2PMQA

Crystal structure of a mandelate racemase/muconate lactonizing enzyme from roseovarius sp. htcc2601
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
367
structure length
367
Chain Sequence
KIAEIQLFQHDLPVVNGPYRIASGDVWSLTTTIVKIIAEDGTIGWGETCPVGPTYAEAHAGGALAALEVLASGLAGAEALPLPLHTRMDSLLCGHNYAKSALDIAVHDLWGKRLGVPVHELLGGALTDSVSSYYSLGVMEPDEAARQALEKQREGYSRLQVKLGARPIEIDIEAIRKVWEAVRGTGIALAADGNRGWTTRDALRFSRECPDIPFVMEQPCNSFEDLEAIRPLCHHALYMDEDGTSLNTVITAAATSLVDGFGMKVSRIGGLQHMRAFRDFCAARNLPHTCDDAWGGDIVSAACTHIASTVLPRLMEGAWLAQPYVAEHYDAENGVRIEGGRIRVPQGPGLGLTIDPERFGPPLFSAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of new enzymes and metabolic pathways by using structure and genome context.
pubmed doi rcsb
molecule keywords Mandelate racemase/muconate lactonizing enzyme
molecule tags Isomerase
source organism Roseovarius sp.
total genus 125
structure length 367
sequence length 367
chains with identical sequence B
ec nomenclature ec 5.1.1.22: 4-hydroxyproline betaine 2-epimerase.
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2pmqA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2pmqA01
1MDRA 4HCLA 2OKTA 3QPEA 3EKGA 3QKEA 2PTWA 2OZ3A 5FJTA 2PA6A 2I5QA 3RCYA 5FJPA 1L8PA 2GDQA 3RRAA 5FJUA 4H1ZA 3ZLGA 3MY9A 3JVAA 5BOEA 3DEQA 3VA8A 3PFRA 4GYPC 4IZGA 3VC5A 2AKZA 2OPJA 2PODA 2PU0A 3KUMA 4Z1YA 3CK5A 3R1ZA 3BJSA 1FHVA 4DX3A 3SJNA 2QDEA 3I4KA 3VDGA 3S5SA 2PTZA 3ZVHA 3BOXA 3U4FA 3JZUA 4FP1A 4HCHA 3MSYA 2GL5A 4E4FA 1JPMA 2P8BA 5J04A 1EBGA 1BQGA 2PP1A 3RITA 7ENLA 2DW6A 3B97A 2PMQA 2RDXA 3Q4DA 1JDFA 1EBHA 2POZA 3UGVA 4MKSA 4IL2A 3FYYA 3DG6A 1EC8A 1SJCA 3DGBA 3OTRA 4IP5A 4DWDA 4GFIA 3OP2A 1W6TA 3DESA 3MWCA 4ZCWA 1WUFA 2OLAA 3TJIA 2GSHA 3CT2A 3SBFA 3GD6A 4MGGA 3THUA 3UJRA 2OO6A 4GGBA 1IYXA 4HNCA 2PS2A 3CB3A 3UXKA 3RGTA 4JHMA 2HZGA 1F9CA 2P8CA 3UCCA 1ONEA 2XH4A 2OQHA 3N4FA 3DFYA 2QJMA 3UJ2A 4DXKA 4HCDA 3FVDA 1MUCA 3V5FA 2PU1A 4KT2A 3I6TA 2P88A 3IJQA 3R11A 4KPLA 5FJRA 3V5CA 4E5TA 2GGJA 3VCNA 3H7VA 1SJAA 1OEPA 3BSMA 2OX4A 2QVHA 4YWSA 3FV9A 2AL1A 3NXLA 3QTPA 4X2PA 3STPA 2OZTA 2FKPA 1E9IA 4GIRA 3MKCA 4JN7A 3PK7A 1YEYA 1KCZA 3ZLHA 3DDMA 3T6CA 2MUCA 3TQPA 4ENLA 2PP0A 4A35A 2PTYA 1JCTA 3SN0A 2HXUA 3DG7A 3ZLFA 4IT1A 1ELSA 3PWGA 3TWBA 4ROPA 2GGIA 1DTNA 4HYRA 3R10A 4JN8A 4KWSA 3SSZA 3SQSA 4GMEA 1WUEA 4GYPA 2P0IA 3IK4A 3JW7A 2HNEA 4EWJA 3HPFA 3UJFA 1KD0A 3CXOA 4IL0A 3T4WA 1BKHA 3QN3A 2OVLA 2NQLA 4HN8A 2AKMA 4M0XA 3UXLA 3OW1A 1R0MA 3MZNA 4F4RA 3GO2A 3RO6A 4K8GA 1XPYA 3ES7A 3CYJA 4E8GA 2XGZA 2GGHA 2FYMA 2P3ZA 2XH2A 2PGWA 3R25A 3V3WA 2XSXA 2ONEA 1NU5A 3P0WA 1TKKA 1R6WA 2PP3A 4K1WA 4ZA0A 1NELA 1KKOA 4A6GA 2HXTA 1P48A 3P3BA 3S47A 5FJOA 1PDYA 2PSNA 2XH0A 1EC9A 3IJIA 3ENLA 1MDLA 1JPDX 3K1GA 2AL2B 4GISA 3P93A 5IDZA 1XS2A 3FJ4A 2OG9A 3PWIA 4KEMA 2ZC8A 3GY1A 3Q45A 3EEZA 2GGGA 3N6JA 4HNLA 1ECQA 3I6EA 4DN1A 1MNSA 3IJLA 3QLDA 1PDZA 2PTXA 3ZVIA 3NFUA 3FXGA 4DHGA 3VFCA 4E6MA 4H83A 3DG3A 2ZADA 1TE6A 2OZ8A 3H12A 6ENLA 4G7FA 3VC6A 3OZYA 2DW7A 2PPGA 2CHRA 3SN4A 4A3RA 3T9PA 3TTEA 5ENLA 1KKRA 3DERA 3FCPA 4J3ZA 5EU9A 4DYEA 3U9IA 3UJEA 3TJ4A 3MUCA 3ES8A 3VCCA 1RVKA 2QQ6A 4Z17A 4H19A 4FI4A 3SN1A 2GGEA 3OZMA 1TZZA 1EC7A 2AL2A 3UCDA 3DFHA 3TW9A 5BOFA 3R0UA 2QDDA 1FHUA 4MMWA 4K2SA 3N4EA 3RR1A 3NO1A 4J1OA 3UJSA 3N6HA 2PGEA 2PCEA 1SJDA 3ZVHB 2OFJA 3GC2A 3NZGA 4E4UA 3TWAA 2QJNA 3H70A 4IP4A 4GGHA 3CAWA 4G8TA 2O56A 2QGYA 3TCSA 3DIPA 4HPNA 3TOYA 1P43A 4IHCA 3OPSA 2OQYA 4M6UA 3H8AA 2MNRA 1SJBA 1MRAA 3R0KA 4H2HA 3D46A 3D47A 3MQTA 3T8QA 2QJJA 2XH7A 3V4BA
chains in the Genus database with same CATH superfamily
3BAXA 3QKEA 3NVVB 3G2GA 5CBIA 2PA6A 1TWWA 3LGEA 4AVNA 2VR2A 3SY5A 4K6AA 1NOUA 3L5OA 2DT1A 2Z28A 1OCBA 3PBYA 2EHHA 4QG9A 3PS7A 3BVJA 1DTUA 2DZWA 2WC7A 1XUUA 1A5BA 2WSPA 1QXLA 4FP1A 5CZKA 3TXVA 1JZ7A 3M0IA 1I1WA 4ZVJA 2GL5A 4PE8A 3OVPA 1EXBA 4R7OA 5T26A 4GIYA 2EPNA 1O95A 5CGTA 4C6JA 1J8VA 2HVNA 1Y8BA 3BMWA 4LCQA 4E2VA 1LBMA 2V69A 1DHPA 3NNTA 3NSMA 2RDXA 1KBKA 2QAEA 1PCWA 2VKZG 1FTXA 1FWIC 4MLRA 3NVZB 1FX6A 3PZQA 4XO6A 2WZTA 4QDWA 3P6LA 4RE4A 1W6TA 3DESA 2GR3A 3BQ6A 1UYQA 4YWOA 3R94A 4Q8MA 1DXEA 2V68A 4XD3A 4GGBA 4E2BA 2Y24A 2PS2A 4GZJA 3O16A 4PA8A 1C7TA 1MZHA 3IJ8A 5CSYA 3SZ8A 3T4CA 3RLHA 4J7RA 3LERA 4AISA 4MNLA 4ZFMA 4BHYA 2PEVA 4C6QA 5BROA 3TR2A 1GVYA 2V3AA 2P88A 2GJXA 4KMQA 3HMCA 5FS9A 4AZHA 3HQ1A 1XSJA 4N6EA 1KFKA 3B03A 3L12A 4N4PA 2CLMA 3LGDA 4X61A 1JGIA 1ZGDA 1M9HA 2AL1A 4A2RA 4P7LA 4BEUA 2OEJA 2VGIA 1GVOA 3E0FA 1V7AA 4LNCA 1VH7A 4R34A 2ZE3A 3VO0A 1O5QA 2VZOA 3S1XA 1HX0A 3J7HA 1VPYA 3CIWA 4JL1A 3FHAA 1Q6OA 3EOEA 4TUFA 1LOSA 2R6OA 3QR1A 2F61A 4HNNA 2GPTA 4OOUA 4M52A 5A6BD 1A5CA 4XAZA 3P62A 2RUSA 2GSJA 3QMRA 1IV8A 3GRIA 4KKXA 4L6HA 1E51A 3TYZA 1XC4A 4Y2WA 4H6KA 4GYPA 5DLCA 1QU4A 2XGIA 3RCMA 1YPXA 4AQLA 4ZFCA 3B8WA 3HPFA 3L5MA 5EMKA 4Z2LA 3AICA 1KD0A 4OBTA 1JDDA 2HTMA 1FCQA 3GIQA 5DY2A 3N2OA 1BWCA 3T44A 4XTIA 9CGTA 3WDRA 2ZRYA 1P0EA 3NZ1A 3OYXA 4D8LA 1G69A 5CCZA 5TNVA 3WF0A 4E8GA 3KFTA 3WMBA 1QCWA 4LV9A 1GERA 1QDSA 1QOQA 1I9CB 3SUTA 1W3TA 3IVSA 5I09A 3WLJA 4PCTA 4I7VA 2A5HA 1YNPA 3LTPA 1E9YB 3EMQA 4EVZA 4LANA 5E70A 4FNQA 2Q3OA 3MHGA 4A6GA 