2PMQA

Crystal structure of a mandelate racemase/muconate lactonizing enzyme from roseovarius sp. htcc2601
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
367
structure length
367
Chain Sequence
KIAEIQLFQHDLPVVNGPYRIASGDVWSLTTTIVKIIAEDGTIGWGETCPVGPTYAEAHAGGALAALEVLASGLAGAEALPLPLHTRMDSLLCGHNYAKSALDIAVHDLWGKRLGVPVHELLGGALTDSVSSYYSLGVMEPDEAARQALEKQREGYSRLQVKLGARPIEIDIEAIRKVWEAVRGTGIALAADGNRGWTTRDALRFSRECPDIPFVMEQPCNSFEDLEAIRPLCHHALYMDEDGTSLNTVITAAATSLVDGFGMKVSRIGGLQHMRAFRDFCAARNLPHTCDDAWGGDIVSAACTHIASTVLPRLMEGAWLAQPYVAEHYDAENGVRIEGGRIRVPQGPGLGLTIDPERFGPPLFSAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of new enzymes and metabolic pathways by using structure and genome context.
pubmed doi rcsb
source organism Roseovarius sp.
molecule tags Isomerase
molecule keywords Mandelate racemase/muconate lactonizing enzyme
total genus 125
structure length 367
sequence length 367
chains with identical sequence B
ec nomenclature ec 5.1.1.22: 4-hydroxyproline betaine 2-epimerase.
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2pmqA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2pmqA01
1MDLA 4KWSA 4GMEA 1EC7A 4GYPA 2PS2A 3H70A 3IJLA 2OZ3A 4IP4A 1FHUA 3IJQA 3VC6A 5BOEA 3BJSA 2PSNA 4HNCA 3VDGA 4DWDA 2AKZA 1W6TA 3QTPA 3U4FA 3UXKA 3FVDA 2O56A 3T8QA 3V4BA 1NELA 4GYPC 4HNLA 2XGZA 1JPDX 3TJ4A 3P3BA 4HCHA 4HCDA 3VCNA 3EKGA 3ZLGA 2P88A 4EWJA 3JVAA 4E8GA 4FI4A 1XPYA 1XS2A 1YEYA 4F4RA 4J1OA 3T6CA 2QDDA 3MY9A 3MSYA 3MUCA 2P8CA 4Z1YA 3PK7A 1F9CA 2OLAA 3FV9A 3CXOA 4H1ZA 2PTWA 2PU0A 3SSZA 3MQTA 2GL5A 3B97A 4YWSA 3QN3A 3NXLA 4IHCA 3UCDA 3R0KA 3DFYA 1MDRA 1RVKA 3UGVA 4DYEA 3ZVHA 4X2PA 3PWGA 2OQHA 4G8TA 4HPNA 3CAWA 4K2SA 4KEMA 4M0XA 1JDFA 1PDZA 2XH4A 3ES7A 4IL0A 3H12A 3UJRA 4H83A 4MKSA 1KKOA 2QJNA 2ZC8A 3CB3A 3JZUA 2OG9A 3SBFA 4GGHA 3TJIA 3VCCA 2QJMA 2XH2A 3RO6A 1FHVA 4Z17A 3DG7A 1PDYA 3T9PA 1DTNA 3NZGA 4JHMA 3OTRA 3N6JA 3U9IA 3DESA 2MUCA 3TW9A 2GGIA 1ELSA 1JCTA 1E9IA 2GGEA 3DGBA 4G7FA 5FJPA 4IP5A 4DXKA 2RDXA 3TTEA 3BSMA 1JPMA 1ONEA 3GO2A 3CK5A 4K8GA 3ES8A 2PTYA 2PA6A 3Q4DA 2QJJA 2PCEA 3VFCA 5FJRA 2PPGA 1WUFA 3EEZA 3VA8A 1OEPA 3BOXA 3QPEA 3S5SA 2PMQA 3OP2A 3R1ZA 1TZZA 2I5QA 1MUCA 3MZNA 2AL1A 3DFHA 3UXLA 3GY1A 3ZLHA 4ROPA 3ZLFA 4A35A 2OKTA 4J3ZA 2HNEA 3OPSA 3K1GA 2PTZA 4DX3A 3ZVIA 4A6GA 2PTXA 3I4KA 4HN8A 4MGGA 2AKMA 2GSHA 4ZCWA 4GFIA 2HZGA 3MKCA 2XH0A 3R11A 3IJIA 3H8AA 4IT1A 3RRAA 3R0UA 4M6UA 3TWBA 2FKPA 4GGBA 5J04A 7ENLA 2NQLA 3TCSA 3TWAA 1P43A 4GISA 2QQ6A 1KKRA 4H2HA 5ENLA 3VC5A 6ENLA 1BQGA 4E6MA 4IZGA 2QDEA 5FJTA 1NU5A 2PP3A 3RGTA 2OZ8A 3P93A 3FYYA 3PFRA 3HPFA 3UJFA 3FXGA 3JW7A 4IL2A 3UJ2A 1WUEA 5IDZA 3KUMA 2OPJA 1R6WA 3IK4A 3STPA 3N4EA 1BKHA 3Q45A 2HXUA 3SJNA 3SQSA 2OFJA 1SJDA 1P48A 4HCLA 4ZA0A 3DG6A 4KT2A 2PGEA 3FCPA 3D46A 2OX4A 3UCCA 3QKEA 3SN4A 1SJCA 4KPLA 2PODA 1SJAA 3MWCA 3PWIA 5EU9A 4MMWA 2CHRA 2ONEA 2GGJA 3P0WA 3H7VA 4HYRA 3UJEA 3OZYA 1ECQA 4JN7A 2PU1A 1EBHA 3CT2A 4A3RA 4DHGA 3DEQA 2GGGA 3I6EA 1KD0A 2ZADA 3R25A 4GIRA 3N6HA 1SJBA 4H19A 2DW7A 3NO1A 3V5CA 4E4UA 3DERA 3R10A 2MNRA 1MRAA 1IYXA 3V5FA 3SN1A 3RITA 3RCYA 5BOFA 5FJOA 3GD6A 2P0IA 2PP0A 1R0MA 3DIPA 4E5TA 3TOYA 1EC9A 5FJUA 3FJ4A 2PP1A 3V3WA 4FP1A 4JN8A 2HXTA 1TKKA 4DN1A 2GDQA 2QVHA 2OQYA 2XSXA 3I6TA 3DDMA 1L8PA 2PGWA 1MNSA 3NFUA 3ZVHB 2GGHA 2OZTA 3THUA 2FYMA 2OVLA 1EBGA 3DG3A 3OW1A 1KCZA 3D47A 2AL2B 1EC8A 3CYJA 3RR1A 3UJSA 3QLDA 2POZA 3TQPA 2OO6A 2DW6A 3N4FA 3SN0A 4E4FA 2P8BA 2P3ZA 3OZMA 3ENLA 4K1WA 2XH7A 2AL2A 3S47A 3T4WA 2QGYA 1TE6A 4ENLA 3GC2A
chains in the Genus database with same CATH superfamily
1C8XA 1XQLA 3VOHA 3PBGA 2YCKX 2PS2A 4FR6A 3FX4A 4ZR8A 4YLWA 4IP4A 3IJQA 2QT3A 4HD5A 4NY2A 3KLJA 1PV8A 2JF6A 4GO9A 4H3DA 3RFAA 2RHGA 5C7HA 3LERA 2Z24A 3V4BA 3M0LA 4JIPA 4HCHA 4TTGA 2PF8A 3M43A 1OK6A 3BV7A 2A3EA 1I75A 3W22A 1GQKA 3OJGA 4DZAA 1E1CA 3GXFA 1I9CB 5H8UA 4GO8A 3EMZA 4XTDA 1E6RA 3EWDA 1WDPA 5JRBA 1QU4A 2Z7KA 3L67A 4KWUA 2Y5JA 3UR5A 3WNNA 5LNUA 1FWRA 1K77A 2QGHA 1LQAA 4FR1A 2WBAA 4NEVA 4HA0A 5MHBA 1XIJA 1Y65A 4JTIA 1NOUA 1FWFC 3PZVA 1Z3NA 1Q6QA 2VM8A 4KH2A 3S9YA 4C6JA 3T4CA 2BVWA 2Q3OA 4O0QA 3RM9A 4F40A 1VEMA 5U25A 3GTNA 3IARA 3IUDA 3ORWA 1O5RA 3KS5A 2E1WA 1RAKA 4D1JA 2VEMA 2ODOA 5G1TA 2WYSA 5FF2A 4YTRA 5AB3A 1AQMA 4IL0A 3UJRA 4PA8A 3MCOA 3VNMA 4O4WA 3CB3A 1VBUA 4I9JA 3KHDA 4GGHA 3TJIA 1K9FA 3BC9A 1KV8A 2W4XA 1M5WA 1A5OC 4E38A 2R94A 4CNUA 1V3JA 1W9XA 4B91A 5CPOA 3G0XA 4LXFA 3W00A 1W5OA 1SFTA 1AMKA 1UQYA 1UP3A 1AMYA 4EPDC 4WQ6A 4KQNA 3VD9A 3A4WA 5BRBA 2O9PA 3T0CA 2J77A 4L65A 3BSMA 4IPJA 3BO9A 2E6FA 5CZJA 3OVPA 1ZQ5A 3O0KA 2PTYA 4DNMA 1AL8A 4TOQA 1OY0A 4U28A 1J0KA 4NZ5A 4P7OA 3GU1A 3QXBA 1RV8A 4QG6A 5FF4A 3GDKA 5D2XA 3ZLFA 4HKPA 3VIKA 2XIMA 3WUGA 5KZEA 1W2VA 1D8WA 3VVGA 4R7OA 4P8UA 4UQDA 5CZ0A 4DX3A 3MBDA 3DK4A 1C29A 4A6GA 4H8NA 2AKMA 3GXPA 2EPLX 4MTVA 1YDNA 2HZGA 1VJIA 4DYKA 2YBTA 1RSCA 4PSPA 1EQPA 1JPKA 2QS8A 4CUCA 1XYZA 1JAEA 4HHPA 4K1GA 4OFCA 2Q3RA 3LI1A 1UJQA 2NUYA 4IMCA 4M6VA 1RXOB 4OOZA 4K37A 2QQ6A 3GG1A 3KOFA 1BVWA 3M0XA 3PTMA 5BXSA 3LBOA 1DL3A 1JIBA 4CEUC 5C9XA 5KETA 1GREA 4XWUA 4JR5A 2OCZA 3B03A 1YBQA 1KR0A 1SM9A 1V0MA 3P5YA 