2PMZC

Archaeal rna polymerase from sulfolobus solfataricus
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
385
structure length
279
Chain Sequence
PYLEEKVKQASNILPQKIVDDLKNLILNKEIIVTRDEIDKIFDLAIKEYSEGLIAPGEAIGIVAAQSVGEPGTQMTLGLPRLIEIVDAKKVPSTPMMTIYLTDEYKRDRDKALEVARKLEYKRAIVQKKGDEYIILTDGSNLSGVLSVKGVDVAKVETNNIREIEEVFGIEAAREIIIREISKVLAEQGLDVDIRHILLIADVMTRTGIVRQIGRHGVTGEKNSVLARAAFEVTVKHLLDAAARGDVEEFKGVVENIIIGHPIKLGTGMVELTMRPILR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-ray crystal structure of RNA polymerase from Archaea
pubmed doi rcsb
molecule tags Translation, transferase
molecule keywords DNA-directed RNA polymerase subunit A
total genus 43
structure length 279
sequence length 385
chains with identical sequence G
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04998 RNA_pol_Rpb1_5 RNA polymerase Rpb1, domain 5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.390 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2pmzC02
2WB1C 4AYBC 2PMZC 2Y0SC 2WAQC 3HKZC 4QIWC
chains in the Genus database with same CATH superfamily
1A76A 2ZIXA 2OWOA 5DQGA 4US9A 2Y1JA 4RNMA 4BXOA 2JHDA 1OUQA 2W9CB 1ZOLA 2W54A 2VKQA 5DQIA 2KV2A 5F3XB 4QWDA 5HP4A 4QIWF 4EBCA 5TZVA 1U47A 4YP3A 2KEYA 4Q45A 1V97A 2PFQA 5DDYA 1ZQJA 3C28A 3PMLA 2BQUA 1SIJA 5KT6A 3HRDD 1KW4A 2EANA 1DGSA 2G5IB 5C0YA 2KIVA 1NJZA 1OXJA 2ZJAA 4ED2A 2MA1A 2LMRA 2DPIA 2ZIWA 1P7DA 1L8OA 1NJWA 3RBDA 3RJKA 3QXGA 4ED7A 4QWAA 5ALJA 4E0DA 1B4FA 1TE2A 7ICRA 1V85A 1F0MA 2GWSA 1ZQNA 1LKYA 9ICGA 4KLLA 3TQ1A 3H7IA 2VJ5A 4C8OA 2KIWA 4DQRA 2AJQA 3LYSA 5IIKA 3AQFA 4DLGA 3JPOA 2A1AA 5KG0A 4C4RA 4YXMA 4RNOA 2H3IA 7ICTA 5IIOA 4M0AA 2FLLA 1X9XA 4JV1A 4F4XA 1DK2A 4KN4A 2Q4TA 2JZBA 5KG4A 1SZHA 4NWIA 4DF8A 1AROP 5J0QA 5KG2A 4F4WA 4QZHA 2HOQA 2AQ0A 2YN4A 1NKBA 2ZXHA 1HEKA 4RNNA 5ALQA 1D8LA 1KSPA 3RBEA 2XY5A 5J0SA 5KNIA 4RUCA 1BPEA 4Q44A 2PFNA 4DL3A 2E8NA 3KKAA 4RT3A 2K60A 3WKDA 4UAWA 4EEYA 4P0PB 3GIJA 1KFTA 3ED5A 