4GYJA 1GXFA 4GJJA 1J6OA 3KOZA 4XK2A 1JI2A 3WO8A 4EQXA 1V3MA 3ZOAA 3OGSA 3NO5A 2HPMA 5A2CA 4MOZA 2P76A 2ZVRA 1KTNA 3T7VA 1LG2A 3ZR5A 1XDMA 2QS8A 1OF8A 5EA9A 3LPOA 4GCAA 4I3GA 1Q45A 5A8OA 3O6YX 1B3VA 3AU6A 1K1DA 2BWGA 1B31A 2ZZ6A 3TONA 3UETA 1H09A 2P10A 1X6LA 1QOPA 2VC5A 3A4JA 3EEZA 4C91A 2B4GA 2J7FA 3I6EA 3M5XA 3BUVA 2Q8ZA 1PDZA 2YZRA 2A2IA 3W37A 1NAL1 3VIJA 2ZZ1A 6ENLA 1H2IA 3OVGA 4IUGA 1KCLA 3W81A 2PDHA 4G7FA 2ODOA 1ZMDA 2PPGA 4IH3A 2ZDRA 1WNOA 1AH0A 1AW5A 2V3FA 4GLEA 2PDWA 4PL1A 1VCVA 3NO3A 1FP9A 2J27A 4C6KA 1ME8A 1XM3A 3RCNA 3MI3A 3VNZA 3PJWA 4L56A 3FXYA 2DT0A 3CPRA 1W8SA 4AIEA 2WP6A 2R1LA 3IJ9A 1LLZA 5FSEC 1EJUC 1BXCA 4XAGA 3DYMA 4NY2A 3OG2A 1MEIA 4JTDA 4ZOCA 2DZAA 2QHAA 3Q65A 1QPKA 2ADAA 5M03A 3ZJ6A 1YXDA 3LDVA 2RKXA 4O0KA 1DIKA 3LXBA 1JYNA 2ZQ0A 1B9BA 4HIBA 3KWXA 3UF9A 3PPCA 5CPTA 3CUGA 1H2JA 1F5ZA 3V36A 1W0MA 3GRSA 4IGNA 3LHVA 1T40A 5I5RA 3SUVA 1GV4A 1P43A 1F76A 3ZYZA 1W32A 3ITGA 4A8LA 4LJ3A 3EWUA 2OR2A 3V75A 5E0CA 3IIOA 1E1CA 4IP7A 1WPCA 2EPOA 4DO6A 3LI1A 4W4QA 2REQA 4P7QA 1KCXA 4CN1A 4R27A 3CBWA 1GZGA 2QMKA 3MI6A 2ZA1A 1R2TA 3C86A 1M5WA 3E5BA 5A3HA 2O9PA 3EGJA 4JXCA 4DXXA 3SO7A 3LLFA 1VAHA 1L8PA 3UA4A 3RRAA 5KINA 1P0NA 1KM1A 3GLCA 1PVNA 4IPJA 3R8HA 4FLOA 1Q6QA 3VDHA 5C9RA 4JTGA 1YPFA 4AHQA 4ASTA 1JFXA 4GIEA 1QBBA 4I7WA 1C29A 3WBYA 3KS5A 4Z1YA 3TP4A 3KAOA 1YBQB 2CETA 1D8WA 3ERPA 2X2GA 1FWTA 4EP8C 5G2WA 1E0XA 3VD5A 2WOWA 1D7FA 2OWWA 2CLHA 2YBVA 1UW9A 3G1HA 1JPMA 1KQZA 1KTCA 3AU2A 1HP4A 4PMOA 1R3QA 4QS5A 3S1VA 4NQ1A 3DH9A 1OFEA 2AQOA 1A0CA 2VNCA 4FSAA 4FF5A 4JDBA 1VFUA 1FWAC 5K7JA 2INFA 1CIUA 3IEBA 4JDRA 4MWAE 1GVEA 4H9TA 1YE4A 2NUXA 4FIRA 4Q8WA 1TCMA 1A3XA 1W1A1 3VIIA 4MY8A 1HGYA 3SBFA 4GVGA 2J7EA 4D6HA 3IGSA 4MG4A 4PB3A 2OJPA 2J9ZA 4YCPA 5IXEA 5J5RA 4ERAA 4M29A 4Z2GA 3MS8A 3K8LA 4XV0A 4DF1A 2Y5JA 4GRSA 3PPHA 5DMLA 2OZ0A 2XH4A 3N4FA 3UZJA 3T55A 1Q1RA 1N8IA 4EF9A 2YZ5A 4DAFA 4P2VA 4DXKA 1U1UA 3M5VA 4IIEA 4WSJA 2V9DA 1TV8A 2J62A 4IIDA 1M01A 5HMEA 1XP3A 3GHTA 3MT1A 1K8ZA 3I6TA 5G1MA 3VNDA 5D33A 3CS2A 2VX6A 4KPLA 4DNAA 3N34A 1WDPA 4HK5A 1Q6EA 2VDGA 2W0HA 1FCUA 3V18A 4EF8A 3VD9A 3VDCA 5AVNA 4FLRA 3W1UA 3FV9A 2DJXA 2Y85A 4L4MA 2J7HA 3ABQA 1H62A 3CO4A 1GOMA 4O16A 3VNLA 1E6ZA 3PG6A 3RLGA 2B81A 3LHTA 3GHUA 3CQKA 4LS0A 3T6CA 4A35A 5AYBA 2ATMA 5JH2A 2PTYA 2IKIA 4M8UA 3HQOA 3O7UA 3UZXA 2XU2A 2CKRA 2ZUMA 3UXAA 1Q7MA 1V6VA 3FIGA 1IF2A 4TX6A 3ZIZA 3E96A 2O55A 4GBDA 4IT1A 4QCFA 1AD1A 4MAVA 4DZHA 5GRTA 4F2UA 2P3EA 4NZJA 4KFOA 2FFCA 3PZMA 4H04A 1FP8A 4FK9A 3PB0A 1XRTA 3KL0A 2H90A 1N8WA 2WPFA 4O50A 4GC3A 5FS8A 1WKDA 3K30A 1ZALA 1Q4NX 1GK8A 5B7ZA 2HNEA 3DI0A 1A5AA 2CKSA 1TPFA 4DO7A 1S46A 2YCKX 4QCEA 3WBAA 1AH4A 1ZBCA 2PC8A 3UXLA 4C90A 1TRDA 5D2WA 5CLWA 3ARVA 4Q4RA 4AXKA 3RO6A 2EQ8A 3KOFA 1FHLA 1IWPA 1YPIA 3VIHA 5F2LA 2YCLB 3CH0A 1A0DA 3IARA 3BGAA 4DAIA 3C2YA 1MW3A 4G9PA 1IEQA 2DDXA 4N0RA 1YMYA 4CKQA 5T9BG 2G3NA 5CGQA 4AFYA 3VOCA 8TIMA 1KFBA 5CC5A 4KBXA 1J01A 2BGNE 3P0WA 2D1ZA 1I0BA 2QJGA 1WDQA 3E5PA 3OYZA 1JYVA 5JIWA 3QJAA 1EB3A 2X05A 3MV01 4DJDA 4DLFA 1U33A 4H6EA 1LRTA 2VJXA 1W8GA 4UR7A 2A3EA 1A5NC 3ZSTA 1EC9A 1JEHA 1B3OA 3ENLA 4UZUA 3UYCA 4MFDA 1KM6A 1JG9A 3QW4B 2FJUB 2OQLA 1FXQA 2VCAA 3L5LA 4ECLA 3QBUA 3FJ4A 2GZXA 1QATA 2XZ9A 4HJFA 5BRQA 2VRJA 4IUOA 2X40A 3T1GA 4C1NB 1CDGA 4MWAA 1TIMA 4ZR8A 1HL9A 1QO5A 3AFBA 3MMTA 1ZS2A 1XCFA 2QDHA 3UPMA 4LUTA 4JTJA 2WVVA 1H1NA 3WJSA 1LOLA 1J11A 4IFRA 4HU4A 1MNZA 3TYUA 3OZYA 2WOIA 1Z44A 1R30A 3HV8A 4XTDA 2AAQA 4C6NA 4C6LA 4JTTA 1V77A 1OHLA 3IS4A 3WH8A 1RA0A 4RK8A 4IMEA 3HO8A 3DYOA 1F6YA 5K9CA 2D3NA 3II4A 2J88A 1W3NA 4A22A 2FZBA 1E9ZB 1E5JA 4V28A 2GUYA 2R24A 4F2BA 1I75A 1N2VA 5AHLA 4JIIX 3AWNA 2VXNA 2YYUA 3KW3A 4JTFA 4XZWA 2FMOA 3CUHA 3BJFA 4A8RA 4NAFB 1H61A 1UMYA 3P7YA 3WK1A 3V0TA 4P8WA 3CWNA 1HP5A 1W9UA 2XFFA 3TK7A 5CXPA 5KZ6A 1PWLA 1BZLA 2YVJA 3WD3A 1TSIA 2QGYA 3S0CA 1JGMA 3VOFA 4C7GA 3KZSA 3WL0A 3WDPP 4L6DA 1OGGA 4PFHA 5CZJA 3FSUA 1LROA 4ZEPA 1HJUA 5FI8A 3WEZA 3R0KA 1OB0A 1XSIA 4FX7A 4S2BA 1IT7A 4GUJA 4TOQA 3P5YA 3A47A 1XR2A 4JKKA 4N9CA 4HP5A 1FH8A 3DJGX 2YA0A 2OT0A 1EJVC 3OB8A 1VCFA 3REQA 3EXRA 3B4UA 1EJTC 3DOPA 2VHLA 4O10A 5FF7A 3WD4A 3IGHX 3JVAA 5BOEA 5D4YA 4ZE4A 3UPWA 5C71A 5CGMA 1PV8A 3DI1A 3BG9A 5A95A 1XV8A 2WOQA 3N2CA 4JZ5A 5LNUA 3GNNA 4Q7IA 2ZRWA 4AXNA 5L9FA 1XLHA 4FO4A 2QCEA 4PC8A 2TRSA 4MTVA 3LXAA 3W24A 1MZRA 2V5CA 3WQOA 4DXVA 4EIVA 1SGJA 2Z1SA 4UCFA 2XSBA 4FNPA 1JQXA 3SGGA 4AB4A 1F74A 1AK5A 4UNLA 1KM5A 3DHPA 3EDEA 2A3LA 1R9YA 1R3YA 1C7SA 2QUUA 5FEWA 1JIBA 4NYUA 2EGZA 1Y5VA 4LALA 2VC9A 4JX5A 3KLLA 1FWHC 4HYWA 4M3PA 3TZFA 3QPYA 4GZIA 4UQAA 4ZCWA 1Q63A 2NX9A 4KFPA 3FGCB 3I7QA 1J4EA 1UWRA 2Y8VA 1U83A 1DJIA 2YA2A 3CHDA 4I8YA 1OIFA 4OUIA 3USBA 4HNCA 4KGLA 2WK2A 5AKQA 4CN6A 2QCLA 4W9TA 4ZSTA 5TF0A 1VEOA 3W2MA 1OD8A 3ATYA 3AIQA 2VDIA 3W6LA 5IOBA 3NURA 1R46A 4DBDA 4Y9MA 1HJQA 9XIMA 4NXSA 1ZU8A 2ZOXA 3URBA 3AZRA 3IIVA 8XIMA 1CXEA 2O9OA 4YJ5A 4B9YA 2YXXA 1ONXA 1TFVA 1Q1WA 1DXIA 3BSHA 4S3KA 2E67A 4DNHA 1V93A 3VFLA 1BYCA 2QVHA 1E0TA 4LAKA 5LSMA 4IMFA 4JNMA 4QEEA 3RX3A 1TQJA 3GKAA 4S39A 4EQRA 1WBJA 1ICQA 1UD6A 3QV6A 2GVYA 2YL9A 3VE7A 4XAPA 2ISFA 3OBKA 1EOKA 4Z0SA 4HPHA 