 4G4XA 3CC7F 3QUWA 3CCSF 4G88A 3JASA 3UT5A 1SZQA 2HRUA 4NWOB 1VHAA 3PLAC 5IJ0B 3CPQA 3GHZA 2Q1XA 5LXTB 3RA5A 3VO8A 4FFBB 2BTOA 4X1IA 3S0HA 3G4SF 1RLGA 1W59A 3HTNA 3VMFB 3HKEB 4G4ZA 2AIZP 1YI2F 3MCAB 4X1KA 3RA6A 4X20B 4X20A 1VQPF 5LYJB 5LYJA 3VOBA 2W8BC 1Q7YH 3WJRA 4ZHQA 3CMAF 2Q1YA 3K0TA 5KX5B 1VK3A 5HY4A 1W5BA 1W3EX 3RYIB 2ZODA 5EIBC 3FBAA 1RQ2A 2R6R1 4BT2A 3HKBB 1Z5WA 3HKBA 3LDTA 4ZOLB 3V3TA 4WBNB 5BMVB 5BMVA 4BY9D 3F0GA 4O2AB 4O2AA 2CZWA 2RHJA 1SDSA 3ZP7A 5JQGB 1M1KH 3E1YA 2VGMA 4O2BB 1YIJF 2UYPA 4TUYA 1RA4A 2V9YA 3R0PA 1JJ2F 5EYPA 3B6NA 3IKFA 3NVKE 2VAMA 4I50A 1IPAA 2UYJA 5IT9M 5DCVA 1U40A 4KWEA 3CCUF 3CPWF 5LA6B 4YJ2A 2L26A 2ZOVA 3M4SA 2VGNA 4O4IB 1VQ5F 5HY2A 3HKCA 3IR9A 4HNAB 3IEQA 3TD4A 5FJ4C 5HXUA 1W42A 4RHAA 5LP6A 4XCQA 1XRGA 4O4HB 4O4HA 4IIJB 3LWOC 2CSLA 1R1MA 4X3LA 3RE3A 2LBTA 2YYEA 2Z01A
chains in the Genus database with same CATH topology
3B6NA 3IKFA 1JN1A 3ERNA 1U3PA 4C81A 4C8EA 1T0AA 1GX1A 1U3LA 1U40A 3T80A 3Q8HA 1IV2A 3FBAA 1W57A 3QHDA 3FPIA 3EORA 2GZLA 1H48A 3P0ZA 2PMPA 1IV3A 1H47A 3IEQA 3IEWA 2AMTA 3P10A 1YQNA 4C8IA 3F0FA 3F0GA 3JVHA 1VH8A 3K14A 1KNJA 4C8GA 1VHAA 3ESJA 3MBMA 3IKEA 5B8FA 2UZHA 1KNKA 3K2XA 3ELCA 1IV4A 1U43A 1W55A 3GHZA 3RE3A 4C82A 3F6MA 3F0DA 3KE1A 1JY8A 1IV1A 3F0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B6N A;  3IKF A;  1JN1 A;  3ERN A;  1U3P A;  4C81 A;  4C8E A;  1T0A A;  1GX1 A;  1U3L A;  1U40 A;  3T80 A;  3Q8H A;  1IV2 A;  3FBA A;  1W57 A;  3QHD A;  3FPI A;  3EOR A;  2GZL A;  1H48 A;  3P0Z A;  2PMP A;  1IV3 A;  1H47 A;  3IEQ A;  3IEW A;  2AMT A;  3P10 A;  1YQN A;  4C8I A;  3F0F A;  3F0G A;  3JVH A;  1VH8 A;  3K14 A;  1KNJ A;  4C8G A;  1VHA A;  3ESJ A;  3MBM A;  3IKE A;  5B8F A;  2UZH A;  1KNK A;  3K2X A;  3ELC A;  1IV4 A;  1U43 A;  1W55 A;  3GHZ A;  3RE3 A;  4C82 A;  3F6M A;  3F0D A;  3KE1 A;  1JY8 A;  1IV1 A;  3F0E A; 
#chains in the Genus database with same CATH topology