4QZBA 5AKXA 4YMMA 5AK6A 4FZMA 3CYMA 3RB6A 1SWVA 1FFUA 2JR5A 4B9MA 3C1YA 3SMVA 9ICKA 2H3QA 5AI4A 3C21A 1QQ6A 9ICBA 4G3IA 3EW9A 4J9LA 3PV8A 2KMDA 3G6YA 4GXIA 2P6RA 5EWGA 4KLJA 1KDHA 1SL0A 4FZNA 3H8SA 3KBBA 4NLGA 3PX0A 1ZD2P 3F5EA 3GIMA 2K8BB 5D4BA 1ZQYA 1XSLA 1QQ5A 2LI6A 4HAIA 1ZQWA 5AICA 3TADA 3AL0B 2OM6A 2XCAA 4KTQA 9ICXA 4Y2YA 5HNKA 3UMBA 2YB4A 1Z00A 1VDVA 3NASA 4RQ7A 3ZD8A 5CEHA 1UA0A 1X6IA 5AI0A 2PFPA 4O5KA 3UXPA 2HI0A 4DOBA 2JEJA 4C4SA 5KTQA 2P6UA 4QWBA 4DLEA 8ICRA 4DWIA 2IA6A 1NK6A 2LPEA 4YFKA 1X9MA 1S0MA 4F8RA 4UAYA 3ZDCA 4KLGA 2XGQA 4O0IA 2QARA 4X5VA 2W8KA 1TK5A 3PSTA 4P4OA 1Q8KA 1ZQTA 2NRVA 3SD7A 4B9UA 2DBYA 3R9KA 3SR6A 1S77D 3MBYA 2AHOB 4I2HA 4DO9A 2UVVA 4Y2PA 1QSYA 3IG5A 2DFLA 2K89A 5EE0A 1JROA 4PJ0U 1KRPA 2BPCA 5AKEA 4TUSA 8ICPA 5JU5A 2J6TA 1MQ2A 2D8CA 3AU2A 2CRXA 3C2LA 2W04A 4O3NA 1ZQPA 1SV0C 7ICSA 1FFVA 2DWQA 5J8YA 4IRCA 1IXRA 2A1JA 2MUTA 2AQ4A 1F5SA 2C28A 4PZNA 3RF9A 3Q8QB 4KMOB 4QZIA 3EZ5A 2WF9A 2W9BB 9ICMA 4FS2A 5KFPA 5KFUA 2B0CA 2NRWA 1B43A 3BJYA 2E1FA 5IIIA 1NK0A 4F93B 5AM5A 2PXIA 2E1EA 2QB0B 5HHIA 3DEEA 2K4EA 1FO4A 1B22A 5KFHA 5KFAA 2WF5A 4FZLA 1VJ5A 4YN4A 4Q8FA 3NVVA 2KSOA 4M9JA 1PK1B 1DOQA 2EQYA 3V6HA 1N60A 3MR6A 5JTIA 4DEZA 2ZUDA 3WK5A 2K8AA 2KFZA 5KFQA 2KN7A 4GIBA 2FI1A 4ED1A 1LV5A 4C8KA 2RDIA 3RJHA 4DS5A 3VC8A 5KFSA 1ZQFA 5KFWA 7ICNA 5ALTA 5AM1A 2B21A 3IM1A 4RQ4A 5D49A 2A1JB 3SZ2A 5L1KA 4A8EA 2VJ4A 3KKAC 3H40A 1TAQA 3RJGA 1TK8A 1ZQBA 3GDXA 3MR2A 4K4HA 4YR0A 2KZMA 4J9PA 2F76X 4KLTA 4J9QA 8ICCA 4IRKA 2ASLA 2HBJA 5AKKA 4CCHA 1FEZA 1NNLA 4NLCA 1S5LU 3GFKB 3ZDEA 5DBAA 4MFFA 5F9LA 1ZETA 2R8KA 3D6JA 5ALRA 3OPXA 2Y9TA 2OXOA 4KLFA 1S97A 5ALFA 4CRXA 8ICQA 2RHFA 1N56A 2FPLA 4P4MA 2YQEA 3NVWA 3ETRA 9ICLA 1RQNA 4I27A 5J2BA 5KFZA 3C1ZA 4PL2A 2VA2A 3MDAA 2BR0A 4M47A 1ZQVA 3QZ8A 3BS5B 5DDMA 4Q43A 5F9NA 4M2YA 2E8OA 5AKLA 5AKJA 4P0QB 4UBBA 4CF3A 1UT5A 4OJ6A 2ALZA 2V4QA 1L6NA 1SWWA 4UARA 3GZFA 4OCZA 1KQQA 4RQMA 4TQRA 1X9SA 3GV8B 3PSPA 3M6KA 1T8EA 