4JX6A 4J35A 1OX5A 4L1XA 4W8AA 4YIWA 5AHMA 4YHEA 2QDGA 1C9WA 1VENA 2GQAA 5DMYA 5HR7A 4LNYA 1LRNA 4IIGA 3FDKA 3GFYA 4UR8A 3WDQA 3KRBA 1ELSA 2X09A 1V3LA 4CCDA 1X7FA 4ZO7A 3M0MA 1T99A 4O15A 3VUSA 1DTNA 2ZZ7A 2GWGA 3R10A 1VBGA 2OX1A 4GMEA 2NVCA 2CPUA 3EX3A 3QV9A 3ZT6A 4DJDD 4APNA 1DOSA 3QSRA 1N55A 3OGRA 4GCXA 2G95A 2CHOA 4M7SA 5LKYA 1VFLA 3NQDA 1TQXA 3M9YA 3AHTA 4Z1CA 1BXNA 3B8DA 3OW1A 1R0MA 4HTBA 3D9XA 3AMGA 3WLQA 4A29A 3CV7A 4D2JA 4W86A 4GXPA 3P81A 1KGUA 3N25A 4MWAD 4PRWA 4URIA 3B8UA 3A5VA 4EX4A 4YWIA 5IBXA 3IK2A 3UZWA 3F2CA 1GQKA 1VHCA 2NSOA 2OB3A 3SQMA 1HVXA 1GOOA 4WZHA 3DKLA 1SO5A 4AG0A 4AH7A 5A6JA 1J18A 4DI9A 1RH9A 4B15A 2Z1XA 1HKKA 3LM3A 2WBKA 2XH0A 1L2QA 3BGJA 1KLYA 1WAUA 4OECA 1JPDX 4AWSA 1CGTA 2Y89A 4NX0A 1VPXA 1S2VA 1OFAA 2ZUWA 3UR7A 1G7UA 4JTHA 1K4GA 3HIJA 2BODX 2ZC8A 4F0SA 4ERIA 3NYDA 1NSJA 2IMRA 3LA4A 3S83A 2X50A 2FVLA 2I16A 4L1GA 1DVJA 2YX0A 3VMNA 3GKFA 1MNSA 3VM5A 3QLDA 2XSAA 1XD0A 3WLIA 4NJHA 2VVNA 3SUSA 3CLWA 5D32A 3IPWA 2VO5A 3RU8X 3NQ7A 1XYMA 4RX0A 4ZL1A 1HW6A 4OJYA 5B7YA 3WMCA 1UH3A 2DVTA 4YNGA 3T09A 3ID7A 2XVKA 3NVWB 3LNMA 1OWQA 3CTTA 5EFFA 4UMAA 2CIPA 4C5YA 3WZ0E 1FA2A 3UJEA 7XIMA 2OT1A 3V0SA 2WM0A 4IQDA 5TIMA 5JXQA 1GQLA 4ZO6A 3QRHA 3R8GA 3SCUA 5A6MA 4O14A 3BW3A 1JZ2A 2QPUA 3V0UA 1TZZA 4LBRA 1XIJA 1XLBA 4UR9A 2IQTA 5J8LA 2HWGA 1XGZA 3KHDA 3LOTA 4CCCA 4QQUA 3A21A 4BS0A 3A22A 3LEPA 1BG4A 4B2DA 4IF2A 4AZBA 4HK6A 1FWGC 3LD5A 1ECEA 4IPPA 3QOMA 5G2HA 4KFNA 4O52A 3WQ5A 3CAWA 5AHIA 3OG3A 4RW5A 4DY1A 1YXCA 1U1JA 4Z0JA 2GQ3A 2OGJA 1DJGA 2FFIA 3XIMA 4N02A 4XZMX 4ZB0A 1E3XA 1LT7A 3L7RA 3AHZA 2WMJA 3KVLA 4DO4A 3EA2A 4M6UA 4PTNA 1FEBA 4NASA 2XG9A 3W28A 2HROA 3HB9A 4HQVA 3ZS4A 2CLKA 3C2OA 3B05A 1RP8A 3CQ0A 3K13A 1FWWA 2EF9A 2PDNA 3EKGA 5GQBA 1R8LA 4QG8A 5LNWA 1TPB1 3ZZ1A 3QC0A 2V3EA 1T41A 1Z41A 4AZCB 1HL2A 3U6WA 4LBSA 3DEQA 2VL4A 1MXDA 1FCBA 4EMIA 4IMCA 4YTQA 1D3CA 2D0FA 4Y96A 1W9BM 4WHBA 1GEUA 3TVAA 3S8HA 4JFTA 3TV8A 4FDCB 3BG3A 1RPKA 5D2XA 3VM7A 5M1TA 1NFPA 1KRAC 3GXFA 1LF1A 2ISDA 3MZ2A 2QIWA 3HGOA 5C2XA 2F8QA 1JR1A 2WHKA 3UWVA 3LRLA 4ZE5A 2G3IA 4B16A 1BQGA 3NQCA 2OYKA 4PZVA 3VOIA 5AFDA 1QI0A 2PURA 4JTUA 1SZFA 1AZ1A 4XZBA 3BLOA 5G5GB 3NPWA 3FNDA 3GB6A 2BS9A 2HRWA 3OTRA 3NQFA 4AY7A 3D3AA 1VBRA 1H0GA 4GBUA 4L1WA 3TJIA 3L68A 5BYWA 4GZ7A 3UVAA 5G5HB 3WQFA 1V3HA 2J3NA 3VUPA 1H0IA 3EWBX 3QLLA 4ZXOA 3W1AA 1PZ0A 4JD4A 4Y9AA 1E1EA 2J75A 1A0EA 5HJLA 2OSWA 1DQWA 4LGXA 2PDJA 2WCSA 3VDBA 1GETA 4ZMGA 2JIEA 4H50A 1JUKA 5U7SA 1YBQA 4PUDA 4QROA 3ICJA 3E38A 3IJQA 3ME3A 1D9EA 2YIHA 3TYCA 1ZENA 2V67A 2GR2A 1WXJA 4YHGA 5LGXA 1JDCA 4M6PA 1XFCA 2OCZA 3K1DA 2CC0A 4Y90A 1PYFA 2CFYA 1OQFA 4G2DA 3U48A 1V51A 3QR3A 5LNSA 2VFGA 1SMAA 4QXIA 3G6MA 1YEYA 4TVCA 3GU9A 1SYTA 4X63A 5CQ1A 4IXHA 1YTEA 3W1RA 2W61A 3FN9A 3SRDA 4OWGA 2O4QA 1PB0A 2J7CA 2X8HA 2Y88A 3S5ZA 1VF8A 4JFWA 1RQEA 3B9NA 5LNVA 5E9AA 4D1IA 2C91A 1R2SA 3PB2A 3A3XA 1ZP4A 2ZRVA 2VFDA 3T0DA 3PJTA 3TWBA 3AIEA 3O9NA 4O1AA 1GHSA 2PWUA 3L2IA 1CLKA 4IFKB 3UYIA 4LBUA 1E0VA 5KVHA 4KWSA 3ARRA 1IT0A 1SSGA 4M80A 1H51A 1SUXA 4BF9A 1VKFA 1E40A 4LVDA 1W2VA 4DVOA 1BYAA 1HVQA 3K4WA 3RRXA 3CL8A 1BKHA 3WELA 3TE9A 4UCGA 3ARZA 1PZ1A 3V5OA 3GU2A 4CU8A 4AU0A 2YOCA 3G22A 3VVGA 2DH3A 4AUBA 4YCOA 2ACSA 3UVIA 7ODCA 1J6PA 5EBAA 1LP6A 2XIJA 3I4EA 4O54A 2E1DA 1XCXA 2DZBA 3GFXA 2PRLA 2XSXA 2F7FA 3SCWA 3APYA 3TW6A 4A21A 2V3BA 1YNYA 2AGKA 4FLSA 3B8IA 3MMDA 1GTHA 4H2CA 3CV6A 3GBEA 3STCA 4N9DA 3BSGA 3EOUA 2HXTA 2NLYA 3ARXA 3MO7A 4WUIA 4TMBA 5FJOA 3FFSA 3RHGA 1PDYA 4JR5A 4O28A 3NZPA 3UWWA 1RJPA 3NVYB 3OLIA 1DJHA 3BZGA 4UUIA 3RILA 1YE6A 1M1BA 3LUTA 2QZRA 1KM2A 2B31A 3ZR6A 3PWIA 2OODA 3LPPA 2Z7KA 4BWLA 4Q7BA 1UOKA 1QO2A 2I57A 3HZ3A 3QQ0A 1ZY9A 1OINA 1DWAM 3W26A 3MYOA 3MBFA 4CQCA 3AJ7A 2GGGA 4P8UA 3GXDA 5F1VA 1EYWA 4GVHA 3G24A 4AMAA 1X8FA 2WSRA 4N6FA 4Q6XA 3IJLA 4H6QA 1H1ZA 4M24A 4H8UA 3FXGA 2EAWA 4GUFA 4H83A 3UFYA 4GQ0A 2GVEA 1IZCA 5F1UA 1RALA 3WNLA 2YCLA 3P80A 1IGSA 2Z25A 4HOXA 3VIPA 4PODA 1QK0A 5JBFA 4B2DD 5C54A 2O9TA 2R14A 3S6OA 2G8ZA 2Z2AA 4DYKA 5DT7A 3GH7A 2C71A 1OFQA 4HHPA 1FECA 2PDCA 1EF2A 1Y7VA 1LWIA 2F5ZA 1KFLA 3WKZA 2VWSA 1NFBA 3VGBA 2DT2A 4LQ1A 3IUIA 4H19A 3ETRB 3SCNA 4NU7A 4QTGA 5DFAA 4CCEA 1LBFA 1OZMA 2BG5A 3TAKA 1V02E 4K1GA 4EM4A 3AYSA 1F07A 4NKCA 7A3HA 2WM1A 5I3FA 3G1RA 4QNEA 3C0SA 3RR1A 3W71A 2X1TA 4LCRA 4C1NA 3S3GA 5EMLA 3LI0A 2PCEA 2WHJA 3GC2A 2QEZA 3C2FA 3GYEA 3NDZA 4UMBA 9RUBA 3GBDA 2WQDA 3GR7A 4WY0B 1VJIA 2EKGA 2CZDA 4LA1A 2HSAA 5KZDA 1DNCA 3SRKA 4ILSA 4BQ3A 3MW7A 1PIGA 4WIWA 2YBUA 1NP2A 1EWEA 4LS2A 4OV4A 4TXEA 1LLWA 2Y0FA 3CHVA 4YYCA 4TQTA 4CNPA 3HJEA 1MRAA 2BY1A 4H2HA 4UQ9A 4D71A 4O12A 3E12A 1E71M 3CIXA 3EAUA 2D3LA 4D8ZA 3LBOA 4NZ1A 2CZVA 2J8GA 2WMIB 4PUMA 3QY7A 2RDTA 1K9DA 3L0GA 3E0IA 4B5VA 2PDMA 2OU4A 3SI9A 1FFQA 5EB8A 1I45A 3H4WA 4GXMA 3CH9A 3EX2A 3ZLGA 3O6CA 1VFMA 1AW1A 1ZHAA 3WQGA 2AKZA 2VOTA 1PSCA 2DSKA 3RF9A 2Z1BA 3CK5A 4NAFA 4ATDA 4ORMA 1FHVA 4UOJA 1V0LA 1J5TA 1XW8A 2AQWA 1V6UA 1EJSC 3GZ3A 1EGVA 4BF7A 4F48A 3O63A 3ZR4A 1XYAA 1MMFA 3UGRA 4YLWA 5B80A 5HATA 1PZ2A 1UC5A 1TVNA 3GC4A 2X0YA 3WX7A 3T07A 2Q01A 2CYGA 3NRZB 2B7OA 3AOFA 2E8YA 2BY3A 3ITYA 1TTIA 3DK4A 2I5IA 2BX7A 