2PMQA

Crystal structure of a mandelate racemase/muconate lactonizing enzyme from roseovarius sp. htcc2601
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
367
structure length
367
Chain Sequence
b'KIAEIQLFQHDLPVVNGPYRIASGDVWSLTTTIVKIIAEDGTIGWGETCPVGPTYAEAHAGGALAALEVLASGLAGAEALPLPLHTRMDSLLCGHNYAKSALDIAVHDLWGKRLGVPVHELLGGALTDSVSSYYSLGVMEPDEAARQALEKQREGYSRLQVKLGARPIEIDIEAIRKVWEAVRGTGIALAADGNRGWTTRDALRFSRECPDIPFVMEQPCNSFEDLEAIRPLCHHALYMDEDGTSLNTVITAAATSLVDGFGMKVSRIGGLQHMRAFRDFCAARNLPHTCDDAWGGDIVSAACTHIASTVLPRLMEGAWLAQPYVAEHYDAENGVRIEGGRIRVPQGPGLGLTIDPERFGPPLFSAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme
publication title Discovery of new enzymes and metabolic pathways by using structure and genome context.
pubmed doi rcsb
source organism Roseovarius sp.
molecule tags Isomerase
total genus 125
structure length 367
sequence length 367
chains with identical sequence B
ec nomenclature ec 5.1.1.22: 4-hydroxyproline betaine 2-epimerase.
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2pmqA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2pmqA01
1ELSA 4KPLA 2XH2A 4A6GA 4GGBA 2FYMA 3DEQA 3T9PA 1P43A 3FJ4A 2PSNA 1PDZA 3FVDA 1RVKA 3S5SA 2ZC8A 3U9IA 5FJRA 2PP3A 3VC5A 3UCDA 3DESA 3IJIA 3GO2A 5BOEA 4K8GA 2FKPA 3MZNA 2P88A 3DDMA 3TWAA 3JW7A 3RO6A 2PP1A 2OQYA 2PPGA 3P93A 2AL1A 3UJRA 2OG9A 5FJTA 2O56A 3RRAA 2QGYA 3OW1A 5FJOA 3DG6A 2HXTA 4GMEA 1SJCA 4JN8A 4YWSA 3H12A 3IJLA 3P0WA 2PA6A 4DHGA 1EBHA 2AKZA 5EU9A 3TTEA 1ECQA 3OZMA 1W6TA 4H83A 2QDEA 3FV9A 1NELA 1P48A 1FHVA 3I4KA 3QKEA 3OZYA 3OP2A 4E4UA 4H19A 3D47A 3DFHA 5J04A 3DGBA 1OEPA 3THUA 1EC7A 3TW9A 2OKTA 3UJEA 3MKCA 3MY9A 4A3RA 3VFCA 2XH0A 2PU1A 3HPFA 3VC6A 3T4WA 2OX4A 2XH7A 2OO6A 2ZADA 3T6CA 3UJFA 3RGTA 2PCEA 3N4EA 2OLAA 3TQPA 4E4FA 4HCDA 3TOYA 4KWSA 3V4BA 2GGHA 3ZVHB 3JZUA 3ZLFA 3MUCA 4HCLA 3QN3A 3VCNA 4ZCWA 2OZ8A 2PTZA 3BSMA 3PFRA 3R0KA 3Q45A 3DERA 4GFIA 3GY1A 1EC8A 3MWCA 3IK4A 4H2HA 3I6TA 3MSYA 1JDFA 1MUCA 3SBFA 2PS2A 4ROPA 2XH4A 3SN4A 1MDRA 3R0UA 1KCZA 4EWJA 4DN1A 4A35A 2OVLA 2CHRA 3ZVIA 3P3BA 1EC9A 1IYXA 2PTXA 3GD6A 3B97A 3ENLA 1R6WA 1FHUA 2OZTA 3H7VA 1TZZA 3CT2A 2NQLA 3DG7A 3SN1A 2I5QA 3N4FA 2QVHA 4E5TA 4F4RA 3TJIA 3K1GA 4GISA 4MKSA 1KKOA 2OFJA 2ONEA 1SJBA 2QJJA 2GGGA 2GGJA 3QTPA 2QJMA 2AL2A 3ES8A 1MRAA 1JPMA 4K1WA 3KUMA 1WUEA 3CK5A 4K2SA 4E8GA 3FCPA 3QPEA 3RR1A 3DG3A 1JCTA 1KD0A 1YEYA 2HZGA 1ONEA 4DYEA 1BKHA 4DX3A 3PWIA 3UGVA 4GGHA 7ENLA 1BQGA 3PWGA 3SJNA 4X2PA 4GYPC 3EEZA 1MNSA 2PODA 3CAWA 3V3WA 3UJSA 3ZLHA 3SQSA 3EKGA 1TE6A 3N6HA 3UJ2A 1NU5A 3I6EA 4J1OA 2QQ6A 3UXLA 1E9IA 3H8AA 3FYYA 3R11A 4M6UA 2GSHA 2AKMA 4H1ZA 1TKKA 3H70A 3D46A 4IL0A 3V5FA 3NFUA 3UCCA 4G8TA 1SJAA 2OPJA 4J3ZA 4M0XA 4HPNA 3TCSA 3FXGA 2QDDA 4HN8A 4KT2A 3CB3A 1KKRA 4Z17A 4HNLA 4KEMA 3U4FA 1SJDA 4GYPA 3V5CA 2AL2B 2PTWA 2OZ3A 3DIPA 3NXLA 4GIRA 3TJ4A 4DXKA 3CYJA 4ZA0A 4MGGA 4HYRA 1XPYA 3Q4DA 3RCYA 1JPDX 3ZVHA 1R0MA 5IDZA 1DTNA 4FP1A 2MNRA 2OQHA 3BOXA 1L8PA 3S47A 2HNEA 2PTYA 2POZA 4JHMA 3RITA 3VA8A 4G7FA 2P8CA 1F9CA 3SN0A 3IJQA 1EBGA 4HNCA 2MUCA 3SSZA 4DWDA 4HCHA 2QJNA 3MQTA 2P8BA 2GGIA 3VDGA 3NO1A 3R25A 3TWBA 4E6MA 4IP5A 4Z1YA 3BJSA 2PMQA 3QLDA 2PGWA 4ENLA 3N6JA 2GGEA 3JVAA 4IP4A 3OPSA 4IHCA 4IL2A 4JN7A 2P3ZA 3OTRA 3T8QA 3VCCA 3DFYA 2PP0A 1MDLA 3STPA 3NZGA 2XSXA 2DW6A 3ES7A 5FJUA 3R10A 2XGZA 4MMWA 1XS2A 4FI4A 3UXKA 5ENLA 1PDYA 2GDQA 2HXUA 5BOFA 2P0IA 2GL5A 2PGEA 3PK7A 3GC2A 2DW7A 1WUFA 6ENLA 5FJPA 3ZLGA 3CXOA 3R1ZA 2PU0A 4IT1A 4IZGA 2RDXA
chains in the Genus database with same CATH superfamily
4CCDA 3K46A 1K9EA 1QI3A 3VIFA 4TMBA 3BLFA 1IQ8A 1B0IA 3DEQA 4DF0A 1FO4A 2F6XA 3TV8A 1VCFA 4K7VA 2Y5SA 1AQMA 1DOSA 2WCAA 1TV7A 2FZDA 5FJRA 3XIMA 4C6EA 1V93A 4DXXA 4MDOA 4NI8A 2W3RA 3PB0A 4H9ZA 3P14A 3RHGA 3SUWA 1AFSA 1ISVA 4HZ8A 4FMVA 4WOQA 4CU6A 4IFKA 5JIWA 2C1HA 4S3BA 4HNVA 2Y5JA 1V03A 3R4IA 3DOPA 3UR5A 4US6A 2CLFA 2ZRZA 1EDQA 2QGYA 2RAGA 2PEVA 7TIMA 2CLKA 5JCMA 3ZXWA 3NZRA 5BNKA 4YWSA 2J88A 1XYLA 4ZEPA 3OG3A 4PGLA 4CD8A 3KXQA 4NEVA 4PBGA 1ZMCA 3L21A 3BGGA 1FY6A 5KTLA 4E2BA 4LUYA 4B3ZA 5CSRA 1M01A 2DH2A 1C92A 4O14A 4JX5A 3TMLA 1FHVA 5D9MA 4UNLA 3I4KA 1MUWA 1BSLA 5KVHA 5SWUA 1B3WA 2X16A 2C0HA 3OB8A 1PJ9A 1XDLA 4C5ZA 6ALDA 1E73M 1QO5A 3TXZA 3VE7A 1VC4A 3M07A 1T0OA 4E2DA 1Y5XA 1E43A 1BRLB 2QKFA 4OV9A 1H61A 1TMHA 3O0FA 4D8AA 3QV9A 3CTLA 2DQXA 1AODA 1YPIA 5FS7A 4INFA 4FLQA 1YTEA 3QLLA 1Z69A 2WOWA 3R8GA 3HPFA 4EQRA 2UY5A 4WZHA 4QBXA 2OO6A 1Z44A 2NQHA 2WJDA 4UMAA 4E4FA 1VQZA 3ABZA 1N8IA 2WPCA 1HGYA 1MZRA 2CZFA 2R1PA 2DY3A 2W63A 4HCLA 5FAJA 4A3HA 3BLOA 3MC5A 1XM3A 3AXMA 3L23A 3GYCA 2GJPA 4ZCWA 3WF3A 1Q6FA 2PTZA 2Y61A 4NAFA 4LUJA 1UD2A 3L67A 2CZEA 3GY1A 3U48A 2PRMA 3U4AA 4GKLA 5EBAA 1IT8A 4OIFA 2GJNA 1MUCA 3CT7A 1EGZA 2FMOA 4YTSA 5JCLA 5IBXA 2DORA 3TH6A 3R0UA 5K4ZA 1JEHA 2ZTKA 1QWGA 3TN3A 4XD3A 4H6QA 1M1BA 1HKWA 3GD6A 2AAMA 4AD3A 4BQ5A 4FXJA 1LG2A 2F61A 1LT8A 2WSPA 4Q8QA 4U4MA 3SIZA 3CUFA 1NP0A 3NVVB 1GYLA 1KB3A 1BLIA 3G8EA 1E4NA 4JFSA 3VZYA 4IXXA 8XIAA 3HFYA 4CD5A 1S5MA 2IKIA 2ONEA 2JF6A 1RBOB 3UYIA 5EMJA 3W2KA 4PUMA 4RLIA 4AWSA 4ILSA 2VEMA 4CNTA 2ZRVA 5FMHA 1MRAA 2ZA2A 2XFYA 