4C80A 4UBCA 1IIPA 3D2NA 4O3PA 1NK7A 4I29A 4ZH4A 1LKYB 1CI4A 4BX9C 1CRXA 1KLNA 5H2FU 3U26A 1JMSA 1Z4NA 5HMMA 2N1RA 3PW5A 2LKYA 4Y2RA 3MFHA 3HP6A 1IM4A 1NK4A 9ICCA 1ZRNA 1BPDA 5ALIA 3PY8A 3D2SA 4B9NA 2D3DA 5ALKA 4DL7A 4YR3A 1SKSA 2BDUA 4C8MA 3QU9A 1L3TA 3NTUA 1NK9A 3MGVA 1QQ7A 3CP8A 5KFNA 2AH5A 4UASA 4JV0A 2RRDA 2KFNA 5KG5A 3HKZF 5DGBA 1NKCA 9ICIA 1SGGA 3H0RB 3K1RB 4F5NA 4AP9A 4RPXA 2LM4A 1ZQEA 5ALGA 3BQ2A 2W9BA 7ICUA 8ICWA 1JRPA 3ORYA 1DRGA 3TANA 2Y0SF 2DKZA 5ALVA 1NZPA 1S76D 1COKA 4BWJA 1ZD3A 1ZQCA 1S0VA 4QZEA 1S10A 5GTIU 4DFPA 5DBBA 4RUAA 4IS7A 4US8A 4ECRA 4K4GA 4M6WB 4NV0A 4FBUA 4YXJA 4DFKA 3PMNA 9ICPA 2H3FA 4UB8U 2ODGA 1RYUA 5DB8A 2W55A 4CDGA 4QZ8A 8ICAA 2KZ3A 4MFCA 3LVVA 5T14A 2F8LA 4EENA 4DFJA 9ICJA 7ICJA 5KFTA 2BCUA 4YCXA 2RP5A 2KJ9A 2KVSA 5CP2A 2ZJ5A 2R18A 3LVWA 2JZBB 2K4IA 4Z6EA 1ZJNA 3BS7A 1URJA 3I1YA 3WK6A 9ICRA 5J0TA 5AK5A 1NOMA 1COOA 3SV4A 4YG2A 1IV8A 4QNLA 3QEAZ 3KHGA 1D8BA 2WF7A 9ICNA 4LZDA 4JUZA 3EWAA 2ISOA 1IG6A 4I2CA 1L5UA 4DQPA 3FC4A 1ZQKA 4IQTA 1SXDA 4DL6A 2ZTEA 1CEZA 2AGOA 4IQWA 1U48A 1T3NA 2KD1A 3V7JA 1PUZA 4RQ0A 1K5OA 1SKWA 2LYBA 2MSNA 2E8MA 5ALXA 4FO6A 3QU4A 4MHVA 4J9NA 4F2RA 5KFLA 2F8KA 1RZTA 1ZQOA 3RJJA 2P35A 2H3VA 2WHEA 4ECSA 4KLUA 3RAQA 3HJEA 4NL9A 1XSNA 5AKHA 1JUDA 4ED6A 3M7DA 4F4ZA 3V6JA 4J03A 5EWEA 3AUOA 1U49A 3GIKA 2ZIWB 2R8GA 2KTQA 3PZPA 2O6KA 9ICEA 4I2DA 2JRZA 3WU2U 2JXJA 5CA7A 9ICQA 3QUBA 4F71A 2PKEA 3RJIA 3RJFA 1X42A 3LK9A 1ZYQA 4QIWC 1V38A 1X9WA 1SKRA 1DGJA 2XY7A 1HIWA 4AYBF 3H8WA 4I2EA 4GXKA 4B9LA 5KL8B 4NXZA 3IHQB 3JPRA 4ED8A 2HBMA 4DSFA 4KX3A 1XO1A 4Y2UA 3BZCA 4IR9A 3OTQA 1JALA 3GIIA 2I9GA 2CXYA 4WJ3B 4UB5A 3K75D 2W3SA 3QU7A 2BQRA 4F4YA 3HX0A 1C20A 2VANA 5KT5A 4IRDA 3ZDAA 1PZNA 8ICSA 3GILA 5ALZA 2YMPA 4DCCA 2NYVA 1KKXA 1X2IA 2EZXA 5IINA 5KG3A 4RQ6A 2W9AA 5J0XA 2XGPA 4EBEA 1NJYA 4R8UB 1K1QA 2V4RA 5GTHU 3ETLA 4O5EA 4XQ8A 5BPCA 2ASJA 4UW9A 3ZI4A 3PNCA 2FLPA 4KLSA 2F44A 2Y0SC 3AU6A 5ALSA 4XRHA 4M04A 4O3QA 1U45A 4KMUA 1HUZA 