3UU0A 3YPIA 1OM0A 3MWCA 3ORWA 1KM0A 4GG9A 3GIPA 4FHAA 3S6TA 3IWPA 3MTWA 2OO6A 1OK4A 4QIUA 4BA0A 1XYLA 1K7FA 5K9XA 1N5WC 3LCIA 3M07A 1X8CA 1TMHA 2BY0A 1R9XA 4BKNA 3M0VA 4Z1BA 4I5UA 1K02A 2JKEA 1PEZA 4K37A 4GE8A 4PBEA 4PUNA 4ZB5A 5I2UA 4E2OA 2YB1A 4WLCA 2OLHA 3H55A 1QT1A 3UP8A 2GGJA 1JVNA 1SJAA 3BSMA 3NEVA 4ZB2A 3N11A 3QHMA 4AWEA 1F3PA 4OGZA 1PX4A 5BCAA 5GJPA 1Z42A 3A9IA 1TTQA 4GJ1A 2YB4A 1V02A 3URAA 3EB2A 2V5JA 3CO8A 3UNTA 1EH9A 1O5XA 3LADA 1F8IA 2GH5A 4JN7A 2J4GA 3GNPA 1EO5A 3GVWA 2DQWA 3AIWA 3KL5A 4L9ZA 2GR1A 5CLTA 3VGHA 3AUJA 3B8VA 4UFJA 3A9BA 1QNOA 1ENUA 1XF0A 3LBMA 1FH9A 1TB3A 3V16A 4AZIA 3L4XA 2C8NA 1ISWA 2BOEX 3EAOA 4LSBA 2DSVA 3W73A 5HBFA 3B0XA 3B0UX 4EACA 3LCHA 1OVDA 5D30A 1WAWA 1U2YA 3QMTA 4RDYA 4WRHA 1LDCA 4X0NA 5HNUA 1ITXA 1J79A 1G01A 4B4FA 1SFLA 3RK8A 2A79A 3QN3A 1ZBKA 3BLFA 3TCEA 1FCVA 1XIEA 2XYLA 2YL8A 3NGJA 1GONA 1W5NA 4LCSA 3MZNA 3W87A 4PMUA 1Q6RA 1AW2A 4YXGA 4RZ5A 1AD4A 4DZ5A 4U4MA 4G5DA 5D02A 2XM1A 3PR2A 2E1WA 2FYMA 4K8DA 1NVMA 3DHFA 1Q6DA 1AFSA 1IIHA 3B9EA 4JTQA 3W25A 3GZAA 5E93A 3BO9A 3BWWA 3I7SA 2HEJA 4CNSA 1POJA 1WV2A 2YR1A 3STEA 1LRQA 3MJYA 4FNUA 3NDYA 3PBVA 2XN1A 1KRCC 2IW0A 1TPDA 2WCGA 3AXIA 6A3HA 2PSNA 1OX4B 4GY7A 3IJIA 3WUEA 3ITCA 1B9ZA 1B5TA 3CUXA 1VLWA 2RDWA 4MJZA 1N61C 1QW9A 3EX4A 4DUVA 4H41A 3W83A 1AOGA 5H2ZA 2PLKA 4XAFA 4MUZA 1CWYA 1TZ7A 1OIMA 2J7BA 1CI1A 4AC7C 1RHCA 1NDZA 3T78A 2VI0A 4HVXA 3KRUA 3QYSA 1CGXA 4NJGA 3KX6A 3W4RA 2QCFA 3NYZA 3S9IA 4NZ3A 2VZUA 3AO0A 4DHGA 2C16A 2Y4SA 5AYYA 4FOKA 1TJ0A 2VEMA 3GAKA 3UWEA 3UA3A 2W62A 4EK7A 1SMDA 1WO2A 1V5XA 2MANA 1MFVA 4MLJA 2INZA 3RM9A 4JTEA 3QV7A 3FA5A 1NF0A 1Q65A 3DERA 3LCWA 4H3DA 3S2MA 1EOMA 1OADA 4MM1A 3ANYA 2PI6A 3F2BA 1RQHA 4BI6A 2E6YA 1V4YA 1GRAA 1SFTA 3BGGA 4GUIA 3AHXA 4D6IA 1CGWA 2ZZ4A 2CHNA 1VQZA 3BAKA 1VFFA 2WSKA 5AN7A 4PN2A 3BAJA 2G4FA 3C2VA 2DU2A 3TW9A 1S3HA 3WSUA 1Z8AA 4AZGA 4C6MA 2YDQA 1VR6A 3VGGA 1W2PA 3HGRA 4M7TA 1H7NA 4J28A 3EPMA 5BRPA 1TRIA 2W3SA 4H7CA 1TV7A 4QE1A 4L80A 4YTUA 1UZHA 1TWSA 2QAFA 1GZJA 4HGXA 3VIMA 3WJXA 3CWHA 1LG1A 1J93A 1S2CA 3WQ6A 3PZGA 3A23A 3VKJA 4PMRA 4RV3A 3T8QA 2JQXA 2DH2A 4Y9OA 3RIKA 1AZ2A 4YTSA 3V1HA 2X16A 2E28A 3QPEA 3LM7A 3VMOA 1GYNA 3XINA 3KVKA 4JTRA 1IXPA 4LH8A 2TPRA 4TO8A 5FJPA 1MEHA 4PGLA 3AIUA 3VXGA 2TSYA 4JIRA 4D6EA 3V7PA 3N1AA 1F6PA 1WX0A 4GYPC 3THQA 4LS1A 4I9TA 3AXHA 4JYFA 2V38A 3L4WA 3ITTA 4IWWA 1H50A 3N9KA 3PVFA 1UBPC 1VIZA 5C8BB 5TR3A 3QTGA 4DF2A 1XDIA 2YW3A 4G56A 2PFHA 2WZIA 1CXFA 1ZKQA 1RBOB 2I5GA 3DJJA 2XHYA 1F05A 1BHGA 2PDLA 1ME9A 2PD5A 3TSBA 2BXZA 1QNPA 2X7VA 4UTHA 5MHBA 4KEUA 4H6RA 1XIGA 1F3XA 1NOFA 3CL7A 2DVXA 3H7UA 4NG3A 3DZ1A 2V5KA 3M44A 4MKSA 3WH7A 3GNRA 1P4CA 3HBLA 3EWDA 1OYCA 4FMVA 4ZQNA 4I6KA 2FHFA 4F9JA 4LPCA 5G4EA 3U5UA 5GJMA 3DXIA 3IV3A 1T3QC 4YTTA 3W7HA 2IXUA 3UJRA 3SADA 4NI8A 1JJKA 2HCVA 4AZCA 3SAZA 2OKOA 2CLOA 4LXFA 3FYOA 4FF7A 2OQHA 3BPWA 4S3FA 4I9MA 1TV5A 1GWJA 2YFOA 3JRKA 3SFWA 5EYWA 4HZ8A 5HMFA 1XDJA 2GRTA 1DEDA 5XIMA 2QCNA 4UFLA 2RABA 5FJRA 3O8AA 1J2WA 1PTAA 2NUYA 1Q8AA 4D6CA 1E4MM 3RAOA 3LQLA 3W7KA 2EQ6A 2VX4A 3GC5A 2PDPA 3THCA 4MZ8A 4YWSA 1TIWA 2YXGA 2Z27A 1Q6FA 3MP5A 3WLKX 1OSEA 2G4JA 4XISA 4M1BA 3JU2A 4NZCA 4XD4A 1XLLA 1TJ2A 3LHUA 1K77A 2VC7A 1IEVA 4ZOAA 5DQPA 5AYIA 3M7WA 3EWWA 2KX9A 2PWGA 1WDDA 3M5YA 1HJVA 3ALFA 1AQHA 1K6WA 1OBAA 3H2AA 1VYSX 3BCJA 2Z2BA 1NPXA 1VHNA 1P0BA 1X6UA 4CQDA 2QCCA 3W70A 4A3HA 3PNUA 2ZXBA 4XKYB 3BMVA 2VCCA 2F6UA 1S38A 3GG8A 3DFTA 1NDYA 3OJGA 1NOWA 4XUGA 3EPOA 3EB4A 3PUDA 5FACA 4PUKA 5JH1A 5LIUX 3ZT7A 4EWJA 2DUXA 2DZVA 1OC7A 3ARYA 1S5NA 3QOKA 4IL0A 3T4WA 3TC6A 2W92A 4PTXA 3VKKA 1XH2A 1QPRA 1KM3A 1UD8A 3LY0A 4F4RA 1G94A 3GO2A 3NPUA 3L4UA 4UTFA 2R94A 4H9UA 2VP8A 4UB9A 3NCOA 3S9ZA 4QG6A 1T8QA 2UY4A 2XIOA 4GQGA 5EKYA 4K8EA 1M7XA 3NSNA 1YDOA 1KR0A 2FGZA 3M46A 4Q8UA 4K3ZA 2UY5A 3GXTA 3I3BA 4F3HA 1KRBC 2VFEA 1UD4A 4UXDA 3SFKA 3V1PA 1V3KA 1S3TC 4J2MA 3TJLA 2E0PA 4L5ZA 1PXGA 2J77A 2NWSA 1BQCA 1G7VA 1S2UA 1P7TB 1AJZA 3SUWA 3MP3A 4IFKA 3APGA 1RR2A 4R88A 1CEOA 1TX2A 2OG9A 2QJIA 3CM4A 2ASHA 1RXOB 4BI5A 4O57A 4GX9A 3EOLA 3WH6A 3NQVA 1AH3A 3GTIA 3TNBA 4IIHA 4MFEA 4XO7A 1YHTA 3GNDA 3VIFA 2G0WA 2J6VA 4B3KA 2ZX9A 4R33A 3G8RA 3GVRA 1TVLA 3OVRA 4J3XA 1ZAJA 3C5QA 2Z00A 3M0KA 4H8VA 1C92A 3WFLA 4AEEA 2NQ5A 5LIXX 5F4WA 1VJZA 4WQ6A 1D7KA 4U31A 3KWSA 1J2BA 4W5UA 2I17A 3MSRA 3N6QA 4YS1A 4GVFA 1QHPA 5EU9A 1POKA 1NF7A 3TQVA 4HOZA 4IOTA 3ANVA 2ATSA 2NQHA 5HQEA 3RJXA 3NPXA 1UH2A 1BSLA 3TFCA 1RVKA 2YCEA 5IHSA 3RN6A 3GR8A 4M5PA 3ITVA 1KFWA 4Z17A 1KB3A 2O7SA 4FI4A 4C6PA 2WVTA 2V3GA 1TO3A 2W6RA 5AC8A 2ZXDA 1W17A 2JF6A 1OCNA 1BPLB 4BQ5A 4TIMA 1IEXA 1HO4A 1YTDA 3M0HA 3QGKC 4TMCA 7TIMA 2E40A 2PRMA 2UWFA 5XINA 1VYRA 2DJLA 1XL9A 5HQMA 1DORA 4MAZA 5E9XA 1QK2A 2EG8A 5F2GA 5FSDC 1U22A 2NV1A 5KETA 4B5UA 4RZBA 3QZ6A 2HK1A 4HSHA 1ZZMA 1PIFA 3N18A 3VNIA 3L4TA 4LU0A 3DAQA 1C8VA 4CQ9A 5CBBA 3EYPA 3W7NA 1NHRA 3MHUA 3BLKA 1H4PA 3IGUA 3XISA 4R85A 4S2CA 1Q3NA 4JX4A 3H8AA 4H7ZA 5FESA 4PRTA 3W2LA 3BQ5A 4Q22A 4B3ZA 1D7YA 3AMCA 3EDDA 3QVQA 3W27A 1X1NA 4DIAA 4LAOA 4GNKB 1MXSA 3KBSA 1EUAA 1DJZA 5E0FA 3ALGA 3W7OA 2Z6IA 2CWXA 4PULA 5FJUA 1CZ1A 4K7VA 3CL6A 1FBAA 3WFZA 