4AX7A 1MEIA 3GNPA 3KVJA 3PBUA 4G1NA 1GOWA 2XINA 1QBAA 4AIUA 3DG3A 3II4A 2PAJA 3UGVA 4GZ7A 1ZHAA 1K6AA 2Q3OA 4XAYA 1GHSA 4F9DA 3N04A 4FZIA 5T9CE 3W2JA 2X1RA 1HL8A 3LCXA 3DFSA 1TE6A 3MKKA 5CJNA 3UPBA 1MYRA 3P2VA 1K6WA 4UTHA 6XIMA 3H8AA 2X42A 1R3WA 3FYYA 3KBWA 2OT0A 5BRQA 3WEOA 2E5BA 3SFKA 4LYKA 1DWAM 2W79A 4IPPA 1P7TA 2HK1A 1UD5A 2R1NA 2VXNA 3D6NA 2PGFA 4A21A 1TQXA 2YYTA 1CX9A 3H4GA 1CGYA 1N82A 2VX7A 3PFMA 3FXGA 4EF8A 3UY7A 2X1IA 1XYFA 1J0JA 4FXRA 3B06A 3XINA 2CZDA 3WLTA 3RFAA 3B9EA 4S3GA 2AL2B 2PTWA 2OZ3A 3WQFA 3DIPA 3GM8A 4DXKA 2EGZA 1LWIA 3VOHA 4MFDA 2CLLA 2BP1A 3WNMA 2DJLA 1JZ8A 1UPMB 2BXVA 4Y96A 3SCVA 3AS3A 4YJ5A 3TQVA 2PDNA 1F3WA 2YOCA 2FB3A 3ZWSA 3N2XA 1GESA 5EGRA 2E77A 1O66A 3VVGA 3W1MA 4HOWA 4E4PA 1DPMA 3ETRB 4JHMA 2RGMA 5G5IA 3SR6B 3UF9A 1H5VA 1BSIA 5AHFA 3VIIA 5AFDA 4XIMA 1ADOA 2HVOA 2VURA 1ZK7A 1ZU8A 3R79A 4OWGA 4JR5A 3EWWA 3E2VA 2VOTA 4L6OA 4AG0A 1XLLA 4I9JA 5GQBA 4IP5A 2I1OA 5FEPA 4RDZA 3M0JA 5DT7A 1US2A 3LADA 3JRKA 4TQTA 1NHSA 3WD4A 4XX6A 4W88A 1VAHA 1K02A 4H8HA 1XL9A 1NOFA 2ZDRA 3LQGA 3OGSA 3N25A 4PMDA 3UG4A 1OINA 3BLEA 2XGZA 4JIIX 1WKEA 5HNRA 1GVOA 4FI4A 5FEZA 3HJEA 3CQKA 5A8PA 2J9ZA 2ZA1A 5I3KA 1KBLA 1S5TA 4QJ3B 5CPQA 4Z1DA 1BYCA 3EWDA 3PJWA 2Z1SA 1JIBA 1RQBA 1H63A 3W53A 3B40A 2FPTA 4EPEC 1DKWA 1LROA 4HA4A 2NVDA 1QHZA 4TX9A 1XP3A 3RCNA 3LZ5A 1GYNA 4ERIA 2CLHA 1P43A 4JD4A 1KGWA 5AYXA 4QM1A 1D3CA 1DJQA 4DUXA 1C8YA 3O7UA 2VZVA 3BLIA 1XJBA 3QFWA 4W85A 2NQ5A 4F3HA 5G1TA 2FKPA 2GOUA 2ALDA 2EQDA 1PIGA 3IIVA 4XZNX 1R3QA 3VOJA 1TUXA 1FWNA 1WDRA 2XVLA 3O15A 2PP1A 4MDPA 2OQYA 1WCGA 3EGJA 4BEQA 1NFGA 3FLUA 4DUOA 3TR2A 3GDTA 3UJRA 1NM9A 1BYAA 3RRAA 2RDUA 1NHPA 2Y24A 4C65A 4B5NA 1GQNA 3W1RA 3H2CA 4J3VA 3AXKA 2PZ0A 4HPXA 4XAPA 3WLJA 7A3HA 4NAEA 3HG4A 3APTA 2J8GA 3OO2A 1BG4A 2JFEX 3SCPA 5TD4A 2PLCA 1A0DA 4UB9A 4U2ZA 1JZ7A 2X09A 3QC3A 1R5YA 2YLLA 3EKZA 3R94A 1J10A 3VKJA 3TR9A 5I23A 2L5HA 4RNJA 1UD4A 3D47A 4ZXLA 3FN9A 3BZJA 3USBA 3LCLA 3TW9A 3DC0A 4N02A 1GQKA 4J2MA 5DMLA 4O4WA 3MY9A 1VPYA 1XLEA 1CBGA 4FNTA 1M03A 1IEWA 5AOUA 4PMXA 1T41A 1XH0A 3RILA 3IK2A 3O0HA 4XK2A 2ODOA 2NV1A 3V4BA 1HN1A 3W7LA 2Z24A 1GVSA 1GUVA 1NH6A 3EWYA 4CGTA 4L4MA 1AUSL 3VX1A 3MS8A 3UETA 4TX8A 4Q8MA 1J8VA 1H1ZA 1L9WA 1DE6A 1DIEA 4ATDA 4V33A 3BPWA 1OABA 4L5ZA 2FJKA 2I57A 5DCEA 1GK8A 1UZ4A 1L6GA 3KHJA 4QS6A 4ASTA 4DYKA 2PURA 4QQUA 3T8LA 3ZT7A 1Y5WA 4XSLA 2VEKA 4OV4A 4PTVA 2VFGA 4MYAA 2YW3A 2CHRA 1MEHA 2OQLA 3M0ZA 3MJMA 4LALA 2Z7GA 2KAUC 1K8XA 4UCFA 3CMJA 5HINA 4TO8A 3BAYA 5A3HA 3BAXA 3GNRA 5G2HA 1UZ1A 4XZWA 1EJXC 1FP9A 4MKSA 1M7PA 3SCRA 3N73A 1NFBA 3WH5A 1OGBA 1JYXA 1ZAJA 3KP0A 4P5UA 4XUGA 1U30A 1LL4A 4MKNA 4O28A 4C6CA 2WZTA 2QJGA 3VKKA 1ISZA 3B04A 3HU7A 3V5OA 5LA1A 5LHEA 3CMGA 4MKVA 1V59A 1KGUA 2PDXA 4O57A 3T05A 5FI8A 5C54A 4IMCA 2VUYA 4KWOA 1LOQA 1WDSA 3KVMA 1H62A 1WZMA 1BVZA 4Y9MA 3I7RA 1LUCA 1VPXA 3MCOA 2ZX5A 1S5NA 1TRIA 3AI0A 1WDDA 2WJZA 1EO7A 5DXYA 1TUFA 1UR4A 3RU8X 1CW2A 2PDMA 3TYEA 1TKKA 3VOGA 5HWMA 3KLLA 3U5UA 3ZR5A 3QFBA 1XH1A 1DQUA 3EWCA 3O16A 3SCUA 1GKPA 4O1BA 4GHRA 4WLCA 4XVDA 1MO9A 5AC8A 1I2QA 3HMCA 3JU2A 2O55A 3EAOA 3E5BA 3CB3A 4KIRA 4YN5A 3W4RA 2BHYA 3T44A 4HNLA 2OMAA 3UYCA 1VBRA 4GBUA 2KZHA 2IUZA 3W7RA 4N9CA 3NVYB 3EMQA 4WXYA 1SO6A 4JQ3A 4PUWA 1RHCA 4JTDA 4RE2A 4NZ3A 1KFBA 4HZ7A 4FF7A 3TQ0A 4X0VA 4W84A 1J79A 2ZUTA 1U5VA 3BLLA 3NRZB 3WD0A 4QCFA 1UWSA 2QCDB 3EWZA 2WKJA 1QNSA 2X30A 3ZVHA 2GWGA 5A95A 3SY8A 3BOXA 3M7WA 1PZ0A 1L0PA 4GXMA 4WY0A 1XG4A 2V0TA 3W7KA 5TIMA 2Y2WA 3FA5A 2GK1B 3GKAA 2YJQA 5CPSA 4AVFA 1MQPA 4S2BA 5H2ZA 1JJKA 3L0GA 1R2TA 3TYZA 1O60A 3I65A 3GW0A 1LG1A 2CBVA 1TIWA 3HGOA 5CH9A 7TAAA 4W4QA 3R25A 4E2VA 3VNLA 5CLTA 3BZGA 2YDRA 2ZWYA 3IGUA 1Q8AA 4OOZA 2V5JA 2W54A 1C3FA 1P1XA 4RPPA 1ICQA 2E8YA 1JF6A 1UKSA 4GFSA 3JVAA 2PDUA 4JTUA 3MHGA 4DWSD 4NP7A 4Q3MA 4IUGA 3VCCA 5GJMA 2PD5A 1F2JA 5JBFA 2WKLA 3CU2A 1B9BA 4FHAA 2RKXA 3R10A 4GI6A 2ACSA 3CHDA 4H7VA 3BW3A 3PUGA 1NOUA 3L12A 4HJWA 3P67A 5ER0A 4NI3A 3TLLA 3M0MA 1F73A 1FCBA 4BKNA 5AZ0A 4H4WA 3N2TA 3RAOA 3CZGA 3LHTA 3LLFA 3MA8A 1Q2RA 3COTA 5D09A 1XHGA 4IICA 1EB3A 3ANYA 1M6JA 1OZMA 5A5WA 4B3KA 5F7UA 4IZGA 2HWGA 3NZ1A 1E6XM 4NXKA 3TFCA 3SJ3A 2X05A 4N7QA 3R58A 4UQCA 2DSZA 1OD0A 1P6BA 3BW2A 5DMYA 3BCFA 1VIWA 3WBYA 4Q7IA 3B9DA 3FVDA 3S5SA 3SI9A 3KFTA 5CG0A 3U9IA 2ZWZA 2QV4A 3TAOA 3SCTA 1LF1A 4W9TA 3BC9A 1VFHA 2E68A 1BQCA 3C8FA 4LF1A 5AHLA 1F4HA 3FEMA 4W93A 1V6UA 5KSWA 2QVNA 4CLMA 4LAMA 3EZ4A 2TPSA 4QQ3A 4DJFD 4WSKA 4KCTA 3WK3A 3HQ1A 1TREA 2ZZ2A 3RPMA 3BJFA 1IWAA 1IEVA 1A5AA 1V5XA 4H9XA 3DG6A 3AS1A 1OK4A 2BMBA 1XSIA 3QGAC 3NJ3A 3QY8A 2PDBA 5ECUA 1SW3A 3TW7A 2VDGA 3EOLA 5A69A 1IZCA 4ZXOA 4L56A 3N14A 2PDQA 3HQPA 3BLDA 4Z2LA 2OX1A 5D38A 1P48A 1KM4A 3R7MA 3WNKA 1LOSA 1W9PA 4KWWA 4QXIA 1GEQA 1W9VA 2EQ7A 4E4UA 3C5QA 4W5ZA 5I3FA 3CPGA 2XVNA 2A2IA 1YE4A 4M56A 4Q8WA 3NPUA 1SZFA 1UH4A 3NL5A 1OG0A 3WUBA 1V4YA 3KP1A 3P80A 4WRHA 4US5A 1UOKA 3H7UA 3PPHA 3WBAA 5ABHA 5FJJA 2XG9A 1B3YA 2ZQ0A 4HSOA 4NX0A 1SGJA 1XIIA 1KFWA 1ISYA 4OVXA 4HA3A 4GA8A 3NOYA 5I03A 1FRBA 5DEZA 3K8LA 4LS2A 2D22A 4D71A 1J12A 4OOUA 3AU2A 3DHUA 2PFHA 3THAA 4IIGA 4TX6A 4UNKA 2W6RA 1K9DA 4Z2KA 4PULA 4Q6XA 