2EZYA 2ES6A 2H3ZA 4UB4A 5J2DA 2ISPA 3PX4A 2FPKA 3QUTA 2FDRA 4B6JA 3SV3A 1QCKA 4YMNA 5DQHA 5KL1B 4NLZA 1ZRMA 2BZFA 5L9XA 3TFSA 2F1JA 3C2MA 5DLFA 4M9LA 3JPNA 3J81j 4UATA 4CGZA 3EYZA 4IC9A 3TAQA 2EAPA 3HWTA 2QB1A 2QKQA 3O0FA 4TQSA 5J2EA 2LBOA 1ZJMA 2EDUA 4RQ8A 5KFBA 2Y9UA 2WAQC 3A0HU 3I28A 4XUSA 2HDOA 4Y2JA 5J0RA 2ZTCA 2OCEA 3MGHA 1ED1A 1SB3C 1MN8A 5TISU 4Z6CA 4BDPA 2JEGA 4UB3A 1T7PA 3MGIA 3LWMA 2GLEA 5HMLA 2UVRA 1XSPA 4Q8EA 3TAPA 1BNOA 1YT3A 4EELA 2A3VA 1N5XA 3T3FA 3QNMA 4IQVA 5J8YC 8ICYA 4C8LA 2YX8A 5BOMA 3AEVA 3BQ1A 4MEYA 4QWCA 4M6WA 5ALHA 4DOCA 4PGXA 2WAQF 3A0BU 3MC1A 4Z6FA 3AQEA 3JPPA 4RQNA 2EH9A 2K4PA 1L7NA 3CNHA 3E58A 1S8OA 1BGXT 2EAOA 4J9KA 3M9OB 1ZQQA 5ALYA 4DOAA 1QSSA 1NKEA 4ED0A 4UQGA 3RR8A 2OHFA 3EPIA 2XO7A 3KHLA 4U6PA 4B9SA 3SAFA 3WK7A 1NI3A 2DF4B 2ZIVB 1RXVA 2YB1A 3B0YA 5ALPA 4DF4A 4DL2A 5FP0A 2HVHA 3GU3A 3KOOA 3BQ7A 3SYZA 5AKZA 3E0FA 4ECTA 5J0UA 4IQUA 2KHVA 1L7OA 3ISDA 3TFRA 3HKZC 4GFJA 2IOHA 5AI8A 3JPTA 5KFMA 2NV3A 3WK4A 5E79U 4P0QA 4I2IA 1S0NA 9ICTA 2NRXA 2F1HA 4FE3A 2BDPA 3OGUA 4YQWA 3KHHA 1F44A 4DFDA 2K8CB 2IMWP 3K4GA 2IOFK 2NRZA 4F91B 4Y2QA 3BDPA 4C4TA 2FMQA 4UAUA 2W7PA 5JRTA 4Y2VA 1XWLA 3IDWA 3RRGA 4DSKA 8ICUA 5L1IA 3N4MB 4BWMA 5DGAA 2DGZA 3DDHA 5KT4A 4O3MA 1ZQDA 2WB1C 4NLKA 3PR5B 4I2BA 1QLNA 3L4PA 5HR6A 5AM4A 4FS1A 5D46A 1QSLA 2DUYA 5AI9A 2G09A 3WKCA 1UHUA 3F2DA 3N7SC 3PR4A 2ATLA 4YVZA 4DQSA 3N97B 2OEHA 4RQ1A 5ALUA 3LWLA 1TKDA 2HHVA 4EZ6A 4QZAA 5J2CA 2C2EA 4BXOB 3H4BA 1JIHA 4F5QA 4Y2SA 5KFDA 1MQ3A 1BPBA 2ZXIA 3QYPA 5CB1A 4ZOHC 4YMOA 3ZDBA 2KHQA 2EAMA 2A19A 5J2HA 2I5HA 3C2KA 3I76A 1LVHA 5KT2A 1UPHA 1PK3A 4RQ3A 2R8HA 2E3TA 8ICFA 4DSLA 2M9NA 5CWRA 3WKAA 5ALOA 3IP4B 4MFAA 2WF6A 2MAXA 5ALLA 2BCRA 3UPQA 3KZIU 5L1MA 3G6XA 3BQ0A 1L8LA 4ACOA 4EYIB 4RPYA 2HHUA 5A0LA 3FYHA 1A6SA 5DBCA 4CNQA 4IL6U 3H8JA 5L1LA 1TVAA 4F3OA 4F5OA 5ALWA 1LB2B 5KFGA 2IBKA 4DS4A 3V6KA 4DQIA 3M8SA 4DQQA 7ICEA 3Q8RB 1CUKA 3QZ7A 2LYAA 8ICLA 5DB6A 4R66A 9ICWA 3PW0A 4UB2A 