1CPUA 2HQAA 3GDBA 4YTRA 1EIXA 4PB4A 1I2NA 3MCMA 4LVAA 1T8XA 3T0BA 4AVFA 4MY9A 1XYFA 5CC3A 2QMJA 1FDYA 3PZTA 3COTA 4MNMA 3CQHA 3UR2A 4DX3A 5M5DA 1TPC1 3TYAA 3CZLA 1STZA 3NZRA 2EPMX 5BZAA 4ICCX 4AIUA 1S39A 1TPH1 4XB3A 5J04A 2X1SA 3VOJA 1BVZA 5JU6A 8A3HA 4FALA 1RBLA 4JNZA 3FYYA 3DG6A 3F4DA 4B5NA 4ZENA 2QGHA 2Y7GA 1TPWA 4XVDA 4DJDC 2FZNA 2WMIA 5CPNA 3TC7A 2X8GA 1KXVA 4V1XA 3NXFA 2BC1A 1K9EA 4Q3MA 2WNZA 5HUOA 4LAMA 3VKAA 3T05A 5LHEA 2BXYA 1JPIA 1DP0A 5H1WA 1A49A 1ITQA 3QV8A 5ABTA 5C9UA 4TTGA 2GJNA 3QC3A 3UERA 4MNJA 4AY1A 1HKVA 4MWAC 3VABA 4Q8QA 4V33A 3WQPA 1R87A 1XX1A 1NARA 1V6YA 2V2CA 4E2DA 3LK6A 3IANA 3S2CA 3PUEA 1JXJA 1QI2A 4WDWA 1K7EA 5A2AA 3H2FA 4WEVX 3AYTA 3ABRA 4CQ8A 4H8HA 4DWSB 1XG4A 2CW6A 5DXYA 3EA3A 5JQ9A 3PZIA 3M47A 2ZTKA 4IICA 5FF2A 2J47A 4QAIA 3U2OA 2V5BA 1LZOA 3NOEA 2QAPA 3HPXA 3STPA 3B9OA 5C7HA 1JRBA 5HUPA 3MKCA 3LCLA 1HF6A 1I2RA 4GY1A 1WOAA 4Z2IA 3WIJA 5TQLA 1FHDA 3DFPA 4HTYA 4C65A 1A5KC 1WZAA 1LPFA 1V0KA 2VURA 3FEMA 2VTFA 3NGFA 4D6JA 4AAJA 1TZ9A 4DUOA 4PMNA 3S6DA 4ZO8A 3L23A 4OT7A 3CJPA 4JN8A 2NQ9A 2JEPA 4C5ZA 3RU6A 2X99A 5DMMA 3UWQA 3N15A 3E2QA 4DZAA 3B3DA 3BLIA 3GH4A 3W76A 1HT6A 5AC4A 4WDUA 1Q85A 2FHBA 1W37A 1J0ZA 1JPHA 1DL3A 3QY6A 1UASA 1YADA 3CYJA 3MCNA 2JFEX 2FJKA 2XUCA 5I3IA 1LQ0A 1UA7A 3R25A 4UNIA 3V3WA 1CB2A 2ZFAA 1GOKA 1GRGA 2YVFA 3B8TA 4RE0A 3K5XA 5A8MA 4E8CA 2RAGA 4CD5A 3SJ3A 5AC7A 4HZ6A 5LNRA 3PJXA 1UR0A 3CMGA 3QPZA 4Q4OA 3NL3A 3G1FA 5F4SA 3RJYA 5A8QA 3E9AA 2DSUA 3BLDA 1S7MA 4H9YA 1A5SA 2F38A 3LG3A 5LYRA 2VCBA 4B90A 2D20A 3KEHA 3U5YA 3B9AA 1PYMA 2DY3A 3THDA 2VYOA 3MDUA 5A6AA 4MF4A 3EZ4A 3WN6A 1DQUA 3KS6A 3GY1A 4D9PA 3O6AA 2VD9A 3OZPA 4ZZ9A 4ZODA 2X1IA 3Q45A 3GTXA 3TLQA 3SRFA 4WXZA 5TD4A 1EEPA 1XGDA 5FL1A 2BHUA 1ZJIA 2RH9A 2C6QA 4TVDA 3NFUA 1EDQA 4TV5A 3SEPA 2IPFA 4G7EB 4FNSA 4KWWA 4Q6JA 1UKOA 4OTKA 1BRLB 4HD5A 4U3CA 3WH9A 1GNXA 1QPNA 1P1XA 2HK0A 4F0KA 3OO2A 3SN4A 3IAQA 3ARUA 1SO3A 4OE7A 1UB3A 1RJQA 3FCPA 1XRSA 4J3ZA 4W7UA 4RV8A 5BW6A 5GVJA 4HNUA 3SW6A 1Q7QA 3KCOA 2G96A 1SO4A 4GC4A 1REQB 3AWOA 5GJNA 2XIIA 1BVNP 2CZEA 1TWZA 1HKJA 1SSDA 1NHPA 3OQEA 2VT0A 1OX4A 4ZOHB 1W56A 1A5OC 1VS1A 2GJPA 1D8CA 1GRHA 1B3YA 3UCDA 3DFHA 2D22A 3PBMA 3TN3A 4JKLA 2GJLA 3O3RA 3EWXA 5D9PA 3O1NA 5CJNA 3L8KA 3VD7A 1Q6CA 4K2SA 1BYDA 1EX5A 1UUQA 1R3TA 1XXXA 1C9DA 1AQFA 1MW1A 2X41A 4W89A 3NZGA 3GVGA 1JCXA 1B57A 3EWZA 4RLIA 3WLOA 3CMFA 5EL1A 2OLSA 2D0GA 1L2UA 5DCEA 4GI8A 4HZMA 4NAEB 1R3VA 2EJAA 4XX6A 2NV2A 2PE4A 4FX6M 7CGTA 1CCWB 4DELA 1JD9A 1Q5MA 4RE3A 3GTNA 4IGHA 3PSVA 3CNYA 1A53A 1UIPA 3D47A 1N7KA 1CBGA 1CGYA 3W1TA 2VGGA 1UUMA 1RUSA 2ZYFA 3AS2A 1YDNA 4S1FA 2X8CA 1G9HA 3MUY1 4HCLA 3SM0A 5BWFA 2OKTA 5HJYA 2X42A 2XGBA 4E3TA 3AS1A 3LPFA 2ACRA 1JAKA 1A5LC 1XPGA 3MY9A 2ABAA 4XZIA 3B0VC 4RPQA 3IC9A 2Y6ZA 3W38A 4LFYA 4QJ5B 5J5DA 4QEHA 4JQ9A 3AM9A 5G2IA 3VC5A 4J9JA 5C55A 4MB4A 3CUIA 1JXKA 2WYSA 4Q4SA 3A4AA 2CLFA 1XINA 4ZQMA 3VDGA 4B5TA 1GCYA 3I3DA 1UR4A 3U4FA 5IDIA 2VRQA 1CB7B 2X30A 1GG1A 2EEXA 5K9DA 1G4PA 1QNRA 4NNCA 4J27A 4DBEA 1IR2A 5D8ZA 1EBGA 1N62C 4J56A 3GNXA 5HNNA 4Q8VA 1PJ9A 2PDIA 3BK0A 7ENLA 5IBXC 1YNQA 5EY5A 2X1RA 1EA0A 5ABFB 5JUVA 4UTWA 3SQPA 1SJCA 3EKZA 3EUB3 1I1XA 4FPSA 1EP2A 4L61A 2BOGX 1GW9A 4ACYA 4ADUA 3MHFA 1XD1A 3EWCA 2QUVA 2G50A 2Y8UA 1E4LA 3IIPA 3THUA 3PZOA 4MB3A 2V63A 3CHEA 1EDGA 5I78A 3T8LA 4DB7A 5BMWA 3CB3A 4I6VA 3RGTA 4H4TA 1TJRA 4KWUA 2OEMA 4C7FA 4RZ6A 4KRZA 3KDOA 3VI2A 2QJMA 4IJRA 1US0A 4KEZA 2GOKA 5I06A 4JFSA 5IFTA 3DGHA 3BCFA 3WQEA 3UD6A 4JGDA 1S5TA 4IPLA 2PU1A 1PUDA 1FDJA 2F2KA 3FEQA 4A2SA 3C4UA 1O60A 3RLUA 2V0TA 3DX5A 1PBGA 1GKPA 2J78A 4JIEA 1XC6A 2BCPA 1G1YA 1QNVA 4C1LA 4L6OA 2HS8A 1UIOA 2GVJA 1M03A 3A3HA 1NP0A 1X7IA 3P0XA 4HSNA 5BWAA 3PC0A 1MO0A 1QWGA 4PCPA 1XLJA 2WKJA 1TJPA 2EQ7A 2OYMA 1EHAA 5AC5A 2VZVA 3KOYA 3E49A 1KQYA 4X0VA 5FF0A 2HS6A 4GRTA 3HFTA 3L4ZA 4J3UA 3QFAA 3I10A 3FJLA 2HXUA 5A8NA 3NPVA 1EP3A 6REQB 3W29A 3PUGA 1TX0A 5FS6A 3PTDA 5U4NA 2J24A 4XSMA 1DYSA 4L4OA 3E2SA 3EPNA 2NXIA 3JR2A 3AIVA 4AHOA 3CAVA 1WUEA 2Y5SA 3K8MA 3DK9A 4Q4MA 3W82A 2GLKA 3N2MA 2XN2A 4GNVA 3KLJA 2Z1VA 5ABHA 1BD0A 5D05A 3RPTA 4CVWA 3TEVA 2GK1B 1DJYA 2GQ9A 4UQBA 3R2GA 3UXDA 3II1A 5BOOA 1GOQA 2PGFA 4PCNA 4TV6A 3DYPA 4Q4KA 2P3ZA 2BV9A 3L67A 1HG3A 3W00A 4BV6A 4PCFA 1UZDA 4KQNA 1SM9A 1YTKA 4O1EA 2V6AA 3EF6A 4QSHA 3M0XA 4ACZA 1NDVA 4GQQA 2WOVA 1F2JA 5D9NA 1DQXA 1W1B1 5DRCA 3W2NA 2DIEA 3W0KA 4FX9A 1KXTA 2WWDA 4U28A 4WOZA 3LGGA 1G4SA 4PMZA 2A8XA 3CLMA 3CEPA 3S1UA 1MDLA 4E0CA 3N29A 1VYPX 4XKYA 4GABA 5KVIA 1S2AA 4GUGA 3A12A 2RJGA 3TLLA 2YDRA 3FW6A 3B0YA 3BLPX 4EQWA 1KFCA 4US5A 4QITA 4Y8FA 3R89A 5HDRA 1EFZA 2HPIA 1W3IA 3EOOA 4LY8A 1VGAA 3EA1A 4B5XA 3WQCA 4O1FA 1UD2A 5CAKA 2ZX8A 3WEOA 2VR4A 3GDRA 8CGTA 4GD0A 1NFGA 3ABZA 4NJIA 3CASA 2OO0A 4ZTXA 4EXAA 4R7JA 2BDQA 5FJIA 4BEQA 4XWUA 1JRCA 1SR0A 4DUWA 3WD1A 2F6KA 3T9PA 3VZZA 3TTEA 3ITOA 1BKSA 4S38A 1KKRA 3EX1A 1O12A 3RX2A 4YVPA 1V08A 2FH6A 5CC7A 4DJEA 1W9VA 3Q37A 4QDPA 3CEUA 4LEFA 4J5NA 1AJ0A 1UKSA 3N4AA 1GRBA 2QPXA 2J7GA 4LIIA 2QCDB 3LYEA 4Y9NA 4Z2KA 3F2DA 3QGAC 5A1AA 2J74A 3SCSA 1V0MA 1H7PA 1US3A 4JQ2A 3OZMA 4WJ8A 1P7TA 1GJPA 4EPKA 4IG2B 3TMLA 1FH7A 2ZZBA 3GHSA 