 4YJ3 B;  2FGY A;  4R40 B;  3T80 A;  1ODE A;  3NMU C;  1JFF A;  4BVQ A;  1W5A A;  3JCM M;  1H7M A;  3G71 F;  5J2T A;  4E6E A;  1W41 A;  3JAW A;  2UYN B;  1IV3 A;  5CB4 B;  3RYH A;  2Z1T A;  1FSZ A;  3I3F A;  3P10 A;  1RQ7 A;  3VYS C;  3CCR F;  3N4Z A;  2HP0 A;  4X1Y B;  4X1Y A;  1QAH A;  5G4U C;  2UZH A;  5EWR A;  1Q8R A;  5J2U A;  2RB9 A;  3WPW A;  2BO1 A;  1W5F A;  3VTI C;  3WPX A;  4BT3 A;  5GON A;  2ALE A;  5JH7 A;  1QVG F;  3HWU A;  2CW4 A;  4O4L A;  4I55 B;  4DRX B;  4I55 A;  4O4J B;  3S0Y A;  2PMP A;  2K1S A;  2KGW A;  3V4D A;  1VQK F;  3IMP A;  2HVY D;  2OTM A;  3JAS B;  4B46 A;  3UT5 B;  3QTY A;  4U39 A;  1Q82 H;  1DT9 A;  3C8L A;  5LP6 C;  3OBY A;  3M84 A;  5EZY A;  2IAF A;  3WJP A;  1QD9 A;  1Q81 H;  3E22 A;  1KD1 H;  2IQQ A;  1VQ6 F;  3F0F A;  3DDN A;  5HWE A;  1FNJ A;  5ITZ A;  4F6R A;  1T0A A;  4X1I B;  3J80 M;  2BTQ B;  1IV2 A;  2VAW A;  3TD5 A;  4BVT A;  3KJJ A;  4ZI7 A;  3FPI A;  4BVR A;  2I6R A;  1H48 A;  5EB1 B;  1Z5V A;  1TVK B;  4X1K B;  1TVK A;  5GAP K;  1H47 A;  1NMU B;  4BT4 A;  4ZHV A;  2EWC A;  1W40 A;  1FNK A;  3I55 F;  3CB2 A;  2Z1E A;  3IKE A;  3CCL F;  4ZHQ B;  3J7A R;  1KNK A;  1NQ3 A;  2I6D A;  2ZAU A;  3CG6 A;  1IV1 A;  4LNU B;  4LNU A;  3ZOP A;  1GO0 A;  5LOV A;  3Q8H A;  3NK7 A;  5HY1 A;  2WAL A;  4EI9 A;  2B33 A;  2DYY A;  4B45 A;  1PF5 A;  2QI2 A;  3VIU A;  1XV2 A;  2HS3 A;  3C9T A;  5HY0 A;  2HS4 A;  4X3M A;  3GYQ A;  3MBM A;  3WGN A;  1PXW A;  2HRY A;  1OAP A;  5G4V C;  1W5E A;  4G4Y A;  5IJ9 A;  1X25 A;  4TUY B;  3VI6 A;  3CCJ F;  3LWQ C;  5EYP B;  3PAF A;  5EO3 A;  4C81 A;  5GIP C;  4I50 B;  3FD5 A;  4C8E A;  3CME F;  3V7E A;  3GTZ A;  4B5C A;  2CHS A;  4YJ2 B;  3N4Y A;  3CCV F;  2VAP A;  3OON A;  4M8I A;  4ZHW A;  3HKD B;  3HKD A;  2N48 A;  3HKC B;  1N8R H;  5AVM A;  1YQN A;  3LME A;  4LCK A;  3NK6 A;  1VQ8 F;  5LP6 B;  1E7K A;  2KTU A;  5HXZ A;  3CC4 F;  2Z1U A;  3K2X A;  1J7H A;  2DT4 A;  2ZVZ A;  1TUB A;  3ERN A;  1U3P A;  4IHJ A;  3V7Q A;  4TZZ A;  1GX1 A;  3D54 A;  3VYT C;  2PHN A;  3VOA A;  1JFF B;  3N2G A;  4BT6 A;  5J2T B;  3JAW B;  3LWP C;  1Q86 H;  5HP8 A;  3RYH B;  1VQ9 F;  3CCQ F;  1FFX B;  1FFX A;  1KNJ A;  2MQE A;  4C8G A;  1YIT F;  4I4T B;  4I4T A;  2HP0 B;  3SIV A;  4C82 A;  4EI7 A;  3D00 A;  4TV9 A;  3WJQ A;  1VQM F;  3AGK A;  1K73 H;  5J2U B;  4ZHY B;  3F0E A;  3WGJ A;  3HAX D;  3TD3 A;  5GON B;  1GZ0 A;  3RYC A;  5JH7 B;  