4KITB 1BNPA 5KFEA 4I2JA 5AM2A 1Z00B 1HUOA 4TUQA 8ICOA 2DPJA 4KLHA 3RH4A 2I1QA 2WFAA 2KKVA 1BPYA 5KFOA 2YY6A 8ICKA 3QU2A 3RB3A 3C29A 5DKWA 3TADC 1UCVA 4BUGA 1ZQUA 2W3RA 4JK1A 1N48A 1RQLA 2BKEA 2MRLA 4RQ5A 1D9DA 1VLBA 1XS9D 5EWFA 1S0OA 2XIDA 4QW8A 2YMMA 4P0PA 4M9GA 5ALMA 2UVUA 2M0NA 1WWVA 2E8PA 5AM0A 3MDCA 2KKPA 3N7RC 2PI4A 4OJLA 1SL2A 3H0MB 3WK8A 4DFMA 4JV2A 4NLBA 2NO4A 2LYHA 1D8YA 3Q8SB 2HMXA 1WUDA 5KAFU 2ZIUA 1ZD4A 1Q3VA 1WCLA 1SXEA 4NJ8A 5KFXA 5J2IA 1YZ7A 2HSZA 3QX7A 5J2JA 3KD3A 3OJSA 1FIQA 3Q8PB 3PO5A 2R8IA 4J9OA 1KTQA 1NJXA 3UMCA 7ICIA 1TAUA 5KT3A 2P66A 4PGYA 5B66U 1ZQZA 5KG1A 5AM3A 2HW3A 2AGQA 1XC9A 2W03A 2BGWA 5AHXA 3ISCA 2QLTA 7ICKA 4YD1A 1T3QA 3UMGA 2K4HA 2OYYA 3UXNA 1L3VA 7ICPA 5ALEA 4I28A 2JGAA 1N63A 2YMLA 3ZD9A 1ZQMA 4O3OA 1N2XA 2B6GA 2NO5A 2NRTA 2BHNA 3Q8MA 2E5SA 1S9FA 4C7ZA 3B0XA 1T4GA 3T5LA 5EE9A 5CHGA 5KFRA 8ICBA 4QZGA 3KTQA 1MSWD 2HBKA 3AMZA 4F72A 4GC7A 2RQ5A 3M9MB 4OJ5A 2W43A 5DLGA 1ZQLA 1ZQXA 1D9FA 1B0XA 3NVYA 3DV9A 3OSPA 2HHTA 5J0WA 2C22A 3ALRA 1SL1A 1A77A 1A0PA 5IILA 4O9MA 2WB1F 1O03A 4ECVA 3QEBZ 4ECXA 5HHHA 2ASDA 4ECQA 2LM1A 1O08A 1WG8A 8ICZA 4Y2XA 4PZOA 1J2NA 4EZ9A 3RB0A 3B9JA 3T5KA 2KNJA 3PX6A 4F2SA 5K4LA 4Z6DA 9ICFA 5IIJA 4ECUA 2F3NA 3Q8KA 1AQ6A 2AGPA 1PVPA 1TFRA 4NM1A 1UA1A 2L5YA 2DKXA 9ICUA 7ICQA 2YTUA 3FM9A 2XY6A 4Y2TA 2PMZC 4R64A 1Z19A 1RXWA 3HILA 1Q3UA 4AYBC 2KICA 1YZ6A 5J2KA 2LHTA 3VCBA 2I6XA 5CR0A 5EE1A 2FMPA 2KG5A 1ZQSA 4O3RA 4RPZA 4YR2A 4KLOA 1JX4A 4B9VA 4ECZA 2MU2A 4I2AA 3SAHA 1BVSA 4MF8A 4M9NA 4IR1A 4GXJA 5CRXA 3K1ZA 1XU4A 4R8UA 4KLMA 4F4KA 4UAVA 1L7PA 1M6YA 1DXSA 8ICGA 1EXNA 5AK3A 3RRHA 4JB3A 5KAIU 1X6JA 1ZQAA 1XO0A 4OJOA 4I2FA 2ZUCA 4PHEA 1J97A 4F5RA 1Z3EB 4P2HA 4GLXA 2F77X 2JH7A 2XVTA 1QH9A 2V9WA 3UQ2A 3T5HA 1KFSA 2QB0A 1NK8A 3H4DA 2FJ6A 4MEXA 3F2CA 1ZXIA 4TURA 1TK0A 4C8NA 4J9SA 3CW2C 1RDFA 1RYRA 3AM9A 3H0LB 3UQ0A 1UQVA 3V72A 3C5GA 4RU9A 5AK4A 4CE6A 2JEIA 4TUPA 1TAMA 1PVRA 2FE9A 2R8JA 1KL9A 4QWEA 3SQIA 2W9CA 2G5HB 3SI8A 