2PMQA

Crystal structure of a mandelate racemase/muconate lactonizing enzyme from roseovarius sp. htcc2601
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
367
structure length
367
Chain Sequence
KIAEIQLFQHDLPVVNGPYRIASGDVWSLTTTIVKIIAEDGTIGWGETCPVGPTYAEAHAGGALAALEVLASGLAGAEALPLPLHTRMDSLLCGHNYAKSALDIAVHDLWGKRLGVPVHELLGGALTDSVSSYYSLGVMEPDEAARQALEKQREGYSRLQVKLGARPIEIDIEAIRKVWEAVRGTGIALAADGNRGWTTRDALRFSRECPDIPFVMEQPCNSFEDLEAIRPLCHHALYMDEDGTSLNTVITAAATSLVDGFGMKVSRIGGLQHMRAFRDFCAARNLPHTCDDAWGGDIVSAACTHIASTVLPRLMEGAWLAQPYVAEHYDAENGVRIEGGRIRVPQGPGLGLTIDPERFGPPLFSAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme
publication title Discovery of new enzymes and metabolic pathways by using structure and genome context.
pubmed doi rcsb
source organism Roseovarius sp.
molecule tags Isomerase
total genus 125
structure length 367
sequence length 367
chains with identical sequence B
ec nomenclature ec 5.1.1.22: 4-hydroxyproline betaine 2-epimerase.
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2pmqA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2pmqA01
4GISA 1BKHA 1TKKA 2NQLA 3H12A 3CYJA 3IJQA 3RO6A 4G8TA 4IP5A 3IJIA 3CK5A 1KKRA 2AL2A 3PFRA 4FI4A 2POZA 2XGZA 3VFCA 1JDFA 1SJBA 2GGIA 4E4FA 1XS2A 1NU5A 1DTNA 2FKPA 3TJ4A 2OLAA 3UJ2A 2MUCA 3FVDA 3SN1A 2QJMA 1EC8A 2MNRA 2PCEA 4H1ZA 2HXTA 3UJSA 1W6TA 3D46A 3SBFA 2PGWA 3QPEA 3ENLA 5BOEA 2DW6A 2AKMA 3R11A 3BOXA 3D47A 3TW9A 3OW1A 1R0MA 3UCCA 4K8GA 1MDLA 3DIPA 1YEYA 4DHGA 2OX4A 2OZ8A 3UJEA 6ENLA 1ONEA 4Z1YA 3THUA 3ZLHA 1JPMA 2OZTA 3RGTA 3I4KA 4K2SA 3JZUA 1MUCA 4IL0A 4JN7A 3VC6A 4DWDA 4GYPA 3OTRA 3TWBA 3PWGA 3UJFA 3MSYA 3GD6A 5IDZA 3H70A 3GC2A 3MWCA 3FJ4A 2HNEA 4HCLA 3DDMA 2CHRA 2ZC8A 3N6JA 3FYYA 5J04A 4G7FA 3IK4A 2GDQA 2GL5A 5FJTA 3DFYA 3BJSA 3VC5A 3TWAA 3DG3A 3NO1A 4KPLA 3R1ZA 4J3ZA 1SJCA 1R6WA 4IT1A 3RITA 3R25A 3ZVHB 4MMWA 5FJUA 1XPYA 2GGEA 3P93A 3N6HA 3PWIA 2PGEA 2PP3A 1P43A 4DN1A 1WUFA 1MNSA 4IL2A 2AKZA 3V3WA 4KWSA 4EWJA 3ES8A 4H83A 1KD0A 3I6EA 2PODA 2GGHA 4DYEA 1JCTA 3U4FA 1SJDA 4Z17A 3V4BA 4HNCA 2OO6A 2PTZA 3UJRA 4HYRA 4GFIA 2QJNA 3VCCA 3CT2A 1PDYA 3DERA 2P0IA 4E8GA 3TQPA 1ELSA 3MUCA 3QKEA 4E6MA 3STPA 3NZGA 3QN3A 1JPDX 1EC9A 3RCYA 4FP1A 4E4UA 3UCDA 2PTYA 4IZGA 4H2HA 3EKGA 4M0XA 2QVHA 2PA6A 4GIRA 1MDRA 2OPJA 3V5CA 1E9IA 1WUEA 4MGGA 5ENLA 4X2PA 4DX3A 3QLDA 3VA8A 3DG6A 3JW7A 3KUMA 4GMEA 2GGGA 2OKTA 2PMQA 3S5SA 2XH7A 2DW7A 3SN0A 2PP1A 2GSHA 2PU1A 1TE6A 3H8AA 2I5QA 3ES7A 1KCZA 3K1GA 1ECQA 3TJIA 4K1WA 2GGJA 3SN4A 3RR1A 2PTWA 3ZVHA 3TOYA 1EBHA 4E5TA 2XSXA 3TCSA 2O56A 1MRAA 5FJPA 2PU0A 4DXKA 2RDXA 2QDDA 4J1OA 3CXOA 5FJRA 3MZNA 3OZYA 3I6TA 3FCPA 1EBGA 4H19A 2PPGA 4YWSA 1IYXA 3PK7A 4KT2A 3T8QA 3T4WA 2OQHA 3QTPA 2QDEA 1SJAA 4ZA0A 4HCDA 3CAWA 3GY1A 3N4FA 3MQTA 3NXLA 4JN8A 3H7VA 5FJOA 4MKSA 1F9CA 4HCHA 3B97A 3FV9A 3RRAA 3HPFA 3IJLA 3Q4DA 2P8BA 1FHVA 4GGHA 2AL2B 2P88A 2HZGA 3ZVIA 2PSNA 4M6UA 2QQ6A 4HNLA 3DGBA 2HXUA 4GYPC 3N4EA 3OP2A 4A3RA 4A6GA 3BSMA 2PP0A 1RVKA 2FYMA 3UXLA 1EC7A 4HN8A 2QJJA 1KKOA 1BQGA 3EEZA 3T9PA 4A35A 3VDGA 3UXKA 3R0UA 3SSZA 7ENLA 3UGVA 3DESA 4KEMA 4ZCWA 4HPNA 3DG7A 2P8CA 3CB3A 1NELA 3Q45A 3S47A 3DFHA 3V5FA 4ENLA 4F4RA 3TTEA 4GGBA 3OZMA 3JVAA 1OEPA 2PS2A 2ONEA 3SJNA 1TZZA 3ZLFA 2OQYA 5BOFA 5EU9A 2P3ZA 3MY9A 2XH0A 3R0KA 2OVLA 3SQSA 3P3BA 3R10A 2ZADA 3ZLGA 2OZ3A 1FHUA 3P0WA 3T6CA 3OPSA 4JHMA 2AL1A 4IP4A 3FXGA 2OG9A 2OFJA 1P48A 2XH2A 4ROPA 4IHCA 3VCNA 2QGYA 2XH4A 3DEQA 2PTXA 3GO2A 3NFUA 1PDZA 3U9IA 1L8PA 3MKCA
chains in the Genus database with same CATH superfamily
3RNDA 1GOIA 4PMVA 3GIPA 3B8SA 2FZDA 2XN2A 3GIYA 4G7EB 5H6HA 2XFRA 4R27A 2HDJA 3N3MA 4FI4A 3O16A 4JL2A 5CPTA 2OWWA 3TAKA 1RXOB 2XN1A 3VZYA 4XVEA 1UIPA 2WMJA 4U2YA 3ZSSA 4FEZA 3SN1A 2QJMA 3STGA 2Z2BA 2XG9A 4YHEA 3UXDA 4KMQA 2A6NA 3QPEA 3LQLA 2BVWA 2BVTA 2V3BA 4R7OA 2XM2A 2CZ5A 1RBLA 1XLKA 2J7HA 3VDAA 2E9BA 5LKYA 2A3HA 3BQ5A 4MAZA 2A6LA 1UD5A 3WMBA 2C71A 1ALDA 1A3XA 1JZ5A 3HQPA 3CUIA 2QDGA 2QMKA 3ZMRA 2ZRZA 1TYPA 5JMUA 1R86A 3Q94A 2QUUA 4K2SA 2XN0A 1Q6QA 1XW8A 1FDZA 1VF8A 3NPWA 2J75A 1KLYA 2CXEA 1TX2A 4XKMA 2F8QA 1T8QA 5IDIA 1ZGDA 4HMDA 3XINA 1WB0A 3N6JA 4JEQA 4JTSA 4PUNA 1AL8A 1DIOA 2BGNE 1UA7A 1QW7A 3DG3A 2INFA 1SPQA 2OOFA 3ARXA 4PUJA 2GQAA 4J56A 1LOSA 4GIAA 1IZKA 2X41A 1V02A 1YTKA 2DZVA 2PDYA 1H6VA 4JHOA 1UASA 3IJDA 3KZPA 2JKPA 3DN5A 2O4MA 5I3FA 2PP3A 4BF7A 2R1LA 4QJ1A 1E71M 1EJVC 3UG3A 1EJTC 3CUGA 1W3JA 3KL3A 3BLFA 4F3HA 1TIMA 4KPRA 2EPHA 4HA3A 3SGZA 1HO1A 4OOUA 3UT0A 3T40A 3GFYA 2PTZA 3UJRA 1TX0A 1X6LA 3WBEA 1M6IA 1ZBVA 3DERA 3S0CA 3W23A 1GQKA 4LVGA 3D5HA 4NRSA 1ZLPA 1UWSA 3N1AA 5ABHA 3GK0A 1XHGA 4DEFA 3P74A 1DXEA 3AUJA 2C8NA 4MOZA 4C6JA 4YHGA 1B9BA 1FWRA 1WX0A 3HPZA 3SIMA 5AHEA 1PKMA 1ZUAX 4H8UA 4NF7A 4FX9A 2OPJA 1V6VA 1KR1A 4LVDA 2YBVA 4LU0A 2GQ8A 2BASA 1MQRA 2WSRA 4J2PA 4RV3A 2YIHA 3IIXA 3I7QA 4H50A 3UG8A 5FACA 1GPFA 1VHCA 2VR2A 5K4XA 4LWWA 2G95A 4D6JA 4H4YA 1F3WA 5G5HB 1HTIA 4U31A 5IOBA 3NVWB 4K39A 5I03A 5ABFA 4OUEA 4Q6JA 1NAL1 3EOEA 4C6NA 3W7QA 1BTMA 3G2GA 1J0IA 1LPFA 3ARVA 1DOSA 2ACSA 1ZKQA 2A5HA 1Q1RA 4B15A 1VFLA 2J7EA 4NVTA 1IIHA 4QXIA 2ZTKA 3LCFA 4Y7EA 1K1DA 