1G7VA 3FFSA 3UJFA 1XCWA 3ZXWA 1KRMA 4W85A 2ZVRA 1MNZA 1XQKA 3SJNA 1KTCA 2DSWA 1QVBA 3ZFHA 4HZ7A 2EQ8A 5AN7A 1GG1A 4C6QA 1WDSA 2V81A 4Q4PA 4M6PA 5GJMA 5IHSA 3PFMA 5EGRA 3MHUA 3BAJA 1Q4NX 4O57A 3SUTA 3PULA 4BQ4A 4AF0A 4Z2KA 4EPKA 5F4XA 1CI1A 4LUIA 3DBNA 3TYEA 3WD1A 4LANA 3WMLA 4W86A 2A4AA 3DX5A 1ZDLA 1OT1A 5C0QA 2WMJA 4MZ1A 3R13A 3H2EA 5AYBA 3PVFA 3EF6A 3RCNA 4Q7BA 1TWZA 4DBWA 2Z1SA 4J2MA 1XBXA 4HSNA 3BWWA 5D8WA 1S5VA 5ABTA 2VNCA 4URIA 1XIGA 2DZAA 1RJPA 1TR1A 5A8NA 4XKMA 4KWWA 3M5XA 3VDAA 3GXIA 4DBSA 3HG4A 2CCRA 2INZA 1ZB5A 4HZ8A 3WBEA 1OGSA 4J2PA 4JCLA 3T07A 4IIBA 3VM7A 1G0CA 4PEEA 3C8NA 3OBAA 4E2OA 4TX6A 4W5UA 2HVNA 1ZBVA 4OUIA 3I65A 2GR2A 4R9XA 3NOEA 3EXSA 4J28A 4OTKA 3V16A 1OF8A 4Y8FA 3OA5A 4LWWA 1VLWA 1UKPA 4Q8MA 2ATSA 2QCEA 1S39A 1CW2A 4XKYB 2R9RA 3E5BA 3THUA 5I0DA 3PUDA 1KCZA 3UF9A 2AL2B 2OGYA 3RR1A 4WCJA 3UJSA 2VEPA 1EF2A 2DW6A 2V5BA 1NDYA 3EMCA 3O05A 2VVNA 3LD5A 1VF8A 3CGTA 3H2AA 1M7XA 1TA3A 2HVMA 4RDVA 3AZRA 3QZEA 1BZLA 1XG3A 3NQ2A 5JIPA 2D2OA 5JVLA 1JCYA 1MQQA 1GOWA 4CCZA 5FSEC 1H2JA 2EQ7A 5BZAA 5K2ZA 1MDLA 1W1YA 5F1VA 4QROA 5A8GA 4BY3A 1SMAA 2ZXDA 3GRIA 3IJLA 3L4YA 1LG2A 3RXZA 2NX3A 1B3WA 3HPSA 4DM2A 3S5NA 3CV1A 1IR1A 2AKZA 4JD4A 1V59A 3PUEA 3CIXA 3T8QA 4OVXA 5D03A 1H7NA 1KFBA 2ZXQA 3BG3A 4AYGA 2PDHA 4AVOA 4DJDD 1CB7B 3V1PA 2YA2A 3OVRA 4HHLA 3AICA 5G2IA 4ZQPA 2CXGA 3W85A 4M7TA 2VR2A 4DZIA 3MUAA 1HP4A 3PANA 3A3WA 4WD0A 3UY8A 1XPYA 3PP7A 1TB3A 3WMBA 4FX6M 4QRNA 3WZ0E 1RA5A 3HPAA 3LPFA 1WDWA 3BPWA 3T44A 1AH4A 3FOKA 3MY9A 4I5XA 2ACUA 1OFPA 3MMUA 3V1HA 1MZRA 2KZHA 3N6QA 4AMCA 3ZR4A 2WNQA 3H4GA 1KCLA 3NRZB 1VENA 3EWWA 1KRAC 3WH9A 1N2VA 3AYSA 3G22A 2PU0A 3NA8A 3SQPA 3E12A 4M24A 3SCUA 3W7IA 3ITGA 4YCOA 2F84A 1FEBA 5EKYA 1BD0A 3GTHA 4N9BA 3FS2A 3FHAA 1ZMDA 1N55A 1XBZA 1J18A 2QAFA 4GNJA 1N61C 2INEA 2YYTA 2FGBA 1DXLA 3VO0A 5FF7A 2ZUVA 4GX8A 1S2CA 4C6IA 5LA1A 1V03A 3CPUA 4MF4A 4RW3A 4BFAA 3U57A 2FZMA 2ZOXA 4HSHA 3WNMA 4FALA 3ES7A 1V93A 4AD2A 2GQAA 4WUIA 5CGTA 7REQA 3F03K 4JQ4A 3EB2A 3K8KA 3P61A 3FEMA 4PGLA 4A2SA 4LBUA 4JFWA 2X1IA 1FHVA 3AM9A 2VC7A 4GBDA 1GRTA 4HHMA 1AW5A 1AK5A 1DV7A 1Q1RA 1QOQA 1W9UA 2EPMX 1PPIA 1LT8A 3DESA 3NNTA 5JMUA 3M0ZA 1UPMB 2YXGA 1XDJA 1V0LA 1Q45A 1IXOA 2HV5A 1UD5A 2TYSA 3TLLA 2QCHA 3BARA 3MI6A 2FZ9A 3THDA 3OQEA 1WOBA 4MM1A 2ZRWA 1W8GA 2OWWA 2REQB 3AMKA 1VRXA 1CIUA 2O55A 3WH5A 4A21A 4D8ZA 3WD2A 1AG1O 3VIMA 1SW0A 3HG2A 1XBYA 2V2CA 3LXBA 1WUFA 1XDIA 4IGHA 3R4IA 1GVSA 1QNSA 3F5JA 4R5EA 1QPNA 1H1NA 4J3UA 1GZ1A 4UTJA 1IE7C 4AWTA 3FSTA 3SR6B 1XLHA 3KTCA 3IJ9A 1EHNA 3A5FA 2PTZA 3B8TA 1QPKA 8XIAA 3VGHA 2HDJA 3N29A 3I3DA 2AQOA 3QRHA 2FB3A 2VD9A 2E7FA 1TJ2A 3IV3A 4ACZB 4ZCWA 2QUNA 2NVAA 4DM1A 4QE5A 1JUEA 1NP2A 4MYAA 3GYEA 3ITVA 3O6AA 2DPEA 4M6UA 1AJ0A 4U3AA 4JTTA 3TWBA 4B90A 2OEJA 2BXVA 2WB5A 2FKPA 3IRSA 4EOUA 3BAKA 1J0YA 4ZOBA 3TFXA 1GRFA 2Q8ZA 3ZWSA 1XDLA 3S46A 5HBFA 3CH9A 8XIMA 4XSMA 2ZZCA 4B5SA 4OE7A 2ZXBA 2QDHA 5LNSA 1Q8JA 2IKHA 5JCKA 4LC6A 3EUB3 2G3JA 2ASHA 1A5AA 1PZ2A 5D9MA 3LENA 4J3XA 3BV4A 2G97A 3KUMA 4QNWA 1OX5A 4H6EA 2E5CA 2YDQA 5CBJA 5EBUA 2EG6A 2OFJA 4BF9A 5HR6A 3N11A 4OGZA 4CEXC 1LG1A 2DIKA 1BYAA 4JFTA 3ATYA 4M19A 4CVWA 4F66A 4NX5A 2PGRA 3L2MA 2H3BA 4ZEPA 3BLPX 4IFRA 3STEA 4S23A 5KTLA 3ZSTA 1AW1A 3ZT6A 3BE7A 1P6CA 3GM8A 3W1XA 2Z2BA 3THQA 1Q6GA 3C6CA 4J3VA 2WJDA 1KC7A 4XZMX 2HQMA 4BURA 1E9ZB 2GJNA 3FDKA 3DEQA 1BVNP 1L6SA 3TDFA 3KRUA 2X0SA 8TIMA 1XIDA 2XWDA 3OBEA 1BAGA 1MI3A 3ANVA 4UMCA 4GJJA 2WSPA 4YTUA 3ZR6A 1MQRA 2WVSA 4AC1X 4TUFA 3OYXA 5BOFA 3RCYA 2IKIA 2QEZA 3GD6A 3I3EA 2RAGA 1GVRA 2ZICA 1CXHA 3V75A 3DIPA 1XR2A 3EX6A 1RJQA 4JNYA 3TZNA 3O15A 4IX2A 1TMQA 2H9AA 3ARWA 3EWBX 3G1HA 4ZOHB 3E49A 2Y62A 4JQ1A 3I10A 1HIZA 4S2CA 2Y24A 1CECA 3WQ8A 1UWUA 2BOGX 4X0NA 4P8WA 1TUXA 3M4HA 3WQOA 4C6LA 2QZRA 4LUTB 4O52A 4MPKA 2HJPA 4Q4SA 2ZX5A 2GVJA 1V4YA 1XICA 1K4QA 1EXBA 4HU4A 1IEQA 3RX4A 1GYMA 1VHNA 1NHRA 2YCEA 1Q6OA 4JTQA 3TQKA 4BF7A 1LLWA 1EC8A 2GPTA 1C9WA 3CYJA 5E9AA 1GVFA 4CCCA 3FA5A 4W8AA 1X6LA 1WNOA 3UD6A 1UKSA 3ITCA 2GRTA 1LWJA 1YYAA 3WF4A 1PCWA 4C65A 2F2HA 4GQQA 1MSSA 3DBPA 1PHWA 2Y1HA 3B4YA 2KAUC 1TE6A 4DWSD 7A3HA 3CQJA 4KF1A 1XHCA 2ZXAA 2H8ZA 2GOUA 4PFMA 1R46A 2VENA 4QNEA 4C6BA 3VX1A 4WKHA 1SMDA 2J9YA 1EJXC 3AWOA 2E9LA 2NV1A 5HWMA 4OV9A 3VDGA 3OLIA 4HNTA 4JX6A 4JTCA 2WJZA 2NQ9A 2HEJA 4QDWA 4P7LA 1G4TA 3CZEA 1SVDA 2ZE0A 3TUUA 2PCQA 2NQJA 4K7VA 1RQBA 4X61A 2ZUUA 2FJKA 2F9RA 1UB3A 2YDRA 1B3VA 2Y2WA 5C5YA 3UZWA 5A69A 5JBFA 5LIYX 4YIWA 4Q7NA 3BCJA 2HBVA 1ZSXA 5G5GB 4KCTA 3G2GA 3VX0A 4UFMA 2WZHA 3L68A 1O4UA 2QUMA 4AZHA 4Y9AA 1Z44A 2NXIA 5FAJA 4Z1YA 1JD9A 1XWYA 3GDLA 2Z1XA 4M81A 3QFAA 4GKLA 2V6AA 4AY8A 2R6OA 2W9MA 3BOFA 5ECVA 4B92A 4YWSA 1C93A 3TJLA 1QI5A 3R0KA 4GINA 1DWIM 3SRKA 3UXDA 4D6JA 4ICMA 3EA2A 5T9BG 5B7ZA 2PWHA 3H55A 1E43A 1OFQA 4HPNA 1LBMA 4I9MA 2ZTKA 4U33A 3A6OA 2X30A 4KGJA 4IG2B 3NQEA 4IJBA 4P8XA 4KEMA 4NJJA 1JI1A 4M0XA 3FXYA 2SFPA 3UXIA 4N0RA 4JYDA 1EZWA 1ISVA 2FPYA 5TQLA 4L9ZA 2OOFA 4BR1A 4NVTA 1WBJA 5J5RA 3WJWA 3P60A 1E1EA 4C7FA 1F05A 1TZ7A 5C9UA 4DO4A 4X63A 1K9TA 2DVXA 1V77A 2GWNA 3OTRA 1JUBA 4WZHA 1PIFA 4OQVA 4FMVA 3LHYA 3DGBA 2WM0A 2CHNA 1D2KA 4O10A 2QPUA 3GW3A 