4NAEB 3FVMA 4U10A 3ZMRA 1GKRA 1WXZA 1K77A 1CT5A 4RZBA 4PB3A 1UIPA 3C8NA 5HMDA 1YDNA 1TYTA 5B80A 5ECVA 3AALA 1YBQA 4BQ4A 1IYXA 1C8XA 5ABGA 3QPYA 4HKPA 5C9WA 4NZJA 4P7RA 5E9AA 3C4UA 1I8JA 2ZUSA 3V0SA 2NQLA 2Q02A 5HQMA 1G0CA 1GRHA 1S3HA 3N4FA 2C3CA 5BMWA 4NXSA 2FZMA 3EKLA 2YCKX 2JQXA 4GC3A 2OYKA 1EBDA 4RZ6A 3WEZA 2YL6A 1YQ2A 1G94A 4U5IA 3G1DA 5C9ZA 1C7TA 2V38A 5C55A 1AH3A 4IM4A 4UTWC 1FWAC 1N5XA 2BC0A 3TNBA 3QPEA 1W1VA 3RR1A 4KPRA 3T1GA 3DBPA 2QLYA 4DX3A 4JIEA 1OFBA 1QPOA 4LBRA 3W6LA 1M7OA 2WWCA 1JROA 4GGHA 5DBUA 2X1TA 3M5YA 3MUAA 3SJNA 4HNNA 4E8DA 4K8DA 3DU0A 3QBUA 4MY9A 3RX4A 3LGDA 3WLKX 3SQSA 3EKGA 1CXKA 3L2IA 1ZLPA 4KKXA 4MNLA 3C2YA 2OEMA 2TRSA 2WBAA 3GDRA 3VIGA 3B05A 5A6SA 4H7ZA 4GLEA 3GXNA 3HM7A 1AQFA 5CGTA 2E5AA 4QG9A 5K7JA 5AC6A 2ZOXA 2WP6A 3NEHA 5AHNA 2VR4A 2PCQA 4QDPA 3DHFA 4IMFA 3LHWA 5GVJA 2CPUA 1XX1A 4BV6A 2J6XA 1J4EA 3IARA 4W89A 4UTWA 1E3ZA 1Z48A 3W1TA 2R1KA 1OM0A 1M68A 5LNSA 3OBAA 3T2QA 3W1PA 4EVZA 4TTGA 1FWWA 4HHLA 4YPJA 1XIGA 5BRPA 3GDBA 3YPIA 2RJHA 3QV8A 4KCUA 4LX4A 2J7GA 1XSJA 3IGXA 1CTNA 2YL5A 2DZTA 4QJ5B 3RK8A 4B16A 1E55A 4DPPA 1OG6A 4LAKA 4LTSA 4HYRA 1F8WA 1ICPA 1R0MA 3W84A 4MM1A 4Z2GA 3BMVA 2WPFA 3HURA 1Q63A 1RP9A 1EJUC 1FBAA 4MOZA 4U3AA 3CUGA 3RITA 3R13A 4RUBA 4HVXA 3AHYA 5FS8A 4GZJA 1PIIA 2CU0A 3RMJA 3RPTA 2PZNA 3MPGA 3KVLA 1KM6A 2CKSA 3PJTA 1PHWA 1AH4A 3NO1A 3GVRA 3EOOA 1N7KA 2G5WA 1RJQA 3LI1A 3TN6A 2ISDA 2OU4A 2GR3A 3RLHA 4BA0A 4ZTXA 2XM2A 3WJZA 5D03A 1JOAA 3LG3A 4IP4A 3T40A 3INPA 2HVMA 4M6VA 1KBKA 2WVSA 3N2BA 4O15A 4URIA 2VEIA 3UEQA 1BF2A 2ZICA 2EPMX 5HJYA 2F38A 1Z41A 1OFAA 3WD1A 4BZYA 2OR2A 3FA4A 5E93A 2Y7FA 4LVGA 2WHKA 4F0MA 1WOBA 4JTFA 4XTIA 1L2UA 1Y8BA 5AYBA 1TWDA 3WQOA 4ZL1A 3AM9A 4IPNB 2XZ9A 3VZZA 2X99A 4ORIA 3NDOA 4EXAA 3W7JA 4L9XA 1OFDA 3PK7A 3GC2A 3TJXA 3CQHA 1SSDA 4D6GA 4NF7A 1XIFA 1OC7A 2CLEA 3HV8A 3B0PA 3L4XA 2FTPA 3W82A 2DH3A 3EEGA 3DKLA 3KDOA 5E9XA 1PYMA 3MWAA 3WLPA 1KN0A 3T0BA 2OWCA 1MFVA 2FJUB 4LPCA 2VZUA 3LHVA 1EPVA 1GW1A 1F05A 4QSFA 3UWQA 3WLQA 4CVUA 3F5JA 5FF2A 3KRSA 1JZ3A 1NHRA 3S1XA 1K4HA 2Z0IA 2WMIA 7CGTA 3CGBA 1OY0A 3TQKA 1TYPA 4YMZA 5DCBA 2DT3A 3NQ7A 3VIKA 2QF8A 1SZNA 3IUHA 3TC3A 3A64A 3IVSA 2GWNA 3A5FA 1XH2A 4W8AA 3SADA 4PSPA 2ZUWA 4GCAA 3QC0A 4H00A 5EBKA 1EX5A 4P7OA 2DZPA 2HBXA 1U33A 3TA6A 2DT0A 1DJXA 1RUSA 3HGSA 5C71A 3VTRA 2EG6A 2FZNA 3OZMA 4LUTA 1RZMA 2QDEA 2YBTA 4JTTA 2RJGA 2Z2UA 3VGFA 1LPFA 3WDIA 3NDZA 5A8NA 3N4AA 3W71A 3R43A 1FOBA 2J62A 2DQWA 4J2PA 3THUA 5G5GB 1EC7A 2C16A 4RDWA 1GZJA 2ZVIA 5JCKA 3GIPA 8A3HA 1VEPA 2WMJA 3ITGA 4NZFA 3K4DA 3UD6A 1T96A 4PTNA 3CAQA 5DLCA 1LQ2A 2BODX 2PDYA 1AJ2A 3DGZA 3E1F1 4V1YA 3T4WA 4JYEA 1YX1A 3R0DA 4ADUA 1PAMA 4NRRA 2PDIA 4ZFCA 5CPNA 3BAJA 1P0NA 3H2NA 3MVIA 4C6KA 3QKZA 1OFPA 2WZIA 3F2BA 3AIEA 3M0LA 1NDYA 1ONWA 5C2CA 4GZEA 1JZ4A 3GRSA 2PC4A 3UZXA 1EA0A 4B4HA 2OOFA 4H3DA 3DBNA 5A8OA 4UTJA 4GRSA 3RN6A 2QULA 4GO9A 4D6DA 3NQGA 1FHDA 4F0HA 3N1AA 3TOPA 3NAVA 1GCYA 2ZTJA 4DZIA 4K8EA 1A0CA 3WNNA 4XAZA 3ANUA 3IACA 4PMUA 4LT9A 3MANA 6TAAA 4Y2WA 4FX9A 3EYPA 4E5TA 3LTYA 4O12A 3A4AA 4AY8A 4Z2IA 5KITA 2B7QA 4V1XA 4IQJA 1OGSA 2ZUUA 4HNUA 1XR2A 1Q7QA 1VS1A 4E38A 1MW2A 4NJIA 1WPCA 3CPRA 1YE6A 3IV3A 3FAWA 5M3WA 1UR3M 1KFEA 4GR1A 1BYBA 3E49A 3GXIA 1US0A 1UR1A 3K5XA 4LUSA 2ZRXA 1GOQA 1KFCA 2DDXA 2EO7A 1NDWA 5E0CA 3CAWA 1GQIA 2VVNA 1MEWA 4FDCB 3M1ZA 2IMRA 3CGTA 1X7IA 3ANVA 2YYUA 3UJ2A 4A8IA 4RW3A 3UXLA 3CL8A 4GABA 3VDHA 5FSDC 3LD5A 2X0HA 1TJ1A 3MUXA 1VHCA 1YBQB 1R9XA 3V5FA 3L5MA 2HPMA 5F1UA 3VKBA 1MZHA 4MF4A 3MI2A 4JQ9A 2VP8A 5DF0A 2OYMA 4WUIA 1A4LA 4HN8A 3M4HA 4B92A 4MWAC 5J8LA 3GLCA 1DNCA 1LWHA 2QUUA 2BVWA 4FEZA 4M19A 1UR9A 4IIDA 4IGHA 4CN4A 1WO2A 3KS5A 4J7RA 4DXVA 3E0WA 2TYSA 3GHSA 2C1IA 4E3TA 2QAEA 4DBUA 2P10A 5E0KA 2GRTA 1H3GA 3CV7A 3B9NA 1JPDX 2JKEA 2X41A 3CASA 1KRCC 2F2KA 4FP1A 4X61A 4X0NA 2POZA 3POCA 2HCVA 2PUZA 3AWOA 1K8ZA 4OECA 1JYVA 2V67A 4M6PA 3WLHA 1OX4A 3I7QA 3SSZA 3ZJ7A 1QASA 4MWAA 4H9UA 4GKTA 5FSEC 2O9PA 2G3MA 3GXMA 1POKA 3CPUA 3UZYA 1DXLA 2CLMA 3OLEA 5CQ1A 3W7NA 4O10A 3AZSA 2GGEA 3OPSA 4IL2A 3ZS4A 4ZOAA 3PZQA 3U3HA 2AGKA 3A7RA 2BY3A 4IP7A 1E5JA 1Q6GA 3GR4A 2DIKA 4J27A 2J4GA 2ISSA 1FWIC 1N55A 3W28A 5EMKA 3QW4B 4AYGA 1M6IA 4B5VA 4MB1A 3AIWA 2ZRWA 4D6HA 2BVTA 2E1DA 2ISFA 1TTJA 1NOWA 2XFWA 4QE5A 1IF2A 5K9DA 3KDNA 2JF7A 4V15A 3AO0A 4U3CA 2GDQA 3HGRA 4YVPA 4EOUA 1UWIA 2WNWA 4JYFA 2WC7A 5FJPA 2WLZA 2NWRA 3KM8A 5AHMA 1CB7B 3V7PA 1CI1A 1TVLA 4RJEA 1HT6A 1ELSA 3CIXA 4HB7A 2QPXA 3TYUA 1VJSA 4EPDC 1XLBA 4MZ8A 4ZO6A 4PZVA 3CWHA 5C5YA 2PSNA 2F6UA 3M9YA 1TG7A 5A6BD 4AF0B 1WZKA 3C3UA 3IJ9A 1G1YA 1YDYA 3M6DA 4DRSA 4NNAA 4J35A 3GHUA 4DJDC 4PUNA 3GK0A 3W73A 2QEZA 3TTOA 1R3RA 4JFVA 2OG9A 3VIOA 1C9WA 2O56A 2POTA 4LU0A 3FKKA 1PXGA 3DH7A 3SUUA 2BASA 2PDCA 1S1RA 2DEPA 1Q3NA 3E9AA 1UQYA 4BR1A 3OC4A 4PFHA 5JBDA 5JIPA 1ZBCA 3CB8A 1TWIA 3TIMA 4HU8A 4LEFA 4QRNA 5A6JA 1TWWA 4PMNA 2OSYA 3S5OA 1DWJM 4YTTA 3A3XA 4KGLA 4NZ4A 4ML9A 4H4TA 1A3WA 1QWKA 4L1WA 4UQAA 1Q8JA 1QK2A 3CQ0A 3O63A 1CXLA 1FP8A 2YCLA 1JI1A 5A6TC 4GX9A 5J04A 4DJDA 1RR2A 3U0HA 3KW3A 1K4QA 1EO5A 3UJEA 2V5KA 4YTRA 1MFUA 3OU8A 4REQA 4QE1A 1PZ1A 2OEKA 2PU1A 2VGBA 3OLIA 2V3GA 