2DPEA 5I3HA 4EQRA 5D2TA 2ISWA 2VR5A 4JQ9A 3BLPX 3AALA 4NZCA 1P6WA 1P4CA 3O6DA 4U33A 1PJ9A 3KOYA 3VMNA 3IIOA 2WV8A 2V2CA 3WQCA 1F07A 3K46A 2CLOA 1XSJA 4EPBC 3RRXA 1CI1A 1VYSX 4JTTA 2BP1A 4MWAB 4ACZA 1G4SA 4KRZA 2IQDA 4X9SA 3MMDA 1XGZA 2ZUVA 4H01A 4WDWA 3VI2A 4M51A 1GORA 4HCDA 3M0LA 1GQIA 4ASTA 3II1A 3KOWA 1YQZA 1EPVA 5FI8A 3W7NA 4Z1DA 4PA8A 3RUBL 4PMUA 4LXFA 4RE0A 4LW7A 4B3ZA 4HMCA 4FNRA 2CKSA 3P82A 1OT2A 3N34A 2PC4A 5DY2A 3GC5A 3MS8A 4JTDA 2X1RA 3R43A 1ISXA 2OXNA 2VX7A 4IXHA 1RR2A 2OT1A 4M3PA 3FS2A 1XC4A 4AMAA 4NX5A 1OFAA 1EUAA 3N25A 3MC5A 3TR9A 2D2GA 4GQ0A 4A22A 1OB0A 2I16A 4HNOA 3UGVA 4A21A 2DVXA 1MUMA 4Q4OA 1OCJA 2JF6A 3DG7A 1MVYA 3L4XA 3RMJA 1C8VA 1NELA 1AVAA 3ZQ9A 4RXGA 1SFJA 1HJWA 2ALDA 2WZMA 3QYSA 2ZUSA 2QAEA 1PCWA 1U5VA 4GGBA 3HPSA 3NQ6A 1QDSA 1YADA 3O07A 3W7GA 2H9AA 3BE7A 2WZHA 4C1NB 1VEMA 3HG5A 1Z69A 2OZ3A 4WGHA 2V8ZA 1A3HA 4IIHA 5BZAA 3RCMA 4M1BA 1UIOA 1K7EA 2XUCA 3DKLA 1G4PA 3CHEA 2P10A 2B7NA 4Q4MA 2GQWA 4ROPA 3W1MA 5I5RA 4IJRA 1T7LA 3RPMA 1VIZA 1OYCA 2BMBA 4A8IA 5KMYA 1E0TA 4DO7A 4H6KA 4DPQA 2NQLA 2RDWA 1QPNA 3WLTA 3RO6A 3I3EA 1W37A 2YAUA 3BV7A 3OGSA 2J88A 2IXVA 3AWNA 1MW2A 1CGUA 3HF3A 3TIMA 2XGZA 4AIBA 3VNIA 3ARSA 1TPH1 4E4FA 3TJ4A 2OEJA 2D3LA 1JPHA 1GRAA 1DQUA 4I7WA 2DZPA 3LRMA 4QQUA 5A2BA 3KRSA 3U5YA 6TIMA 1N60C 2AOSA 5AYXA 3IIZA 1TV4A 3KW3A 3OLGA 3BOXA 3W7RA 4MNMA 2Y6ZA 2VWSA 3BTNA 1SR9A 3DYOA 3M7WA 1QPKA 1A5OC 3WBXA 2HV5A 3COTA 1UWUA 1MZRA 2CYGA 3E02A 1YLVA 4OWGA 4W87A 3WD2A 4K7ZA 4WD0A 1S5WA 2PRMA 3TSMA 5HMEA 4L1GA 3W7IA 3TC3A 1G67A 3BAWA 1BTCA 1CNVA 1JGMA 1EGZA 2B4GA 2BDQA 3VOGA 5CPQA 4I9MA 1MOKA 3OTRA 3FOKA 4MFDA 1YHTA 3WELA 1UOKA 4LBUA 2WHKA 1XQLA 1YTDA 2Z26A 1CZ1A 4LUTB 4PUEA 1VB9A 3UZWA 3MHFA 5K2ZA 1DIDA 1US2A 3B8WA 2J27A 4IG2B 1CLXA 3E3HA 1C90A 1J79A 3HG4A 1E0WA 3VX0A 4DJED 4F0MA 3KS5A 4ZQPA 2A79A 1V97A 1Z42A 4MY8A 2BY1A 4UMCA 1GOXA 4I9AA 3WENA 5HJLA 3IAQA 4AZ6A 2WAGA 1WYIA 2YXGA 1DJNA 1RLDA 1UQZA 4MG4A 4GYKA 3CBWA 3P93A 3VK5A 4XUYA 2PDQA 3M16A 4HOXA 4AUBA 1GKRA 3REQB 5H2ZA 2E4TA 1CGXA 5BU9A 2FZMA 4ZE5A 4XV0A 3NAVA 2JE8A 2VC6A 1O94A 1L6WA 3K2GA 5I77A 2YXOA 1NP0A 1SW0A 3LLDA 3HRDC 4YTQA 5C0QA 3D0CA 2C3DA 5U4NA 4WY0F 3HZ3A 2Y7FA 2VUYA 1GRTA 2OELA 3CYVA 3WK0A 3NTYA 5F1UA 1JCMP 3RCYA 2NSXA 1XV8A 4F8XA 1FWBC 3WUEA 3VKCA 4ZQOA 5DLCA 1RBOB 2QCDB 1QATA 3FJ6A 2GUUA 2JBMA 1UUMA 1SZGA 2WKLA 4KIEA 1G1YA 1KFWA 2BBFA 2XIJA 3VM5A 4E0CA 2J24A 4QSFA 4J28A 4IFKB 1EWEA 1PEZA 4QFUA 3SY5A 1NJJA 2UY4A 3EAOA 4H6EA 3NSMA 1FFUC 4GRSA 1WOBA 4A2RA 1ZP3A 1BYDA 3ZR4A 1T3QC 5HOSA 4JNYA 3SY1A 4IQJA 1XH1A 3LCHA 4AX6A 3L7RA 2PP1A 2GSHA 3NPUA 1JYVA 3L4VA 1REQB 4YNGA 3W7CA 1XSIA 2HS8A 3M41A 1Z8AA 3W85A 5AZ0A 3AXHA 3NQMA 3CUJA 4CU7A 2DSWA 4G5DA 3CUXA 4W88A 3TP4A 3PR2A 5DXYA 1CTNA 4PTNA 4LBSA 1EBHA 3DBNA 1VPYA 2YL6A 4JTRA 2JQXA 3EZ4A 3U2OA 5XIMA 3SQPA 5G1TA 1PHWA 1A3WA 1HJQA 2VCAA 1TV8A 4GY7A 1TO3A 2ZX5A 4MB5A 2BC0A 4AD3A 1JEHA 2X2YA 4MWAA 1OJTA 1R38A 1JRPA 2Y8UA 1J11A 2OYKA 4HHLA 3H54A 3M43A 1XICA 3L8KA 2P76A 4YTUA 3FCPA 4H19A 2QCLA 1TZ7A 2V6AA 4OE7A 1F3PA 3BO9A 2GDVA 4WY0A 2PZNA 1OCNA 4HHHA 1EIXA 4DZAA 1KTBA 2EQ7A 2WSKA 2WO5A 3TZNA 4C6EA 3B0UX 1EXPA 4UQEA 3DOPA 5K9CA 4GGHA 5GNYA 4ZXLA 4AFYA 1A47A 2F38A 2FHFA 1NM9A 3RLHA 1XC6A 2HCVA 2OWXA 2HXUA 2ZZ7A 2ZWZA 2Y62A 1MEIA 1R87A 1H7XA 4KWWA 2QEZA 3ORWA 2FYMA 1EC7A 2WNQA 3VGDA 3N14A 2GK1A 3PZ9A 1F74A 2OYLA 1O60A 4A35A 4JCLA 3A23A 4KFOA 3LNMA 4HPNA 4CLMA 1L0PA 5CZJA 1JFHA 3E2RA 2VEIA 4DF2A 3A13A 3N9RA 4W9TA 1FKXA 1DE6A 4B2DA 4UNIA 1PWLA 1ITCA 3W2UA 1NQKA 4ENLA 4UR8A 4C6MA 1WKDA 2A8XA 2YCIX 1XLFA 1OX6A 4QGCA 1BFNA 3CL6A 4CD5A 3F1QA 4ZB0A 1XYFA 1FDJA 3SQSA 4JDRA 2ZZ5A 3S2LA 1TWSA 4ZFCA 1XUZA 3ZLGA 2IPWA 4TX6A 5GPRA 3OOQA 1OD0A 4LC6A 4XO6A 3GXMA 1A50A 2TYSA 2QAFA 2WVVB 3WNMA 2I7GA 3GU2A 5AC5A 4DB7A 3WNNA 4MSSA 3MP5A 3CGEA 4JR5A 5BNKA 4CCEA 3NFUA 3SDOA 4NZ3A 1SB3B 4HP5A 4UZSA 2VEMA 2CLMA 1AK5A 4GKTA 1TKKA 2J7GA 3EOLA 5D33A 2QCNA 1V7YA 1R8LA 1KCXA 1FWNA 3TEVA 2CKRA 2QCHA 1NTHA 3FIGA 1BWKA 4RE3A 3TTSA 2XSBA 1JULA 1XS2A 1S5MA 3G3DA 4B9ZA 3K30A 2YYTA 1YRRA 3NL2A 4Q8NA 5AHMA 3ABOA 1MFUA 1SW3A 4O53A 4H7VA 1EC8A 3GAYA 4FOKA 4H7CA 1R2TA 3C0SA 1YXYA 5KZDA 1PO9A 3TJLA 1XGEA 3WNLA 4HNVA 4WKAA 1V0LA 4IUGA 3CZJA 3CIVA 2CLKA 4JYEA 2VJXA 2Q6ZA 3AIQA 5LXEA 1BWVA 4LUYA 2GSEA 2A7NA 1AD4A 4MNJA 3R58A 3THCA 2OX4A 3EDEA 6CGTA 2ZBTA 2OZTA 4OKDA 4RDZA 4U4MA 1VBGA 2WWDA 1D8WA 3BC9A 5CZ0A 1YE4A 4IL0A 3W72A 1DJHA 2D1ZA 1TCDA 3QFBA 1O5KA 1XLIA 2HNEA 1D2KA 5F2IA 1K70A 1IR2A 3SW6A 2B0MA 1FCBA 1WKYA 4DZHA 2WOVA 1JFXA 4H4PA 1FHLA 1RCOB 4QG6A 3LLFA 4DWSB 2W3ZA 3VD4A 1FWSA 4KPLA 3BOFA 1XLEA 4LUIA 3Q37A 3AICA 4Q8WA 4RL3A 3B04A 3W6LA 5I00A 3VIPA 1EJWC 4WSJA 3N9SA 3WLSA 3KS6A 3D9XA 3VM7A 3CASA 4DBSA 3REQA 3CHFA 2W0UA 4GKLA 5LA2A 1ISZA 1ZBCA 3VIKA 5CG7A 1K03A 3G1XA 4IIBA 3E5PA 4FZIA 2BOEX 2V69A 1UMYA 5CAKA 3WLPA 3S46A 1TWZA 3EKLA 3FA4A 4HNUA 3I6EA 2PODA 3IJ9A 3NQVA 3WFAA 2FPTA 2PBOA 1BG4A 1P0KA 5HPOA 3PNZA 5C5YA 4NAEB 1RP9A 4ACYA 5DMNA 5EGRA 3H2AA 3TC7A 2A3EA 4AQLA 3BG9A 3NL5A 3GXDA 4XB3A 3EKZA 4MAVA 2BGQA 5HUOA 4WDTA 1V5XA 2QULA 3EANA 4KKXA 3I65A 3R4IA 3VVGA 2VDHA 1PX4A 5AHNA 2RGMA 4JIEA 3VCRA 