2D23A 1V51A 5DCDA 3NPUA 3B9AA 3WQPA 3F2DA 1EYWA 1ONEA 5I06A 3KXQA 4L5ZA 3GAYA 3P74A 3ES8A 2E25A 1VQTA 4NAEA 1E0XA 3A47A 2PRLA 3TAOA 3R8RA 5TAOA 3GRSA 3IIVA 5DCBA 2D1ZA 3G24A 1YX1A 2O0TA 3ZIZA 3WH7A 1E0WA 1EJTC 5DY2A 1FWAC 4ROPA 4G1NA 5I03A 5BROA 3KP0A 2J75A 3NR0A 3C0LA 4CLMA 4K8EA 2HNEA 2CWNA 1W1TA 3WEOA 3TYDA 3G1AA 3NXFA 4Y6GA 1ZMCA 2FVMA 5A5WA 3AOFA 2EO7A 1W3NA 3CQ0A 1FUYA 1HJSA 4DVOA 2V2HA 1EPXA 2PUZA 1MFUA 3M41A 2XFRA 3S4TA 5DLCA 4B16A 3SZ8A 3JR2A 1JCLA 2XVGA 3LTYA 3OGRA 4GGBA 1TWDA 3TA9A 3E74A 4ADUA 2X8HA 1V3IA 1ZP4A 3HOJA 1DQWA 4H2HA 4TVUA 1BGAA 3NOYA 3ARSA 3YPIA 3M0HA 1VBHA 4I7UA 3NTYA 3PB2A 4S3CA 3FYYA 5FEXA 1QI4A 4Y2WA 4M7SA 1DHKA 1KM5A 4A05A 3ONCA 4RNHA 3G3MA 1H63A 3N4EA 3H2FA 5DQPA 2QV5A 1RCXB 2PD5A 4UTIA 3T55A 2WVVA 2VR4A 5CCZA 4ZA0A 3DHDA 3OO2A 3IUIA 4KERA 2WMIA 3I68A 4NNAA 4Q4RA 3R7MA 4GYJA 1FXQA 1R3SA 2GOKA 1MW1A 2F8QA 5A6TC 3WNPA 3FIGA 4FXJA 1OGBA 4S3GA 2O9RA 2W54A 2BVYA 3CC1A 2C6QA 2WZEA 2DQWA 3S1WA 3GZAA 1ECQA 2AQVA 1AQ0A 1V08A 4WJ8A 4UQCA 4AZCA 3EWCA 4AY1A 3VE7A 3BXWA 2Y6ZA 3EBVA 4JYEA 4NZJA 3W7CA 4WKFA 3M0KA 1UH2A 1O66A 3VMPA 1VIWA 2Z29A 5I02A 3M64A 4F0KA 3HMCA 3KS6A 4NZCA 1LWIA 4BI7A 4NXKA 3GB6A 4LF2A 4WOZA 4CNPA 4H50A 3DH9A 3WBYA 3AMZA 1GQNA 3KTXA 5CAKA 2WAGA 4AZ6A 1TPVA 4Z1BA 2FB2A 2V3BA 1YDVA 1SFLA 2ZC1A 3QZAA 4QLKA 5LIUX 2HXTA 4HMCA 4MB5A 4R3UA 4N7QA 3I6TA 3UR7A 4R53A 1L8PA 3WF1A 2WSYA 3NZQA 2CZVA 4AX7A 5FS7A 4EMJA 3KCJA 4GNVA 3DOPA 5BYWA 3VD7A 1WDQA 1E51A 2XHYA 1DP0A 4QHRA 3O8AA 3N13A 4A8RA 1SQ7A 2FFCA 1WZKA 1N7KA 4BK9A 2POZA 3CZJA 3VOIA 4PRRA 1SW3A 4DUWA 1YKWA 3C0JA 2C1GA 4Q4MA 3SCNA 3H4XA 3BQ6A 1UWAA 1IXQA 3BLKA 3U7VA 2HK1A 4K1WA 5M5DA 1ONXA 3WDIA 5D32A 2D73A 3VI2A 3C8FA 1NDZA 4LT9A 2BLEA 1S5NA 1LM1A 1VDVA 2BFGA 3ABZA 2XGBA 1F07A 1J0IA 4ZB5A 3GLCA 5LA2A 4UFLA 2DFAA 4MY9A 4UZUA 1NJJA 2PSNA 1O68A 3U4AA 2O56A 2E4TA 4C60A 1ZNNA 4AHQA 2QR6A 3WLKX 2QPSA 2VC6A 5AHFA 1EDTA 4MOZA 1CCWB 1B9ZA 4LS0A 5D37A 3FVMA 1W17A 2BCPA 2PE4A 1YW1A 4HK6A 5F2MA 1Y8BA 2WSRA 4F4RA 3FN9A 3UFYA 4XBJA 3ZJ8A 4DJEA 3TN4A 1W3KA 3PF3A 3THCA 1TYTA 1R8LA 5FKYA 2CKSA 2OELA 4IIGA 4OIFA 4BA0A 4W93A 4JDYA 3A3HA 3HTWA 5HATA 3A7RA 1WXZA 2YBUA 3C2OA 4IIDA 1K8CA 2UY2A 4TX8A 2ISSA 2WMFA 2IQTA 1OFBA 3S1VA 1V3LA 3B97A 3SCPA 2ZZ2A 3BMWA 3AJ7A 1POKA 1GONA 3MUZ1 1QI0A 3TSDA 3BGAA 1O5QA 4JXCA 3VIJA 3LGGA 1G4SA 1I45A 1S46A 1AZ2A 1KFWA 1Y5XA 4HNNA 2GR3A 1XLDA 3NEVA 1IWAA 2F61A 5JBDA 3EEGA 2GUBA 1HJUA 2HMCA 4OT7A 2WCAA 1FX6A 2UV8G 3VOGA 3MO4A 3BSGA 1A5KC 3AUOA 2XH4A 1UOKA 1BXBA 3A64A 3AXMA 3HGRA 3DCPA 5I3DA 1A4LA 5J8LA 4H04A 3UNTA 5AZ1A 4F2TA 3NL5A 1J6OA 4N2YA 3VCCA 1TPB1 1HJQA 3MB9A 4H9TA 1WV2A 3DG7A 1DTNA 3K4DA 5E93A 1W1IE 2DV0A 2VGBA 2G8ZA 2HE5A 3AHXA 3G18A 3UWQA 4Q7IA 3T1GA 1VFTA 3P62A 1HUVA 1XRVA 4ZXLA 4AZCB 3GS6A 1I2OA 3DXIA 2O7QA 3AS3A 4NZ4A 1K7FA 4G7FA 4F3HA 3W37A 4G1KA 1KNWA 5KINA 2Z0IA 4A3YA 1MEIA 3RK8A 4PTWA 3CEPA 3N73A 4S3AA 4FO4A 1V7AA 4K8HA 2BB0A 4LAKA 1XRSA 3HFTA 1O1ZA 3TP4A 4HOWA 3P67A 2PDGA 1FY6A 4WXYA 1IEWA 1TELA 2VGFA 4CD7A 4ZO8A 2GDVA 3ECQA 1DJWA 2A8XA 1ALDA 4MNLA 3GY1A 4O1DA 4AD5A 2WZTA 4I90A 1LUCA 4J3ZA 2J7EA 2VZUA 4KFOA 1W37A 3K1GA 1XFCA 5BXPA 5AYYA 1ISWA 3IEBA 3VUSA 4RNJA 4M1BA 4J3WA 4UR8A 1AQFA 3NL2A 3VD3A 4O1BA 4K7ZA 3FAWA 5DT5A 4GKTA 3R11A 7TIMA 1EA0A 1C91A 3PJTA 1QO2A 2ISVA 4PB4A 2X1RA 3HGJA 3RPDA 5HQMA 3H26A 2BY1A 3O6DA 1VQZA 3WNKA 3KL5A 4L6HA 2EBNA 1JZ5A 1MZHA 2RGLA 7ENLA 1DWGM 1SFJA 4PE8A 2Y0FA 1X1OA 4EQWA 3JUGA 2CU0A 1U1UA 3ZO9A 4Q6JA 4A3QA 3BLIA 1PBGA 2YA1A 1QHZA 3U2ZA 1EZ2A 3LADA 3AMGA 2R91A 3HPFA 1L2QA 4EP8C 1ICSA 2OX1A 3A7AA 1PX4A 1OWQA 2G3IA 4DI8A 1R30A 3RR4A 4XD6A 2X09A 3IK4A 1E6QM 1K8ZA 4AVFA 4I6VA 2F2KA 2XN1A 2E9MA 1DQUA 4GH1A 3DG6A 3PS7A 1QWKA 4H4RA 2JGQA 3CAQA 4PBEA 5CC3A 3D46A 3SGGA 3D5HA 1U2YA 5CG7A 4HNUA 4W7UA 3SIMA 2OR2A 2I16A 2BWGA 4AXNA 4DLFA 3PWIA 3QTGA 3LCLA 4HTYA 3PN8A 2NT0A 1CXIA 1HGWA 4JEQA 1PB0A 3H7UA 4A3RA 1FWTA 3IJ8A 3REQA 4UQBA 2WPGA 3RJYA 7CGTA 1P0NA 3GSMA 4XO6A 2GVGA 1LQ0A 1W5MA 2YZRA 2FHFA 3W1LA 4JIQA 3R10A 2FDMA 4F0RA 2MNRA 3IC9A 2ZVIA 4JNZA 4H9ZA 3NDZA 2TAAA 2NQHA 3LM3A 3CYVA 4Q4OA 2QCCA 1R0MA 1H1YA 1X2GA 2D0GA 1IEIA 1UR3M 4NJGA 1QRQA 4RZ6A 3AQUA 1WXJA 2Z2AA 1IZKA 5EYWA 3DDMA 1VBJA 4KRUA 1U22A 2QJHA 1FFQA 3PJUA 4IPIA 4DJDC 1LZOA 1FH9A 3RX3A 3R0DA 1ZAHA 4R85A 1QASA 3TU9A 1J2WA 1JYVA 2JF7A 1CTNA 4DJEC 4UFKA 3D47A 4QCFA 3S1GA 5DXXA 4ERGA 1SZFA 2V30A 1UD6A 2C3ZA 4AD1A 3U8GA 5GNYA 4LPCA 3KL0A 2CBJA 3DI0A 3GHTA 4RPPA 1WZMA 2CFFA 2WBGA 1L6YA 4YHEA 3GNXA 1ADOA 2JGYA 4DXVA 4ZGYA 3VZYA 1H11A 1EJWC 3WNLA 4Z1AA 4ZQMA 3WQVA 3TZFA 4B5UA 2Z4GA 4FAMA 1FRBA 3QV8A 1FH7A 1S5TA 5BOEA 1M3UA 3FVDA 5HQEA 3Q37A 1NELA 1DVJA 2WWCA 4H9VA 1US0A 1ZX9A 3FNDA 3QR0A 3VCNA 4IJRA 4FI4A 1P0BA 2R1MA 2FZNA 4X9YA 3WQWA 4AHPA 4MDOA 4H4QA 1ISXA 5CC7A 4MJ2A 2PTDA 4EQSA 4ORIA 2FQIA 3D3AA 2Y7EA 2DY3A 4O17A 4C6MA 4DAFA 5LNWA 1GT8A 4ZSTA 4C6PA 1UH4A 1UD3A 4I8DA 4H1ZA 4AZ5A 4FOKA 5BXTA 4YVPA 2CXEA 1JG9A 5EMLA 3IVUA 1SSDA 3L0NA 3HF3A 4CU8A 3BW4A 2XSBA 1JULA 1VFHA 4ZO6A 2FJUB 3PJWA 3W73A 3WX7A 2QYGA 1VS1A 3WLSA 3H53A 3M46A 1OYAA 1ICQA 4RXFA 3MUIA 3DFSA 4HJFA 1UR1A 2WHJA 1AOGA 2Q6ZA 2CBIA 3DI1A 3VIIA 3NQ6A 