3WO8A 5BXPA 4B2DD 5EB8A 1IZJA 3T6CA 2ZBTA 3R2GA 5D9PA 5DFAA 1TYGA 3M16A 3NL2A 1RJPA 4N42A 1M53A 2GGHA 1BAGA 3PPGA 4GG9A 1UD3A 4KERA 3W7GA 3ZJKA 2GZXA 3UPWA 1NARA 3ZR4A 3A7AA 3PZIA 3HF3A 1XIMA 5M1TA 1YIXA 4AB4A 1EP3A 1FWGC 1IEXA 3PFRA 3WFLA 4OZOA 1XIHA 1QNRA 1TSIA 3WUEA 5JMUA 4D1IA 4IJBA 4H2HA 2E3ZA 1XWYA 1W3NA 1W2PA 4LWWA 4NG3A 5I5RA 2J75A 3P74A 4I5RA 4QE4A 4JTKA 1KRMA 1GPFA 1G67A 4EWJA 1ITCA 4KW2A 3AMDA 4XTDA 1TPUA 4C6MA 5CPOA 2W91A 1UC5A 2J8FA 2QGHA 4Z0SA 4Q4KA 3THQA 3FSUA 4QGCA 1VBUA 4O1EA 2AGTA 2XYLA 3MYOA 2V6AA 2GVLA 2GSEA 4B5UA 3QR1A 1O5QA 2AAQA 2FPYA 3NNTA 3EAUA 3NQMA 4BQ2A 1UASA 1XBZA 5CC3A 3K1GA 4JTIA 3NQAA 3KCOA 5IRPA 4AH7A 4OTKA 4W7VA 5MKGA 1E6QM 2VZTA 3AIVA 3VFLA 3T7VA 7REQB 2FZ9A 4QROA 3TW6A 3G1VA 4RDVA 4KRTA 3LPGA 4YCPA 1JPMA 1XGDA 4PTXA 2OCZA 1AL8A 1WUEA 3AS2A 1W5MA 4BI5A 2I17A 3FG2P 2YDSA 5C70A 1YEYA 2EEXA 5D2VA 2DIEA 1XYAA 2V2HA 3DJGX 3LXAA 4LS0A 3PSWA 4B5TA 1PEZA 1TFVA 3S0CA 4ZE4A 4IH3A 3UJSA 1EQPA 1S7MA 1E51A 4AWEA 3VD5A 2QUMA 5G5HB 1TPDA 3QZ6A 3N3MA 5EYWA 3VPLA 3M0YA 1BTMA 4M6UA 1PIFA 3FYPA 3EMZA 3E6EA 5REQB 1LRQA 1E0XA 1TPEA 3QQWA 4L1GA 2R6OA 4J3UA 3TYCA 1WNOA 1NP2A 3UCCA 2XN1A 4S39A 5EY5A 3CIWA 4GYKA 3QYQA 3TTQA 3MHUA 1P0BA 3A24A 1ONXA 2LLEA 2IKHA 1XD0A 2NLIA 2P50A 1T40A 1R30A 2DZVA 1UWAA 3NUKA 5M2FX 3EA3A 4J4KA 4P2VA 4WDWA 4HHHA 2WLYA 3FKRA 4WKHA 3WNPA 3CMFA 3MDWA 2C6QA 4LB3A 3WBXA 3SZ8A 2QS8A 3WG6A 2WQDA 4CN6A 1XPYA 2G4JA 3G6MA 1B57A 4H8NA 2TODA 4Q4SA 3IIXA 4QG8A 2Z1VA 2GR0A 1OJXA 2GVGA 4LUSB 2REQA 2C7FA 1TR1A 3FX4A 1BPLB 5A2CA 3VA8A 1VQTA 3IPWA 1UJPA 1RALA 4JKLA 3K4WA 1ZBWA 1VDVA 2XIIA 3QHNA 3TROA 2X8GA 2ASHA 4JN6A 1UC4A 3B4YA 1CIUA 1S2TA 1Q1WA 1WP6A 4I9AA 4FOJA 3S1UA 4ZB0A 5I3HA 4NJGA 3REQB 1E4MM 1VFTA 1N8WA 2IQDA 2A3HA 1MW3A 3N17A 3NO3A 3BTNA 2GVJA 1NWTA 1WBJA 1B5TA 1EIBA 3TVAA 2PP0A 4PMZA 1A49A 4GI8A 2PF0A 1LBMA 3UU0A 2XM1A 5CBBA 1W3KA 3SCSA 4EMJA 3UVIA 1UA3A 3SR7A 3W2LA 4CQDA 4U33A 2RDWA 1UKOA 1GJPA 3I3BA 5IOBA 2Z1BA 4GE8A 2BS9A 1IEQA 1OB0A 4IIFA 3C2RA 1IIGA 1KFKA 3GFYA 1B1YA 2ANUA 1QW8A 3UXKA 4D8ZA 3MMWA 3PTDA 4ZSUA 2Z7KA 2A85A 4HP5A 2DT1A 2VCAA 1B90A 3VCRA 5BOFA 4O0KA 2IPWA 3SM0A 6TIMA 1WUFA 3AU6A 2A7PA 2TAAA 3ARWA 3BO9A 3RPDA 1J0HA 3RIKA 1JUBA 1EGVA 2W5FA 3W7IA 5U1OA 2WOQA 3QGKC 1EEXA 3H4XA 4PC8A 5HAOA 4GRTA 5DRCA 1LLOA 4AU0A 3B9JB 2ADAA 3FJ4A 1PWLA 3OYZA 3T4CA 3QSRA 2VT0A 3EDEA 2YVGA 3A4WA 3WK1A 2WVVA 1R38A 2PWFA 4LCRA 4HMCA 3VXGA 1Q6QA 3ITCA 5ABTA 1HKKA 3WH8A 4ZZ9A 2E6FA 2PPGA 5ABFA 3ZSTA 3E0IA 1OIFA 1TPC1 4PRRA 4J56A 3A4JA 1G4PA 1W17A 3OHMB 3A7UA 1IXOA 3MMTA 4GMEA 2NWSA 4W5UA 2GQWA 1LRTA 3U2CA 2PA6A 3G6LA 4FS9A 4D8LA 4QDMA 1EA9C 2XFFA 1TE1A 1GQLA 5CKSA 3WLIA 3VD9A 3W85A 3NR0A 3H4KA 3P0XA 5JH2A 8CGTA 4PMOA 3S2MA 5XIMA 4GACA 1HQTA 3AHXA 5A94A 1HJUA 3SY1A 3AFBA 4S3AA 4ATLA 3MSDA 4AISA 4PMJA 4H8UA 4HMDA 3RLGA 1Q6OA 1L6YA 3DK9A 4CKQA 1PO9A 4Y90A 4FIRA 1K1DA 3BLPX 1T8QA 1SU5A 1PX3A 3HG3A 2DGAA 1XUUA 3UJFA 4OU1A 3URAA 3XISA 4TV5A 4U28A 5PTDA 1H41A 3GZAA 4AMCA 2HS8A 3JZUA 4I5XA 2I14A 4ZMGA 4A05A 5I24A 1XDJA 2YX0A 3GUGA 3RX3A 2NQJA 2J25A 1MVYA 3DERA 5KZDA 3PBVA 2E6DA 1WKYA 6XIAA 3UT0A 3WF2A 4U5KA 3LX9A 1JGMA 1NQ6A 3I6TA 3C2EA 1B4EA 1F61A 3M46A 3H22A 1TCDA 1XKYA 1UWTA 1AJZA 1E1CA 1RY0A 2XH4A 2Z6JA 3MP4A 2Q3RA 1QMLA 2E9MA 3VK5A 4IG2B 5XIAA 1SZEA 1F74A 2OVLA 3UZZA 5C6MA 3UZWA 5L6UA 1LWJA 4QSHA 2D1ZA 1Q45A 2ZUVA 3SCQA 1J2BA 1WQ5A 4UFLA 1R6WA 4GQBA 3RM9A 1ZQ5A 1JXKA 4S3KA 3M6YA 3W7PA 4PB4A 1HW6A 3CL7A 3G1SA 3W2NA 1G4EA 4FOKA 2PC8A 3IRDA 3LXDA 2BDQA 4G7EB 2VHLA 1WZAA 3N9SA 3BW4A 2X1SA 3FGCA 4R27A 2INZA 4F4RA 4JFUA 4M7TA 3TJIA 1V97A 2XIQA 3TC6A 1JNDA 5JVLA 1Z3NA 2OFJA 3B8DA 1H60A 2WK2A 3LHUA 4E2OA 3KOZA 5D9NA 2G95A 5D05A 1H7PA 2GGJA 3GG7A 4QG6A 1DE5A 4A3YA 4HD5A 1GW9A 1JD7A 3PBWA 3U5YA 3UZJA 1DIKA 4M80A 3PS7A 4N9DA 3CGCA 3CK5A 4CEUC 4J28A 3GH4A 1HJWA 2PBGA 3TXVA 1TTIA 1ZCOA 2A7NA 3MCNA 1E1FA 1KM5A 3B8VA 3LSCA 4AX6A 1YXCA 4MZYA 4GIYA 4PE8A 2CXGA 1TJ0A 3T2OA 3HO8A 4HT3A 3BSGA 1LZOA 3D0CA 3N6HA 2GPTA 1KA9F 1S2AA 3BDKA 3DI0A 4GZIA 1XUZA 2CDUA 6A3HA 3W2MA 1Y5VA 3V36A 1FH9A 1ZP4A 2YXGA 2V5DA 1UKTA 1ONRA 3W7QA 3S9ZA 3A9IA 1YTDA 2PDKA 1YNPA 3OGVA 4Z2JA 2Z25A 1XLKA 3VNZA 1R3VA 1SFLA 3V75A 4WJ8A 4QLLA 4NJKA 4JQAA 4EP8C 1E9ZB 1UR2A 3LNPA 3OJGA 1SR9A 1KKRA 1PZ2A 4JNMA 3RM4A 4R7WA 2Y1HA 5C7VA 4HU4A 4LBSA 4GI4A 2Y0FA 2Z2BA 3L4UA 4O16A 2VTFA 2XGBA 1GG0A 1BRLA 2ZZ1A 4GO8A 5MKGB 4I8YA 4QTGA 2VD8A 5GNYA 1RA5A 3KAOA 4GQRA 4EANA 3UA3A 3K13A 2HDJA 5E6ZA 3C3NA 4O8AA 2PLJA 4KFNA 4MGGA 1GETA 1VFUA 1LVLA 3M47A 4S23A 4U2YA 3LCHA 3PPFA 1E1EA 3NVWB 4JS3A 1Q7MA 4NILA 4IFRA 4C6OA 1PPIA 2FB2A 5CSUA 2VFFA 4PMYA 3GKFA 3IJQA 3T0TA 1SO3A 1HO4A 1YTKA 2MUCA 3QY7A 3B9AA 5F1VA 1O7AA 1ZTVA 4QFUA 1JZ5A 1TV2A 1ZJAA 2P8BA 3ERPA 3I68A 2YDAA 5CZKA 1H2IA 3DFNA 4UFHA 1HVQA 2Z26A 3TN5A 1YNQA 3QLDA 2BTMA 3N6JA 1X1ZA 4P8XA 5I07A 5CGMA 1KLYA 4QLKA 2G3JA 3LTSA 4H6KA 2XN2A 1CENA 4Q4MA 1V3LA 1WOAA 1OT2A 1DTUA 4TVDA 1XV8A 2HQMA 3LGEA 4LY8A 3SY5A 4QNWA 1RH9A 3I6RA 1QJWA 3VD4A 2VGIA 4WIWA 3AIUA 1E15A 4XZ9A 2F7FA 1PHQA 2DZUA 4LV4A 3CUIA 1VIZA 4I3GA 3CUZA 3L0NA 4DUVA 1EZ2A 1VCGA 2FHCA 4S2CA 3N34A 4IGSA 5E5CA 3QFEA 3IJDA 2GDUA 