3ZO9A 1P1MA 3AIRA 3BLLA 1KXQA 1YIXA 4HZ7A 3BZJA 1FHUA 1OFPA 4O19A 3BJTA 4J3SA 1UR8A 3H26A 1KW1A 1SJDA 1QI5A 4IP4A 4GGHA 1KM4A 1BF6A 4Z42C 4G8TA 4HPJA 2PC4A 2O56A 2Q8LA 4HJWA 3DIPA 1GRTA 3VZYA 5LA1A 4H4VA 2ZUUA 5DBUA 4U3AA 3TOYA 2PBGA 3WYZA 3EDKA 2HE5A 2XIQA 1VZWA 1ZNNA 2V82A 3N04A 4DF0A 2ON3A 3WK2A 3WF3A 2NXGA 1BWLA 4BI7A 3C0JA 1ZUAX 1DWGM 3U2EA 2OWXA 2ZUVA 1WZLA 1KN0A 1JCYA 4XBKA 5D2YA 4OHQA 3W1MA 3MKKA 4GI4A 3AI0A 3KL3A 4FXRA 2HQMA 2OPJA 4JN6A 2O9RA 2B7QA 2D23A 4DBWA 2BLEA 1XCWA 3F5KA 1Z69A 1I2PA 2G37A 3N3MA 3OHMB 3S5SA 3WMLA 4AX6A 2REQB 3JZUA 3LLDA 3MSYA 4AD4A 2Z26A 4K7ZA 4I90A 3W07A 2V6OA 2VUNA 3FY1A 2PF8A 3MSGA 1MUWA 4GY0A 1CNVA 1GG0A 4NUWA 3K46A 3CZGA 4GI6A 3RITA 3WNNA 5LXXA 2H3BA 2PMQA 1JDFA 3WLMA 3RO8A 3UGVA 4H9MA 1R7AA 3WQ8A 3H2NA 3W2UA 5IRPA 3QY8A 1QW8A 1KTBA 2WZEA 1WUFA 1Q4WA 1PTGA 4ZOEA 4C6BA 1TE1A 3BXWA 1I60A 2D24A 3HPSA 4HB7A 3ZFHA 2RGMA 1ZQ5A 2P8CA 3PTQA 1DJQA 1TMLA 1ZRQA 3UR8A 5CBJA 4BWLC 3LX9A 3GVQA 1OABA 3T0AA 3P5ZA 1ZTVA 2QIIA 3HA1A 3FVDA 3FAXA 1XQKA 4KWVA 1W54A 1X2HA 2XVPA 3UQNA 3GWQA 3LCXA 3HGJA 3GTFA 3R11A 3LN3A 3GK0A 1OCJA 3VPLA 2F9RA 2WPBA 4CEXC 3UG5A 3KHJA 2FLIA 1EPVA 1ZX9A 1K6AA 1U5VA 2XFRA 4R9XA 1PAMA 3NXLA 1M68A 3QKZA 1ADDA 1FWCC 2FKPA 1ZDLA 3CZ8A 2QF7A 3OLDA 4XUYA 2QXWA 1ZJHA 3DDMA 1HJWA 3JZEA 1MYRA 3WCZA 1C8QA 3A6OA 1WXZA 1ZB5A 3MU7A 1R3SA 2O92A 3W7IA 5C70A 1JZ3A 4XZHA 3HPZA 3IV8A 1QRQA 1E6PA 4MPKA 1F73A 3QHNA 2NQJA 3WJZA 2HE8A 4V15A 3ECQA 1JF6A 5I02A 3G1AA 4NXKA 2PDYA 5LA0A 1W5MA 1E5NA 5F4XA 1W3LA 5H6HA 4PEKA 1MQPA 4F8XA 4ML9A 3JW7A 3U7BA 1FY6A 1O4UA 3HU7A 2Y63A 1FWFC 1ZBVA 2GVGA 3HG3A 5LZLA 3PG8A 4KETA 2OVLA 3W84A 2NQLA 2QUTA 2C15A 3GDKA 2P1FA 5I3DA 2DGAA 3FLUA 2FIQA 3LHWA 4DWSA 1RCXB 4K8HA 4KEVA 5KITA 2JGQA 4FZIA 4US5D 4G1NA 4MJ2A 5CSSA 1OD0A 2H3DA 5HR6A 3FK4A 4KPRA 3DBNA 4F9DA 1SZRA 3FS2A 3IJ7A 1BVWA 2R1MA 2C79A 4A05A 1MEWA 1OYAA 3U0HA 3TA9A 2WSQA 5HA7A 4CU6A 5CPMA 1LQAA 4PB5A 4FS9A 1NELA 4OV9A 4UFMA 4A4AA 4RXGA 3P3BA 4H4PA 1GVFA 3GE7A 2BVWA 2Z0IA 5AZ1A 3T0CA 4AYGA 1UD5A 3DFQA 3VNKA 4OOZA 5FEXA 4GISA 3T2PA 4HKPA 1D2KA 4V27A 4JIHA 1CLVA 5CG7A 3RDKA 4DJED 1R85A 2Z1KA 3C52A 3PZ9A 1RCQA 4MIMA 3RM8A 1F7BA 1W1PA 5FS7A 2V2DA 4BY3A 5EFDA 1V0NA 1QR7A 1ODZA 1JNEA 2YPIA 1YYAA 1IXNA 1GEQA 3WLSA 2NVKX 5HANA 3PP7A 3R58A 2FGBA 3USZA 1ECQA 5HMDA 3UG4A 3CPGA 4L7ZA 3WK0A 2BTMA 3B9JB 4EQSA 4HSOA 2ZZCA 4H00A 2FTPA 2H9AB 3ITXA 2NXHA 4M51A 3S5NA 1IXOA 3FG2P 4EM3A 5ENLA 4FOJA 4GK8A 3NQAA 4WGHA 5D2VA 4DYEA 1LBLA 3NZQA 1YKWA 3I68A 4EE9A 3SCVA 4M1RA 1EIBA 3KVMA 4GKTA 4AD1A 3ES8A 1RY0A 3DN5A 2QQ6A 1ISZA 3O0KA 1KRMA 2CXGA 5BNKA 3DUGA 1WDSA 4BJHA 1I2QA 4FA3A 3F7JA 3VK5A 3O05A 1QVBA 3QM3A 1PL9A 3IJDA 4RJEA 4MZ1A 2JIWA 2WXDM 5RUBA 2QDDA 3N4EA 4J1OA 4MDPA 4FNTA 4PMVA 4WD0A 3ZVHB 4LYQA 1G4TA 5D2TA 4CD8A 3NSXA 1W9PA 2QUMA 2GJRA 4JOMA 3URNA 4HNVA 1GT8A 4G7EA 4GHRA 1GYMA 4C6OA 3HV9A 1BRLA 1SFSA 3OPSA 4RL3A 3IGXA 4C6IA 4UOQA 1C8YA 3ZJKA 3EXTA 2PCQA 1PTDA 2VMFA 4NEVA 4HU0A 3UCQA 5M17A 3WENA 4O17A 4FIQA 2BSLA 1H49A 1REQA 3ANUA 4NYYA 3WH5A 4XKMA 2ZCGA 1GYLA 3P82A 2GDQA 2A85A 4H1ZA 3WD0A 3GVVA 1LLOA 4IZGA 4WX2A 4KCTA 5DF0A 2YL6A 1EF3A 1QASA 2E5CA 1E73M 1YDYA 4U33A 3G1SA 1KLZA 1LL7A 2WWCA 2L5HA 2DORA 1VRDA 4L64A 1XFBA 2FPVA 3DU0A 1V6XA 1N5XA 2D73A 1WDWA 3NVDA 3AJXA 3REQB 2GYIA 4JCMA 3PBWA 1W1IE 3TJXA 1BYBA 4NAEA 3CQIA 1KBLA 4E4PA 1XLKA 3MYPA 3F4WA 2VD8A 4Z2JA 4GNJA 1WZMA 1E6NA 4O1CA 4H4QA 4CGTA 2WBAA 1OZQA 4LAZA 1IWAA 1MI3A 3GHRA 4JEQA 4CD6A 3W1LA 2WANA 4MGGA 4LWWA 2PZNA 1GOIA 3VKCA 1ALDA 2BC0A 1ZAIA 3AALA 5CJMA 1VRXA 4HA3A 4E3VA 3DFYA 3E3HA 3F4NA 3OOQA 3R07C 1M53A 4M81A 1SZNA 2EJ1A 2DUZA 4GACA 3EBVA 1M04A 1A80A 4JY9A 1L6FA 5LIWX 1IIGA 4ZO9A 2W54A 3BL3A 5I6SA 1EZ2A 2ZX6A 3WMSA 3O0FA 1RD5A 1ICPA 1XBYA 2P53A 3WQDA 2IKHA 1KR1A 3TDFA 2XVNA 2XZ7A 1UPPA 4MJMA 2OX4A 1EGMA 4S3GA 2J66A 1HZYA 4ZTYA 2YXOA 3M6DA 2C0HA 1HJXA 3QTPA 1QAPA 1J9YA 3T2QA 3KBJA 3VGDA 4L65A 3WF2A 1XRFA 1RQBA 2C13A 5FKYA 1FQ0A 5ABFA 1NTHA 3TQPA 3NTYA 3GH5A 2W27A 4P61A 1RK6A 2PP0A 5EPDA 3BTNA 4ONVA 1US2A 3TQ0A 4ADWA 2CLEA 4DWSD 1GPWA 2EXOA 2CEQA 3S42A 6XIMA 2WQPA 1A4MA 4TVYA 2TODA 2OELA 3KZPA 4JFVA 1Z89A 3IUHA 4S23A 1Q6GA 2ESCA 3KCLA 2CZFA 1NQKA 3WUFA 5AECA 4HYRA 3KDNA 1GTEA 3VOGA 2CDUA 3A4XA 4H01A 3P61A 2P0IA 3C8FA 1E15A 3W72A 1F8MA 3GQYA 5LIYX 4R5EA 1W3HA 1PE1A 3HW2A 3PZUA 2ZRZA 3OIHA 2CZ5A 1HIZA 2GR0A 1H7XA 1ONFA 2AKMA 1X97A 3AIBA 2YCJA 4BZYA 3L66A 9XIAA 3UESA 3O6DA 1XPYA 3URHA 2CCRA 3LZ3A 1KA9F 5HK4A 2AAMA 4AX7A 3OZOA 4Q33A 5C9ZA 1F61A 2BHYA 3BOLA 4XG1A 1FOBA 1TTJA 3ZQ9A 3L4VA 3GXIA 4YMZA 3TZNA 5EBUA 1ZL1A 2DZSA 3W9ZA 2DZXA 4RZ4A 4AWTA 2IXVA 4AZ7A 4X3ZA 1S2TA 3GUWA 4A3QA 3FYPA 3NQ8A 5I03A 3O07A 2EPLX 2EQ9A 3H4XA 4I7UA 4B5SA 3QR0A 3ZJ8A 6REQA 4WJEA 2PLMA 1GVRA 3DECA 3VKBA 1EUNA 3TTYA 4CU7A 3LCFA 3P74A 3NQ6A 5AY7A 4AEFA 1T96A 2YL5A 2J8TA 2PDKA 4UTUA 4JHZA 1GOXA 3W7GA 3T42A 1X2GA 1F3WA 3W6YA 5DEZA 2GK1A 4FOUA 4EPDC 4OUEA 3CB8A 3WEMA 2ZXQA 3UWZA 3BV4A 2BGQA 4LF2A 1RZMA 3DG3A 3G0XA 4QX4A 4EXQA 4AIOA 1FFRA 2R1PA 4LUIA 3QFWA 3TIMA 2VFFA 5JCKA 3AMZA 2BZNA 3EDJA 2VEIA 1KGWA 1JUEA 4OBSA 4UIOA 1PKYA 5REQB 3MI2A 3UR5A 4AD2A 3U3HA 3SY1A 3W74A 3KP1A 