3E2EA 9ICOA 2OH2A 3JPSA 1L3UA 2KJ8A 1WCNA 4DL5A 3UM9A 4NL9C 3D2QA 5EE3A 4JWMA 3UXOA 1RG6A 3LDAA 3THVA 5G5HA 2J6UA 5KFVA 1X40A 2XICA 3TACB 4PHDA 3F53A 1JXEA 1Y88A 4KLIA 3BZKA 3F2BA 3OHBA 4KLDA 5BOLA 2QARB 3N7PD 1K1SA 4ELVA 1NK5A 5EOZA 1KBUA 1PVQA 3ZDDA 4ICAA 4RQ2A 3RJEA 5AI6A 3EPGA 3SAGA 1L3SA 4OD0A 2JH1A 3RAXA 4K4IA 3F5AA 3IV6A 3WKBA 1SV4A 2Q0ZX 5KFKA 2KK0A 4ECWA 2KSOB 4RT2A 4PGQA 3M6ZA 4LJXA 4CF4A 3RFAA 5ALNA 3H8MA 4F92B 2HHXA 1L7MA 2W8LA 4NM2A 2H5XA 3HW8A 2WF8A 1JXLA 3HPOA 3PW4A 2FLNA 2JMGA 2BCVA 1RPLA 5J2AA 1N62A 4DSIA 3L5KA 7ICFA 9ICVA 2RLTA 1MC8A 4R63A 4EBDA 3ICXA 4ED3A 7ICGA 4GC6A 4QJFB 2IHNA 2MUTB 1KEJA 3NRZA 2C2RA 8ICNA 2KZZA 5KFYA 2XCPA 5DG8A 5DB9A 2ZIVA 4XA5A 7ICHA 2Y1IA 4EX7A 1N61A 2D6FC 2AU0A 2AXTU 3BS5A 5KFJA 2F2AB 2HHQA 4U7CA 3V7KA 4UB6U 3RB4A 5KFIA 2BCSA 5HR7A 4KLEA 3V7LA 4QZFA 1Z1VA 5DG7A 1H38A 1JI7A 4FBTA 2HOFA 1RYSA 1ZQIA 1BPZA 4DSEA 4HYKA 4PPXA 4PL1A 2F1IA 2G07A 2HBLA 3L3FX 2YMQA 3RH5A 3KZXA 2BQ3A 5AIAA 2KJ5A 4OJPA 4NY8A 3RH6A 2PI5A 7ICVA 3MR3A 7ICOA 5ALDA 2JV3A 4I2GA 4YD2A 3S6JA 2ZTDA 5KFFA 3GV7B 3PW2A 3CRXA 4PH5A 2C2DA 4MF2A 5J0OA 3IRUA 5DB7A 3QU5A 8ICVA 9ICSA 3IN5A 5L1JA 2PFOA 1JN3A 1OW5A 3TI0A 2HHWA 4ELUA 1GO3F 2HHSA 1DK3A 3FDSA 4J9MA 4O3SA 1Z4OA 3OSNA 3RR7A 2W7OA 5J29A 2ESEA 1PK1A 1BPXA 3C23A 3T79A 3JPQA 4KLQA 4C0ZA 4PHPA 2KE7A 9ICHA 3NVZA 3KFUF 3ONNA 5G5GA 4F50A 1ECWA 3MABA 3TARA 2G08A 3PSIA 8ICMA 2JEFA 5J0PA 3GQCA 3HT3A 8ICXA 5AKGA 3PO4A 4EEKA 2VA8A 1J2MA 1T94A 4LVSA 7ICMA 3FAHA 4CF5A 4QZCA 5J0YA 1ZQRA 2XI9A 2WTFA 3NUQA 5KG6A 4P4PA 3IG8A 3T5JA 4JMUA 2ZIUB 4UAZA 2KVCA 2HCFA 4O5CA 4PHAA 3BQTA 3C5FA 4LZGA 3WK9A 3QUQA 1ZQHA 3NGDA 2W9MA 3M9NB 8ICJA 2GOLA 1WYGA 2VIXA 2FMSA 9ICAA 4F5PA 2PMZF 4QZDA 2ZJ8A 8ICIA 1N5WA 1ZQGA 4RZRA 2BPGA 2EZZA 5JUMA 3N28A 1ZD5A 2HVIA 5B5EU 1QTMA 3QUCA 4QW9A 3NRWA 8ICEA 4KN7A 1V9PA 4J9RA 2IOFA 2GO7A 3PVXA 2ZG6A 2IHMA 5J2GA 5KG7A 2ZIXB 3PSFA 5KT7A 1X66A 4DSJA 8ICHA 1C7YA 3NS1A 3OJUA 5AIBA 3OHAA 5AI5A 4DL4A 