2YB1A 2J8TA 1GERA 2VZVA 4H6QA 4EMJA 3WEZA 2WNWA 5EKYA 2WK2A 3KDNA 2VNCA 4DQWA 1E9IA 3IVUA 3XISA 5DMLA 5IHSA 2ZE3A 3A21A 2G97A 4PB4A 1W5PA 2W61A 3GLCA 3KUMA 4HOZA 4CN1A 2VOTA 3URHA 1GEHA 3UU0A 4JKMA 1TTPA 1IXQA 1I2NA 4DUOA 3W7EA 4ZMGA 5FEXA 2FGZA 2W27A 3L2LA 1UKOA 4LAUA 1EP3A 2P5NA 3USZA 3H22A 1MQQA 3LERA 3BVJA 2DSZA 1RY8A 3P62A 3S1WA 1KO0A 2ZX8A 1GWJA 1LDCA 1NDVA 4XZ9A 5E0CA 1Q2RA 1QI2A 4KBXA 4TTUA 4E2DA 1T40A 5D9PA 1XDMA 3GTHA 3MU7A 3WBAA 3AU6A 3AHYA 1VLWA 2DH2A 2YB4A 3PJTA 3ABRA 4IQLA 4EP8C 4JY8A 1A80A 1N55A 2V0TA 3MHUA 2A21A 1SZNA 4X2RA 3LPFA 4GACA 5EFFA 1RALA 1LG2A 4ICNA 3QOMA 2OCZA 4IMCA 2NQ5A 2E3TA 2WJEA 1Q6OA 4C1KA 5FJJA 3EMZA 4OGZA 4J1OA 4QP0A 2Z24A 5A6BA 1JUEA 5M5DA 1XKYA 1AW2A 2WHJA 3GH7A 5L6UA 2EPLX 1HKJA 2I5GA 1ZP4A 3KFTA 5HPCA 5LGXA 2A3AA 4D1IA 3K5XA 4APNA 3HQ1A 3F4DA 1KLZA 1ZL1A 2WPEA 4W85A 1IT8A 2PD9A 2Y70A 1GJPA 4GOAA 4NRRA 1BEUA 1LP6A 3QY6A 2Q8XA 2CEQA 4XTDA 3WK3A 3MQTA 4ICCX 5HMSA 3N6QA 1IEXA 3GG8A 1QK2A 1H2JA 4JTLA 5DBTA 2EO7A 3UG4A 3WBWA 2WBGA 2DEPA 1UCWA 1XD1A 1FOBA 3MZ2A 3W1XA 2ZZ3A 1NY1A 1XPGA 2WWCA 1I60A 5KINA 1YMYA 4BWLC 1RJPA 3AYVA 4YYFA 1YBQA 4EX4A 3T81A 3UXKA 3LCIA 1J0YA 5A94A 3R89A 3S1VA 2AQOA 2IUZA 3S47A 2ZXQA 3QMSA 4JFUA 3LBCA 3FNDA 4L4MA 1Q4WA 1X2GA 1V03A 1W3NA 4L1WA 4ONVA 4XZIA 2PS2A 3HG2A 3SJNA 1P0NA 1NQ6A 2IPJA 4HSOA 5BOFA 5GRTA 5F4SA 1YYAA 3LSBA 3TSBA 1K8YA 3CHVA 1TB3A 2KZHA 3V16A 3PTQA 3URBA 2X1IA 1A53A 2GJPA 5HINA 3ABQA 3F2BA 4JEJA 2HBXA 5HK4A 3UZ5A 2WVUA 4CQ8A 5F2LA 1JF6A 1UYQA 2XH2A 4IHCA 4Q8VA 4WOZA 4FS9A 1IZJA 3F4WA 4ZO8A 4ADTA 2ALRA 3S1XA 1IGWA 1B57A 1IXPA 2ZA2A 5TQLA 3WL1A 4PN2A 5B7ZA 4B90A 2WM0A 3IJQA 4AY1A 3MMWA 2RHGA 3LCLA 4BF5A 1YDOA 4HSNA 2OT0A 4EM4A 2AL2A 3RILA 1Q13A 3R2GA 4MIMA 1FFVC 2DJLA 3II4A 1A0DA 3GE7A 1K77A 4S3DA 4DJEC 2D2OA 5XIAA 3FGCA 2FDMA 2PDXA 1S2TA 3SGUA 3TQVA 4AZGA 3UR8A 3SRDA 1E6SM 1I2RA 4PUDA 2A3CA 4XD6A 3R5EA 3PZGA 1XIEA 2RH9A 3SUSA 4XZNX 2J79A 3TFXA 4AD2A 5JCLA 1XIBA 1DWJM 1MW3A 1R0MA 4EMIA 1XYCA 1YDVA 1XIMA 2FFIA 3R94A 4V33A 5ABGA 1AMYA 1HKVA 4O8RA 3A47A 4INFA 5JQ9A 3VZXA 3SCVA 2A7RA 1TV3A 4LAMA 2VZOA 3RGTA 1SMDA 2EBNA 3H2CA 4LF1A 3ANVA 2J4GA 5E0KA 5ABTA 1EF2A 3PZOA 1UA3A 1ME9A 1MQPA 4L6OA 4PRTA 3HFTA 4JAWA 5JXQA 3AS3A 3EGJA 4AIEA 4D9PA 3GC2A 3MWCA 3LM7A 1UW9A 2CZEA 3GKAA 3APGA 1GOOA 1EA9C 3SUTA 2CC0A 2R1MA 3A24A 4QG9A 2P0OA 2W79A 3MW7A 1S5NA 3Q65A 3T55A 5AFDA 1MRQA 4OFCA 3SR6B 3ZO9A 5CPOA 3AIEA 4J3ZA 3RIKA 4BEUA 1GQJA 3B3DA 4EPEC 3RU8X 7PTDA 1SO3A 3GM8A 1YW1A 1XR2A 3OU8A 3RK8A 4Z0SA 5CXPA 4X3ZA 1XLBA 2F6XA 4KS0A 5DCEA 3W1UA 3AC0A 2PURA 1Q4NX 2A85A 2G8ZA 2CLIA 1GTEA 4Q33A 1JYNA 2R91A 1S46A 4GUHA 4DYEA 4S3EA 1HQTA 3RXZA 2OO6A 3VKKA 4HYRA 4CQAA 1XLCA 3RDKA 4HHMA 1GKPA 2QNEA 4PTMA 5KZ6A 4C6LA 1SFSA 3DX5A 1TPWA 1LWIA 2ZYFA 4E6MA 2VYOA 3QZ6A 2QJGA 4BV6A 1SGJA 2EPNA 3KVLA 4CKQA 3WK1A 1TWWA 5F4WA 1ODUA 1CXEA 4KCWA 4L6DA 4O1FA 1DJYA 3PZUA 4DRSA 4HU8A 3BAYA 2UY5A 2ACQA 2Y5EA 1UP0A 3FVMA 1JL8A 3TN4A 3BJFA 4GX9A 5FCZA 2JK2A 2PE4A 1A5NC 1IEIA 2ANUA 4MTVA 3AO0A 3QLDA 3EPNA 3NYDA 3UWEA 3LV5A 4LBRA 1E55A 3EXTA 1KRCC 4DUXA 3CMFA 5GNXA 1V0MA 1S2VA 1BYCA 4BHYA 5KETA 3PFMA 1J18A 3HO8A 4OBTA 1VS1A 1TR1A 2BHYA 4PZVA 4GABA 5U1OA 2AMXA 3CZEA 4H4QA 5CPSA 2PD5A 1LQ0A 2QV4A 1M03A 1O12A 5I78A 1G01A 2O92A 1WDQA 1KCZA 4H9TA 4GA8A 3DJGX 4O19A 4H9YA 4GCXA 5D8ZA 1WPCA 5EMLA 3W7PA 2PTWA 4DUWA 1GRHA 3CIWA 2YOCA 4N4QA 3U48A 4GBUA 4GR1A 2XSXA 3NPVA 3QQWA 4QS6A 3TNBA 3W22A 1W8GA 4YVXA 2QDHA 3EX3A 2D3NA 1H51A 3AIWA 2DT2A 3GNRA 4D71A 1S2AA 4AZCB 4L80A 4Z2JA 5D9MA 1EQPA 3MZNA 3L23A 3TKFA 4HA1A 1M7OA 2PDWA 4QNEA 3NQDA 3PK7A 3LUTA 4JX5A 4UFHA 3NSXA 1VP5A 2E6DA 1ZAHA 3C2FA 5REQB 3T4CA 1KFLA 3AJ7A 3CL8A 1M7XA 2ZIDA 4B91A 3H23A 3LDVA 3N4FA 3NXLA 3LGDA 4O13A 2JGQA 4S3CA 1TJPA 1XDJA 3GRIA 4Q4RA 4WKFA 2ZRVA 2VX5A 3BJTA 3IGHX 3PBVA 2OO0A 2NT0A 4P7LA 3CGBA 4Z2LA 2ZCGA 4I9JA 3DCPA 2NXIA 3SCWA 4GYPC 4CQCA 1WBJA 3ANYA 3NA8A 4FSAA 1XBZA 3EWDA 3T2PA 2VM8A 4K68A 4JYDA 1R7AA 3UWVA 3W88A 2VO5A 4V1XA 2WMFA 1GW1A 2OYMA 1C8QA 1ZQ5A 4GE8A 4S2BA 3K8KA 2AAMA 1FDYA 3O06A 1P7TA 3HN3A 4I7UA 4KWUA 4LVFA 1XHCA 3GDKA 2WP6A 1L6SA 1KB3A 3W1NA 5G5GB 5JRBA 3SUUA 4UNKA 3O15A 3TN3A 4P8XA 1KTCA 3H4GA 2BNJA 1M53A 4XZWA 1GVOA 1W1ZA 4UIOA 3TLQA 4OVXA 3MV01 3WD4A 3HG3A 5AYBA 1XYLA 2H90A 1JJKA 3MY9A 3M0IA 2BLEA 2IMRA 3IRSA 4UQCA 3LZ3A 1NWUA 1DL3A 3E12A 4HK5A 1GG1A 2ZADA 1UPMB 2PDUA 1FHUA 4LCRA 3P0WA 1MO0A 1KA9F 1P6CA 2VD9A 1L6GA 2QR6A 4FIRA 4LCQA 1ZFJA 1TSIA 4TR9A 3C0JA 4NNCA 2OG9A 4L7ZA 4IJCA 2PWHA 2A4AA 1LOLA 3GD3A 1R9ZA 4NZ1A 3AI0A 4DJDA 2J74A 4BA0A 2QGYA 5A6JA 1RK6A 4HOWA 3M6YA 2A7PA 2EPOA 1L8PA 4PMNA 4EE9A 1KGXA 3LHTA 3PF3A 2J25A 4B5XA 5EMJA 2E9MA 4HA0A 3H12A 1HZYA 2YL9A 4WZHA 3A4JA 3QFAA 4AX7A 3TC6A 3VD9A 1B90A 1TQXA 5AC6A 4G2DA 1MFVA 3TVAA 1AQMA 4GQRA 1H0GA 4H7ZA 3H4KA 3A9BA 3RHGA 2ATMA 5HWNA 5E09A 4UBPC 4F79A 1N63C 4J3TA 3RX2A 4IGMA 4POCA 4ALDA 1DPMA 3CH0A 1OY0A 2VXNA 3STEA 2PFHA 1STZA 4B16A 1AJ2A 1ONWA 5BOEA 4ES4A 3UF9A 2AKMA 2BODX 2XIOA 3WLKX 3GXFA 3G1RA 4AISA 4H4WA 1XLAA 4AVOA 2JGYA 3VGHA 3F4NA 4JIHA 3QZEA 5FESA 2EXOA 4IFRA 5A69A 3W4RA 1UWQA 3VDHA 1FCQA 1QPRA 1SO4A 3T08A 7TAAA 3W86A 2EG7A 