4H83A 4MB1A 2CLKA 1XGDA 2ZC8A 4HNVA 6A3HA 1EJRC 1GORA 2LLEA 3SRDA 1MVYA 4KETA 4XZHA 3UEQA 4E2DA 3TN6A 4P8VA 3TC3A 5FS8A 4DO6A 1HT6A 1YQZA 2CBUA 4XTIA 1V3KA 2W3RA 3ARXA 3MMTA 4PUNA 1G94A 2VEIA 4WDXA 4KCUA 3SCWA 4PMDA 3S6TA 4E2BA 3N3MA 1MEHA 4WK9A 5FD0A 3CMFA 2W5FA 1KTBA 2O7SA 4F0HA 3STCA 4XKYA 4XD4A 4AEFA 4EQXA 4BS0A 4A3HA 1D3CA 2Y70A 3WK0A 4H41A 3EEZA 3VCRA 1UMYA 3OA3A 5MF5A 5K9XA 4P5UA 3CO4A 3R1ZA 2CESA 5IHRA 2V5DA 1M6IA 3DN5A 1HJVA 4L4MA 2KX9A 2QJGA 3WCZA 3QY8A 3GVGA 2OU4A 1PIIA 3FA4A 5G4WA 1NVMA 3W72A 3URAA 4M29A 4J56A 2BS9A 4UR7A 2WHMA 4W88A 1RLDA 1H6VA 2I7GA 4LC8A 4O54A 1J4EA 1DWHM 3VIHA 2X99A 2JIEA 4ATLA 1KXHA 3TCEA 4E3TA 5BNKA 3W70A 4MY1A 4PYSA 3R58A 3WH6A 3T0DA 2P10A 4V2XA 1S3HA 1H60A 3RRAA 3L4XA 4WJEA 5IDIA 3QC0A 4H7CA 3EPNA 1FKWA 2CFYA 1S2UA 4RZBA 1B3OA 1VPYA 4J40A 4P7NA 5C9RA 5J04A 3VGFA 3AU6A 2VCBA 3TCSA 1G67A 1GKRA 4JTRA 4N02A 1FHDA 2I17A 4IM4A 2XIBA 4H9YA 1LT7A 1JRPA 4LH8A 3RGTA 1VRDA 3PFRA 1KXTA 5A6MA 1C9DA 3KLLA 5D4YA 5DXYA 4MJMA 4EE9A 5M3WA 4NRRA 2XTKA 1GG0A 3TSBA 3ABSA 2VHLA 3C2VA 5FS6A 2EG8A 1M03A 1UASA 3RHGA 4CNSA 2OWXA 1XF0A 2EPNA 3HA1A 3MMDA 1FECA 2PGEA 3PR2A 5TNVA 1PO9A 3CQKA 4A29A 2YCLB 1JL8A 3LN3A 1B57A 3GKAA 4GI6A 1SJCA 5REQB 3TMQA 1RD6A 4KPLA 4GFSA 3G6LA 3TW7A 3RMEA 3SECA 1N82A 3HG5A 3F5LA 2YVGA 2GGJA 3P0WA 3LHZA 1H51A 1RD5A 2QIWA 2ABAA 2Z1KA 2WLZA 4NASA 5K4XA 1YTEA 1O5KA 1O5XA 3MC5A 4A22A 4FXRA 4HB7A 4DHGA 5HINA 2EGZA 3W53A 2G95A 2ZADA 4F9JA 2YLAA 3QY6A 1PIGA 3OLEA 4TVCA 2CDUA 2G50A 4Z2LA 3NO1A 1KBBA 4PCFA 4RV8A 3W07A 1EKOA 2OSYA 1F8MA 1FWSA 5I5RA 1UR2A 4JTKA 4I6KA 5T91A 4D1IA 2GSEA 5FIPA 1LL7A 3FJ4A 4XAPA 3CH0A 1XW8A 1LJYA 2WNNA 3W2MA 1A47A 3VE9A 4UOJA 4QP0A 4BV6A 3KRBA 3O2LA 5LKYA 1GPFA 4HIBA 1YDYA 2C71A 1CGTA 3K4AA 2PGWA 3WENA 1TR9A 4HSOA 1UHVA 3ZVHB 3SFWA 2B4GA 3T8LA 2GGHA 4C1NB 3GRTA 4QJ5B 4HJWA 5KITA 1PE1A 4JQ3A 4S38A 5A6JA 1HF6A 3E1F1 1B3XA 1P4CA 3PUOA 2E09A 1IGWA 2VO5A 3U5UA 2BODX 2IQDA 4CKQA 3W2JA 4CQAA 1V0NA 3KHJA 3THAA 3P8IA 3QW3A 3ENLA 2VZVA 4ONVA 3R07C 3S47A 3T4WA 2Z27A 3LV5A 1LWHA 2AAAA 1WB0A 2FVKA 4U2YA 4O0KA 4MDPA 1G69A 3LQGA 1DXIA 4QJ1A 5LYRA 4HMNA 1FKXA 1JDCA 2O92A 4RE3A 5F4WA 1QUMA 1UZ4A 3MWAA 5G1MA 4GCXA 3TV8A 3UZXA 3A9BA 1KO0A 2IPFA 2QUTA 3H4WA 5A94A 1GCYA 4AF0B 2PBGA 1DTUA 3MJYA 2G37A 1GRHA 2WZMA 1VYPX 4DJFA 1JRCA 3U2CA 1M1BA 4XB3A 1UQZA 4EWJA 4O8RA 1QHOA 1LVLA 4PMJA 1WZAA 1RP8A 1UC4A 2E1DA 2YDSA 4FNTA 3OVQA 4X22A 4Q33A 4ATWA 3KEHA 1F5ZA 3D9XA 4D6EA 1JQXA 3W1NA 2AGKA 3DFNA 2BHYA 4DB7A 3V0TA 2YFNA 1A0CA 5BW6A 4XBSA 2WOWA 3STFA 3SR7A 2QCMA 2Y7GA 3JS3A 5GPRA 4IMAA 2YVJA 1VEOA 4XISA 3GG8A 1R9XA 5E5CA 5FAGA 3QF0A 4B3LA 1TV8A 1T41A 1HO4A 1E5NA 1TTJA 1NFPA 1OFOA 1VYRA 1OC7A 1ITCA 1YXDA 4NF7A 5H8PA 3HGOA 1SO6A 3DC8A 1ZJIA 1S5MA 4PTMA 2BHUA 3UG8A 1L6GA 5AY7A 4TXEA 1ZY8A 1GKQA 4S39A 4UTLA 2AGTA 3VAVA 2PZ0A 3W1PA 3LMYA 3IACA 4JYFA 4LS2A 1EFZA 3RJXA 5EMMA 3DJGX 4JN6A 5LZLA 2BMBA 3OG2A 1JRBA 1Q13A 4ZO9A 1QTWA 3MP3A 3NQDA 5D2WA 3C0SA 3QHOA 5BWFA 4O0ZA 4RNFA 3WD3A 1BKSA 3U9IA 1AH3A 4IJCA 4NQ1A 2NQZA 2RDUA 2G96A 3QC3A 1X1NA 4BCEA 4Y9NA 4ZB2A 3AIVA 2PDLA 3BL3A 2RDXA 4Q8TA 1OADA 3EX1A 3AS1A 5AYIA 4FF7A 5M1TA 4MWAC 4M51A 1O60A 3UVIA 3ZYZA 3N2OA 1X8CA 3L12A 4E4PA 1YMYA 1OJXA 4ZO7A 3Q4DA 1Q65A 3VFCA 5JIWA 1UR8A 2DORA 5LSMA 4QAWA 3URBA 4GI9A 4FEZA 4YWOA 4LV4A 5HNNA 3QGAC 3LGDA 1LF1A 3MSGA 2V0TA 4HA4A 2WPEA 2OLHA 1V0KA 2CPUA 3PTDA 2IMRA 5C2GA 3MYPA 5HPCA 3IIOA 4AHOA 2X8RA 1NQ6A 3OBKA 1DJIA 1XLLA 4MGGA 2PWFA 1U5JA 2GSHA 4PL2A 2WPBA 2B7NA 4CD5A 3ABQA 3WQFA 3LRMA 1GW1A 2PLJA 3TXZA 1XIFA 3PZNA 3POCA 3W1MA 1VKFA 2NQLA 3U2OA 4GXPA 3TWAA 3NURA 1VAHA 2Z1VA 4GYFA 4PULA 1ME9A 1KKRA 2VZTA 3MHGA 2J74A 4MUPA 3VC5A 1VFOA 4H4ZA 5FJTA 5AVNA 4JX4A 1Q7QA 4MYXA 3WLMA 1WOAA 4LVDA 3EOEA 1A49A 3A24A 2PF0A 3EKLA 1WUEA 3HV8A 4O13A 4C7DA 3NIYA 2A7RA 4NZ1A 1TIMA 3STPA 4GOAA 6PTDA 4RZ5A 3GW0A 4JTJA 5K3VA 2D2HA 2X42A 3MHFA 4HCLA 3TNBA 3C5QA 3UQNA 5D33A 5EBKA 4H4SA 2WJEA 4Q8OA 3D0CA 2WP6A 4F8XA 4M5PA 4PMZA 1RCOB 4UB9A 5A6SA 3T0AA 3II1A 3QFWA 4MG4A 5A3HA 1V6UA 1VJSA 4QXIA 4FA3A 1Z48A 5FCZA 2VOMA 1PHQA 3PG6A 3WG6A 2E8ZA 3CZGA 5A8MA 3BMVA 3NVWB 1K70A 3QPYA 1JNEA 3B0XA 4RK8A 1YE6A 5HXMA 1U1JA 5HUOA 2CC0A 1SPQA 1TPEA 4EQRA 1DHPA 1E6SM 1YXCA 3F2BA 2XUCA 3EWZA 1T3QC 3R25A 4XVDA 1TPFA 3N6HA 5CPLA 5HNRA 2VMFA 4H9UA 3SY8A 2Y8KA 2GLKA 2WMKA 5BMWA 3WMCA 3ARZA 4JY9A 1R5YA 4HU0A 5C9ZA 3H22A 1JJKA 2WKGA 3SUVA 3U3HA 4F2BA 1MUWA 1XV8A 3DC0A 2QJIA 3RO8A 1JYNA 3VFLA 4Q8WA 1IXNA 5JU6A 4IFOA 1SZGA 4WXZA 3F2CA 5H8MA 1U5VA 3FW6A 4MPQA 3TX9A 4J35A 4ZQCA 3PBWA 3HPXA 1QK0A 2VCAA 1MNSA 3WLNA 3L2IA 3F7JA 2PDYA 3WQ4A 3C2YA 3OYZA 4I5RA 1E15A 4H8UA 1UWIA 3W1TA 3STGA 3BAXA 2OZTA 2F38A 2DZWA 4FNPA 3VIGA 5FL0A 4LALA 3CIWA 1OCJA 4ZL1A 1KCXA 4HU3A 1OHLA 4X2RA 2W92A 2QAPA 1XSKA 3OZMA 3RG6A 1RH9A 2H3DA 3R12A 5A1AA 2QGYA 1E1CB 1XGEA 1V3HA 4CNTA 3GUWA 1V3MA 1K4GA 4US6A 4GI4A 4ZE4A 4GUHA 3L8KA 3NQ7A 4MWAA 1ENUA 5CAHA 2OT0A 2DUZA 4I9AA 1LBLA 2HISA 3BSHA 4UFJA 4LUJA 3QSTA 3WUEA 1H1ZA 4L6OA 4L7ZA 1KFKA 2OOGA 3DHFA 1QBAA 2C18A 1EPVA 2I14A 1FWNA 2IXVA 5AC8A 1ZU8A 4PTDA 3JVAA 3SQMA 1OFDA 1DNCA 4OBSA 1OIFA 3LXDA 1KBIA 3VUPA 5LGXA 1RP9A 