3SEIA 1HJPA 1Z1BA 3PW7A 2GH1A 1WWUA 4NLNA 4UB1A 2RDJA 4JWNA 4BJQA 5KFCA 2KOBA 2BCQA 5C5JA 3G6VA 2W11A 3AN1A 7ICLA 4EYHB 4ELTA 3QE9Y 2VA3A 4BGDA 1TV9A 4QZ9A 1KN5A 2Z7JA 1U4BA 1SV0A 4G9BA 1KFDA 3M1YA 2G06A 3SENA 5J2FA 2FPMA 4KX5A 4R65A 5IIMA 5AKIA 5AKYA 5DG9A 2J6SA 1SZPA 3EUB2 1Q46A 1RM6C 2CPRA 2G0AA 3WKEA 3KHRA 1UT8A 8ICTA 3Q8LA 2DQNB 2KP7A 4OO1J 4FFDA 4M9HA 3TKAA 2XC9A 2ZUBA 4USAA 3MR5A 1U9LA 1XNSA 1NZBA 4C7YA 2CN1A 4B9TA 2DL0A 4EX6A 5CJ7A 3ISBA 1MA7A 3GV5B 2UVWA 2HOIA 4ECYA 1ZQ1C 2BPFA 3MFIA 3M8RA 3RTVA
chains in the Genus database with same CATH topology
2ZIWB 3E0FA 2M0NA 2ZIXA 3DEEA 2K4EA 2KKPA 3N7RC 4NV0A 3PZPA 4CGZA 2JHDA 2F77X 2JH7A 2KHVA 2XVTA 3ALRA 4FZLA 2H3FA 2HOQA 4IC9A 3IN5A 1A0PA 2ZG6A 3H0MB 1OUQA 3IP4B 2JMGA 2ZXHA 1HEKA 3HKZC 2ZIXB 4NLBA 4GFJA 3PSFA 4CDGA 3O0FA 2VKQA 1GO3F 2KV2A 2WB1F 2HMXA 4OJ6A 5KL1B 1WUDA 4QIWF 2ZIUA 2NV3A 4OJLA 1Q3VA 1L6NA 4P0QA 3LVVA 3F2CA 3GZFA 2LBOA 2W7OA 5T14A 2F8LA 3ICXA 4FE3A 2WAQC 3PSPA 2KEYA 1F44A 2K8CB 3T79A 2RP5A 2KJ9A 2K8AA 4ACOA 4QIWC 3M6KA 3H0LB 4QJFB 4C0ZA 1IIPA 2R18A 3D2NA 3LVWA 1Z1BA 2GH1A 2K4IA 3KFUF 3PSTA 1ED1A 5A0LA 2W7PA 3C28A 3ONNA 1HIWA 1URJA 4P0PB 4AYBF 2KNJA 1A6SA 1ECWA 4BJQA 2G5IB 3VC8A 5C0YA 2G08A 3PSIA 5KL8B 2KOBA 1PVPA 1TAMA 4BX9C 1PVRA 1CRXA 1YT3A 2A3VA 2ZIVA 4FZMA 3CYMA 2DGZA 4QNLA 3SQIA 2HBMA 1D8BA 3SMVA 4O3MA 2H3QA 2N1RA 2LKYA 2G5HB 2MA1A 2WB1C 2W03A 4KX3A 2PMZC 3IG5A 2YX8A 2OH2A 4A8EA 2VJ4A 2ZIWA 2K89A 1Z19A 1P7DA 3D2SA 5HR6A 2LYAA 2Z7JA 4WJ3B 1Q3UA 2KJ8A 4AYBC 2KICA 2D6FC 2LHTA 2G09A 1T94A 2G06A 3D2QA 3VCBA 4KX5A 2F2AB 2WAQF 2BDUA 3F2DA 2XI9A 4U7CA 2F76X 2K4HA 2XICA 3AQEA 2KD1A 3NUQA 2OYYA 3N7SC 3MGVA 3F53A 3CP8A 3IG8A 5HR7A 2HBJA 2CRXA 2RRDA 2JGAA 2W04A 3HKZF 2LYBA 4JMUA 4NLCA 3H0RB 2ZIUB 2VJ5A 4FZNA 3F2BA 2CPRA 2G0AA 2HOFA 2E5SA 2DQNB 3SAHA 2KIWA 4OO1J 2KVCA 3N7PD 3F5EA 1KBUA 2KKVA 2Y0SC 3LYSA 4PL1A 3C29A 2G07A 3AQFA 1DRGA 1PVQA 2K8BB 2HBLA 3OPXA 4ICAA 3L3FX 2ZXIA 1XNSA 1NZBA 2CN1A 3KZXA 