3ZR5A 4TX9A 3NQGA 1MSSA 1KFJA 2FVLA 1CT5A 4O1AA 2E0PA 3PWGA 2WOIA 4EQXA 3UETA 4X0VA 3UJFA 4K8HA 1W31A 5EY5A 5HNNA 2Z1XA 5AY7A 1FEAA 2R94A 1AQFA 3P8IA 4O17A 1BRLB 3WBYA 3F03K 1HW6A 1JCNA 1GJWA 4PODA 3N13A 1RPKA 1UQYA 4URIA 4A2SA 1B3VA 7CGTA 4XAPA 3B8IA 3M5XA 3TU9A 4GVIA 2GJLA 4MJ2A 3WDJA 4C6KA 3PAJA 5LNUA 3KEHA 2OB3A 1JD9A 4CNPA 5AC4A 4FK9A 1XPYA 1KFBA 3OA3A 4HGXA 4E8CA 4NJKA 2PGEA 1KCKA 5G2HA 4NXKA 2PDMA 3LI1A 1OM0A 3AMDA 1NDAA 3P60A 4IL2A 2AKZA 3PC0A 4KWSA 5D09A 1YPFA 3IPWA 3TAOA 4TOQA 4KF1A 3VAVA 3U7VA 4O1BA 1ENUA 2YZ5A 3ARYA 1WKEA 3K4WA 3POCA 1EJ7L 3PBGA 1DXFA 3PP7A 3RU6A 4FPSA 1MW0A 4DO5A 1V3MA 3PBYA 2OEMA 3QW3A 2Y89A 2W5FA 3PAOA 4BZYA 1K9FA 3QKEA 1U1HA 4US5A 3DHPA 5BMXA 5H1WA 4NZJA 3ARRA 4GBDA 3W71A 3QHNA 2PDHA 3PB2A 3BANA 3E38A 2HVNA 3M6DA 3NVZB 3LA4A 1LL6A 1XWYA 1Q66A 1W9BM 3Q58A 1PYFA 3U8GA 1V0NA 2G3IA 1EZWA 4DX3A 4EKJA 3WF1A 3AQUA 1DQWA 1GNXA 1HX0A 4UTWC 1S5TA 2OKTA 3LBOA 1BVNP 4OBSA 1XCXA 1FH8A 3W1QA 2XH7A 1OF6A 1KM6A 1OWQA 4H4VA 3FY1A 4QJ3B 2P1FA 1TE6A 2PWUA 3C4UA 3N18A 1DIEA 4R7JA 4RJEA 2J9YA 3W29A 5DEZA 4Y6GA 4IMEA 4DNHA 2ZX7A 1UH2A 5A8PA 1F73A 4F0SA 1EXBA 4OBRA 1F4HA 1KM2A 4M56A 4QCEA 4H9UA 4RX0A 1M3UA 1NHQA 3B8DA 3TCSA 1E43A 5CLWA 2O9RA 1KXVA 4HHPA 2W66A 3E2SA 5BWAA 4AVFA 1FH9A 4PULA 4L64A 1PVNA 2QCEA 1H63A 2VC7A 1SVDA 4YWIA 4PRWA 1ZJHA 1EO5A 2DORA 2L5HA 2NQJA 1D3CA 2CZDA 1VJIA 3IJ6A 5CBBA 3E96A 3ARWA 2VENA 4KT2A 5FAGA 3GHUA 3LTSA 1H7PA 3GIQA 5A2AA 4ZA0A 4CD8A 2D22A 4KEVA 2BHUA 7TIMA 4C7GA 4NYYA 3CAWA 1BYAA 2WMHA 2VFFA 3GTIA 1S7MA 1F9CA 1LJYA 4HCHA 1IEWA 3HB9A 3FSUA 2JIWA 1HL2A 1Q3NA 3UG5A 5A8MA 3QVQA 1KM4A 4XBJA 3CGTA 2O9TA 2PCQA 4JTQA 3PTDA 3BK0A 3TQKA 3MMTA 4C90A 2JK6A 2QPUA 2REQB 4RR4A 1VEPA 1TCMA 2E6FA 2DSUA 1T5AA 3LG3A 3G8EA 2AAAA 3S8HA 3KL0A 3PPCA 4PCSA 8XIAA 3HPXA 3LMZA 4GC3A 2R14A 3GXTA 3ZFHA 1FVPA 3HV9A 1KXHA 5DBUA 4IXXA 4NY2A 1W1YA 2NV2A 3OIXA 4NL1A 1NF7A 3KLJA 3CHCA 1J0JA 1XSKA 3VNLA 3WLNA 3BW4A 5G1MA 4EF9A 3QBUA 1K7FA 2Z6JA 4K7VA 4M29A 4XG1A 1BZLA 2PWFA 3EXSA 2ZTJA 4WGXA 1XLGA 3M64A 3P3BA 3R6IA 4M6QA 3ITTA 5BRBA 1FCUA 3WL0A 2VFHA 1J4EA 1GZJA 3AMZA 3OPSA 4FF7A 4JHMA 5D02A 1E9LA 4PCPA 2BHZA 2AL1A 4ZQNA 1HN1A 5HXMA 3EWXA 2YW4A 3UYIA 1E5JA 3C2RA 2FTYA 1L9WA 3DEQA 2Y85A 1RP8A 2D73A 1K6WA 3AYRA 2HVOA 3VOHA 4H9XA 2OEKA 1F8MA 3ZM8A 3VNMA 1GJUA 5HULA 5K4ZA 3JR2A 1ZXIC 5XINA 1NFPA 3T8LA 4KRUA 1PIIA 1KWGA 1NU5A 1OVDA 1OYBA 1VDVA 5CEWA 1X1NA 1E6NA 1ESWA 1CECA 4K8DA 4GX8A 1IF2A 3B0YA 2PGWA 5EYWA 1XIDA 2CESA 4H4TA 3MB9A 3NQ2A 3AMCA 4FXRA 3FAXA 3O8AA 3CL7A 4PFMA 3A12A 4GY1A 3DYMA 3IARA 1MEHA 4Z1YA 3GUGA 3S5NA 4HNTA 4JN7A 3PBUA 3ZJ7A 2GFTA 1E4IA 4L4PA 4RV8A 3G1YA 2Z1KA 3CT7A 4Y9PA 3JS3A 2V81A 2P50A 4LX4A 3G22A 3IK4A 4PCFA 3PUOA 4GO8A 2E5BA 1NHSA 4FX7A 2D24A 2ZZCA 3GZ3A 3UNDA 1BVZA 2PDPA 5CKSA 4GQGA 3CUZA 4FMVA 2X16A 4C6BA 4IT1A 3RITA 4GVFA 4REQA 2FZ9A 1HKKA 3S9IA 1DJGA 4MNKA 4PSRA 3BCDA 1EJSC 1DVJA 9XIAA 4ZBCA 3KBJA 4B3LA 2VELA 3SCRA 4DWSD 1QI3A 4Q8UA 1K02A 5HWMA 3M46A 1VLIA 1HF6A 1ZALA 1ZPTA 4GUIA 1A5AA 2V6OA 3GR7A 4IX2A 3W7MA 1JCTA 4D6CA 2GLKA 1OGBA 4HN4A 4ROQA 3GXPA 2O0TA 5TD4A 2PC8A 1CYGA 4CCZA 1AZ2A 4J9JA 1KGUA 2ISVA 4AIOA 2HE5A 3L4WA 1PKNA 5DCDA 2E40A 2V3GA 4BQ4A 2YCJA 2ZRUA 5FS9A 4GQBA 3MWAA 4M24A 3N2TA 3F2DA 1Q1WA 5FD0A 2CETA 5CPMA 3UW6A 2FIQA 2RUSA 2I5IA 1ECEA 3NQ8A 2CXGA 4HB7A 4H4SA 4HZMA 4Q8TA 3OLIA 3TONA 2DZSA 3EB4A 3VMOA 5EMUA 1OD8A 1GG0A 3ARTA 4YYCA 4PTWA 5C2CA 1W5OA 1Q6CA 4H4XA 1RD6A 1TR9A 4KESA 2PTDA 4MY9A 3WLIA 1FBAA 3SN0A 1SFLA 1LYXA 4ZGYA 4M19A 2RAGA 1EIBA 2ZZ4A 1YTEA 1PTDA 1TPB1 1KW1A 1FWFC 4WQ6A 2GOKA 4IF2A 4RPPA 1X2HA 4LYRA 4MWAC 3PNUA 2VRJA 5AB3A 1KC7A 4A4AA 3C2YA 3PHAA 4K1WA 3AXMA 1B3YA 2G0WA 1UWAA 5HBFA 3HPAA 3A4WA 4NZFA 3UFYA 5I79A 1VJSA 3UWQA 4XVDA 1WZMA 1V6WA 1ZENA 3OODA 4D72A 1EP1A 2FPYA 2E6YA 5ABEA 4PSPA 3UPWA 3TN6A 1TFVA 4GJ1A 3L5OA 4XKYB 3WK2A 3NYZA 1NWRA 3W2LA 1QBAA 3UXAA 2EQDA 3E9AA 2HQAA 2C1IA 4JQ2A 2CBJA 4YWSA 3SQLA 3MVIA 1OSEA 3IRDA 4QEHA 3VKBA 2UY2A 6TAAA 1GOMA 4RE4A 1XDLA 3KCJA 3TUUA 1UWTA 4UFJA 4GZ7A 4NJJA 1JQXA 3LYEA 1FXPA 1XJBA 3UWUA 1SZFA 2VX4A 2VC9A 4IPNB 4QM1A 2BOFX 4S2CA 1Y5XA 3NPXA 4EXQA 5FF2A 3ZVIA 2WJDA 4Z1BA 3RM9A 3UY8A 2YVGA 1X96A 5HJXA 1WQ5A 5CSRA 1X39A 1QPOA 2CDUA 1H7NA 2XFYA 1SW7A 2DJXA 4LUSB 3MCNA 1A0CA 1XLJA 1GVQA 3IAPA 1RVKA 1XM3A 3VMPA 4QE5A 2YCEA 4JS3A 1AZ1A 2RDUA 2FGBA 3T0DA 1ONRA 3SR7A 3T9PA 4S3KA 1FQ0A 1UD6A 4HJWA 1W5MA 3DK4A 3FEQA 5ER0A 4NUWA 4DZ5A 2V5KA 3WUFA 3MCOA 1LRQA 1VBRA 1F3XA 4ZO9A 3MKVA 3GH5A 2OMAA 4N42A 1Y7VA 5J5RA 2RJGA 2QZRA 4Q4QA 1W3HA 5TNVA 4W8LA 2OQYA 1E6ZA 2VEFA 3VNDA 1A5CA 2WHMA 4JBRA 4S38A 2GVGA 1FRBA 3WKZA 3WF0A 1UZHA 3KRZA 3W1AA 3O2LA 2EG6A 1TJRA 4FLSA 4CGTA 3BH4A 3CGDA 3GU1A 4P61A 2RABA 1W91A 2NQHA 1JVNA 4H4RA 2EKGA 3U0HA 3DHUA 3AUOA 1QT1A 5AYYA 2YVFA 1P0DA 4XIMA 1VIWA 1B3OA 3W0KA 2PWDA 2R9ZA 1GETA 3V18A 2V3AA 3AXKA 3ZS4A 3OLEA 4MUPA 3N29A 3GUWA 5E70A 9CGTA 5IBXC 3WSUA 4DBUA 3R13A 3BL3A 2DY3A 3O0KA 2J9XA 1TV7A 2CCRA 3GX9A 5CLTA 4P2VA 4LS2A 5CC3A 3ZXWA 4P7NA 4I8YA 3PFRA 1MUWA 4L9ZA 3CWNA 3WJWA 3U4AA 5GQBA 4QAIA 4BK9A 4I5RA 3FHQA 4QLLA 3M4HA 4N6EA 4UXDA 2W63A 1G7VA 1O5XA 3E0FA 5IFPA 3IVSA 4JTHA 