3Q2DA 1C93A 3TU9A 5BU6A 1RA5A 4GH1A 3AN1A 3S2JA 5H8PA 2DSZA 4DJFA 4QR6A 1ZLPA 3TYDA 3W1PA 3VTRA 3KCJA 2ALDA 2BNJA 4LRTA 3R6IA 2WKLA 2WVSA 1P6CA 3LLXA 2PTDA 3E0WA 1B0IA 2JBMA 1TYTA 1YW1A 2QVNA 2O4MA 4QM1A 1V6TA 1QPQA 1CX9A 3UJSA 3NUKA 3MVTA 3TN6A 3VX1A 1O7AA 5CKSA 3P2VA 4QRNA 1BF2A 1U5JA 3H70A 1JPKA 1XUZA 4NP7A 1K9TA 1T0OA 2DSWA 2GWNA 4PMYA 3IAPA 2GQ8A 4HPNA 1PS9A 3JUGA 1KBJA 1FWDC 3KTCA 2I9EA 2C3CA 5HPCA 2OQYA 1ZJAA 2Y5EA 2Y7EA 1U1HA 3DGRA 1EHNA 3ZSSA 5CSUA 1W31A 3MB9A 3QZAA 2C19A 4AWUA 3W7PA 3B4YA 2WNNA 1O6IA 1D3HA 3B06A 5TBOA 4QNWA 3WG6A 3HTWA 2J6XA 1HJSA 2QCDA 4K68A 4ZQOA 5I7GA 4Q8PA 4WK9A 4OIFA 5C2GA 4UMCA 3GNOA 2DZPA 1O1HA 1BGAA 4NJKA 2VFIA 2X0HA 3EEGA 3PFRA 3KBWA 4IG2A 5LA2A 2IPWA 1WDRA 3AMDA 2QNEA 1GVSA 3PTKA 3ZJ7A 3P60A 3SGUA 1IZJA 2Q6ZA 2A7RA 2G3JA 1JCLA 2Q09A 3KBMA 1UWUA 4RNIA 3SJNA 4UBPC 2G97A 3LENA 2PTZA 5AZ0A 3GDTA 3GDLA 3VIGA 1XYCA 5CAHA 5F2IA 2E77A 3C0LA 4F0RA 5FEPA 3M4HA 4PMQA 2PGRA 4EAYA 3AS0A 1GVIA 4RKAA 3WF4A 3LSBA 1K7XA 1D3GA 3RNDA 3B97A 4Q7NA 4MVAA 3O06A 4W7VA 5DX7A 4R3UA 4IJBA 2PDQA 1FO4A 1AODA 1QI4A 5FF3A 3QQWA 4RW3A 4O53A 3OP2A 1FIQB 1HUVA 2WAGA 1S1RA 2GSHA 1V7YA 3BC9A 3SIMA 4H4UA 2IKGA 4C6CA 1R3RA 2Y2WA 4EOUA 6TAAA 4IIFA 1H7OA 4PUUA 1H6VA 5T8GA 1L6SA 2HZGA 2IPJA 4MB5A 1ONEA 2G41A 2PUZA 5AYXA 4AZ6A 3DCPA 1ISYA 2WCAA 1MUCA 3W02A 2QV5A 3OBEA 3AUOA 4CD7A 2VGBA 4K38A 3CYVA 4KT2A 4E8DA 1QHOA 3CAQA 2QUNA 4MKVA 3KOXA 3TTQA 3W7JA 5CEWA 3CUFA 5GPRA 2PRHA 1JD7A 2A3AA 4GX8A 3VILA 1Z9AA 3O15A 1JEZA 4IGMA 2GFTA 2HBXA 5C2CA 3RMEA 4X2PA 4C1KA 4PRRA 3CXBA 1TR1A 4GIRA 4U2YA 3PK7A 1AL7A 4OBRA 4UC5A 2I7GA 3ZLHA 1W1VA 2FB3A 1MXGA 1ZPTA 1FFVC 4JPGA 1ZBWA 2BBFA 2E9BA 2YCIX 4JQ3A 1Y5WA 3OIXA 4CEUC 2C3ZA 2POTA 4ADTA 2CBUA 1AMYA 4JTIA 3IVUA 5JVLA 4FXJA 4JQ1A 1MVYA 1H1YA 4TVUA 3PTMA 2RDUA 2YYTA 3JS3A 4GKLA 2WJZA 2OMAA 3BMXA 3G6LA 3TSDA 2I9UA 3ITLA 3S1GA 1GHRA 3W1XA 2UY2A 3WLLA 2WV8A 3FJ6A 3MUIA 1HO1A 1V8EA 1MW2A 1XBXA 4IM4A 3CV2A 1L8NA 1E1FA 1PKNA 5JRBA 4BF5A 3WQVA 3HQNA 3W7RA 4NX5A 4HN8A 4M0XA 3B8SA 1BAGA 1EWDA 3WQWA 4EWND 1DV7A 3POHA 1N63C 3ES7A 1EKOA 1WXYA 4OKDA 1RY8A 1UR3M 1OT1A 2NVDA 2J8FA 2ZA3A 1SW3A 5AHNA 8XIAA 4PR4A 4V1YA 3GG0A 4XZ9A 3RR4A 1XLCA 4S3JA 2ONEA 1NU5A 3U8GA 2CITA 5LXEA 1J5SA 1TPVA 4NI3A 5HXMA 3H2EA 1V3IA 2V2HA 5IHRA 1CXHA 7PTDA 4K1WA 2WPEA 2YFNA 5HWJA 1Y5XA 1DWJM 2E3ZA 3S5OA 3UXIA 3HPAA 3B0PA 4IPIA 3R13A 4WSKA 1HQTA 3FAWA 1DXFA 2EBNA 4OU1A 3IIXA 4GXWA 5TAOA 1UP3A 2E9LA 3P93A 1I4NA 1ADSA 2A0NA 4Q8TA 4AIBA 5KZEA 4MZYA 3W1QA 3PPGA 3W2JA 1VFTA 4LY4A 5CZ0A 3M7SA 1VEMA 1NH6A 4HPXA 1PIIA 1B3ZA 4XSLA 3BOFA 2R82A 2ZBTA 1MWOA 5C7VA 1AG1O 1PCKA 4DJFD 3MV11 7TAAA 5H8UA 1XYZA 2GDUA 4QHRA 4I5RA 1TUFA 2DQXA 3F03K 3E2VA 1EBDA 4LVFA 1PX8A 3NL2A 1S1PA 4W88A 3O0HA 3ZWSA 3BLEA 4LVBA 2FZMA 4G1KA 2GQWA 4ERGA 1P6BA 3NOYA 1PKLA 1UKQA 4J3WA 5I07A 3BDKA 2DW7A 3L2LA 4AC1X 4RDZA 5U1OA 4FXSA 4AY8A 4DEFA 4UQEA 1BGGA 2XWDA 2H6RA 1HGWA 1CENA 4W8BA 4QQ3A 4CLMA 2CERA 4DRSA 1QFEA 1PHQA 4W84A 1CTNA 4JIPA 1I8JA 4UFHA 2NWRA 4NL1A 4TR9A 4QJ4B 1B3XA 1F6KA 2QCHA 3CU2A 2BASA 4EANA 1M6JA 2NX1A 1E56A 4NF7A 3KLKA 1P6WA 5I79A 4F0MA 3AXMA 4N9EA 1UOZA 1ZJBA 2JF7A 3BURA 4YPJA 1VPQA 3UNDA 2R1NA 3R5EA 1IHIA 1QNSA 2W66A 4JIQA 3VCRA 5CC6A 3LB8A 1K8CA 2WJFA 3L2MA 3BANA 4L4PA 4AVOA 2PWFA 4E4UA 2PAJA 2XIBA 3RPDA 1THFD 2C0AA 3GD4A 1GZ1A 1BTCA 1DJWA 3W7DA 3R12A 3LBCA 3TCSA 3Q94A 4R9OA 2OGYA 1CXLA 3UZYA 1ZXIC 5HMSA 5ER0A 4JL2A 1V97A 4XIMA 5GNXA 2H9AA 1F3TA 4DI8A 3G3DA 4LV4A 1VQTA 5DRIA 1EQCA 4AYSA 3TKFA 1NWRA 1X38A 1A3WA 5E6YA 2ZUTA 2Q71A 5D9MA 1E3ZA 3EKLA 3L65A 4AW7A 1TVPA 3S46A 1UBSA 1E6SM 4DUXA 1MQQA 5I00A 3LTSA 4QE4A 1VP5A 3MKVA 2FQIA 3SCPA 1CXKA 1VCGA 4RDVA 1VBUA 2O7QA 1M41A 1ZCCA 4O11A 3MP4A 5DMNA 1U5HA 4EPBC 2H8XA 2QW5A 4DM2A 2AMXA 2FPYA 3N14A 2PU0A 1CGUA 3THAA 3KUMA 3UG8A 4J57A 4IIBA 3STFA 3DH7A 4RNHA 1DWIM 3ABSA 1KBBA 4ZXLA 3AISA 3G77A 2QDEA 3OC4A 2IKJA 2VR5A 1SFJA 3ZVHA 2E25A 1ESWA 3FGCA 4JAWA 3VMPA 1ZY8A 4V2XA 1W1ZA 4C60A 4DNMA 1JZ4A 4RDWA 3TTSA 5M2FX 2WPCA 1KO0A 1PWMA 4JEJA 1Q13A 1LWHA 3SIZA 2J9XA 2Z4GA 6TIMA 4LB3A 2AMGA 3NIYA 1JRPA 5SWUA 3M0ZA 1OGBA 2Z29A 2WO5A 3MUXA 5DELA 3DGBA 3ARQA 1FEAA 1UC4A 4I8DA 1Q7ZA 1J0JA 4GFIA 3DENA 5CZSA 3CT2A 3FA4A 3BW2A 5E6ZA 1XH0A 1A5UA 5H91A 3HN3A 3L21A 4LYPA 4P7NA 3OGVA 2NLIA 2BVTA 3OA5A 1H5VA 1GOWA 1WBHA 2WPGA 4HT3A 3WLPA 3CT7A 1EZWA 1ME7A 3BAIA 2D2OA 1T5AA 3W01A 2D2HA 2QKFA 3AXKA 2FPTA 3N2XA 1ITCA 4B92A 1KFEA 2NSXA 1JOAA 2YQUA 2Y1HA 5HPOA 1OX6A 2D2GA 1E70M 1TWDA 2C1IA 4MDOA 2J13A 1T6MA 4LTSA 4WF7A 1TR9A 1CGVA 3LHYA 1WZKA 3S2LA 3GM8A 1XBVA 2J25A 1H3GA 3G1XA 3VOHA 1JZ8A 1KGXA 2OZTA 1BTMA 2QR6A 2E5DA 1SVDA 3FX4A 4KCVA 2ZZ5A 4X2RA 3HG5A 1U30A 3M41A 5D04C 5IFPA 2FHCA 3LB0A 2UV8G 4PTWA 4QJ3B 2VFHA 5G1TA 4BQ2A 2VOMA 4EAMA 3D5HA 3EMZA 5JCIA 2W91A 3MBDA 3UW6A 4IMGA 3ZLFA 4LYKA 2C18A 1UJQA 4KS0A 6CGTA 2E7FA 1JZ6A 1RV8A 2GGIA 3VZXA 2BVYA 3PWAA 1XHCA 3O2LA 3UWUA 3N9RA 2ZZ3A 3PPFA 2AAAA 1LWJA 3RG6A 1DWFM 4OQVA 3VIKA 1RP9A 1Q8JA 1UWSA 3CUZA 4QGCA 3VU2A 2VZSA 1B4KA 2W0UA 3QF0A 1UROA 2VX7A 2EPHA 3KVJA 3W2KA 4XQ6A 2E6DA 4GJIA 3SR6B 2A6LA 4JTAA 1G5AA 1MW0A 2OYLA 3TSMA 2DUAA 2XGZA 1K9FA 2XH2A 1EJRC 