3BG9A 3VIJA 4AZCA 3CV6A 2QDGA 2RGLA 1ME9A 1U1UA 1E56A 1X6NA 2PGRA 4B5XA 1UIOA 4DF2A 1P4CA 2JBMA 1Z32X 3VOIA 3CLWA 5FD0A 4OUIA 4LC8A 9XIAA 4Q8OA 4C1KA 1G9HA 3S2JA 2YVJA 4YIWA 2E8ZA 1IEIA 3HPXA 5HWJA 1AZ2A 3BQ5A 3V1PA 4UWMA 3RLUA 1FFRA 5T26A 3GIQA 1CXFA 2YFOA 4HU3A 3FJNA 3MTWA 3NXFA 4ZODA 4HOZA 5BRBA 4M82A 1I75A 2H9AA 5DY3A 3DDMA 4XZHA 1UH3A 3QMTA 4EXQA 1ZRQA 2Y7GA 4Q6JA 4KESA 4PFMA 1GRBA 4N0RA 2WZEA 3OW1A 4JTQA 2E0PA 4C7GA 3WH7A 4RKAA 3E5PA 3IJ7A 4DHGA 2VZOA 3URBA 2QCLA 2W3ZA 3GC5A 3T81A 4KBXA 2ZE0A 1ZPTA 3HPAA 3FSTA 4NX5A 4YL2A 1G01A 3GVQA 4J3TA 1EPXA 3OP2A 4QITA 2YXOA 4MLRA 1OYBA 4GWEA 2QCNA 4Q7NA 3GNNA 5LXEA 5CSSA 2V82A 4UTKA 3WQWA 3PJUA 4P61A 3GAYA 3GH7A 3G0SA 4A3RA 4K39A 3VFCA 2NX3A 1US3A 4QJ4B 1U22A 3VC6A 5AVHA 3K2GA 4ZB2A 2PCEA 5HOSA 1BXCA 4ZR8A 1FCQA 3R8HA 2Q8XA 5I2UA 4JTCA 3RO8A 2WZMA 4Q4RA 4H2CA 1JDEA 4C6FA 2PDGA 4HA1A 3R07C 3G5EA 3FOKA 3GR7A 3W87A 1UP0A 1UG6A 1E72M 1G7VA 2BCPA 1XBYA 1WYIA 4FNPA 4OBTA 9CGTA 2OSXA 4IQDA 3LU2A 3FJ6A 2R9ZA 4GVGA 3SGUA 4YCOA 2ZUNA 1WB0A 4DN1A 3DENA 3OVQA 2FDSA 3AWNA 2BSLA 3O05A 1A5MC 2H90A 3EPOA 4N6EA 2Q6ZA 3TSDA 4WDUA 2YL9A 2E09A 3B97A 4CD6A 4NEWA 3W6YA 2WKGA 1FHUA 3KTCA 2CHOA 1BWCA 1XBVA 1VD6A 4PUDA 3SN1A 5DT5A 1RPXA 1GKQA 1S1PA 4GK8A 4LAUA 4RE3A 1T6MA 1A5KC 1XI3A 2O4MA 1KKOA 3NYZA 1STZA 4OBRA 3HQNA 4R33A 5D2YA 3MBDA 4Q8TA 3I7SA 3PG6A 3HTWA 4LH8A 4M1BA 1RK6A 2W0HA 2CBIA 4ZB5A 3QV7A 1Z6KA 5DX7A 3G1YA 3LPOA 4H4SA 1M5WA 3W29A 3PBYA 4LGXA 1BKHA 5IFTA 3ZOAA 1B3VA 3PWIA 5IXEA 4NZ1A 3DFTA 7ENLA 2YZ5A 1OZQA 3AYVA 3CZEA 6REQB 1OJTA 1EJSC 2EQ8A 1VGAA 4GPNA 2IQ0A 4G9PA 2FQIA 5D2WA 4MVAA 1BYDA 3TTYA 1THFD 4YYCA 5GJPA 4W8LA 1L6SA 3VNDA 2IPJA 1UUOA 3U8GA 1XCWA 3NFUA 3UQNA 4HNTA 4W7UA 3AHTA 4KETA 2C13A 3PF3A 2VGGA 4FLSA 4XD4A 4A8NA 8RUCA 4RW5A 3K30A 4WGXA 3ITLA 3HGJA 3FGCB 1NWRA 3RJYA 5FKYA 3ONBA 1S2VA 4JY9A 1VHNA 3TJLA 3UGRA 1EJTC 2NT0A 1VP5A 3S9YA 2WWDA 3ZO9A 2VCBA 3AQUA 4NYYA 1H49A 4RNIA 3NXLA 2D0GA 1JCYA 1PTAA 2GVEA 2UV8G 4J57A 3PN8A 3WUGA 2SFPA 2PLKA 3VGBA 2OGJA 3OLDA 3PZ9A 5E0FA 2OSWA 3DK8A 1A3HA 2MNRA 1L8PA 3EUB3 1MNZA 1E4IA 4HHMA 4X2RA 3LY0A 3LI0A 3LN3A 4B5WA 1H09A 2UZ9A 1V0NA 3QOKA 1KC7A 1I45A 2WSQA 2C19A 1JUEA 4RV8A 2VEFA 3N2MA 2P0OA 2YAUA 4NL1A 4YHEA 1KQZA 2BXZA 2O7SA 1PVNA 2FLIA 2QJNA 5LA2A 1OX6A 3PHAA 2WBGA 3HV9A 1JPIA 2B81A 1KTCA 3NTYA 2PGWA 3WY1A 3UPMA 2EPKX 4PUKA 5HNNA 4V28A 4LCSA 2Q71A 1DJHA 1G6CA 5KZEA 3GRIA 4P7LA 2ZRYA 3B8WA 2PDLA 1J0IA 5IBXC 3NGFA 3LM7A 1QT1A 5LNVA 2O7QA 3U57A 1A5SA 4A3QA 4H4ZA 1X2GA 4HYWA 4O17A 4B3LA 1VR6A 3EDDA 4XZMX 5TR3A 2ESCA 1HJVA 4DJFC 3O6DA 2WNNA 1I9CB 5EPDA 1NQKA 3A3WA 4L4OA 4ZGYA 3UR8A 1TR9A 5C2XA 2MANA 4O0ZA 4R88A 3S9IA 2W55A 5JCNA 2PD9A 2PI6A 3ZLGA 3LRMA 1TTQA 4O11A 2HVNA 3DFOA 3MMUA 3CWNA 4QEHA 1JCLA 1J11A 1DJGA 4Q22A 3GTXA 3H2AA 4GINA 5D2XA 1CGUA 3PAJA 2DZWA 4M81A 2DUXA 3B9OA 2X7VA 4EQSA 1GONA 5I02A 3F4NA 4H4QA 1RD6A 2PTDA 4NHVA 2VFDA 4CU7A 3BXWA 4Z1BA 3B8UA 4GBDA 2PP3A 2D69A 4TOQA 1NF7A 2IPFA 3UCDA 5F4SA 3GRTA 4TR9A 3IJIA 3IAQA 4MPKA 4D6CA 1G7UA 1I0DA 1DJIA 3LDVA 3PZNA 2HROA 1TPWA 4HIBA 5TF0A 3WF1A 2Y88A 4DJFA 1X2HA 4UZSA 1DJNA 1MWOA 4OGZA 4XV0A 3WMSA 4Q4OA 2Y7EA 3MB9A 4QX4A 1ITXA 1F07A 1XG3A 6PTDA 1ISWA 1V3HA 1UZDA 1ZFJA 3WELA 3BV4A 2F9RA 3AIBA 1EBHA 4JTAA 3MVTA 3GVWA 3CAVA 4WCJA 3HJZA 5LNRA 2XGIA 5I00A 2VI0A 3WH9A 1XYMA 3VDCA 1FWEC 2IKJA 3KRUA 3HPZA 4AZCB 1CGWA 5C0QA 4B5SA 3ME3A 3PG8A 1QO2A 5CZJA 2QCDA 4L9YA 5CAHA 2RFGA 1OEPA 1X1OA 4HQVA 1MI3A 3HG2A 3LLXA 4QDWA 4F2UA 1GOIA 5I79A 4IQEA 4U31A 4L1XA 2QPUA 1RK5A 2GK1A 1E9LA 3CS2A 2A6NA 1HXJA 3GSMA 4XVEA 1TO3A 3PVFA 5G2WA 1Y7VA 4RX0A 3WQ5A 4JBRA 3MSGA 1DHPA 3OZOA 1J96A 2H9AB 4C1LA 2YXXA 4KS0A 3W23A 5I09A 5TAOA 3T08A 1O5RA 1PKYA 3GNDA 4K37A 1XDIA 2ZA3A 2IS7A 1F76A 3S2LA 3MWCA 3GU2A 4UR7A 3LBMA 4N9BA 3H24A 1GOXA 3MSYA 1GORA 5CLWA 1V6XA 2C8NA 3CQIA 3AYTA 1JZ2A 4TVCA 4PTMA 2Z6IA 1RA0A 2CW6A 3CH0A 4KWVA 4DYJA 5FACA 2QCHA 4TUFA 2FZBA 1J5SA 3P5YA 3CV1A 3PP7A 5KETA 2X2YA 3VNMA 3AMKA 1SQ7A 2O9RA 3KS6A 5C2GA 4IF2A 2CFYA 3NVTA 4WXZA 4LRSA 4WDTA 5HDRA 3UG5A 4F2TA 2QVHA 1FH7A 3LOTA 2YSWA 2D2OA 2NSXA 1FWRA 1H51A 1I6NA 1YRRA 1W3JA 1P0KA 2H8XA 1UWUA 1VF8A 1SJBA 1SFSA 2V3EA 4B91A 4KRZA 4PCSA 3WBWA 3T0DA 2C15A 1NSJA 3AS0A 3S1WA 2VR5A 5H8UA 1DQWA 1TPVA 5I3JA 3DX5A 3ZZ1A 2BV9A 2QW5A 3BANA 4HMEA 1MXGA 4JTRA 3KWXA 1JCTA 1KD0A 4UFMA 4FNSA 5CEWA 1GJWA 4W8BA 3WNOA 1V02A 1QNOA 2PDJA 1KXQA 2IKGA 3EEZA 3H6OA 5D9OA 3WK2A 1QU4A 3V3WA 1W9DM 1XLAA 2PWVA 1ZMDA 3HQOA 1Q4WA 3D5HA 1N60C 2EHHA 3MO4A 5DQPA 4A29A 3GC4A 3EPNA 3CUHA 3FXYA 4M24A 1QHOA 1MQQA 3W76A 1JCJA 4PUJA 2P5NA 1PV8A 4XBKA 3CUJA 3WZ0E 1H7RA 4MWAE 1YHTA 3QHMA 1KM1A 1SJAA 2CLIA 2FGLA 2OPJA 2E67A 1H0GA 3C0QA 1ZJBA 4AZGA 1E70M 1Q65A 4ZO8A 4DIAA 2JK6A 3C0SA 1KFLA 2QDDA 3ARQA 4APNA 1A5OC 5F2GA 4F66A 1EFZA 4LB4A 3A23A 4BF5A 1L6WA 5G2IA 1KBJA 2E7FA 4AHOA 4ONVA 4CCZA 3MJYA 2QUNA 1JCMP 4ZENA 3STCA 3LYEA 2NXGA 1Z89A 2DU2A 1R8LA 4Q7BA 4Z1CA 2V81A 4I5UA 3C0JA 3FK4A 2GQ8A 1JDCA 1FWJC 2GUYA 3VE9A 4TTUA 1C29A 1MMFA 3RCMA 3ITYA 4DQWA 1XDMA 5E09A 4NUWA 2KX9A 3BURA 3IIPA 2E9LA 1PX4A 1S38A 3ATYA 4NSBA 4KCWA 4RNFA 5HQLA 3G2GA 1Q85A 3N13A 5M03A 2WCSA 4DJED 