1GYNA 3B0VC 4KFPA 4AZIA 1EL3A 3C3NA 1YQ2A 1FCVA 3VILA 2GR1A 2PRLA 1JF5A 3CAKA 9RUBA 3UQNA 2HMCA 1PIGA 2DZXA 2J62A 3P84A 1DORA 3L0KA 3W24A 1N8FA 2W3SA 4H8VA 3MYOA 1FO4A 3A5VA 1VFFA 4Q8OA 3RM4A 3WLJA 2JEPA 3I4KA 4LYQA 4M80A 5A3HA 4LUJA 3EA2A 1BQCA 3QRHA 1OX4A 3VYLA 3CEPA 4U10A 1L2QA 4LTSA 3KDOA 3B9JB 3BURA 3DU0A 3H70A 4IH3A 5ABFB 1ICSA 8TIMA 4LRTA 3LZ5A 1OC7A 2VX6A 1FKWA 2X99A 2YA2A 1PTAA 3NO1A 3TK7A 1QAPA 1KWKA 2RFGA 4B5WA 2AGTA 4AG0A 1X38A 5LIWX 2O7QA 3R79A 4QITA 2MANA 4FLQA 1A0EA 1Q7MA 2ZDSA 4IIDA 4RNIA 4AU0A 1QTWA 1BKSA 1AD1A 3PZMA 1XLDA 1RJRA 3LY0A 1VZWA 3AHTA 3MSRA 1C8YA 2WSQA 4L4LA 4OHQA 3NL6A 5A8OA 3G5EA 1SJDA 2Z1WA 2DDXA 4F0RA 4EMWA 2F84A 4QDMA 5I09A 1Q7ZA 1LRNA 1ITQA 3RR4A 4AZBA 2QJNA 3QKZA 3VCCA 2DZAA 2B7QA 2E1WA 1PDYA 2P0IA 1TELA 4Z2KA 3KVJA 1J96A 2XVKA 4FHAA 4KQNA 3WCZA 1YPXA 5HMFA 3TLLA 3KX6A 1XANA 1UKSA 3O1NA 3SFWA 2PLMA 4H2HA 1CGWA 1HT6A 1W5NA 4KWOA 3WQEA 3GYCA 3STCA 4MKNA 4J5NA 2FTPA 4UQDA 5MKGA 1UZDA 2PWGA 1P5BA 1GYLA 1O6IA 3C2VA 1FWCC 3N2CA 2X8RA 3QSRA 4US5D 4UQBA 1ZY8A 1GT8A 1ZTVA 2DFAA 3E6EA 5BROA 3EA1A 4F9JA 4C6OA 2QCMA 2WSPA 2I9EA 4FX6M 5G4HC 1OIFA 3ZOAA 6ALDA 4BKNA 3LCGA 4LB4A 2NVCA 4LVAA 3V75A 3ES7A 1LLZA 2QW5A 4ZQMA 3UESA 3DUGA 1AH4A 1HL9A 3EWZA 3GHTA 3ZT7A 2ZKMX 4GRTA 1PZ0A 4RDWA 2OODA 1PKLA 3KLKA 3TOYA 1F3TA 3RN6A 3MYPA 2PDLA 4GCAA 3F2CA 2NX1A 3JU2A 3GWQA 3AS0A 2VEGA 4M6PA 4JNMA 4V15A 1WDSA 2H9AB 4PMYA 3RG6A 2NUXA 3LQGA 3UR2A 2WMGA 2R9RA 2BZNA 1J9YA 4YN5A 3UWWA 3O3RA 7A3HA 1GZ1A 3KCLA 2PU0A 4PGLA 4BQ2A 4NJIA 2HPMA 2VFDA 5BWFA 3VE9A 3DK8A 1TV5A 4JKLA 5DFAA 1JYXA 3TOPA 1LUCA 1YNQA 1W0MA 4LAKA 3T05A 5C54A 3WDRA 1JIBA 4Z0JA 5F2GA 3FN9A 1IHIA 5EB8A 1LG1A 1X6NA 2IKHA 2QF7A 5AHIA 5KVHA 2NQ9A 3NEHA 1QNQA 4KEZA 3RCNA 3EX4A 1RY0A 1Q65A 1B0IA 4JN8A 3NNTA 1QXLA 1GUVA 1TMLA 2YDQA 5B7YA 1KBIA 3B97A 3RRAA 3KBVA 3HPFA 1VBJA 3Q4DA 4W4QA 1NVMA 1FHVA 1LBMA 1VJZA 1G5AA 1JCJA 3W7KA 1BVWA 2QV5A 1GV4A 4IQDA 3OVRA 4QX4A 2QQ6A 3EMCA 3EWBX 1GRBA 1RAKA 5D4YA 1EOKA 4LUSA 4OT7A 2JALA 1EDGA 1EHNA 8RUCA 4A6GA 4I9TA 3I10A 3P6LA 4OQVA 4BF9A 4H9VA 3QH2A 2XIIA 2E3ZA 3PZVA 1AODA 3QPYA 3T2OA 5E6ZA 1K9DA 1W9XA 3VDGA 4W7VA 2NLYA 4MUZA 5JH1A 3WUBA 4OV9A 4D6DA 4AD4A 2VCBA 2XFWA 2ZRXA 4WSHA 4WDXA 4CNOA 1HVQA 1RM6B 3CTLA 3SCPA 4N0RA 3LHUA 3N2BA 3NO5A 5JBDA 2I17A 3S5YA 4QNWA 1YXCA 4IMAA 1V77A 5CQ1A 4PMJA 1ZB5A 1RCQA 4MB1A 4R7WA 1QFEA 3R10A 1QJWA 2VGGA 3TMQA 1KBJA 4UFMA 4TX8A 2J3NA 1RCXB 3OVPA 1WV2A 1BF2A 1B54A 5D9NA 2XVPA 1HXJA 4GO9A 3LK6A 2Y8VA 4AWTA 3IUIA 4NZ4A 4LVBA 3VGEA 2DGAA 2RGLA 1AL7A 4B5UA 3VCNA 1JZ7A 3GO2A 1OZMA 4B4HA 3HMJG 3WQ4A 4V27A 3LB0A 2Z0IA 1UR8A 4XISA 3RLGA 1Q6FA 3TYZA 3LHYA 2DIKA 3TYAA 3CK5A 4IGSA 4DUVA 3VFCA 3QTGA 4DM2A 1O7AA 1F6YA 4NNAA 4XQ6A 4RNFA 3OG2A 5FSDC 5MF5A 1XCWA 3AM9A 1OFPA 1JG9A 4GINA 1TVPA 4XBSA 4AVNA 2GUYA 1E0VA 5AYZA 4WEVX 4YS1A 2CNCA 1GEQA 1ADDA 1CXHA 3ITXA 3KZSA 1HGWA 4K8EA 1PHQA 4S1FA 1V3KA 4ORIA 4JTGA 1DWFM 1W9VA 3ME3A 3KRBA 4DI9A 4DWSC 2EF9A 3UCCA 2OR2A 4K8GA 4FA3A 1QOXA 3DIPA 3QMTA 2V82A 1AW1A 1GK8A 1QI4A 3ALFA 3QGAC 3ZLHA 3DFPA 2QUVA 3PPHA 1LWJA 3NURA 2QYGA 4LS0A 2YPIA 3VC6A 3UY7A 3TWBA 3UERA 1CXKA 2WBAA 1FWTA 3LXAA 3CV2A 1JI1A 3W37A 3A3XA 3FJ4A 3TXZA 2WOWA 2J7DA 5D8WA 4DO6A 3GDLA 3LHZA 2G4FA 5J04A 3GBEA 4MPQA 4O16A 4G7FA 1CEOA 3DFYA 4J27A 4XIAA 3FHAA 3L66A 4N2YA 1TTIA 3M9YA 4M52A 3NM3A 4TMCA 5T91A 2BC1A 1ISWA 5H91A 1R6WA 1I2OA 1UJPA 1GVIA 3PJXA 3WQVA 1V08A 4BURA 3CAQA 4H4IA 4I8DA 5FOOA 5DCBA 1S2CA 1RQHA 4ML9A 4EOUA 3L12A 5EA9A 3UZZA 3TYUA 4NAFA 2DQWA 1M9HA 3KLLA 5D2YA 2HJPA 1QMLA 4BQ5A 1GSNA 5D37A 4HKPA 3WF3A 4TVWA 4D6HA 1TWDA 1B4EA 2W3RA 3TJXA 4QISA 4XZLX 2YCLA 1QOPA 1IWAA 3PG9A 4UFIA 4F48A 3WMCA 1A5UA 1VBUA 3AYTA 2C1GA 2OSWA 4JL1A 3MUCA 4QTGA 2IS7A 1EPXA 4WY0B 1G6CA 5BW6A 4W5UA 3ATZA 3QR1A 2XTKA 2CLEA 4FXFA 1QNPA 1GW9A 2YA1A 4FLRA 1UR3M 5LHEA 3E0IA 1UD2A 2PDKA 4OTKA 3BG5A 3MPGA 3GDBA 5I6SA 1I45A 4KWVA 1AJ0A 4EQSA 3B8UA 2CHNA 1JDDA 5ECUA 1LTDA 4L65A 1XIHA 4Y8EA 2NVKX 4MGGA 4CNNA 1HJXA 2ZUNA 1C92A 4IP7A 4ZEPA 4D8LA 3A4XA 3H2FA 3FSTA 5F2MA 1ZY9A 3MO7A 4HPXA 4DJFD 2ODOA 2ZX6A 4ZODA 1JUBA 4NEWA 2PMQA 3ERPA 2ISSA 3H2MA 3W74A 1RUSA 3DKJA 2ZDRA 2GK1B 4AMCA 4R5EA 3H8AA 4L4OA 3WNOA 3BOLA 4YTSA 4PRRA 5DQPA 2XISA 5TIMA 1QPQA 1MEWA 4X22A 2PB1A 2GGJA 3TN5A 2GR0A 3WIJA 1HO4A 2VFIA 3E0LA 5EMYA 1TPC1 4IIGA 3L2MA 2C18A 1K4GA 1CW2A 4H9MA 1CB7B 2VEKA 3OQEA 2VGFA 1JDCA 3GRTA 4OUIA 3B0XA 1MRAA 3CUFA 3ZJKA 3QLLA 4UTIA 5C9UA 3SI9A 1A5LC 3SCSA 3O7UA 4AW7A 3DFNA 2X7VA 3EX6A 3UVIA 3QV8A 4AEOA 1JZ2A 2EKCA 3ZWSA 3QFEA 2PUZA 4XZMX 1O1ZA 4HJFA 3NVDA 5AZ1A 3SAZA 4B5TA 1OK4A 2W54A 4XAGA 1TTQA 3I6TA 4A3QA 3FEMA 1QNRA 4B92A 1Z6KA 1LVLA 3EAUA 3W76A 3RJXA 1C8XA 5C8BB 2Q8ZA 4XSMA 2FMNA 1OFOA 1NHRA 1HIZA 1GYMA 4PTXA 2AGKA 1HKIA 1TG7A 3WJYA 5LIYX 4EXBA 3UBPC 5H8PA 1EF3A 3P0XA 2HZGA 5D03A 4ZOAA 4BJHA 1G9HA 4HIBA 3L21A 2HE8A 3FDKA 4GYFA 2BXVA 2KAUC 3TSDA 4A3RA 3U3HA 3W82A 3WX7A 1FWIC 1MXSA 3BG3A 4UQ9A 3HQNA 4OU1A 1VFSA 3B0PA 3W6YA 3V35A 1DHKA 4GFSA 4PTVA 2D23A 4S23A 3CMGA 5GJNA 1R9YA 4X60A 1KXQA 3PVFA 3EDDA 1H5VA 1UKPA 2YDAA 1WZLA 1VFMA 1GESA 2WYSA 4HD5A 4F2UA 1FP9A 1H7OA 7ODCA 4GPNA 4LCSA 5D05A 3T0AA 