3N2K A;  4O4L B;  1RLU A;  3P0Z A;  4ERH A;  2HQS C;  1X52 A;  3E20 B;  3L7Q A;  2ZF8 A;  3DC2 A;  3K14 A;  4G4V A;  5IYZ A;  2CWJ A;  5JVD B;  5JVD A;  2KG4 A;  3ON1 A;  3ESJ A;  3WGM A;  3WGL A;  1ZWZ A;  1W55 A;  1SA0 A;  5EAZ A;  5EZY B;  3E22 B;  3RYF A;  3JAT A;  1VQ4 F;  1T0K B;  2VXY A;  3C9R A;  1GO1 A;  5ITZ B;  4F6R B;  3JAR A;  5CA1 A;  5MN4 A;  4BW0 B;  4ZI7 B;  5HP7 A;  5CA0 B;  5CA0 A;  3I56 F;  5GIO C;  3OBW A;  1XBI A;  2P6Y A;  3JVH A;  2Z1F A;  2NMU A;  3VCZ A;  3JAK B;  4G4W A;  3CYP B;  3JAK A;  1XHO A;  5IJ0 A;  2BTU A;  5JCO A;  1KC8 H;  4C4W C;  3LWV C;  2UYK A;  1IV4 A;  2RHL A;  5KMG B;  5KMG A;  4EI8 A;  3S03 A;  5EIB D;  3I7T A;  1YHQ F;  5LXT A;  5FNV B;  4FFB A;  5FNV A;  1VQO F;  1X7P A;  1ONI A;  3HJW C;  5LOV B;  3OW2 F;  3HKE A;  4BT5 A;  3JAL B;  3JAL A;  2QA4 F;  1JD1 A;  3O85 A;  2AMT A;  3BYQ A;  4C8I A;  3CYQ A;  1M90 H;  2GLZ A;  3G6E F;  2OTJ F;  2LCA A;  1S72 F;  3J81 M;  2CHT A;  3SIU A;  1VQV A;  2H6L A;  3D01 A;  2G9I A;  2R75 1;  5IJ9 B;  5KX5 A;  2OTL F;  4U3J B;  4U3J A;  1OFU A;  2HS0 A;  3MCQ A;  1VQ7 F;  1UFY A;  3MDO A;  3RYI A;  5A2Q M;  1K8A H;  1U3L A;  3K12 A;  3QHD A;  2CVL A;  1W2B F;  4ZOL A;  2HX0 A;  2YXZ A;  2RHO A;  2QTP A;  4WBN A;  4BT7 A;  4B62 A;  3WXM B;  1VH8 A;  2LBW A;  3KIZ A;  5MN6 A;  3CC2 F;  4TV8 B;  1VQL F;  4TV8 A;  3MQW A;  5JQG A;  1QVF F;  4O2B A;  4RQO A;  5JCO C;  1YJW F;  3KHN A;  1X7O A;  1U43 A;  2KTV A;  3F6M A;  3LYB A;  3C9S A;  3KE1 A;  2OHW A;  1TUB B;  2ZVY A;  2F9Z C;  4IHJ B;  1COM A;  1KQS F;  1DBF A;  5LA6 A;  3WGK A;  1W57 A;  4O4I A;  2HP3 A;  3N2G B;  3P4E A;  4HNA A;  3IEW A;  4NQ3 A;  2RHH A;  3FFM A;  3S02 A;  2JNB A;  4IIJ A;  3ZP4 A;  1CLI A;  3C9U A;  1W58 1;  3ELC A;  1VQN F;  1K9M H;  4TV9 B;  5EB0 A;  1YGY A;  4EB6 B;  4PWT A;  4YJ3 A;  5C8Y A;  4EB6 A;  5C8Y B;  3CCE F;  3LFO A;  2QEX F;  4NUT A;  3RYC B;  2FC3 A;  3EOR A;  3N2K B;  3CXC F;  1YJN F;  2UYN A;  4ZK7 A;  5CB4 A;  4DXD A;  1QU9 A;  1NJI H;  3CCM F;  3FD6 A;  1UI9 A;  3VYU C;  2IG8 A;  3JAM M;  5IYZ B;  3S0W A;  3LWR C;  1YJ9 F;  5FLX M;  2H8E A;  3M1X A;  1CK2 A;  3KJK A;  5B8F