4ATLA 1CT5A 2A4AA 3EANA 1RCOB 4ALDA 5FJJA 4O4VA 1EXPA 1X6NA 2OSXA 3T2OA 2R8WA 3MUZ1 5F2MA 3UWYA 4QBXA 1M6IA 4OZOA 3OVQA 5U25A 1UCWA 4U5KA 1FRBA 2YGYA 3GFZA 3DK8A 1NEYA 3N12A 4NZ5A 4P8VA 3TQKA 4PMXA 4N4QA 5DANA 5IDZA 1N82A 4J40A 1UR9A 5A69A 2R91A 3AZSA 3WLNA 3PSWA 1NM9A 2JK6A 4Q8NA 3S5YA 4H9ZA 3P8JA 1FWBC 5MKGB 3ARWA 4HNLA 5ABGA 1S5WA 5M3WA 1OFDA 3NVTA 4Q4QA 1ADOA 2OZ8A 3H12A 3WDIA 3N3TA 3FJNA 4A8NA 1DWHM 3ONBA 1J96A 3VGFA 2F2HA 3VC6A 4D6DA 1RSCA 4GZEA 4UTWC 3H7RA 1LL4A 4LAUA 1BFNA 3LMZA 5BXRA 1LQ2A 4INFA 3OQ8A 3VIOA 3VNJA 2Q02A 3DFOA 3DHUA 1AA1B 3SURA 2W55A 4DQWA 4JTKA 4UTTC 4U5IA 3F5LA 1XIHA 3DBPA 3C8NA 4ZGYA 1A50A 3U2CA 1ONRA 1EP1A 2GGEA 2OXNA 1Q66A 2PWVA 4C6EA 4H4ZA 1M65A 5H8MA 2HDJA 1EC7A 3E6EA 5I3JA 4N42A 1MO9A 4FAMA 2PD9A 3GU1A 1F8WA 5BOFA 5D37A 3R0UA 1F3EA 2SFPA 3NO1A 1XH1A 4GFSA 1W9DM 4MKNA 2ZIDA 2XJ7A 4JKMA 3PAJA 4CUCA 4H4XA 5KMYA 3BAWA 4H8NA 3Q67A 3SCRA 2DIJA 3PBGA 1XIMA 1A5MC 2JGYA 1NJJA 1TG7A 4S3CA 4H4YA 4IXXA 1WKYA 4CQBA 3KRSA 1C91A 3MC5A 1DE5A 4DLMA 3HQPA 1OY0A 1DXLA 1JCNA 1UP0A 1E72M 5HWMA 3S9YA 4POCA 1E43A 5REQA 4IX0A 3DKJA 1K03A 1ZSXA 2CLPA 2QJJA 1QI3A 2PDFA 4F0HA 2ZE0A 4W7WA 3PM6A 3V35A 3V4BA 1FKXA 2FZ9A 3W23A 5L6UA 3ZXWA 4WXYA 2OZ3A 4QLKA 2NT0A 4YVVA 3UBPC 4C6DA 1JDEA 1S2WA 1Q2RA 2FH8A 4N9BA 2BFGA 2CLLA 5CH9A 4GUHA 4Z2HA 3TXZA 2YLAA 1F4HA 3A7RA 3OBAA 3M0LA 3NEHA 5A8PA 1N8FA 4HOWA 4L9XA 3NJ3A 3BJSA 3PANA 1XJBA 4HK7A 5I3KA 3CZJA 1SW7A 4HCHA 3SQLA 3F4VA 5JBDA 1R3WA 1L6GA 3H53A 1TPEA 4UNKA 3BG5A 4BCEA 1TJ1A 2DZUA 3WJWA 3N17A 2HISA 2XN0A 3A24A 2CESA 4NIRA 1QW7A 4UZSA 5BMXA 4IQJA 1IZKA 3C3UA 4PH6A 1JULA 4REQB 2XFWA 1QJWA 4Z1DA 4IL2A 3RUBL 1EC8A 3D6NA 3LNPA 3FDGA 3FHQA 1LORA 4DWDA 1FWSA 2WB5A 3QFEA 3UZ5A 1E0WA 3GD6A 4KCUA 3TNOA 1UZ1A 3P84A 4IMDA 1WYIA 1LTDA 3HM7A 2Z7GA 1XQLA 1GQIA 3UXKA 2AGTA 3WBEA 5I3GA 4JHMA 1UKPA 2Y70A 5PTDA 3UJ2A 2VEFA 1YRRA 1OT2A 4JICA 1HKIA 4HCDA 3C0QA 3TX9A 5E09A 1HKMA 2O0TA 1E6RA 2WC3A 1VLIA 4UTMA 1XLGA 2WZMA 2EO7A 1C90A 4YL2A 3GD3A 3WNOA 5CG0A 1GSNA 4J4KA 4S3DA 5C0QA 3MWAA 2ZRUA 1OK6A 1PKMA 4CQAA 1TPUA 3G0UA 3NR0A 5EBKA 1ZFJA 4XVEA 1E9IA 3F5JA 4DJEC 3AZTA 3K2GA 2R9RA 1KNWA 1QOXA 2CWNA 4MPQA 3M43A 1JCTA 4RNFA 1XLIA 1XHGA 1UQZA 5D8WA 3HRDC 1BXBA 4K39A 2XPKA 3TOPA 1O94A 2Y7FA 1TA3B 3T0TA 3BAYA 5D03A 3CUJA 4ZSUA 1SR9A 3NQEA 2ZUSA 3WDHA 2VX5A 4HMEA 2HNHA 2V81A 4CNNA 1EQPA 3CXOA 5G4HC 3GDMA 2ACQA 2FVMA 1R9ZA 2TPSA 2VUYA 2ZWYA 5FIPA 3VKDA 4XBJA 3R7MA 2YW4A 1M7OA 3MDWA 4JTSA 1LCOA 2DFAA 4NRRA 5A6LA 4WR3A 1Z7AA 4K8GA 4WOQA 1VFSA 3L9CA 5JBEA 4K7YA 1E4NA 2WHLA 4M56A 4GA8A 1JFHA 2GGHA 1RBAA 2ISVA 3UY7A 2V8ZA 1LUCB 2PGWA 4IMAA 4OVXA 1F4AA 2ALRA 1ZAHA 1DJXA 3QHOA 4WDXA 2PLCA 5HOSA 4MYXA 3VGEA 2YVGA 4M6VA 1TKKA 1EA9C 4CD4A 2GDVA 2D69A 4WGXA 2FZ8A 4ZA0A 4BFAA 2UBPC 1ZK7A 5C5YA 5FEZA 5F7UA 1P48A 4B9ZA 3G3MA 2LLEA 4P7OA 3W75A 4ICMA 3ELFA 3GRTA 2FGLA 1IXQA 2R9ZA 1LL6A 3AHYA 1H7RA 3DFSA 3FOKA 2AL2B 3HG4A 4F40A 4O8RA 1XLEA 3A7UA 3L0KA 1XS2A 1WB0A 3C2RA 3SB0A 1OGSA 1JI1A 1XYBA 3E0LA 3W7MA 3A13A 3U7VA 3GIYA 3A3WA 4MHBA 4O4WA 5LGZA 1X1ZA 2E4TA 4HYVA 1EJXC 5K2ZA 3QXBA 4LUSB 1FFUC 1RAKA 1RVGA 2VELA 3C61A 3QGVA 1AUSL 2QULA 2ZX7A 1HN1A 2CHRA 3G5EA 5CPSA 1SU5A 4GOAA 1VDVA 1IEIA 3R79A 1Z3NA 4U2ZA 5CSRA 5EMJA 3U9IA 3TC3A 1QUMA 1E4IA 3WK3A 1EDTA 1OC6A 4WY0A 3TFXA 3NM3A 4B3LA 3LRMA 1V6WA 1EYEA 2RFGA 5FOOA 2PDXA 3SN1A 5FCZA 1O1ZA 1R2RA 1QMLA 1MQRA 4BQ4A 3NQGA 2EKCA 2VEGA 4X9SA 1GJWA 2GUBA 1BEUA 3DHDA 2ISWA 2A6NA 2BP1A 2VM8A 3MJMA 3PAOA 4IFOA 4E38A 1XSKA 4LVGA 1OYBA 4NZFA 4X9YA 2P0OA 2TMDA 4Q32A 3AYRA 3NL6A 3D0CA 4X22A 4H4RA 1UWTA 4U10A 2Y62A 3H23A 2W79A 4HN4A 3DFNA 3CGEA 2XWEA 3AYVA 1SPQA 1W3KA 4FXFA 4JHOA 1K3UA 2FDSA 4I9AA 4LW7A 4DPQA 2E68A 4L9YA 1Z6KA 5FL0A 4IX2A 2NX3A 2QLYA 2C1HA 3NQ2A 1DE6A 2X0SA 5K3VA 3VE9A 2V5DA 2C14A 1JROA 1WP6A 5HINA 1TYPA 3MQTA 4UFIA 4NNAA 2XH7A 2RJHA 3MO4A 3DC8A 2VQTA 4JTLA 3WLRA 4AD5A 4CCZA 5FJTA 4LB4A 1B90A 1JCMP 3RPMA 4FNRA 1XLMA 1TUXA 4LUYA 3OHIA 3H6OA 3VA8A 3W86A 3L4YA 1P0KA 1IR1A 4L4LA 3ABOA 4HNTA 3RLVA 1TREA 2PODA 3FVMA 4J2PA 2IS7A 3VNMA 3H2MA 3G0SA 3AC0A 4QAWA 4MB1A 4WKAA 4AF0B 2XINA 1NHSA 2CLIA 3CIVA 3QSTA 1XANA 3W6MA 4DWSC 1X96A 3E02A 4PCSA 1GEHA 1K4HA 2P8BA 2YKKA 4Q4PA 1XDLA 1ZCOA 1XIIA 2VQUA 1FWEC 1FVPA 3FKRA 1VC4A 3A5FA 2CXEA 3Q4DA 3LHZA 3AMKA 3CZEA 1EBHA 2POZA 2VZTA 1OC5A 1UA3A 3MMUA 5C9XA 1DPMA 3ZM8A 1A47A 3I3EA 5I0DA 5HULA 3SSJA 2H8ZA 7REQB 1KWGA 2ZUNA 1TTPA 2OTDA 3QQ1A 4BURA 4HMNA 1KBIA 4ML4A 1Q2SA 4AZ5A 4CVUA 2A3HA 1DIEA 2PWDA 2G5WA 4W93A 3UCCA 2ZX5A 3IUDA 4IQLA 1RLCL 4KESA 1Q6LA 4QFUA 4HBKA 5DBTA 4LUJA 3GSMA 2WZHA 3TH6A 3V5FA 2NW0A 2UZ9A 4O1BA 1EEXA 2W67A 3SGZA 1JCJA 3M5ZA 2ZVIA 4PUWA 3E1F1 5A6KA 2QPSA 4W8LA 2BOFX 3WFAA 3V5CA 4EMWA 2INEA 4KCWA 1J12A 1OEPA 2A1YA 4DO5A 3M16A 3LV6A 3NG3A 5BXTA 2J79A 3P14A 3TW7A 1JQVA 3LMYA 4N7QA 2CBIA 3S4TA 3WDJA 3EMCA 2FTYA 2VEPA 1LT8A 1KWKA 5HJXA 1MUMA 3TMQA 4KH2A 1TCDA 4ENLA 3HOJA 1NIUA 3LTYA 1NDAA 3ARTA 3MVIA 3TA6A 4N2YA 2WKGA 1ICSA 2Q3RA 2EG7A 5ABEA 4GYKA 3UEQA 4ROPA 4O18A 3H2CA 3IACA 3T08A 1C3FA 3H21A 1GESA 4UTKA 2DZTA 4NNBA 1VBJA 3LQGA 3SQSA 2WLYA 3SSZA 4W85A 1W3JA 5KTLA 3RNMA 4HHHA 5C6MA 5FAGA 3IK4A 1B30A