3AOFA 4LGXA 1TQJA 2XZ7A 3WH6A 2XVLA 5A1AA 1EOMA 1HNYA 2XH0A 3MI3A 1M1BA 2E5DA 2OVLA 3DENA 3HV8A 2YA0A 4N4PA 1DP0A 3W87A 1EYWA 1XBVA 3ZJ8A 1TJ0A 2Q3OA 3VIGA 4PL1A 1KNWA 5A2CA 1AUSL 4IP4A 1QO2A 2H6RA 4UWMA 1V93A 4KGJA 3VINA 1K9EA 1XUUA 3IUDA 3KXQA 1SZRA 5JVLA 4PEEA 4NYUA 4XZBA 4A8NA 1XRVA 3EOUA 5HQMA 4WVXA 1KBKA 1US3A 3APTA 1W2VA 3PSVA 1VYRA 4AD1A 4LB3A 2CFFA 4NQ1A 4WKHA 5EL1A 1UZ1A 3T7VA 4F0KA 2WJZA 3LI0A 4QDPA 5FS8A 3H24A 1KKRA 1CGTA 5D2XA 4FOJA 5KZEA 3MI6A 1UD3A 2POZA 1GVEA 1LOQA 1CPUA 1SJBA 1RK5A 1ZHAA 3PBWA 4J3VA 4Z2HA 3U2CA 2FHCA 2F2HA 4HZ8A 2EJ1A 3VTRA 4HK6A 3W28A 3VIIA 1E6QM 4ILSA 3ENLA 1TPEA 5AC8A 2IKGA 2CHOA 3EOOA 3G18A 2FVMA 3WLRA 3GG1A 3LPPA 4Y2WA 2X0SA 3TW6A 5HNUA 3N73A 2BFGA 3FK4A 4AD0A 2CLLA 2ZZ2A 3WLMA 2G37A 3LNPA 1EKOA 1UMLA 3UJEA 2EG8A 3IVTA 2ZICA 3WJSA 1EGVA 1JPMA 3GFXA 4I90A 4MPKA 3AISA 1XFCA 5A6KA 4D6IA 1UR1A 2E5CA 3SZ8A 1FEBA 1QU4A 4DWDA 3PULA 1F05A 3DC0A 2RJHA 3WEOA 3P8JA 5IDZA 5FSEC 1VEOA 3UR5A 1GOQA 2WSYA 2Y88A 1K4QA 3V5OA 1DWIM 5F1VA 1W54A 3TYCA 4NSBA 1K4HA 2DVUA 4CCCA 3PUDA 3BJSA 3L0GA 3VUPA 2FZBA 4Q4PA 1POJA 1T41A 3BLKA 4M81A 2PDFA 3M0JA 3C5QA 4GNKB 2Z2UA 2OGYA 2EHHA 3WQDA 1XH2A 3C52A 1SO6A 2VC5A 4LV9A 4JTKA 1FWWA 4FALA 1OCBA 3AHVA 3QZAA 4DY1A 3CS2A 4W7WA 1H60A 2NUYA 5BU6A 3AROA 3L4ZA 3VDBA 1LQAA 1E6XM 1NDZA 3M7SA 4DN1A 3A3WA 4XX6A 1KCLA 3C56A 3V3WA 1KXTA 3ES8A 4FXJA 2GJXA 3K8LA 3HJEA 4D6FA 1KD0A 1R2SA 4X0NA 4DF0A 2GGHA 3FW6A 3KRUA 4JGDA 1GEUA 4G1NA 3NRZB 2WQPA 4GFIA 4D8AA 3VABA 3W1TA 1VFHA 2YR1A 5I06A 1CXIA 1TRIA 3UD6A 1VC4A 2XINA 2F5ZA 4ZOBA 1BF6A 4PBEA 5EMKA 5CAHA 4RW3A 3WJZA 4LAOA 4Q4SA 3U2EA 4BCEA 3WQ8A 3PS7A 2HVMA 3LCXA 2FZNA 2NT1A 4GWEA 4HPGA 1YXDA 3FXYA 3V5CA 2VFEA 3BWWA 2NVDA 4LANA 1IXNA 3RX3A 4DJEA 1R3QA 1GZGA 3DG6A 3M5ZA 3VD5A 1GQLA 1JR1A 2GGGA 4FOUA 1VFUA 1R3YA 3URAA 1F2JA 4K6AA 3WD3A 3GW3A 4UTTC 2WANA 1SUXA 1EH9A 3QXBA 1EFZA 1YBQB 3MP4A 2DT3A 5G4EA 4RE2A 4RXFA 2ISDA 3WH8A 1ECQA 1UBSA 3LCWA 1H7WA 1SYTA 4US6A 3VO0A 2G3NA 1L8NA 3ZVHA 2YVJA 2GJNA 3GR4A 2TPRA 1WZKA 2GQ3A 4R9XA 2B81A 3E49A 3OO2A 4F0HA 1KQYA 3FKKA 3ITGA 3WQ5A 3QV7A 4NHVA 3CPGA 1N8WA 2DUXA 2OGJA 4R3UA 4KCUA 5C2GA 2BY2A 4MLJA 1GQNA 3QGVA 2W55A 2B7OA 1UG6A 1RV8A 3A22A 3CXOA 3TZFA 1H49A 2FPVA 1XH0A 3NDOA 2ZRYA 1AW5A 4PMDA 3VIMA 2V5LA 3LRKA 3OBAA 1FX6A 1E0XA 1WE5A 2V67A 4O57A 3ARQA 3PG6A 5A6SA 6REQA 1PCKA 5E6YA 2W92A 1Q8JA 4WXZA 1EZ2A 3L9CA 1NPXA 1A5BA 1ZNNA 1YE6A 4MADA 5FJOA 1BYBA 2DIJA 3OB8A 2HK0A 1E73M 2V38A 2X1SA 2AL2B 4GXMA 4S3JA 4R34A 3NGJA 2WVTA 1E15A 3W84A 2VZSA 2IW0A 3QYQA 2R24A 3A7UA 1K8CA 3URQA 5LA0A 4C6IA 3FGCB 2WC7A 1A5MC 1M7PA 4YL2A 1TREA 5FL0A 3DGHA 2FMOA 3MA8A 3G0XA 1Q6DA 3NOYA 5M3WA 4JNZA 4PUUA 1DJQA 4JHZA 3AMLA 4UUIA 1B1YA 4NG3A 1CX9A 3L65A 3U6WA 3VKJA 5G2IA 1F61A 4F66A 1OG0A 1EYEA 3VKDA 1S3TC 1CLKA 3H4WA 4K3ZA 4AZ7A 3VZZA 3ZIZA 3WMLA 4F4RA 1EDQA 4W5ZA 3CC1A 3LGEA 3LTPA 4HQVA 3WQGA 1VFTA 2XDFA 4MF4A 4G1KA 2XWEA 1GRGA 3RO8A 2WVSA 3U57A 1TZZA 3IGXA 5JCMA 4H6RA 2E5AA 2BG5A 1NWSA 1W3IA 4W89A 5J5DA 1WA3A 4AYSA 4ZOHB 4D6GA 2D0FA 1Z89A 3GDMA 3RF9A 4Q7BA 3ETRB 2VZTA 4L6HA 3FA3A 1S1RA 1MXDA 3DH7A 5AVNA 3M0MA 1J5TA 4JQ3A 4MM1A 4J3SA 2OFJA 3DZ1A 4JX6A 3O6CA 1ZDLA 3N12A 1H1YA 4XD4A 2PTXA 1IT0A 4ORMA 1TA3A 2OU4A 3GDTA 1PDZA 2DV0A 3MKCA 4DLMA 5A6LA 2V9DA 3QF0A 3O6AA 1JCLA 4O15A 2HPIA 1NDWA 3CYJA 1GXFA 3UCQA 5E5CA 4XBKA 4IP5A 3MVTA 4ZE4A 2ZVIA 3WF4A 4ZL1A 1XD0A 2G3JA 3CHDA 4HMNA 4JOMA 3DFOA 1TVLA 1UD8A 4PMXA 3VOJA 2HS6A 2XU2A 3D46A 1E9ZB 4IQEA 1THFD 1IEQA 4C65A 4PMZA 3W2JA 1H50A 3BMWA 1J2BA 3S42A 4ECLA 4QQ3A 3NDZA 4LSBA 4N02A 4HPHA 1DJXA 5AOUA 1AJZA 3P67A 4HNNA 2WOQA 2ZWYA 1E4LA 5E0FA 4ZO6A 1EUNA 3SGGA 1E6RA 3PTKA 2QXWA 3P2VA 2W6RA 2ZC1A 3SCQA 3WLQA 1EA0A 2CLPA 4GYPA 4M6VA 3AYSA 3MSYA 1UWRA 4ATLA 3AHXA 1F7BA 3DECA 1G94A 3PPFA 4LY4A 1I4NA 3CZ8A 4UQAA 4JIRA 3FYYA 4HYVA 4YCPA 1W3KA 4Y9MA 3OGRA 5DELA 3B8VA 1LM1A 2J13A 2G4JA 4M7SA 3KBMA 3B9EA 2V3DA 3CGCA 3BAIA 1XXXA 2PI6A 1EX1A 2PRHA 3K13A 3EBVA 3NZ1A 1SJCA 1YKWA 1EJXC 2DH3A 2VL4A 3TYDA 3LSCA 5FEPA 4MMWA 2VOMA 6XIMA 4KW2A 2QT3A 4DJFC 3VNZA 3LD5A 3HURA 2VFGA 2OJPA 3HIJA 3JRKA 1L2UA 1MNSA 2NPXA 2E9LA 1KFCA 4CNSA 1W5QA 2QJHA 4P7RA 3WNKA 3IACA 4LEQA 1E4NA 2O9PA 4A05A 4O1EA 4Q3MA 3I7RA 2Z4GA 1QASA 1ODZA 2HQMA 3MI2A 4WX2A 5I02A 5TR3A 3VGFA 1KM5A 4HBKA 1TE1A 3N4AA 1POKA 3EOSA 2F2KA 2Z6IA 1D7YA 5FF3A 5LHFA 2YFNA 4AEEA 1DJZA 2YXXA 2CZVA 1X6UA 4FXSA 1W32A 3U5UA 4AEFA 3AN1A 2GVLA 3S1UA 4E4UA 2BXYA 5EMMA 2W9MA 3N19B 1UOZA 4J3UA 4MY1A 3EWCA 2WKGA 3IK2A 2UWFA 2EQ9A 4LS1A 5CZTA 3M5YA 2GZXA 4L1XA 5HR7A 3EX2A 3S4TA 4IOTA 3UPBA 1UUQA 4B4FA 3WLOA 3ZYZA 2HK1A 2NX9A 1B9ZA 2WHLA 4CVUA 1C9DA 3BLEA 3MJYA 2VR4A 1PB0A 3F5LA 4RUBA 5H8MA 4ZZ9A 2PEVA 4TVYA 1QOQA 4LPCA 1S5VA 3BLOA 2X8GA 4GHRA 1QK0A 3VE7A 1KM0A 1P7TB 1EBDA 4ZOEA 3K1GA 5HJYA 2CZFA 2DIEA 1IXOA 1ZBWA 1E1CA 2OSYA 1CLVA 1XBYA 4Q32A 1HGYA 1B31A 2C14A 1RQBA 1A49A 3DXIA 3EWWA 2Z7GA 1UH4A 1MYRA 3DC8A 2PDIA 5C9RA 5MHBA 3EB3A 4WJXA 2Z1SA 5JCKA 3HGSA 6PTDA 2YZRA 3CZGA 1XG4A 4W86A 4YMZA 3NM1A 2ZZ0A 2BVDA 4Z2IA 2QUNA 3KOFA 2NZLA 3H2OA 1FWHC 1XFBA 5E93A 4TTGA 3GG0A 3NCOA 5AHLA 2GR3A 4TQTA 2FJKA 2ZZBA 2WLYA 2YFOA 3B9OA 3ARUA 