3ID7A 5F4XA 5JH1A 5G4WA 3F4CA 4A3UA 4O54A 4FB7A 1F3EA 4XZIA 4O53A 4AMAA 2GR1A 3TWBA 2EG7A 1UBPC 1DORA 3M5XA 3SFWA 1UH2A 4GXWA 4HJFA 4RR4A 1Z9AA 1FVPA 5LIYX 3ABQA 3M0VA 3GXDA 5T9BG 2P3ZA 2Y7DA 4X60A 4ES4A 1HZYA 4JCMA 4AVNA 2C79A 2VMFA 4XQ6A 3SRHA 2I9UA 1W3HA 5DY2A 3MKVA 1XGZA 4NYUA 5JXQA 1XISA 4GQQA 4ZQMA 2ACRA 1EHNA 2ZYFA 3H54A 3S1GA 2Q01A 2A1YA 5JQ9A 1WXYA 1HP5A 4KQNA 4MYXA 5LIWX 4K38A 4RV3A 2G3IA 5LHFA 4QCEA 3ICJA 4PTDA 1LOLA 1LM1A 1UP2A 5D32A 1JCXA 4NRSA 2QDHA 1EEPA 1ODZA 4AAJA 1GGOA 3EX4A 1XLFA 4LAZA 3K8MA 1IXNA 4AHQA 1T5AA 3MUIA 4H41A 5DMMA 2VWTA 4JTLA 2VYOA 3EPMA 4HPGA 3MYPA 4WQ6A 3VIMA 1XKJA 3NOEA 2J78A 3H2OA 1JPKA 1SYTA 1FDYA 1TELA 3W70A 1W8SA 4K68A 3M64A 5IHSA 1OQFA 4IPJA 3RM8A 4DLFA 4FPSA 1JFXA 3VKDA 1ZJIA 2Y6ZA 1DXEA 1WKDA 2Y8UA 2TSYA 3VNIA 2QUVA 4DWSB 1EUAA 4ICMA 3VIHA 4F79A 4H4VA 3RJXA 4FR1A 1QOPA 3BV7A 4LUIA 3EX1A 3Q58A 3ARTA 3G1FA 1D3HA 3DFPA 5H6HA 1B9ZA 2VQUA 1P1MA 3H12A 5HQEA 4ZQOA 1FTXA 1GZ1A 2PRLA 2P3EA 4ECLA 2BGNE 1SMDA 2PWGA 5F2MA 1G4TA 4H4XA 2E6YA 4LCQA 2I7GA 1Q6EA 2YFNA 3VMNA 2RABA 4QIUA 2IQTA 3G1XA 3ZFHA 1TJRA 4ZOEA 2GUUA 3IV8A 3IGHX 1RVGA 1QCWA 1W37A 2G37A 1H7XA 2B7NA 2BG5A 4P8UA 3NURA 5CCZA 3IUIA 1A5LC 5AZ1A 5XINA 4AEEA 2BY2A 4O1CA 2XH7A 4FO4A 3UZ5A 5TNVA 1FH8A 1PKNA 4L61A 4LQ1A 5BROA 2V3BA 1IZKA 2PWEA 1F4AA 2C1GA 2D0FA 3AUJA 3KRBA 3GDKA 3BAIA 4IPLA 1EJWC 4I90A 5AVNA 4H9TA 3CUXA 4QAWA 3NQBA 3QMRA 2OTDA 1S39A 1C8QA 2NUWA 1TRDA 2Y8KA 4CQ9A 3PM6A 5TQLA 4EE9A 3NDYA 4UFJA 5J5DA 4HZ6A 3TA9A 3GFZA 1W1B1 4W86A 3LRLA 4HN4A 4HNOA 1HKIA 3PJXA 3NYDA 3UESA 2WHJA 1OCJA 1RD5A 3W26A 3W72A 3QH2A 3L8KA 3N18A 1ZJHA 4I7WA 3NWRA 4IPIA 4Q8NA 5FF4A 1EIXA 1XQKA 1VEMA 2OELA 3HB9A 3VD7A 1LBLA 2I5QA 1EJRC 1GV4A 4MNKA 3GW3A 3VABA 4I6KA 2BY0A 2XVPA 1VYSX 4N4PA 1J18A 1AA1B 5AECA 1CZ1A 5DCDA 1UB3A 2VUNA 3S46A 1W1IE 1VLIA 1W5OA 3QM3A 4GVHA 1XW8A 4K1WA 3OVRA 3G1HA 2BOGX 2VRKA 2ABAA 3CWOX 2R82A 3VUSA 4DJDD 3SCNA 4AIOA 1GERA 1KQYA 3LEPA 1TA3A 1O68A 5ABEA 1NFPA 1BQGA 4X2PA 3RG6A 3PZOA 1MNSA 1TV3A 3EOSA 3O06A 2V9DA 3GUWA 3LPFA 2B7OA 1LLWA 2BGSA 1AH0A 3G1AA 3I6EA 2WSRA 2CETA 1E9IA 3SCOA 2ZZ5A 2GSHA 4D2JA 4ERGA 1NIUA 4HA0A 1QPQA 2OT1A 3EANA 1W9BM 4C1NB 2OWWA 1P0EA 2A3LA 3NM3A 4IJRA 1D3GA 1WBHA 3UR2A 3A4XA 4OKDA 3TX9A 2TMDA 3UNTA 2D0HA 2A6LA 4JAWA 4QEEA 3S6OA 2XTKA 1Q5MA 1W0MA 1A53A 3WJSA 4Z17A 3FNDA 3U4FA 2ATMA 4O0QA 2A3BA 2J7HA 3RMEA 3BGAA 1HKMA 2VX5A 4AD4A 1NWUA 3VILA 4EACA 5HMFA 1UYQA 4H6RA 2OWXA 2VR2A 2CC0A 1P6WA 2V30A 1A5NC 3R89A 1FWCC 1SPQA 1EKOA 5DELA 2ALRA 1DTNA 4PL1A 4WR3A 2HNEA 2R1LA 4R9XA 1J01A 4JPGA 2NW0A 1OT1A 1F9CA 3BG3A 3LLDA 1FQ0A 4HGXA 5GRTA 3WLNA 4UQEA 1F5ZA 3KOWA 4IFOA 1TB3A 1H7NA 4LANA 3BH4A 2BNJA 3MQTA 2J7FA 1R3TA 2X7WA 3M43A 4LC6A 1JAKA 3VIPA 4NKCA 2J13A 1DHKA 1QUMA 4Z1YA 3QFAA 1AG1O 3ABOA 3RRXA 1HTIA 4PYSA 1OK6A 1AJ0A 4R9OA 1O5XA 1YNYA 1VCVA 1MO0A 3P8JA 1QW7A 2JIEA 2Y89A 3OVGA 3STPA 1PB0A 2XSXA 4XO7A 3TZNA 2JE8A 4S3CA 2VJXA 5AYYA 4FAMA 4IIBA 2JIWA 3GS6A 4RPQA 4PTWA 2HS6A 1JEZA 3OG2A 3KLJA 1CECA 1QI2A 1PX8A 1UA7A 3ZYZA 1JXJA 4G1KA 4MADA 4JIRA 3MV01 2DZAA 5LZLA 2P0IA 3PZUA 1O5KA 3MHFA 3GVVA 2PGEA 3GG0A 3UG8A 2VWSA 5E70A 1XSKA 1EOKA 3C2FA 3DJJA 3MO7A 2YVFA 1Q7ZA 4KPLA 1A50A 4ADSA 4NIRA 4XB3A 4YNGA 1KTBA 1VBHA 3TC7A 3WQDA 1GVIA 4F2BA 4O4VA 2W27A 3L4YA 2OLSA 5M5DA 4AC7C 1ZALA 3BLKA 3WLMA 4ZTYA 5A6BA 1SFJA 2VVSA 3W07A 3IJ8A 1EDTA 4DM2A 3BVJA 3BG5A 3KL3A 5LSMA 2R14A 1IGWA 4JTGA 4N4QA 1IHIA 4UC5A 3C6CA 2J66A 5CPMA 4ZOCA 3KL0A 4RNHA 1H6VA 3RLVA 1JRPA 4JEQA 4MZ1A 4DZHA 2PWDA 1JCNA 3E96A 4B9YA 1J9YA 4Q8PA 3GTHA 5CZ0A 2XIJA 4FK9A 2DSKA 4LSBA 4G5DA 3DYPA 3CHCA 1NJJA 1L2QA 1S2CA 1NHQA 2QT3A 4JQ1A 5BWFA 3W38A 1D9EA 4H9YA 1W1TA 4IUOA 3KCJA 3SRKA 4IWWA 1X7FA 3HFTA 4Z2HA 2NQZA 1M3UA 1OCNA 3OBEA 3M5VA 1LTDA 3VI2A 4DM1A 1RCXB 1TX0A 3DZ1A 3UXAA 5K2ZA 3QKEA 2W92A 4UTFA 4KGJA 3KL5A 3CXBA 4H19A 3OODA 1XRVA 1TMQA 4TV6A 2ZXDA 1DYSA 4J9JA 4F0RA 1UPPA 2ZRUA 3NQ6A 3PTMA 4TIMA 2ZZ6A 1UHVA 3PULA 1KBIA 1SUXA 3MBFA 3GNXA 4HK6A 3HOJA 1QVBA 1AMYA 3UWWA 5I78A 1S2WA 2QYGA 3V1HA 3P62A 2ZX9A 5EMYA 2D3LA 5U25A 2ZZBA 2B4GA 4D9PA 3TU9A 4JHOA 2FVMA 1JNEA 4HZMA 2V8ZA 2QAPA 4GUJA 3DXIA 3Q65A 3VCNA 3G0XA 2E9BA 7ODCA 1BFNA 3GH5A 5CZTA 4IMGA 1LT7A 3SEPA 1XLMA 1EC8A 5EFFA 3H23A 3TFXA 4KEUA 1WX0A 3AXIA 5FL1A 1JDFA 3THCA 1VRDA 2GH5A 2PS2A 1TVNA 3WJYA 3O3RA 5CBJA 3ARZA 3T09A 1D2KA 3CHEA 1FCVA 4A35A 4FNUA 3JZEA 4FX8A 2FGBA 3APGA 2R94A 1Z42A 3MUZ1 4AXNA 3KZSA 1WZLA 1VZWA 2E5CA 4FXSA 1KM0A 2G97A 3MCMA 3OA3A 4D1JA 4AIEA 3VGHA 2OODA 4Y9PA 1V08A 1WYGA 3T0CA 2JEQA 2CLOA 1KWGA 4YXGA 3SURA 1QNVA 4GISA 3VNYA 4F9JA 2F84A 2EKGA 2V6OA 3KBJA 4IISA 2WOVA 1F6YA 3ARSA 1NAL1 3PZMA 3PG9A 1U5JA 2H6RA 4M5PA 4LVAA 5IM51 1UROA 3ES8A 5CJMA 1QPKA 2Q8LA 4AF0A 3DGHA 1NDZA 2BHZA 1FA2A 3FCPA 3QYSA 5BXRA 4MTVA 2ABBA 4K8HA 3BICA 4O52A 4F0KA 2Q09A 3L66A 4GNVA 4AZ7A 4AVOA 2V68A 1ONFA 2QCGA 3AJ7A 1EXPA 3P6LA 1IXPA 1B3XA 3NQFA 4GY7A 4FX7A 1RLCL 3SQLA 2PF8A 1EZWA 1SZGA 4JY8A 5DMNA 2E3TA 3MP3A 4D6JA 1XLDA 1W9XA 3Q94A 4XSMA 3ABSA 2YA0A 2XWDA 4JX4A 3NQ2A 1XFBA 3ORWA 2WZHA 4P8VA 5HBFA 2WAGA 4LRTA 2R8WA 2G8ZA 1I2NA 3LCGA 4K7ZA 4M0XA 4ATWA 3H2FA 4G2DA 4MJMA 4H4PA 1EWEA 