1WKFA 2AAQA 2Z6IA 3POHA 2IPWA 1W32A 4C5YA 3U0HA 1TVNA 4IISA 4LY8A 3NVDA 1ZY9A 3EMQA 2OZ0A 3SGUA 4AW7A 5XIAA 4FZIA 3HM7A 2ADAA 2YIHA 2V3GA 3GIQA 1MOKA 3O6CA 3SURA 1AJ2A 3CTTA 1KXVA 4YVVA 1RVKA 4MHBA 3L7RA 3DU0A 1E6XM 5BCAA 3PTQA 3CLWA 1Q6CA 2FMNA 3CAWA 3W38A 1FTXA 1CENA 2HQAA 2Y63A 4ZODA 3WMSA 4L64A 2PWVA 1RALA 4YVXA 4MIMA 1XUZA 1QNQA 1E9LA 2C14A 3HQOA 1O1HA 3LG3A 2R1KA 3M7WA 3M0MA 4Z1CA 1LOLA 2FHBA 2DT1A 3WBWA 2J9XA 4AIBA 2D3NA 2PWEA 4FDCB 2CERA 1MWOA 4GY1A 1L2UA 4NYYA 2BOFX 1W3LA 1BG9A 4JQAA 1A80A 1F4AA 2ZZ6A 4KS0A 1RM6B 2OJPA 3TW9A 2NLIA 1Q6EA 1JCTA 4NRSA 1V5XA 1R9YA 2EJ1A 1HO1A 3PZUA 2YLLA 4FIQA 2Y8UA 3AJXA 2X0HA 3LS9A 1DPMA 2RKXA 2ZZ0A 3CHDA 3CL6A 2FDSA 3W74A 5IOBA 2J47A 4I7VA 2EHHA 3QV9A 2D0FA 3E0LA 4PUUA 2ATMA 3GTFA 3PM6A 5G2WA 3S6OA 3GXTA 3BOXA 4GXWA 2CIPA 3MCNA 4CNOA 2V3FA 1MUCA 3RNMA 3AYVA 3WLHA 1SR9A 1DWFM 3ZLHA 4ICNA 4CD8A 4NHVA 2I5GA 1UW9A 1MEWA 2OKTA 4PZVA 1E1FA 1OX4B 5KZMA 4LAUA 4B5TA 3BCDA 3IJ7A 2J27A 1JPIA 2GWGA 2J78A 4OECA 4O18A 2VRKA 1ONRA 5DX7A 4CQ9A 5BRPA 1MXGA 3O0HA 5XINA 1GKPA 3D6NA 4N9EA 3MKCA 2XH0A 3WBAA 4JIEA 2ZQ0A 4S3EA 1W5QA 5GJNA 3NAVA 4NNBA 3W2NA 5M17A 1A5MC 4UTHA 3SFKA 1UUMA 8RUCA 4FLSA 3IK2A 4HU8A 4NL1A 3PBUA 5BRQA 2DU2A 3CWHA 5DF0A 3UPBA 3LLXA 1C90A 4L4LA 1CLVA 1NAL1 3E2SA 3UWEA 2XVNA 4QE4A 2W91A 4F48A 5ENLA 1K8XA 2GYIA 2WBKA 1UWQA 3N1AA 3NVZB 1B3ZA 3WBXA 4H9XA 5BXRA 1FDJA 3NSMA 1S1RA 4NEWA 4U5IA 3WLTA 3REQB 2V63A 1KRCC 3QVQA 4G7EB 1X1ZA 2VELA 3ANYA 3SQSA 3M0VA 1PKYA 3KTSA 4O1AA 3WLOA 2EAWA 3NQCA 3EOSA 3F4DA 4J27A 2DZTA 3HQPA 1HN1A 2FZBA 3UZJA 3AHZA 4EANA 4JKKA 2JKAA 2CHRA 1GTEA 3SSJA 5PTDA 2ONEA 2WHKA 5DELA 3OZYA 1QW8A 3EWUA 3K5XA 1XINA 4LOCA 4JEJA 2JKEA 1UA7A 5D9PA 4DIAA 1H7XA 2BTMA 4EX4A 2NVKX 4V15A 2I57A 3EANA 3E38A 4AIEA 2BDQA 3PG9A 1RK5A 3WF2A 4NYUA 4KFNA 2J7FA 2DW7A 1E40A 2Y89A 3AXKA 1QAPA 3WFLA 2CLPA 2F6KA 4ZBCA 1NP0A 2BXZA 2VDHA 4FNQA 5D2TA 4QG9A 1Y5WA 3H21A 2OLSA 3AXXA 3AU2A 3RM4A 1GRAA 1KM0A 4ECLA 1WBHA 1TV3A 1GOOA 1S1PA 3B9OA 3MV01 2YBVA 4GVGA 4UOQA 2GJRA 3GNOA 4QITA 3CQHA 1FO4A 3OZPA 2CZDA 1GRGA 1CDGA 1DOSA 3APTA 1M7JA 2BY3A 4PMVA 3W3OA 1QDSA 3W7JA 1CWYA 3TA6A 1MXDA 1CGUA 3NM1A 4CN4A 4DF1A 1P6WA 3SY5A 2CETA 2P1FA 3ZQ9A 4W87A 4QDPA 3BZGA 3WF0A 2J8TA 1ZUAX 1EJUC 4R7JA 1HVXA 4E4FA 5RUBA 3G0UA 4IGSA 4PMNA 4Y9OA 3URHA 7XIMA 3AHTA 2E6DA 3EA1A 4FB7A 4ZQOA 3WFAA 1US3A 4W89A 3ITLA 4IMDA 2J8FA 1E6ZA 3E2VA 3H7RA 4JFSA 3NDOA 4MB4A 5HOSA 1GYNA 1C92A 1OZQA 3OGSA 1BXCA 3LUTA 2NXHA 3AHYA 3V7PA 4XD3A 2QCDB 4GY0A 1ZAJA 4P61A 1VCGA 4LFYA 4CQCA 1YNYA 4ACYA 3ARVA 4IPNB 4PFHA 2CLLA 4EF9A 2QCNA 1K6WA 1EBDA 5SWUA 5DFAA 3TJ4A 3W7OA 4HMEA 3CAKA 1GEQA 3VGDA 4RUBA 3L4TA 2TSYA 3UY7A 3GC5A 4WF7A 4JFUA 1GETA 2YJQA 1W1PA 4ZTXA 1ZFJA 4L4OA 1XH0A 3GHSA 2XWEA 2JBMA 1E0TA 1XI3A 4OBTA 2DSVA 3WQ5A 1X96A 4YHGA 2WVTA 3SSZA 1OYCA 4J3TA 2HS8A 4Q22A 3ARPA 1Z7AA 1YE4A 3QN3A 5EPDA 3B4UA 4NAEB 5E0KA 4X9SA 1MDRA 2JE8A 4WY0B 3GH4A 3WEZA 1NIUA 3NZPA 1S7MA 4MADA 4UCFA 1P6BA 1W1B1 3J7HA 4MJZA 5CC5A 2DT2A 5CZKA 2X8CA 2TPSA 1TCDA 4PUMA 4FPSA 2QJNA 2NPXA 2OG9A 1M41A 4MKVA 4EAYA 1R7AA 4YYFA 2X1UA 5D9OA 2Z25A 4Q4QA 5JCLA 1WPCA 4YCPA 1EO7A 5I07A 4UOZA 1GTHA 2PDPA 4TVYA 2I1OA 2WANA 3Q94A 1ELSA 3ABXA 2E6AA 2GGEA 1CNVA 1ZTVA 5I23A 4KEZA 5JCMA 1XH2A 5LNRA 2YVFA 3B40A 4IP5A 4QQ3A 3OU8A 1E73M 1KBLA 4IFKA 1QR7A 3GWQA 4L80A 4EM3A 2YOCA 3C52A 3VD5A 4OJYA 3ID7A 2TMDA 4NUWA 1KBKA 3CK5A 1Q8AA 1T7LA 3T0TA 1A0DA 3HBLA 3NM3A 2PPGA 2EEXA 5D30A 3UPWA 1Q6LA 1ITXA 1GQLA 3BDKA 3VM5A 1G7UA 1KGXA 1TZZA 5FI8A 3VYLA 3KBSA 4J4KA 1J01A 3DFHA 1K7EA 1A5UA 3BANA 5FF3A 1E55A 4J57A 4Q8NA 4AZ7A 1W3HA 1XYAA 2X40A 1HJWA 3GTIA 2L5HA 3ZVIA 5KMYA 1FWGC 3LCWA 1STZA 4NKCA 5LHFA 2EKGA 1V6VA 1V6YA 3MP4A 5CSSA 2PDMA 4DJFD 1XUUA 2XFFA 2XIQA 3TW6A 3VKBA 4GVIA 1IT0A 3H6OA 3UU0A 1D3HA 3LX9A 4M82A 3OQ8A 3S2JA 1TTPA 1DQXA 1AZ1A 1KFJA 1JCMP 1FWWA 4RW5A 1XSIA 4LJ3A 4K3ZA 2JIWA 3QR1A 4PUKA 4B3ZA 3O63A 3EDJA 1NDAA 2QLYA 2YPIA 3G1VA 1OBAA 1PTAA 2V5LA 3CGEA 4DBDA 4E6MA 3P84A 1LDCA 4HMDA 5DMNA 6REQB 3SB0A 1P5BA 3GXDA 1I2QA 1JEHA 1OFAA 3TXVA 3W7MA 4PN2A 5J5DA 2WW5A 4FLQA 3TE9A 9CGTA 1OX4A 1HL9A 3G8RA 5AZ0A 4WJXA 4FLRA 1KR1A 1US2A 1C8YA 1GOKA 4UZSA 4AFYA 6TIMA 4AAJA 2UBPC 1V02A 3KZPA 4CU6A 3B8IA 3B8UA 2F6UA 2XISA 4NXSA 4NJKA 6CGTA 1FFUC 1Z69A 2V2DA 3UNDA 4GR1A 5DT7A 3UCCA 4W8LA 3SN4A 4HK5A 2UWFA 2XIJA 3GFZA 4XUGA 4XZWA 2ZDRA 3PZGA 4UWMA 2QCLA 3S5ZA 3V0UA 3TQVA 5CGMA 5I24A 1P0KA 4LUYA 3WD4A 1FEAA 2DT0A 2W66A 5A6LA 3HU7A 4WHBA 2DIEA 3AAMA 2YA0A 1LROA 1TUFA 1SJBA 1VZWA 3KVJA 5I2UA 3OB8A 1UD8A 4A8IA 3GVQA 3SN1A 4CD4A 5HQLA 3TYCA 2PP0A 4DRSA 5C2CA 4L9XA 1EC9A 2EXOA 5H91A 1TQJA 5FJJA 1MQPA 5F1UA 4ES4A 5GNZA 2G5WA 1KFCA 1W9VA 3F4VA 2VX4A 4YPJA 1JPHA 1TPDA 3G6MA 5HANA 6TAAA 5HMEA 4LNCA 1FCUA 1KRBC 3TNOA 1LLZA 4DPPA 5I3GA 4PH6A 1IHIA 3ALGA 3RIKA 4HTBA 1V6WA 2BX7A 3IIXA 3LPOA 2YXOA 5GJPA 2ZCGA 2BC0A 3LK6A 1XD1A 1A3HA 1BGGA 1I4NA 1Y5VA 4EPBC 3GC4A 1G5AA 3GH7A 2J3NA 2RABA 5KSWA 4D8LA 1GEHA 2BGSA 3F4NA 3S6DA 2YDAA 4RL3A 3JRKA 2CYGA 3GC2A 4GQ0A 3QMSA 3GAKA 4ERIA 4GMEA 3N25A 5HMSA 4QBXA 4DJED 4XX6A 3N19B 1CEOA 1OFRA 3W7GA 1ZAIA 3MZ2A 4GRTA 5E70A 3MUXA 4HNCA 4HN4A 4W4QA 1J8VA 