5M1TA 4EQWA 1N8IA 1CENA 1H3GA 4J7RA 5LIKX 3KM8A 5DF0A 1EBGA 2GWGA 4GUGA 4M82A 2YCKX 3WH7A 1RPXA 2R1PA 3USBA 1IEVA 8XIMA 4GC4A 4D1JA 2OQHA 3GNDA 4N9EA 5AHFA 1ZJIA 1WO2A 9XIMA 3TTQA 3VFLA 1UPPA 4HU0A 2V5JA 1H09A 3FV9A 2EQ8A 3IJLA 1M04A 1IQ8A 2DSVA 1ZJAA 1SSGA 4KGLA 4XO7A 1EJUC 3EMQA 2PDCA 4CUCA 1DWAM 2PSNA 4M6UA 4UMAA 4HVXA 4G6CA 1R30A 4HNLA 4LT9A 3W53A 4DBEA 3NVVB 5AKQA 1I1WA 4L9XA 1JOAA 3O05A 4R33A 2PP0A 5E9AA 3WUGA 4EVZA 2WPCA 4P8VA 3C2OA 3SECA 4UCFA 5FL1A 4O50A 1BQGA 1EEXA 1PWMA 4S3AA 4GK8A 3ONBA 2ABAA 3EF6A 1KFEA 3CB8A 4GZJA 4DF1A 3LTYA 2WMIA 2V2HA 4B5SA 5BYWA 1DWGM 3R8HA 4P8WA 2WNZA 3WQOA 4LJ3A 1W1IE 1QHZA 5I3GA 5EBKA 3OVQA 4NASA 4Y9OA 3CWHA 3BW2A 1JYWA 4AIUA 4GH1A 1CIUA 1EHAA 4UTWA 4BQ3A 2FHBA 2JKEA 2NQZA 1TUFA 4C5ZA 2OWCA 3G1AA 4UTLA 3PUGA 2ESCA 3I6RA 3APYA 4AWUA 3T6CA 4JD4A 2IKIA 1ZCOA 4B5NA 2Z25A 2YW3A 1AQHA 3TA9A 5GJMA 4PL2A 2Q02A 1J2WA 3NDYA 1ITUA 1BSIA 4F9DA 3GG7A 3GNNA 4JX4A 2Y7EA 3VOIA 1W17A 4GIYA 3OQ8A 3B03A 1NFBA 2Z29A 4O54A 5TF0A 4FNTA 3S2JA 1XCFA 4DO4A 2CFYA 3VNJA 5RUBA 1KGWA 2FDSA 4OIFA 4Z1AA 2VHLA 4U5IA 3TX9A 3H7UA 2X1TA 3L5LA 1W1PA 1W9UA 1DTNA 1C3FA 2FKPA 2YLLA 3O6YX 3MDUA 2UBPC 1R3SA 3AHZA 2MUCA 3FVDA 4M1RA 2HXTA 3S2NA 3UJSA 1W6TA 3WN6A 4ZQRA 2QCFA 1JI2A 5IRPA 3H53A 2Y63A 3BGGA 4E2OA 1RBAA 1DE5A 3RLUA 3H2EA 1PBGA 3HGJA 2Y0FA 5T8GA 2WW5A 3OJGA 2WZIA 1E0UA 3BAKA 4QEEA 4QCFA 1O1HA 1OFQA 1MDLA 4GJIA 1YDNA 4I6VA 4ZR8A 4WIWA 1P0BA 1ONEA 1KN0A 4QDWA 1Y5WA 2C16A 2ACRA 4N9DA 5IM51 3N3TA 3UA4A 4IICA 3E0WA 1E40A 2FZ8A 2QIWA 3SRFA 1VRXA 5A5WA 1DNCA 1C9WA 4DYJA 1E4MM 4EAMA 3CQJA 2VEPA 4DM1A 2V3EA 4UNLA 3UP8A 1Y0EA 5C9XA 3KWSA 4C6DA 4NX0A 3LU2A 4HYWA 5DMMA 4I6KA 2ZZ6A 1B3WA 2VWTA 3BARA 5C7VA 3QFWA 4N7QA 4QLKA 5C55A 4NU7A 4IGHA 2PDNA 2V5CA 3PWIA 1RQEA 1BSLA 4MVAA 2XJ7A 3OHMB 3HM7A 4GVHA 3Q67A 4G7EA 3GNOA 4HSHA 3T78A 3GC4A 3QSTA 1MO9A 1PPIA 3PSWA 2F6KA 3M0YA 3BPWA 4R88A 1C7SA 3K4DA 3PM6A 3V4BA 4LAZA 1RLCL 1JGIA 1G0CA 3AZRA 3BDKA 4O4VA 3HTWA 3M5VA 1XLHA 2YDSA 3TW7A 1E1FA 1UKTA 2TRSA 2OSXA 3QQ0A 3CUHA 2Y5JA 1FFQA 4QSHA 4RDVA 1QBBA 3E1F1 2CBVA 2XZ9A 3AXXA 5CG0A 2J7FA 4AAJA 2NSOA 3N2OA 5AN7A 4MWAD 3V0SA 2SFPA 3OG3A 1B30A 1IE7C 3PPGA 4W8AA 4H4UA 3C8NA 2PA6A 1PE1A 1PSCA 4OOZA 4W93A 3CO8A 4UTUA 5ENLA 5LA1A 3T0CA 1NIUA 1E5NA 3LADA 2X42A 3G1DA 3JW7A 3IIPA 1XRFA 1QW8A 3DAQA 5HWJA 3G6LA 3S5SA 1V6XA 4KFNA 1V3IA 4ATWA 1DYSA 3GQYA 4K37A 1WBHA 3FLUA 1T0OA 5CSYA 4O52A 4GYJA 3V7PA 4Z08A 3KVKA 4EPDC 5HA7A 3S2MA 3IEBA 1IR1A 1PYMA 2D0HA 1XX1A 1ME8A 1SR0A 1UZ4A 3W7DA 1R3WA 3OYZA 1PZ3A 1E1EA 1OT1A 2VVSA 3KVMA 4CQ9A 2BV9A 3A5FA 2O56A 2YLAA 1DTUA 2ON3A 2ZA1A 4U2ZA 1EDTA 4DBDA 3W73A 3GVWA 1RZMA 1ZAJA 1KRMA 4B2DD 4EANA 5D2VA 3AIUA 4O11A 3BICA 3HGRA 1R9XA 5KTLA 2Z1VA 3E74A 4D2JA 3HGOA 1GREA 1UHVA 1JAEA 1Q45A 3FX4A 3BW3A 5HANA 1TJ2A 3DK9A 4GY0A 2WM1A 2PPGA 1S1PA 4CEXC 4UOQA 3GXNA 2Z7KA 3PY2A 5FF0A 3QTPA 5K3VA 2QDEA 2DQXA 2CLFA 5A6MA 2DP3A 5GVJA 2H3BA 1NFGA 3GY1A 3KOZA 2J7BA 1Q85A 3ISIX 1YDYA 3M47A 4F2TA 4AZHA 2P88A 3C61A 1SSDA 1R3RA 1IWBA 2J7CA 1UB3A 4UOZA 3A4AA 1UWIA 4U5KA 4J4KA 3W7OA 1CB2A 2A2IA 4LRSA 1GOKA 2QCCA 3KBWA 3GB6A 1JDAA 5CGQA 4UOJA 2R8WA 3TYEA 3WFLA 1H2IA 1FIQB 3GHSA 2ICSA 2QPSA 3L4YA 4LYKA 4J3WA 4QG8A 3B4YA 3TNOA 3AFBA 4C6PA 1BWLA 4PB5A 4YJ5A 1F6PA 2GDUA 1LWHA 3BSGA 3OBEA 3EXRA 2GPTA 2ONEA 3AIRA 2DUAA 4H8HA 4TMBA 1HG3A 3ZLFA 1AG1O 1H5YA 1RH9A 2P3ZA 3CLWA 1YNPA 4QS5A 4TO8A 2D2HA 5EBUA 3RYSA 2OQLA 3AWOA 5G4WA 1UD4A 5FAJA 3LX9A 2Q3RA 3H7RA 3V1HA 4JDBA 4C6FA 3YPIA 3QC0A 4I5XA 1TV2A 2GVYA 3W3OA 1UC5A 3NWRA 2C79A 1UP3A 3GKFA 1VRDA 4JZ5A 3OGVA 3V36A 1LZOA 2KX9A 4JFSA 3MUXA 2DU2A 4WOQA 2Y1HA 4JQ1A 1L6FA 2NXGA 4Z2GA 5I2UA 4REQB 4DYKA 3NGFA 3UNTA 4J35A 4IPJA 4JFVA 1HL8A 3G24A 3IJ8A 2BY3A 3BGJA 2VQTA 3WG6A 3LXDA 3WDPP 5F7UA 1BXNA 2E09A 4NNBA 1B5TA 1OX5A 1J6PA 5BXTA 4L56A 2WLZA 6XIAA 1Z3NA 3WLLA 3FYPA 4WF7A 1EEPA 2Z2AA 1GPWA 4NJHA 2YBUA 4MYAA 4YTTA 1OADA 4FR1A 1IIGA 3GH4A 2VGBA 2YBTA 4UTFA 3ATYA 2BVYA 2G5WA 2AMGA 1HUVA 3ZWTA 2HISA 3M0VA 5C7HA 4XAZA 5A6AA 1M6JA 3F7JA 3LENA 2NW0A 4CNUA 1NP2A 3R0DA 1XRTA 1OFEA 1W1A1 1JRCA 3BLLA 5A8QA 5I3DA 4RDYA 2PLJA 3CNYA 5FMHA 2WMKA 3CO4A 1XQKA 3HQOA 3GZAA 4JTCA 1CXLA 2VCCA 4PR4A 4S3FA 3LLXA 1Y5VA 1P1MA 3GD6A 3TV8A 1SQ7A 2H3DA 4C1NA 1GGOA 4PEKA 2CHRA 3QR0A 3ABZA 1DXIA 2P3EA 1WAUA 1YPIA 2C91A 4QJ5B 3T07A 1VPXA 3R1ZA 3ZT5A 4IIFA 1ISYA 1W2PA 2WZEA 5CSUA 1MXGA 3G0SA 2ZXBA 4M5PA 3N6HA 3ITOA 4C7DA 5C9ZA 1VQZA 1QW9A 4A3UA 3EDKA 4WDUA 3HOJA 2X8CA 3EUB3 1F5ZA 4JTJA 2W62A 4AHPA 2V30A 4WHBA 1XF0A 2F61A 3MP3A 3CV7A 8CGTA 1Z7AA 1M68A 3LHVA 4Z17A 1N7KA 1PIFA 3UGRA 3GRSA 1M65A 1PAMA 3CPUA 4HMEA 2E8YA 3F5KA 1QO5A 3BLIA 4E8GA 3KCOA 5T9CE 4PUMA 4LH8A 3STPA 4WLCA 2X30A 1RVGA 3QPZA 3W7JA 2AAQA 3VUSA 5A6BD 5CBJA 3R8RA 4CN6A 2POTA 4TU1A 3P80A 3LM3A 5IBXA 3ITCA 3QHOA 3P61A 4AY7A 4IZGA 4UC5A 1AOGA 4H2CA 2Y2WA 3URNA 4AYGA 4P7OA 4GIRA 1Z9AA 3GTXA 1XGDA 1MDRA 1YX1A 2F9RA 4LC8A 4GI8A 2BWGA 3S2CA 2ACUA 4GMEA 2Q71A 5I3KA 5AC7A 1LBLA 3HA1A 3OYXA 3JUGA 5C9WA 4K7YA 4TVDA 4LUTA 4PBGA 4HU3A 3PANA 4NILA 1H1NA 5HNTA 2OLSA 4QE1A 3Q6JA 2C15A 4IG2A 3U7BA 4IX0A 1DHPA 3B4UA 1V6TA 3W25A 2C3CA 3J7HA 3DHFA 1WDWA 1J0ZA 