2X40A 3WQCA 3GDMA 1U1JA 1ML1A 2WSYA 4YU1A 2TPRA 1E0VA 4K36A 1TWZA 1AW1A 1R87A 3NQCA 1AVAA 3WLSA 1GJUA 4I7UA 3WDQA 3RF9A 3KOFA 3QZAA 4L9ZA 2CYGA 3EB3A 2PWHA 4GIRA 5AB3A 1VH7A 4MUZA 3CYJA 1X98A 5K9CA 2FPVA 1PBGA 2E28A 1XLHA 3FHAA 3V0TA 1C9DA 3QR0A 4TU1A 5JCIA 3M5ZA 1AD1A 1TA3B 5HNTA 3S47A 1ENUA 2PTYA 3KWSA 2CCRA 1DWHM 4JL1A 1E6ZA 3S4TA 4A2RA 4LVDA 5FOOA 3SECA 3N19B 4HMNA 3T2PA 3PNUA 3L2LA 4IJCA 4M52A 3BAKA 2WHMA 4JIQA 4LVBA 1QPNA 1CLXA 1JYNA 3O6YX 2PMQA 4UQBA 3VINA 3EA1A 1TIMA 2UWFA 2G50A 2ISVA 1KBBA 2J9YA 2V3DA 2VDIA 4ACYA 4HSHA 1FKXA 3A12A 1C93A 4IHCA 2HQAA 2PE4A 5A2BA 3T8QA 3HBLA 3VO0A 3WD2A 1EP1A 1AOGA 3B0XA 5I3DA 1FWBC 1MDLA 1W54A 3V16A 4G56A 3TCEA 2QJHA 1ZBVA 3P81A 4JTJA 3A9BA 2ZDSA 3ARVA 1KXTA 4H9VA 1TJ2A 3AYRA 3LK6A 2WXDM 4PRTA 1E6SM 4XD5A 2Z27A 5AC5A 5A8GA 2WPEA 4H6EA 1OSEA 1V77A 4DNMA 1N63C 7REQA 4Q4PA 3OOQA 2BVDA 3S3GA 1J0KA 4GJ1A 3W81A 2XWEA 3KBMA 3N29A 3F4WA 3R1ZA 1F8MA 3IUDA 3FHQA 3B0VC 3TAKA 2XH2A 1SMAA 2OKOA 3M41A 3F4VA 2FYMA 4JFTA 1K9TA 4KCVA 4G6CA 2O9OA 3GBDA 3H2MA 3DI1A 3L68A 1UWRA 2ZFAA 2R91A 2ZX7A 4BJHA 1H5YA 2J7EA 1Q6CA 4K8GA 1BF6A 1E4LA 4OFCA 5REQA 1OCQA 2E4TA 1GYMA 1B3ZA 4JKKA 3EWBX 3WNLA 3FEQA 2A4AA 2NXIA 2YIHA 1H2JA 1KLZA 1JQXA 3UWVA 2HMCA 4ROQA 1NPXA 4JN8A 1RV8A 3P0WA 4O1DA 3LB8A 2VC9A 3BQ6A 2EKCA 3IAPA 5EMLA 1KRAC 3TP4A 1W6TA 3FV9A 2C18A 5CXPA 1GHRA 2HPIA 5IFPA 4DZ5A 3CEUA 1PTGA 4XO6A 3OVPA 3DGRA 2QJIA 2XUCA 3OZYA 1JZ6A 3W3OA 3I3EA 4GJIA 3LUTA 3CHFA 2DVXA 1AW5A 4NASA 1IWPA 4NQ1A 4EXBA 4EWND 4MNJA 4ZO9A 1ADDA 2VOMA 4ZO7A 2J7BA 1K8CA 1JGIA 3WF0A 4F0LA 3ALGA 3DCPA 2W3SA 4GNJA 3PC0A 3QVQA 4HCDA 4JIPA 3ECQA 2YB1A 3S83A 1I2PA 4PODA 4R5EA 2XSAA 1QHPA 5AHEA 3OLGA 1GT8A 3OYXA 3R0KA 3Q45A 4HHPA 3FAXA 1JFHA 3REQA 4LJ3A 1E0WA 1X97A 1YLVA 4WHBA 4J3SA 3KCLA 4M3PA 4POCA 3AUOA 2QHAA 5AYIA 2A0NA 3VMPA 5LYRA 1V8EA 3BL3A 5T91A 4LA1A 3AMCA 5HULA 3GU1A 4RXFA 3ZVIA 4Q8UA 4TMCA 2WC3A 4N9EA 1JUKA 1D8WA 3WL1A 2XN0A 4Y9OA 5G1MA 4NZ5A 2OOGA 2YZRA 1V7AA 2EQ6A 4L7ZA 3ENLA 2CBJA 1UJQA 1DJZA 4GCXA 2V2DA 3GWQA 1G4SA 3CT2A 3DG7A 2VKZG 4UQDA 3VZXA 3TK7A 3V35A 1LL7A 3GIYA 2DV0A 1FX6A 2UY4A 3BUVA 4JICA 4EK7A 4E3VA 3PPCA 1HKJA 3IC9A 1UQZA 1WV2A 4XG1A 2ICSA 1YQZA 4AD2A 1L6FA 2YDQA 3KOYA 1WAWA 4NJJA 3WX7A 2B0MA 5DXXA 1UCWA 4GX8A 3PNZA 1T99A 1VFSA 3NS1B 2D2GA 1GTHA 4ORMA 4E8GA 1FWSA 2ACUA 4JL2A 4O1FA 4DYEA 1EF2A 1KV5A 3FFSA 4XZBA 1XIJA 3JR2A 1SO5A 2XFRA 1TV4A 4PRWA 4QS5A 4XD6A 2CIPA 9XIMA 1VFMA 2J74A 4AUBA 4KRUA 1XLCA 1E6RA 1X8FA 2PODA 4H4UA 1IIHA 4H8VA 4AY7A 1SO4A 4KIEA 3W86A 4DAFA 3OEXA 2V69A 2X2GA 1NTHA 2GSJA 4FNQA 1SW0A 3B8SA 4WK9A 2DUAA 1C7SA 2AKMA 1F3XA 1KGXA 3GXTA 1HJXA 4C6QA 3QXBA 2VM8A 5FJIA 1MW1A 5JBEA 4IFKB 2EG8A 3LPPA 2BBFA 3GB6A 1XRTA 5G4HC 5C8BB 4YWOA 1XC4A 3WEMA 3U2OA 2WVTA 3NG3A 5FEXA 3E0LA 2ZCGA 3B3DA 4KFOA 2I5GA 3O6AA 3PUOA 1RBAA 3W7OA 5AN7A 1SVDA 3KVKA 3GBEA 3UWZA 4ACZA 4AHPA 3TJ4A 5DANA 1WXJA 2DUZA 4XUYA 2VGFA 1SW7A 4EPBC 2WNQA 1RPKA 1JD9A 3W22A 4LW7A 2OO0A 2WMGA 3CAKA 4S3EA 3UXIA 4AZIA 4W87A 3K8KA 1TX2A 5HPCA 2YR1A 2YCJA 3A47A 1Q13A 4IOTA 4G7FA 2IXVA 3LRKA 4GC4A 1V0KA 5BXTA 1GRTA 2IXUA 4CCEA 4FALA 2PWUA 1EBGA 4D6IA 2UY3A 2YL8A 4XKYA 3V0UA 3L5LA 2J47A 3PB2A 3M44A 4QNEA 3S2NA 5D8ZA 3NQEA 3N11A 3EXRA 2GGIA 3SIMA 3UXDA 3CNYA 4LV9A 5DN1A 3A13A 1JL8A 4WY0F 4B4FA 4IG2A 4HSNA 2H3DA 4NAFB 4I7VA 1I2RA 3FIGA 2ZZ4A 3PR2A 3AZRA 3R6IA 2BOEX 5FAGA 1LRNA 2EXOA 4JN7A 4YHGA 4LFYA 4E0CA 2QZRA 3ES7A 4IGMA 5KEZA 4RXGA 4G7EA 4DPQA 1DJYA 3DUGA 1LLZA 1ZCCA 2VELA 1KM2A 1SM9A 3W75A 1EWDA 4FSAA 5AKQA 4AYSA 2DSWA 3N9KA 2GQ3A 1S46A 1DXIA 3SAZA 3TE9A 1E3XA 4WSHA 3WDHA 2V5CA 1BKSA 2XVKA 1OC6A 3O0KA 2GL5A 3PY2A 1EDGA 3OQEA 5GPRA 1AMKA 3IWPA 4ZQRA 3EB2A 4HK7A 3W0KA 1FWHC 3GR8A 1QPRA 2CKRA 1HGWA 2XIBA 1K7EA 2VC5A 4DB7A 3LV6A 4A6GA 1Q4NX 3CH9A 1GQJA 4KEZA 2Y70A 3CJPA 2QIIA 2X8CA 1N61C 3ZIZA 2O92A 3C2OA 5FCZA 1AQHA 3AN1A 5LIKX 3IRSA 5CPTA 2V5LA 1KO0A 4PCFA 1M7XA 4DBSA 3GO2A 5BOEA 2NLYA 3NA8A 3WDJA 1PYFA 1Z8AA 3W7DA 4JQ2A 3CBWA 4TVUA 3P93A 2AL1A 1V3JA 1XBXA 4CUCA 4AZBA 4CQCA 5A1AA 1BTCA 3IJLA 1FEAA 1DXFA 4UOQA 3FS2A 2BGQA 2GUBA 2WJEA 4C7FA 3NSXA 3EOUA 2P76A 1P7TB 1E9YB 4JGDA 2RDTA 3ARUA 1A4MA 2F2HA 2XSBA 1V51A 3RDKA 4GUGA 3SB0A 5F2IA 1K7XA 2FH6A 1EH9A 4GUIA 3QF0A 5D2TA 3W6MA 3B8TA 2Z29A 5FL0A 3NQ8A 2B31A 5CG7A 3WMCA 4EF9A 1X39A 3E2RA 4JHZA 5A6KA 1XXXA 4PCPA 3MUY1 2ZADA 3OZPA 3P5ZA 3LHZA 4AQLA 1VYPX 1TPFA 3MUCA 3B0UX 3APYA 4AY1A 1EGMA 2GOKA 2WB5A 2CERA 3ITTA 4RCXA 5I3GA 4X9YA 3PZGA 1M7JA 1QNQA 3USZA 3S8HA 1TWSA 4JDBA 3IK4A 1HL2A 8XIMA 1V02E 2QMJA 1ECEA 4KH2A 4BS0A 2WNZA 4YVXA 1TMLA 3SBFA 3EDFA 1VKFA 1IT0A 3STFA 1MDRA 1X1NA 3VM7A 1DIDA 3BCJA 3AICA 4DNAA 5KVIA 1NWSA 1W9UA 1BEUA 1YDVA 4GD0A 3MZ2A 4Y9AA 4HPHA 3AHVA 2PTXA 1W1ZA 1FDJA 4B90A 1RCQA 4QLJA 2HE5A 4WKAA 1J6OA 2QCCA 4PEKA 4BI7A 4M51A 5KZ6A 2OZTA 4DVOA 3H7VA 1TZZA 1OFOA 1GVQA 3CLMA 3GE7A 3DK4A 2WBKA 1CDGA 3QOMA 3N2CA 2EQ9A 4R85A 3TYBA 4PMVA 4Y7EA 2FIQA 2GGGA 2G4FA 4Y9NA 3UVAA 1ZAHA 3QTPA 3QRHA 1AZ1A 2FTWA 5GNZA 3UP8A 5K3VA 3SGZA 3VYLA 5AC7A 1WDPA 2YCEA 1MUMA 2WANA 2PB1A 1F7BA 3Q2DA 4R7OA 5FF0A 2HZGA 1ONEA 3H26A 4WJXA 1BWKA 1ODUA 5H8PA 3NPXA 4M8UA 3L65A 1BG9A 2CESA 