4YJ5A 3ERPA 1ZKQA 2XINA 4HPXA 1NWUA 4CQ8A 3GVVA 1Q2SA 1ISYA 4R33A 4Q8VA 3GD4A 1JPDX 1EJVC 2WO5A 1JZ6A 2OT1A 2GK1A 3OIHA 4CNNA 3ZLGA 4GQBA 5FEZA 3BLDA 1XRTA 2QMJA 1VCFA 3CWNA 4TV6A 3OODA 3O3RA 4ALDA 2FH6A 4C6CA 1JEZA 1Q6RA 3SUUA 4HYVA 3NZ1A 4F2UA 2J6XA 2WKJA 5HNUA 2W3SA 5D2VA 3VPLA 3MUCA 3QFBA 4DF2A 4UNKA 1XIMA 4P7RA 5EB8A 5CH9A 1X6NA 3COTA 3T7VA 1KM1A 3MU7A 3K46A 3LGEA 2VEGA 1P1MA 5I79A 3EX3A 2DUXA 4LSBA 1MO0A 5LIWX 4QIUA 3O16A 4H01A 3G1DA 5HDRA 4RCXA 1A5LC 1FFRA 1KA9F 3LQLA 1NM9A 3W4RA 4QISA 1W8SA 3BGJA 3NS1B 1U30A 4E8DA 1XYLA 3AMDA 5A8QA 1GHRA 1UMLA 1F3WA 1TPUA 5M03A 1JZ3A 1T0OA 2ZRYA 5B7YA 1PAMA 1YPFA 3ZOAA 5EBAA 5A8PA 5E6YA 2XDFA 4NZ3A 4R9OA 2YCLA 4Q4KA 4FSAA 2E6YA 3B9JB 6XIAA 3TH6A 3NZGA 3TAKA 4GJ1A 2DEPA 4GH3A 4IICA 5DMYA 4PODA 3NO3A 4HK7A 3M1ZA 1TTIA 4YU1A 1GW9A 3VNJA 2YW3A 1F76A 1FWDC 3A5VA 3RLHA 1KM6A 1UZ1A 3QQ0A 2HRWA 4GABA 1XIEA 3IPWA 3PBYA 3W6LA 4LA1A 4ZOEA 2V38A 3KOXA 1VFUA 3S9ZA 1ZCCA 3NPWA 1UPPA 3CPRA 1NARA 2W0HA 3HB9A 3QHNA 1XLGA 3E0FA 1KFEA 3FJLA 4M80A 2ZWZA 1FBAA 3GBDA 2Q71A 3LZ5A 3S5SA 3PPHA 3OHMB 2J88A 1B9BA 4QSHA 4UUIA 5TR3A 2F7FA 1YRRA 2VOTA 5AECA 1XPGA 3UZZA 8CGTA 3LZ3A 4A35A 4ZB0A 1ADSA 2BOEX 2IPGA 4PRWA 4DO5A 4REQA 5CLWA 5IBXC 2PC8A 2OWCA 1CXEA 1JNDA 4X3ZA 3WUFA 3WLIA 1IEXA 1RQEA 3S8HA 2ZZ3A 3AWNA 1KWGA 2PTXA 1ISZA 4XZNX 3EX4A 4GZEA 2YXXA 4HN8A 4XZ9A 9RUBA 1J12A 4BI5A 4UTKA 4PB5A 1XFBA 3S3GA 1H7WA 2JK2A 4K8DA 1PJ9A 4E2VA 1ONFA 4H00A 2FGZA 4P2VA 4INFA 5F2LA 3RDKA 3LHTA 5IFPA 1MMFA 2A79A 3W1QA 1HGYA 4IH3A 2A0NA 3A4JA 3CJPA 4IMGA 1J79A 3E9AA 1J9YA 1DYSA 4Z2IA 3G1RA 5HNTA 1OINA 4ZVJA 1MRQA 4MSSA 4DEFA 1LQ2A 4O1CA 2BVDA 3UCQA 2W67A 2QDEA 2WVUA 3CZ8A 1PTGA 3WLPA 1W5NA 3QM3A 1YHTA 2PAJA 4HOZA 3W86A 3LTSA 4XAGA 1U5HA 4JHOA 2ZYFA 4UTTA 4K68A 1EXPA 4LB3A 2QPXA 1J6PA 4QEHA 1GJUA 2XZ7A 1P48A 1SZEA 2X1TA 2OMAA 1NFBA 3L5MA 2X2YA 2Y61A 2P0OA 3TR2A 3DENA 1POJA 1XYFA 3O6YX 1RUSA 2OX4A 3W1UA 1ZBCA 1Q1WA 3QKEA 1RPKA 1UJPA 3CHEA 2G3FA 1EJSC 2MANA 3U5YA 1RPXA 4RZ4A 1TV5A 4KWVA 5EU9A 5BOOA 4GBUA 3MSRA 3CIVA 3H7VA 4M52A 1JUKA 1S2WA 1SU5A 2NT1A 3PHAA 3VKKA 4TVDA 4IQEA 1EBHA 1T96A 2AMXA 4UQEA 3CNYA 2X50A 1AH0A 4OWGA 1KD0A 3GR4A 4WR3A 4CGTA 2H90A 3NGFA 2O4MA 1TYGA 2Q09A 1K1DA 5BU9A 4Z2HA 1VYSX 1WYIA 4PCTA 1XH1A 4PMUA 3V5FA 2IUZA 3WLRA 4D6HA 4FF5A 4FX7A 1FWIC 3P80A 1NHQA 4AWUA 1W3IA 3T2PA 4D6IA 1HL2A 2EKCA 3AROA 1SGJA 4JCMA 4O15A 2PP1A 1RCQA 4FK9A 3AIUA 1SO3A 1GJPA 3VNDA 4JN8A 3UPMA 5I78A 2HCVA 2QVHA 2Y5SA 1QW7A 4H8HA 4HGXA 4ADTA 2YW4A 3T08A 1HP5A 4KW2A 3NFUA 1GVIA 1IWPA 2OYKA 1K03A 2ZRVA 2QF8A 1UWSA 3UG4A 1VLIA 1Q4WA 3GBEA 4XAZA 1JDDA 4GIYA 3G1XA 4Z42C 4C5ZA 3SRHA 1T6MA 3FHQA 3WN6A 1WZLA 2V8ZA 3MJMA 1HFBA 3E3HA 3WJZA 3ANUA 3TN3A 4NILA 2CHOA 1WA3A 1UR9A 2GDUA 4QR6A 2ICSA 2NW0A 4NSBA 2UY4A 1JZ2A 4ZOCA 4YWIA 2V3EA 3UT0A 1OJTA 2P50A 2VFEA 3B9EA 3H24A 2PRMA 1RBLA 1WAUA 4U10A 3C61A 1J2BA 2FLIA 4QLJA 1BWVA 1J0ZA 4KEVA 1TSIA 3LTPA 4J5NA 1GSNA 2FHCA 4LYPA 5TD4A 3Q67A 4EIVA 4I9TA 4LCQA 3MW7A 2PDFA 3SGZA 2BASA 1X7FA 1XKYA 4L56A 2YFOA 3R79A 3P3BA 1CXKA 3DFOA 4AD0A 1IEVA 1W56A 1TX2A 3M6DA 4Q6XA 2OKOA 3FKRA 2AAMA 4JIHA 4BQ5A 4DYJA 2VQUA 1FCBA 1W1ZA 4ZMGA 5HULA 2WSKA 1WKYA 4QJ3B 1YNPA 4MJ4A 4HPJA 1ZLPA 4W8BA 5BMXA 1TFVA 2RJHA 2J7BA 3H2OA 4FNUA 2YYUA 4PEKA 1K7XA 3A7UA 4ZFCA 4B5VA 1X38A 3DFQA 4GWEA 2DZUA 5KVIA 3FJ6A 1OQFA 4V27A 4LAMA 2W3ZA 4S3KA 4NU7A 1RQHA 4WY0A 3AMCA 3CEUA 1IIGA 2O9OA 2Z1WA 1AQHA 4LY4A 2JK6A 3GD3A 2QV4A 2VFHA 4X2PA 1R86A 3WO8A 1UR0A 3LBCA 2FPTA 3WNOA 2CLOA 4V33A 1F3TA 2Y8VA 1R38A 5IBXA 2FZ8A 3W0KA 4V1XA 4EKJA 1Q6DA 1SSGA 3H12A 4IPLA 4MKSA 4XZBA 3M9YA 4DQWA 1N8FA 2E5BA 1S3TC 4YS1A 2XH2A 2C13A 1N5WC 3T78A 1XLFA 2GUUA 3BH4A 3W7HA 3N6JA 3LSBA 2MUCA 4EXQA 3CV7A 3S2CA 4ERAA 2BSLA 1SUXA 1FCVA 2ZUSA 5AC4A 3G8EA 1CLKA 3VNKA 5FJPA 3ITTA 2PI6A 3W23A 3WELA 1UZHA 3FEQA 1DE6A 1DIKA 1TRIA 1QO5A 1GYLA 2G4FA 4C1LA 3CO8A 2A1YA 3ALFA 4ZZ9A 1LRQA 2EPOA 3BW3A 4L4PA 1H50A 2H6RA 3UWYA 2F6XA 3VKJA 3E96A 2BBFA 1JDAA 3RPTA 4NNCA 3TR9A 4L61A 3UXAA 4L6DA 1DJYA 2R8WA 2QMKA 4UTTC 5CSYA 3GK0A 4PUJA 1SZNA 2ZA2A 4S3BA 2QDGA 1XRFA 3KRSA 3LU2A 3TLQA 3G77A 2GH5A 1Z42A 3I7RA 2J6VA 1XLBA 4MLRA 3BG5A 4UNLA 1C7TA 5BU6A 3MSDA 2H8XA 3RILA 3RAOA 2A3AA 5C55A 4O8AA 1XD0A 1R3RA 3DUGA 1I1XA 3RN6A 1UKOA 2YL6A 3IJIA 3WFZA 1I60A 3OLGA 1TYPA 1NWTA 2X1SA 2WKLA 3OEXA 1RLCL 4GQRA 4GVFA 1TPWA 1NF0A 3LYEA 1W3JA 3QLLA 3BZJA 3CV2A 1ICPA 4HZ6A 3K13A 4O50A 1E0VA 3QQWA 2VDIA 4GZ7A 1CGWA 2WM1A 4IGMA 4BEUA 1NH6A 2ZA3A 3Q65A 1KW1A 3UA3A 1HKVA 3T09A 1ONWA 4UMAA 4EAMA 2CBVA 4GHRA 4NAFB 1JR1A 3UYCA 1ADDA 3MKKA 4NP7A 4S3JA 5CC6A 3NEHA 3W7EA 5AHLA 3QSRA 2D24A 1UWRA 3JW7A 3QR3A 3LB8A 3TC7A 1XCFA 2XZ9A 4Q8UA 5DRIA 4B9YA 4B3KA 2ZBTA 1AODA 1EEPA 4OOUA 1TJPA 1NFGA 3ARQA 2E3TA 1IR2A 2DH3A 3NSNA 5U4NA 4LUSB 2VEKA 2XGIA 2WOIA 1EDGA 3A22A 4N6FA 2JEPA 4LRSA 3TTQA 3UWZA 1WP6A 2I9UA 4MMWA 3IAQA 4GXMA 5F2IA 4U2ZA 3UJEA 4MFDA 5DO8A 3PZQA 3KWXA 2XVKA 3TJXA 3QBUA 4FXSA 3SW6A 3E2QA 4IX0A 2GGGA 3O06A 4MWAD 1NQKA 2PDCA 3HJZA 3KBMA 3N04A 2Z7GA 1YIXA 1ML1A 2RDWA 1G4EA 2OGJA 2OTDA 3DERA 1F3XA 1JXJA 3M47A 2P76A 4ZFMA 4AZGA 4AWEA 2C3DA 2AOSA 1GZGA 5LGZA 4AY7A 1H7OA 1GOIA 3ARYA 2VGIA 