A;  5MN5 A;  1CN7 A;  1SA0 B;  3F0D A;  2GVI A;  5GIN C;  2OZB A;  1JY8 A;  3RYF B;  3JAT B;  1JN1 A;  4BVS A;  2LBX A;  3CD6 F;  3ZO8 A;  3JAR B;  4DRX A;  3U0O A;  2H8C A;  5CA1 B;  4O4J A;  2GZL A;  3S06 A;  2AIF A;  5GAN K;  3NVI B;  4G4X A;  3CC7 F;  3QUW A;  3CCS F;  4G88 A;  3JAS A;  3UT5 A;  1SZQ A;  2HRU A;  4NWO B;  1VHA A;  3PLA C;  5IJ0 B;  3CPQ A;  3GHZ A;  2Q1X A;  5LXT B;  3RA5 A;  3VO8 A;  4FFB B;  2BTO A;  4X1I A;  3S0H A;  3G4S F;  1RLG A;  1W59 A;  3HTN A;  3VMF B;  3HKE B;  4G4Z A;  2AIZ P;  1YI2 F;  3MCA B;  4X1K A;  3RA6 A;  4X20 B;  4X20 A;  1VQP F;  5LYJ B;  5LYJ A;  3VOB A;  2W8B C;  1Q7Y H;  3WJR A;  4ZHQ A;  3CMA F;  2Q1Y A;  3K0T A;  5KX5 B;  1VK3 A;  5HY4 A;  1W5B A;  1W3E X;  3RYI B;  2ZOD A;  5EIB C;  3FBA A;  1RQ2 A;  2R6R 1;  4BT2 A;  3HKB B;  1Z5W A;  3HKB A;  3LDT A;  4ZOL B;  3V3T A;  4WBN B;  5BMV B;  5BMV A;  4BY9 D;  3F0G A;  4O2A B;  4O2A A;  2CZW A;  2RHJ A;  1SDS A;  3ZP7 A;  5JQG B;  1M1K H;  3E1Y A;  2VGM A;  4O2B B;  1YIJ F;  2UYP A;  4TUY A;  1RA4 A;  2V9Y A;  3R0P A;  1JJ2 F;  5EYP A;  3B6N A;  3IKF A;  3NVK E;  2VAM A;  4I50 A;  1IPA A;  2UYJ A;  5IT9 M;  5DCV A;  1U40 A;  4KWE A;  3CCU F;  3CPW F;  5LA6 B;  4YJ2 A;  2L26 A;  2ZOV A;  3M4S A;  2VGN A;  4O4I B;  1VQ5 F;  5HY2 A;  3HKC A;  3IR9 A;  4HNA B;  3IEQ A;  3TD4 A;  5FJ4 C;  5HXU A;  1W42 A;  4RHA A;  5LP6 A;  4XCQ A;  1XRG A;  4O4H B;  4O4H A;  4IIJ B;  3LWO C;  2CSL A;  1R1M A;  4X3L A;  3RE3 A;  2LBT A;  2YYE A;  2Z01 A; 
#chains in the Genus database with same CATH homology
 3B6N A;  3IKF A;  1JN1 A;  3ERN A;  1U3P A;  4C81 A;  4C8E A;  1T0A A;  1GX1 A;  1U3L A;  1U40 A;  3T80 A;  3Q8H A;  1IV2 A;  3FBA A;  1W57 A;  3QHD A;  3FPI A;  3EOR A;  2GZL A;  1H48 A;  3P0Z A;  2PMP A;  1IV3 A;  1H47 A;  3IEQ A;  3IEW A;  2AMT A;  3P10 A;  1YQN A;  4C8I A;  3F0F A;  3F0G A;  3JVH A;  1VH8 A;  3K14 A;  1KNJ A;  4C8G A;  1VHA A;  3ESJ A;  3MBM A;  3IKE A;  5B8F A;  2UZH A;  1KNK A;  3K2X A;  3ELC A;  1IV4 A;  1U43 A;  1W55 A;  3GHZ A;  3RE3 A;  4C82 A;  3F6M A;  3F0D A;  3KE1 A;  1JY8 A;  1IV1 A;  3F0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...