4GYPC 3GTFA 1POJA 2EJ1A 4FX6M 2NT1A 3S5NA 2DT2A 1XGEA 1NF0A 1QATA 2QQ6A 2W0UA 1WA3A 2ZKMX 3MV11 3AXXA 4AW7A 2XJ7A 3AMZA 4IXHA 4M7SA 1F3TA 1JI2A 5AC4A 1PE1A 5CZSA 1A5CA 2QF7A 4J3ZA 5DBTA 2V3FA 2VC7A 3NSNA 4DBEA 3AJXA 1U2YA 3KX6A 3UERA 2PDFA 2W9MA 4CNSA 1RBLA 4KT2A 3STEA 3NCOA 5G1YA 4KEMA 5A6AA 4MPQA 3OQ8A 1Q1RA 2WYSA 1SJDA 3EX2A 1S2UA 4GYPA 5E6YA 4BHYA 1VRXA 5I6SA 1AK5A 2J27A 1D7KA 3AISA 1R47A 2QIWA 3O07A 1BVWA 3WK0A 2FVKA 1HP4A 4YLWA 2A21A 3S5YA 3RCYA 3G22A 5HMEA 1CCWB 1ICSA 3C0LA 3S2CA 2W4XA 2DFAA 3ARXA 4CD4A 3IVUA 3OBKA 4TVWA 1W56A 4XZLX 4Z08A 3F1QA 4HOXA 4H4RA 4L6DA 4LNYA 3ZJ8A 3CO4A 4P7NA 4B15A 1OCBA 4PL2A 1Y65A 1R7AA 4DWDA 2QUTA 5C7HA 1VBJA 4R53A 3PAOA 2X50A 3VDGA 3VDBA 5CJ5A 1A5BA 3RYSA 2R24A 3VD3A 3E0VA 3ARYA 4Q4QA 1FEBA 3LZ3A 2Y85A 3SCWA 4JEJA 3QPZA 4ENLA 2CZ5A 3NZPA 3H55A 4MJ2A 1J93A 4C6BA 4DBDA 3LCIA 1KCLA 4WVXA 1J2WA 1CPUA 3LBCA 4BURA 2DVUA 1CXIA 4AEFA 3F2CA 4MG4A 3N9RA 3WH6A 4MMWA 4N2YA 3SQMA 1PZ3A 2G96A 1XS2A 3PZTA 4ACZB 4C6PA 4UTMA 4PCNA 4WKFA 4CQBA 1WE5A 3C52A 5ENLA 3WENA 2DZBA 3M0XA 1UKQA 4WD0A 1FWFC 4PUUA 3CO8A 4JNZA 3WDPP 2GJLA 3TTSA 4C60A 4HPJA 1JPHA 5H91A 3OHIA 5A6MA 4QJ1A 2PU0A 5BOOA 1ZY8A 4H9MA 1P0DA 4DBWA 2GJXA 2J9XA 1K4GA 1O95A 2OLHA 2UY2A 1M65A 1DL3A 3ISIX 5HK4A 4XKYB 1C90A 2RH9A 4RE0A 3T9PA 6REQA 4AD0A 3QMSA 3URNA 2CBUA 2D73A 3E2QA 1OX5A 1IWBA 3QEZA 5BU9A 3VC5A 1KNWA 1Q66A 3M0IA 4BI6A 1HNYA 4BY3A 4DUWA 3CV2A 3L4WA 3E3HA 2CHNA 5LNUA 1NDVA 2E25A 5HWNA 3PSVA 3TWAA 1RLDA 2NQ9A 4UR8A 1HO1A 1REQA 3AROA 2E1WA 5FIPA 1JAEA 3W27A 4PEEA 4UUIA 3ITXA 1BGGA 1LUCB 1IR2A 1FUYA 4IMDA 1ZY9A 1ESWA 3AC0A 1UD8A 2NUXA 1R2SA 1QI4A 1EL3A 5L9FA 2AKZA 5EU9A 2G3NA 5D4YA 3W1UA 3QQ1A 4EM3A 3ELFA 3Q37A 3M0HA 3RR4A 1S5VA 3G0UA 2HEJA 3JUGA 3QY6A 2VFHA 5U7SA 2VX6A 3GG8A 1MOKA 4XBSA 4DLMA 1RM6B 3W00A 3DGBA 2VENA 4FLOA 4IQLA 1KRBC 2C91A 3IIOA 3P60A 4ZQNA 1XICA 2G3FA 2YCIX 2C3DA 5HATA 5IHRA 2XH0A 2YLAA 3MT1A 4XKMA 4JKMA 3I3DA 2QXWA 2W67A 3LSBA 3GZ3A 3RGTA 1TCMA 3N4EA 1OF6A 1TV8A 2OLAA 4UR9A 4KWSA 3DHPA 3ZVHB 4JTHA 2H3BA 3ZLFA 3LA4A 3WKZA 4WY0B 2FDMA 2OZ8A 5I06A 3BSMA 4GI9A 3HMJG 3D3FA 1K8YA 1X6UA 3WMLA 4S38A 1A5UA 3VMOA 3OA5A 3WYZA 1N62C 3GG1A 4UFKA 2AMXA 4GNKB 3FJLA 2ZXAA 1T8XA 1B54A 4PR4A 1CEOA 4LYPA 3UWYA 1YXDA 2YKKA 2XDFA 1X8CA 1ZXIC 5C9RA 1QTWA 2PDWA 1HJQA 1OGGA 1X6LA 3L9CA 2ZIDA 1G5AA 1EC9A 1YMYA 4F48A 1BHGA 1XLIA 1OFRA 5CSYA 3QTGA 4ZQPA 1K70A 4WDXA 4MIMA 2V63A 3BARA 4CQ8A 5I77A 1VJIA 5B7ZA 3ONCA 3N6QA 1GPWA 3FDKA 2NVAA 4GVFA 4YWIA 4ADWA 4PUEA 4JTEA 1CYGA 5KINA 4MFEA 3MI6A 2D2JA 3AMLA 1XIEA 5E1QA 4A8LA 3GXPA 2G0WA 1V3IA 4E8CA 3U7VA 3UG3A 1C8VA 3B4UA 1TPH1 3EX6A 1GVRA 2JGQA 2ZUMA 3WJXA 3EXTA 2H8ZA 1ME7A 1W5NA 4C6JA 1VLWA 3NO5A 1NEYA 1PKMA 3K4AA 4IIHA 4ADTA 2D23A 3DKJA 1P5BA 1NU5A 4QR6A 1FXPA 4O50A 3R11A 3G3DA 3LMYA 4H1ZA 1RSCA 3D46A 3WQEA 2J8TA 1VFFA 1YKWA 2EPOA 3PTKA 3LXCA 4GVIA 3BAWA 4LOCA 4CCCA 1KCXA 1N5WC 4G8TA 3FY1A 5D04C 3DC8A 1CLVA 5HANA 1XYBA 4DJEC 4UTTC 3TCSA 3WQ6A 1OC5A 4UOZA 4PMRA 4YYFA 3O6CA 3CZ8A 1GOOA 3STGA 2WC4A 5CC6A 1YXYA 2JALA 2WP5A 4M6QA 3ARPA 2EPNA 2DZSA 1GG1A 5HJXA 3N3TA 2OYLA 5RUBA 2X8HA 1U1HA 1QNPA 1F6PA 4XWUA 4LNCA 4D6EA 4WX2A 3LERA 5K9XA 1VYRA 5IDZA 4R7JA 2OQHA 1XLJA 5LGXA 3L4ZA 2A79A 2GVYA 3EOEA 1UUQA 2P8CA 3KTXA 4J3XA 3NVZB 5IDIA 4DJEA 2NV9A 4UTTA 2YPIA 2J77A 3MU7A 1V7YA 3SDOA 3W37A 1DWGM 3KBVA 3II1A 3IEBA 4JQ4A 3CM4A 4XAGA 3CQJA 1B3OA 1W31A 1O1ZA 4DAIA 5C9XA 1OWQA 4AZ6A 2FVLA 3JS3A 5EBUA 3LS9A 1CLKA 1MXSA 3L5AA 1E0TA 3DFQA 4BFAA 3B0YA 1SZRA 4H4YA 3MP5A 3O2LA 3PUDA 5JUVA 1J6PA 3WCZA 2DW6A 2AQOA 2XVGA 5A6LA 2J24A 1ZAIA 3W1XA 2WV8A 4O19A 1IT7A 3R8RA 1ADSA 2OEJA 1KWKA 4A4AA 1HVXA 4MY1A 2J7DA 4R3UA 3UA4A 5FS9A 4MSSA 3M0KA 1GRFA 1ZSXA 2JK2A 3MDUA 4PCTA 4LIIA 3W1QA 4FIQA 3BMXA 1EUNA 3QQ0A 5F4WA 2NVCA 2BWGA 5AY7A 1ITQA 3ZR6A 4LF2A 2OZ0A 2ZZ0A 3CZKA 5EMMA 1GRAA 4IT1A 3QJAA 2BC1A 4GQ0A 3WLLA 1PKLA 4Q8VA 2CWNA 1V0LA 2VFEA 1CGXA 4FF5A 4IMAA 3SRFA 4N6FA 1PDZA 3CYVA 2ZC1A 9RUBA 2HTMA 1Q6RA 3EXSA 3CGDA 2CITA 1GTEA 2VD9A 1W8GA 2WJFA 4GH1A 2Y8VA 3A6OA 1H50A 4X63A 1SB3B 1DJWA 2P88A 4MB5A 3JW7A 4PB5A 4PSRA 3IGSA 4EAMA 2W62A 4CU8A 1GXFA 4XBJA 3E38A 3S6DA 3TONA 1JDAA 4LYRA 2X8RA 1I60A 4JOMA 3OIHA 2VC6A 5FJOA 3WMBA 5HUPA 3VM5A 3CEPA 2WO5A 2NPXA 2F5ZA 2NSOA 1ECQA 1W3TA 4WJEA 3R12A 2NX1A 1NELA 1ZBKA 3TN4A 1XINA 1XYZA 2HE8A 2ZZ3A 3L4TA 5FESA 3ITVA 1UMYA 1GNXA 4WGHA 1FKWA 2FZ8A 3WQ8A 3DFHA 4HK5A 1YW1A 2V2CA 2GJXB 4H01A 4KF1A 2OKTA 4X9SA 2WSKA 2ZE3A 3POHA 2D3NA 3MKCA 4NNCA 5BCAA 4PBFA 2AMGA 2Z4GA 2QCFA 1BD0A 4US5D 1UKPA 3GYEA 2BLEA 3TEVA 1F3PA 5BWAA 4H50A 1IE7C 2I16A 7XIMA 3UWEA 2GQAA 1H11A 2CWXA 2ZVRA 4OUEA 4UXDA 1V6VA 1QOXA 3TOYA 4DF1A 4S3FA 1PUDA 1EJ7L 3T78A 3HW2A 4ICCX 2OJPA 3EA2A 1W1A1 3EX3A 2A7RA 3QN3A 4IX2A 1KR0A 2C0AA 1REQB 2NXHA 1B2YA 2Z1XA 4NZCA 4UFIA 1R85A 3UBPC 4GFIA 2ZZCA 3PANA 4DO7A 3R5EA 1XPGA 3GFXA 3TSMA 3WJWA 4AZ5A 1R3SA 3SUSA 4MUPA 1RCOB 3P84A 3BK0A 1A47A 4ROPA 1B4KA 5D8WA 1KCZA 1YYAA 1K03A 1UWQA 4IX0A 5MF5A 4JTSA 4AWUA 1OADA 1ZL1A 3P3BA 3AYSA 1W2VA 4PN2A 4DWSC 2XHYA 4GOAA 2X1UA 8TIMA 1ZKQA 1XC6A 4L64A 4AEOA 4CNOA 3QSTA 3VGGA 5HPOA 1DWFM 3WQVA 2BXYA 1YPFA 2YW4A 1FFUC 1L8NA