1YPXA 4GK8A 1FWCC 1B54A 1E5JA 4GG9A 5HJYA 3NSXA 2BGNE 4HOXA 4PUEA 2R1LA 3N17A 4NIRA 1BYBA 5H2ZA 1QI3A 3SO7A 1GRBA 1UROA 3QOMA 4ROQA 3ZZ1A 1ECEA 4CN1A 2XFYA 1DIEA 3I3BA 1ZXIC 1NY1A 3JU2A 4D72A 1H7PA 2VT0A 1E72M 3QLDA 1GEUA 4IIEA 1BYDA 4S1FA 1FWEC 5D38A 2NSOA 5JCNA 5CSUA 1J11A 4C6OA 1W0MA 2NWSA 3GVWA 3WUBA 1XG4A 2ISWA 2X05A 3FY1A 2CNCA 2HSAA 3WK3A 3QYQA 1QOPA 4MWAE 2JALA 3URQA 3L4UA 2D69A 3WQ6A 3WDRA 4Q8PA 1CGYA 1DJHA 3F4WA 3DJJA 2PDQA 3GE7A 4QX4A 5FACA 1TA3B 4C1KA 1SO4A 4HVXA 2A2IA 4JZ5A 1CB2A 1UKQA 3TONA 3VC6A 3BAIA 3NWRA 1W6TA 3A12A 1WKDA 1ZALA 3EXRA 5F7UA 1XLCA 3FYOA 4EXBA 3RX2A 3MMWA 5HJXA 2V68A 4O4VA 1EX1A 2OQLA 4JTAA 3N2TA 1YEYA 4WX2A 4J1OA 2AMGA 2RDTA 3SCQA 4JDRA 4KPRA 3QZ6A 3ATZA 2HVOA 3DYPA 5D9NA 7ODCA 4IQLA 3QMRA 3D3FA 4JTSA 4MKNA 3CPGA 4AYSA 3PK7A 4B5XA 1I8JA 3PBMA 1F9CA 2OLAA 4FIRA 1X2HA 1NDVA 1F6PA 3KOWA 3VMNA 4TMCA 1KLZA 3MQTA 3IV8A 1N63C 4DBUA 1W5PA 3EXTA 3WJSA 5HMFA 4IXHA 3UCDA 2ZWYA 1XC4A 2W27A 3W7DA 2C0HA 4KIRA 3KW3A 3CHCA 4QFUA 2VYOA 4LAZA 4F0MA 3W2UA 4IMEA 1OABA 1JDFA 4OV4A 1PDZA 1Q6FA 3EOUA 1BF6A 3SUSA 3AFBA 2C1HA 1EWEA 4PSRA 3VZXA 1KKOA 1TPH1 2CEQA 4XD5A 5HMDA 3QJAA 3SBFA 2RJGA 2QJMA 4EVZA 3NYDA 4UCGA 4TO8A 3N2CA 3UG3A 1KXQA 3T9PA 4WEVX 2HK0A 3TTOA 3L0KA 1REQB 1V8EA 4DJFC 4UQAA 3T81A 1ZL1A 4N9CA 1F6YA 3VGEA 4IIHA 3E0VA 1QOXA 3TTEA 3VDBA 4K38A 1R85A 3ISIX 1PZ3A 2E5DA 1OC5A 3NCOA 4JIIX 2DVUA 3L0GA 2CZFA 2PA6A 3W76A 2PCEA 1IV8A 4N4PA 5I3JA 1WXYA 4M6QA 5HAOA 1YTDA 3QPEA 1XYBA 4MY8A 3C2FA 3HV9A 3OP2A 4GC4A 2JEQA 2PEVA 3V36A 4QS6A 5CGQA 5LXEA 2GZXA 3OPSA 1T8XA 3L9CA 1PX3A 3DGRA 1W9DM 4YYCA 2VWTA 3IAPA 3NQBA 3MDUA 1Q66A 4DZHA 4ZXOA 3H54A 2Y5EA 2Y7FA 2P5NA 4D6GA 5ABHA 3CLMA 1EUAA 2X2GA 5C8BB 2PBOA 3VNIA 4PL1A 4JIRA 3LI0A 4EMIA 3RMJA 1JXKA 4MZYA 1FDZA 5IXEA 3RLUA 1A0EA 2GSJA 4C7GA 3SCSA 1V6TA 1W3TA 3TN5A 3W7PA 4RKAA 1L8NA 3CUHA 1HX0A 4UC5A 1VC4A 1OX6A 1P43A 3FGCB 3H4KA 3AYRA 3SDOA 3GDMA 4TTUA 3GQYA 1ZZMA 3B8DA 1DJXA 4A8LA 3BICA 3PY2A 2FVLA 1DJZA 1B1YA 1L0PA 2EQ6A 3L23A 3JZEA 2P3EA 3AYTA 1EO5A 3AALA 2PP3A 1KCKA 3CS2A 2OZ8A 1BVZA 3CGBA 4GIEA 4KKXA 3TYZA 1B4KA 3PSVA 1UH3A 1VFLA 1PXGA 5GRTA 2PDJA 2E8YA 4HP5A 4BWLC 1TIWA 4G56A 1OD8A 3Q45A 4US5A 3C3UA 2X0YA 1XJBA 1SJDA 3A23A 2D22A 3UA4A 4YN5A 4GUGA 1EDQA 4KT2A 4LRTA 4PUWA 3PNUA 4U4MA 1ZCOA 3NJ3A 4HA1A 2XM2A 2VUNA 2HWGA 2X7WA 4UR9A 4JTEA 1E3XA 3AHVA 1ZHAA 3F5KA 1SJAA 3MWCA 3NDYA 3CTLA 5JH1A 3FGCA 3O9NA 3EB3A 4TIMA 3EA3A 4IG2A 2B7OA 4GLEA 1HKWA 4FNSA 4ZQNA 4ZENA 4KCWA 3LCFA 1JOAA 5HR7A 1UBSA 2YAUA 3SADA 2B7QA 3LCGA 1TG7A 5C71A 3FYPA 5A6BD 2ZUTA 5FF0A 3S5OA 3GHRA 3S1XA 5CXPA 3L4ZA 1UWTA 3RPMA 2P0IA 4GUIA 3GXMA 3SM0A 1JROA 1LBFA 1TQXA 1ESWA 3N9KA 3TOPA 4Z2GA 1R2SA 4PMQA 4M56A 1WE5A 1H5VA 1YBQB 3WF3A 3WK1A 3QEZA 3K8MA 3P81A 4QEEA 2Q8LA 5G4EA 2ZZ7A 1YPIA 1GQJA 2QCFA 1UIPA 1BF2A 3VOFA 4NI8A 3LMZA 2A7NA 2PD9A 3SY1A 5U1OA 5KZ6A 1VPQA 5I09A 2DVTA 2OVLA 3W1AA 3OW1A 2Y85A 3P6LA 1KN0A 5LA0A 6XIMA 4GJIA 2WSQA 5CSRA 4W84A 3E0WA 3N4FA 3EOLA 3PPCA 4UTUA 2V67A 4B2DA 4O14A 4KRZA 5CPTA 3GNDA 4ZQRA 2E5AA 4CD6A 2Q01A 2AL2A 3A21A 1OF6A 3ABOA 3KX6A 1GPWA 4Z1DA 3W25A 2E68A 3AN1A 3VDCA 3APYA 1EWDA 3AZTA 3UG5A 3BLEA 4BWLA 1F74A 5EFDA 3ARTA 1Q7MA 3WQDA 2A21A 4AMAA 1OM0A 1XIBA 4X60A 4H4PA 4WKAA 3MKVA 3PAJA 1EB3A 5EMJA 4EXAA 1UCWA 1H7RA 4GYPC 2XGZA 3KOZA 4RR4A 5D04C 3CUFA 2OXNA 1KGUA 5H6HA 1W31A 3OGVA 2TPRA 1Q5MA 1KTNA 2J66A 1ZPTA 4H7VA 3CHVA 3W7NA 1XS2A 2YKKA 1PYMA 1TO3A 4DBEA 1CT5A 1OG0A 2ZE3A 3GX9A 3AIBA 4H6QA 3UBPC 1QPOA 3G3DA 1BYCA 4MLJA 3M44A 3UETA 3QMTA 1GOXA 2BG5A 2WP5A 1LRNA 1OT2A 1E6PA 1FH8A 1GV4A 4UBPC 4QDMA 3W28A 3E02A 1KBJA 1WDDA 3GDBA 5E0CA 2GL5A 3NQVA 3PZIA 5KEZA 1K3UA 3HGSA 1TE1A 3GR8A 2OYLA 2RFGA 3N2MA 3ZVHA 2EPHA 2VKZG 1W1A1 1GNXA 2GQ8A 1PUDA 3W7KA 4DUOA 1CLXA 4HNOA 3HQ1A 5I3KA 5AYZA 3VDHA 3KBVA 2I9EA 4J9JA 3FJNA 4RLIA 3ONBA 4TV5A 3RLVA 4BEQA 1GOQA 4LUSA 3HZ3A 3B8WA 3W6MA 1NHSA 1HNYA 4EWND 3GUGA 1QK2A 1EIXA 1K8YA 4Z17A 3L4WA 1TJRA 4JY8A 5AHEA 4REQB 1XXXA 2YCIX 3VOJA 2X8GA 1C8VA 3RU8X 1YNQA 3I7SA 4EACA 4AD4A 1L9WA 2VJXA 3HURA 4AC7C 5JXQA 4DXKA 1JVNA 3AIQA 3KVLA 2FH8A 3W9ZA 2WJFA 4JTLA 3GYCA 1BRLB 3GO2A 2F5ZA 4K8GA 3ARRA 1B4EA 3NQFA 1BWKA 5A6AA 3RU6A 3ZS4A 4APNA 3UP8A 2W0UA 1VFFA 4OZOA 2GUYA 5FESA 3VA8A 3CGDA 4L1XA 4LIIA 2BP1A 7TAAA 2VRJA 3GH5A 4JTDA 1ZENA 4LU0A 4S3DA 1F8WA 1R9ZA 3W01A 1HJXA 3PC0A 4ACZA 4JTFA 3IANA 3IVSA 1J96A 1KB3A 3P7YA 3BQ5A 1UA3A 1UR4A 2DP3A 4C1NA 2BY2A 4V28A 5DCEA 4IT1A 1Z9AA 3LHVA 4DY1A 4JX5A 4ZE5A 5HPOA 4EMWA 1R3WA 1ZJBA 1D8CA 4G5DA 4NJHA 2YCJA 1TMHA 2DZBA 3VNZA 4CU7A 1JFHA 1K9EA 3FDGA 4WIWA 4O19A 1BXNA 1GZJA 3M5VA 3MI3A 4JOMA 4K39A 1IQ8A 2A85A 5TF0A 4LBRA 3LCHA 3LRKA 5D05A 3W2KA 2D3LA 4Y7EA 5AC5A 3WKZA 1DXFA 2FTYA 3N34A 3K30A 1P1XA 1RJRA 1E6NA 4CCEA 1DE5A 3P14A 3P93A 5E1QA 5H1WA 2ZRZA 3APGA 1HTIA 3FXGA 2ZX8A 5I77A 1F3PA 1LCOA 1TV2A 3O1NA 3ZJKA 1FA2A 4A4AA 2DIJA 1O95A 4QGCA 4I3GA 3LV6A 1H41A 3DHUA 3CUJA 3I4EA 4JAWA 2Z28A 3N15A 4U3CA 3KFTA 3LRLA 4HYWA 3G1YA 3HJEA 2XN2A 3H2MA 1QNPA 4AD3A 2VX5A 3VU2A 4H6RA 3W27A 2PODA 5LIKX 2WK2A 4YNGA 4L9YA 2B81A 1E3ZA 1S2VA 4GIAA 1PL9A 2D0HA 4H8VA 4HYRA 3GU2A 1HW6A 5G4HC 3CM4A 4JN7A 1LPFA 