1KQZA 1Z41A 3ABSA 1V51A 4UTKA 3R8GA 3DBPA 1DXLA 3NOEA 4Z42C 1M7JA 1S2WA 4J57A 1JNEA 3UWYA 2WCGA 3QR3A 1HVXA 1GOWA 3LS9A 4TVUA 3LBMA 1GVYA 3O63A 3P81A 4U28A 1WDPA 2VDIA 4DXKA 4YPJA 4CQDA 4LA1A 3SRKA 1V3LA 3HU7A 3NZPA 4UR9A 4ZFMA 1V4YA 1Y65A 1VCFA 3WQWA 3WEMA 1WXYA 4Y8FA 4O8AA 1JDEA 1NOWA 4IWWA 4A8RA 3OBKA 2NUWA 1I2QA 3W2KA 3H2NA 4S3GA 3V0TA 2PF0A 3VOCA 4RLIA 1GKQA 2I57A 1GVFA 1OABA 2Q01A 2QKFA 4JIPA 4X61A 2QCDA 3WMSA 2Z27A 1Z44A 3WH5A 1ICQA 4L9YA 4EACA 2W67A 2GVEA 4H04A 5I3JA 3LMYA 4IFKA 3CXBA 1JNDA 4E4PA 4RNHA 4MLRA 1K9TA 3P14A 3BV4A 1J0HA 3SSJA 3IGUA 5BRPA 4ERIA 3BUVA 3OP2A 4HK7A 2PF8A 3SCTA 3I4EA 1HP5A 5GNZA 4N9CA 1J10A 3QV9A 3SUWA 4TXEA 3W1LA 5C6MA 1WXJA 1V59A 4FNPA 5LGZA 5HQEA 1HJUA 3KHDA 5T9BG 1REQA 1ZMDA 2C1HA 1FP8A 3W01A 5JBFA 1XDIA 1V3HA 3CIXA 4P7QA 3WDQA 1ZCCA 4GLEA 1VBHA 4RZ4A 3QJAA 1OGGA 3V5FA 2WCAA 4IPIA 3GDRA 4ATDA 1O4UA 1PZ2A 1OX4B 3FA5A 1QUMA 4M8UA 2D20A 3ECQA 1DJWA 3NQFA 2OOGA 4NJGA 3EDFA 2X40A 3INPA 2WCSA 4MZYA 3GXIA 5CPNA 3FKRA 3FXGA 1ML1A 5LSMA 4GUFA 1P6BA 3GHRA 4RZ5A 1M5WA 4JKKA 1GCYA 3WLHA 2NV9A 2XH4A 1N82A 4ZSUA 3OZPA 3JZEA 4GNVA 1JPKA 1GONA 2G50A 1AQ0A 4C91A 4KH2A 3BAXA 1U1UA 2NWRA 3U2ZA 7XIMA 3E2QA 1LROA 1KR0A 2A3LA 4LQ1A 2GH5A 2EPMX 4O10A 1HKMA 1ZRQA 1S39A 4E3TA 1JDFA 4YVPA 3NG3A 4NIRA 3ITVA 2FVKA 2Y8KA 1D7KA 3EX1A 3GR8A 3OLDA 3BXWA 3UJ2A 3PB0A 1NSJA 3W02A 2BSLA 2VT0A 3NO3A 4QHRA 3SEPA 1X8FA 1TIWA 1FWAC 4JIIX 2I14A 2XGIA 3CQ0A 4I5UA 1Q6RA 2QHAA 4GQQA 3IUHA 3D6NA 3T2QA 3D47A 3I68A 1KV5A 1Q7QA 3SB0A 5JBEA 2CWNA 1B4KA 1A5SA 1XIGA 2ZOXA 1XISA 1VYPX 2ISFA 1TTJA 2WPBA 1AH0A 3ZT6A 3UXIA 4NXSA 3C6CA 5MKGB 3THUA 3ICJA 4QROA 4AY8A 4E3VA 1JRBA 1H0IA 1LRTA 2YGYA 2YQUA 3CWOX 4FO4A 4TV6A 3WDIA 2X0YA 5DT7A 2ZRWA 4Q8MA 4DAIA 5D9OA 3IWPA 2PDJA 3OIHA 3DI1A 4DZIA 5CC7A 2FFCA 3EYPA 3LEPA 2J77A 1TZ9A 2QCGA 2ZZ1A 5G1YA 2GL5A 4E2VA 2CWXA 1ZMCA 4PH6A 3VC5A 1ZBKA 1VPQA 2I1OA 3T1GA 1K3UA 2C13A 3XIMA 5A8GA 2Y4SA 3E2VA 1V02E 3RX4A 3A7RA 2WVVA 3L5MA 3S9ZA 4DIAA 2QPXA 5FJUA 4IMFA 4FB7A 3R07C 2QLYA 5FS7A 4ZTYA 4D6EA 4HZ7A 3CEUA 1TMHA 3UA3A 3TMLA 1NEYA 3VIJA 2XFFA 4Q8PA 1OYAA 1P43A 3B06A 1H11A 3QHMA 4HTYA 4H83A 4HTBA 1I8JA 3MKKA 1KM1A 3ZSTA 2VD8A 3WD0A 1LUCB 1FWDC 3STFA 1ZJBA 4L5ZA 3F4CA 1AA1B 1JROA 5I0DA 1A5KC 1R2RA 1W1VA 1XLLA 2X09A 4UCGA 4A29A 3NZGA 5G5IA 1I1XA 1JPDX 3M0KA 1CBGA 5LXXA 3UCDA 4GIEA 5CSSA 4XAFA 1R5YA 2D0GA 2HSAA 3W1RA 3EKGA 3NQCA 5DY3A 4Q8QA 3WNPA 2JF7A 2QS8A 3GVRA 4B9YA 1PV8A 3KHJA 4X2PA 3AMKA 2QJIA 3S3GA 1FTXA 5BMWA 1XYMA 2QMJA 5JU6A 1W3TA 2J6VA 1VGAA 1WYGA 3FJLA 4JXCA 2FH6A 3O0FA 3M1ZA 2DW7A 1FH7A 4ZO7A 2BB0A 4I7VA 4F2BA 5D2WA 2PZ0A 1V6UA 4HZ6A 2BTMA 1US0A 3TH6A 1EO7A 5FEWA 2I5QA 1LCOA 3A9IA 1KBBA 2XVNA 1K8XA 1SMAA 3AS1A 2BXZA 4DWSA 1G7UA 2CERA 1TYGA 4IPLA 4ADWA 3E5BA 4K1GA 3SN4A 3IS4A 3KTXA 2X7WA 3MSDA 1PS9A 1X7IA 3RM8A 2JFEX 3FAWA 3VIOA 4LFYA 3ZJ6A 4ADUA 1GTHA 3WH9A 3MUY1 2Q09A 2Z1BA 3HFYA 4CN4A 5G2WA 3FJNA 2CBIA 5D30A 3V0UA 3N11A 1E9YB 2VURA 3BMXA 4WUIA 5K9DA 3GS6A 2X0HA 3G1VA 2QUMA 4X63A 1EGMA 2JKAA 4NAEA 5FJRA 1J93A 3DGZA 3OZYA 3S83A 1QHPA 3NQ7A 4FIQA 4RPQA 3W83A 3E0VA 4Q22A 1JPIA 4WXYA 1IT7A 2VI0A 4PB3A 3ITYA 3T8QA 2J66A 1I0BA 3N15A 4RW5A 3N04A 1PKYA 2A1YA 4C60A 1WDDA 4XWUA 3TTYA 1WAWA 1VAHA 2GVJA 4LOCA 3S5ZA 4TVCA 4LALA 3CM4A 4CCDA 4DJDD 1HP4A 4IISA 1BGAA 4HT3A 5LNVA 5HR6A 1UUOA 2WQDA 3MDWA 1RHCA 5C2XA 4NT0A 3FYOA 4HN8A 4PFHA 4MB3A 2NX3A 5E9XA 4RK8A 4IGNA 1D9EA 3R0UA 1SU5A 3NJ3A 4KEMA 4ZB5A 1EJRC 4DXXA 5JUVA 4UTHA 4MZ1A 4G9PA 4LF2A 2W91A 1X8CA 3AIVA 1F4AA 2INEA 4IUOA 1BAGA 2FTWA 3MCMA 4C1LA 4FLOA 1FXQA 2NV1A 2J8FA 3QQ1A 3N2MA 3UVAA 4BY3A 2UV8G 4U3CA 4AF0B 4CD6A 1IV8A 1WDRA 2AQVA 4MJZA 5D38A 3ELFA 4GXWA 3T44A 4JTUA 2EQ6A 3LB8A 2HROA 1JCYA 1B3XA 4S3BA 4RCXA 3EWUA 3MV11 4DELA 1VCGA 3RAOA 1OG6A 3DYPA 1NH6A 1GHSA 1VD6A 3W38A 2DZWA 3TE9A 2DSKA 2ZUTA 1JZ8A 3S1GA 3U9IA 4NKCA 3T0BA 3H21A 1BKHA 3KBNA 3D3FA 4O4WA 3EDJA 1F6KA 3RLVA 3BZGA 4G8TA 4NAFB 5LYRA 3DJJA 3IJIA 3S9YA 1UP2A 2Y24A 4H4ZA 3H55A 3CQIA 5SWUA 2GGIA 2FGLA 4CU6A 2YCLB 1KBLA 1WZAA 3VGBA 3MHGA 2CITA 4KERA 4H9ZA 3POHA 2FQIA 5HQLA 5M03A 3SBFA 3WY1A 5TBOA 2NWSA 1OBAA 1Q2SA 4GNJA 4H41A 3CV1A 3R11A 5JIPA 1DQXA 1Q6GA 3MBDA 3TW9A 8A3HA 1O68A 1MWOA 1ITXA 2O4QA 1Z48A 3WFZA 4UTMA 4JDYA 2HRWA 3UZYA 1T99A 4XSLA 3B8TA 5EPDA 4DHGA 2OZ8A 2TMDA 2ZX9A 4IFOA 2PLCA 3WF2A 1PX8A 3PUEA 3KL5A 2H8XA 1Z32X 3HBLA 3OA5A 3CV6A 1VCVA 2FH8A 3JZUA 4WRHA 3VNKA 1WXZA 2QGHA 1D3HA 2ZFAA 1RA5A 4GI6A 3MBFA 4FR6A 3THQA 4KETA 1Y8BA 3OHIA 3QGKC 3NR0A 4JCMA 3DDMA 3AU2A 2ZC8A 5CGMA 3CPRA 3SFKA 4DLFA 3A64A 4JTIA 3LOTA 5ECVA 3W75A 1FA2A 1CXFA 3MSGA 1V0KA 3TTOA 5CJNA 2FJUB 1BD0A 3UYCA 3MUIA 3CAVA 3R25A 4MZ8A 4JTEA 2GGEA 5H8UA 2WPFA 2HBVA 3UPMA 2V3FA 4GZIA 4CNTA 3TXVA 5DN1A 6A3HA 1S3HA 1HJSA 2X50A 4W8BA 1F3EA 1CWYA 3R12A 4ZB2A 5C71A 4PC8A 1LT8A 2NVAA 2Y7GA 1QNSA 2YDRA 1J6OA 2DZBA 3CZKA 1QRQA 3OEXA 4GUJA 4WR3A 1NHPA 4HNCA 4XZHA 4EPKA 2G3FA 1LLOA 2C0HA 4RKAA 1KFKA 3AIBA 3RMEA 3OZOA 1U83A 1O66A 1VH7A 5FA5A 5A8NA 1R7OA 1ONXA 1TUXA 3QN3A 1XYAA 1OGSA 3TYBA 1TPDA 2FB2A 3ANUA 3N2XA 3VPLA 4V2XA 1G4TA 1O95A 2ABBA 4UFKA 1YIXA 3BQ6A 2PTYA 3PN8A 1GVSA 3C0LA 4EK7A 3CZLA 1QNOA