3BLLA 3V35A 4DUVA 2V3DA 2WMHA 3L2LA 3M0JA 5IFTA 3I6EA 1T8QA 1NTHA 1MUMA 3NG3A 1GVEA 3VMOA 4PCSA 5E0FA 4H4YA 1A53A 4WDUA 4AEOA 2PDIA 1X97A 2A3CA 3UWVA 3V5CA 4M1RA 4LVBA 3UZYA 1M7OA 2VFIA 1MRAA 1B3YA 1IYXA 3TROA 3NPVA 5FJOA 2WOQA 2GK1B 1ZGDA 3W88A 3TOYA 3GR7A 3GKFA 4H7ZA 3B0UX 3GTXA 5A2AA 3V3WA 1VD6A 1LUCB 3NVTA 1HKJA 4OU1A 2ZZ1A 1DWAM 2VXNA 1VPXA 1WKEA 4W5ZA 4UTMA 3Q58A 1VGAA 4NZFA 2TRSA 2J79A 2OQYA 2XSXA 1QBBA 3KRZA 1B2YA 3WIJA 1ODUA 3WDHA 1OD0A 4EK7A 3E5PA 4IIFA 2ZUNA 3XINA 2C19A 2Y7DA 1TV4A 2FYMA 2REQA 2WNWA 7PTDA 3DG3A 2Z6JA 3F1QA 4TVWA 3SRFA 3LPGA 3PPFA 2DSUA 3QY7A 2OO6A 4MB3A 1JDEA 4TX9A 5BWAA 4US5D 2P8BA 4ML9A 3SI9A 1ITQA 1PZ0A 5KZDA 2P3ZA 3W1RA 2V3AA 2I56A 2V9DA 1A4MA 4LS1A 5FEPA 1H62A 1V97A 4GD0A 4ENLA 3RRXA 3AI0A 5AYXA 4EPEC 3R2GA 2NSXA 2OSXA 3QV6A 4ORMA 2JQXA 5A95A 1B30A 5HA7A 3W7QA 3IWPA 2R1PA 1EC7A 1F61A 3O7UA 4H4VA 3P2VA 1JD7A 2DUAA 1R3TA 2J24A 3U6WA 4DWDA 4GPNA 2NV2A 4WDTA 2CLMA 2DQXA 5CJMA 3VILA 1SB3B 4O16A 2E77A 2DZVA 4NG3A 4R27A 3DKJA 4HCDA 1E70M 5L9FA 3EKGA 4PCNA 1E56A 3L5AA 3M7SA 3VGBA 2XG9A 1TMLA 3CUXA 4UTFA 4RX0A 1BQCA 1KWKA 4E0CA 4GQGA 4WRHA 2A3HA 3VIFA 1UZDA 1E0UA 2O9TA 4ASTA 2ZIDA 1MYRA 4GY7A 2QKFA 4GE8A 1I0BA 3W83A 3NL6A 4NT0A 3MVIA 1CX9A 3DFYA 1NSJA 1KM3A 1TZ9A 1XCXA 5ABFA 3UGVA 4H6KA 3CBWA 3A9IA 3N4AA 3UR8A 2OQHA 3I6RA 2VX6A 1Q2RA 2GQWA 1HKIA 2V5JA 3WL0A 2HPMA 4LVFA 2RUSA 2ZKMX 4AX6A 2VL4A 1H09A 4K2SA 2PZNA 4GCAA 1J93A 2PURA 1JYXA 1ODZA 1UIOA 1EIBA 2ZTJA 3A4AA 1I2PA 3NYZA 2P53A 2J7GA 3JZUA 2PB1A 1YADA 3AUJA 3BURA 3B9DA 1CPUA 1OVDA 4D6CA 2WCGA 3RO6A 4C6EA 2VEFA 3G5EA 1CXLA 1QT1A 1O7AA 1U83A 4A2RA 2ALDA 3WK2A 2D2GA 2GGIA 3R5EA 2WLYA 1QMLA 1XM3A 5HJLA 4PMOA 3CWOX 3BK0A 4F0LA 4AG0A 3PNZA 3W7LA 1K4HA 4RNIA 2Y88A 4J7RA 4O1FA 3NUKA 2C3CA 5DANA 3E2RA 2C7FA 3WLLA 1XLKA 4TR9A 5E9XA 1T99A 1AD4A 2WNZA 4FLOA 3A13A 3WL1A 3ZMRA 3LLFA 2YGYA 4IFKB 1R7OA 1RK6A 1JZ4A 2PMQA 3TIMA 2I5QA 3MZNA 4E8CA 1UD2A 2ACQA 4MAVA 5CPSA 4FHAA 3DYOA 1EJ7L 3MS8A 2NZLA 4NJIA 2GFTA 1O6IA 2QUUA 3QGKC 2HS6A 2CLIA 2PDKA 3A3XA 3DFPA 1IZCA 3B0PA 3M5ZA 2R24A 1ZJHA 3CUGA 5FOOA 2WPCA 3DK8A 2J7CA 1ZP3A 2FZDA 2GQ9A 4AWSA 2QIIA 1GESA 3O07A 5KVHA 4QAIA 4W7WA 2NVCA 1JI2A 3HN3A 1SO5A 1DIOA 2IPJA 5DBUA 4I8YA 3W84A 3T2OA 3R43A 3MA8A 4GISA 4LYRA 4BF5A 3TYBA 1OFEA 2QXWA 3CHFA 2YR1A 5C2XA 4YMZA 3MO7A 3UWUA 1UYQA 3B0YA 1A5CA 2D2JA 2R14A 2ZX6A 3M5YA 4IZGA 4MNMA 4UMBA 5FSDC 3GHUA 3W02A 3IRDA 4DPQA 5T9CE 3QGVA 4QSFA 1X98A 3T05A 4PR4A 4XZLX 1E71M 3WSUA 2VZOA 3PBVA 1E4IA 3CMJA 2NQ5A 3VNYA 5I6SA 3LB0A 1ZS2A 3HRDC 5IDZA 3WDJA 1UUOA 1G6CA 1R6WA 5AC6A 1RBAA 1BKHA 4UFHA 2HXUA 5I3IA 2Z00A 5U7SA 1F2JA 5CLTA 5HK4A 1ZBWA 3IS4A 2DSZA 1FXPA 3EB4A 2OEMA 5JH2A 1X6UA 4JICA 3MUY1 3TC6A 3DECA 5ECUA 1XL9A 1P0DA 3EAUA 3EDDA 3L4VA 3OVGA 3USBA 3TKFA 2VWSA 2VD8A 2XSAA 1M65A 4EM4A 2CWXA 4Y8EA 2IXUA 2CW6A 4QS5A 2J9ZA 3AC0A 2XM1A 3ITOA 3LDVA 2ZZBA 5DEZA 1XHGA 2AQWA 4LF1A 2O4QA 2BXYA 2V6OA 3W7RA 1V6XA 2VFGA 3GDRA 1DWJM 4XAYA 4ML4A 1MW2A 3B06A 2CZEA 3GNRA 2BVTA 2VVSA 3NPXA 5AC7A 1D7KA 5B80A 1F7BA 3FSUA 5D02A 1AFSA 1GXFA 3SAZA 1TCMA 5F4SA 1VIZA 4NX0A 4DNHA 2V69A 1Z6KA 1Y0EA 4LEFA 1Z89A 1CBGA 1EQCA 4E5TA 3DKLA 3KE0A 5FJUA 4FP1A 2WPFA 4B9ZA 3AISA 3GG0A 3VGGA 3RYSA 1JZ8A 4YTQA 4DN1A 2GDQA 3OLDA 3Q6JA 3BUVA 4ICCX 4JTUA 4B4FA 3CMGA 3QHMA 4QCEA 4QQUA 2J7DA 4D8AA 3LOTA 1SZRA 1PSCA 5TBOA 2ZZ5A 2IQ0A 4LEQA 2DZSA 3C86A 3EOOA 1LORA 4WLCA 1EBGA 3PPGA 4XV0A 2J62A 4LQ1A 1WX0A 4YTTA 1JF5A 2GVYA 4A3UA 1AVAA 1K02A 2QUVA 1ZK7A 2VUYA 4IUOA 1DXEA 4HZMA 3KBWA 3GNPA 3G0SA 3UESA 3CL7A 1FWHC 3EWXA 4POCA 3TFCA 4HA3A 4RE4A 3ME3A 4DXXA 1R3YA 2WXDM 2WMGA 3N12A 1HZYA 3GFXA 4AH7A 1H5YA 3VKCA 3KP1A 3AIRA 4UXDA 3PWAA 2WC3A 1FWJC 1EOMA 1HG3A 1JQVA 1PKNA 5DRCA 4XUYA 3S83A 1XGZA 3TEVA 1QNVA 3DHPA 1FHUA 5EFFA 1YQ2A 1H4PA 4D2JA 2XFWA 3W82A 4F9DA 3DK9A 2XIIA 3BLFA 1MO9A 2OEKA 4AISA 2IS7A 4JPGA 2QVNA 3CXBA 4WVXA 3WDQA 3IIZA 4KMQA 1JAKA 2RH9A 2FGLA 2YZ5A 4D9PA 3H23A 2VCCA 4QG8A 2YL5A 5CJNA 9XIMA 1KM2A 4HT3A 3ICJA 5HUPA 4B5NA 2GVLA 4AB4A 1AL7A 4OHQA 1PZ1A 2VGGA 2QDDA 1B90A 1IIHA 3MSYA 2BV9A 4OKDA 3IVTA 4G7EA 3LHWA 4EF8A 2OSWA 1DIDA 2PWGA 4AZIA 4GACA 3GU9A 2PTWA 3W29A 3NL3A 4WDWA 1WCGA 2XYLA 5REQA 4XVEA 4PB3A 3VNLA 1S2TA 4R34A 1O94A 4H4UA 3EYPA 3PWGA 1SR0A 4TU1A 1M9HA 3IGHX 1Q63A 2EJAA 5AKQA 4PTNA 1NEYA 1QNOA 2VZSA 4KGLA 4O53A 4R88A 3BW2A 4DWSB 4GX9A 2ZX9A 2W62A 1LLOA 1H49A 2VP8A 3CZLA 2PGFA 5K9CA 1WDRA 3TYUA 1VP5A 5T26A 3TSMA 3LLDA 2XVLA 2E3ZA 4ZTYA 1D7YA 3B9NA 2YX0A 4LVGA 4UIOA 2Y4SA 4AUBA 1T40A 3VZZA 5AOUA 3QPZA 1BEUA 1GQIA 4DI9A 2PLMA 2WWDA 1G4PA 5CZSA 3P0XA 1XYCA 5CKSA 5EMYA 4ATDA 1FCQA 1KGWA 4RJEA 1J5TA 2ZZ4A 3W2LA 1VFSA 1EEXA 1E9IA 3PJXA 1EP2A 1H0GA 4GVHA 1OK4A 1MW0A 4D71A 2VURA 4XSLA 2CKRA 1DEDA 1E4LA 4DLMA 3EZ4A 3BVJA 4O11A 4D6DA 3WQGA 1PYFA 3I7QA 3L5OA 1QJWA 3BJFA 3LCIA 2A5HA 1FOBA 4U31A 1DJQA 3T0BA 1DJNA 4AEEA 2WZIA 1BWCA 2VTFA 1XIIA 2HNHA 3AZSA 5FJRA 4IOTA 1GOMA 1A3WA 4CQBA 2NLYA 1VFMA 1OB0A 3LPPA 1D9EA 5DY3A 5MKGB 1D3GA 2PDBA 1Q85A 3MT1A 3FAXA 3WYZA 4GUFA 3OHIA 4OBRA 1A5NC 1F8IA 4CQDA 1A3XA 5JCIA 5CEWA 1M01A 4BZYA 1DJGA 3HO8A 1QWGA 3OC4A 2C16A 4GFIA 3CZKA 5M2FX 2DH2A 1AJZA 1AD1A 4GRSA