2OXOA 3RF9A 2KJ5A 2Y0SF 4OJPA 5CRXA 3K1ZA 4BUGA 4CRXA 2GOLA 2H3VA 4KMOB 4U6PA 2H3IA 3SAFA 2VIXA 3SAGA 2RHFA 2H3ZA 2DF4B 2HBKA 2OM6A 2JH1A 2ZIVB 3AL0B 3F5AA 2YB1A 2MRLA 2PMZF 3RFAA 2KHQA 1MA7A 2HOIA 2Q4TA 1ZQ1C 3M7DA 3GU3A 2E1FA 4OJ5A 2YB4A 2XIDA 1XO0A 4OJOA 4P0PA 3M6ZA 3NRWA 1UPHA 4PL2A 3CRXA 2E1EA 1SZHA 4P0QB 4NWIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WB1 C;  4AYB C;  2PMZ C;  2Y0S C;  2WAQ C;  3HKZ C;  4QIW C; 
#chains in the Genus database with same CATH topology
 1A76 A;  2ZIX A;  2OWO A;  5DQG A;  4US9 A;  2Y1J A;  4RNM A;  4BXO A;  2JHD A;  1OUQ A;  2W9C B;  1ZOL A;  2W54 A;  2VKQ A;  5DQI A;  2KV2 A;  5F3X B;  4QWD A;  5HP4 A;  4QIW F;  4EBC A;  5TZV A;  1U47 A;  4YP3 A;  2KEY A;  4Q45 A;  1V97 A;  2PFQ A;  5DDY A;  1ZQJ A;  3C28 A;  3PML A;  2BQU A;  1SIJ A;  5KT6 A;  3HRD D;  1KW4 A;  2EAN A;  1DGS A;  2G5I B;  5C0Y A;  2KIV A;  1NJZ A;  1OXJ A;  2ZJA A;  4ED2 A;  2MA1 A;  2LMR A;  2DPI A;  2ZIW A;  1P7D A;  1L8O A;  1NJW A;  3RBD A;  3RJK A;  3QXG A;  4ED7 A;  4QWA A;  5ALJ A;  4E0D A;  1B4F A;  1TE2 A;  7ICR A;  1V85 A;  1F0M A;  2GWS A;  1ZQN A;  1LKY A;  9ICG A;  4KLL A;  3TQ1 A;  3H7I A;  2VJ5 A;  4C8O A;  2KIW A;  4DQR A;  2AJQ A;  3LYS A;  5IIK A;  3AQF A;  4DLG A;  3JPO A;  2A1A A;  5KG0 A;  4C4R A;  4YXM A;  4RNO A;  2H3I A;  7ICT A;  5IIO A;  4M0A A;  2FLL A;  1X9X A;  4JV1 A;  4F4X A;  1DK2 A;  4KN4 A;  2Q4T A;  2JZB A;  5KG4 A;  1SZH A;  4NWI A;  4DF8 A;  1ARO P;  5J0Q A;  5KG2 A;  4F4W A;  4QZH A;  2HOQ A;  2AQ0 A;  2YN4 A;  1NKB A;  2ZXH A;  1HEK A;  4RNN A;  5ALQ A;  1D8L A;  1KSP A;  3RBE A;  2XY5 A;  5J0S A;  5KNI A;  4RUC A;  1BPE A;  4Q44 A;  2PFN A;  4DL3 A;  2E8N A;  3KKA A;  4RT3 A;  2K60 A;  3WKD A;  4UAW A;  4EEY A;  4P0P B;  3GIJ A;  1KFT A;  3ED5 A;  4QZB A;  5AKX A;  4YMM A;  5AK6 A;  4FZM A;  3CYM A;  3RB6 A;  1SWV A;  1FFU A;  2JR5 A;  4B9M A;  3C1Y A;  3SMV A;  9ICK A;  2H3Q A;  5AI4 A;  3C21 A;  1QQ6 A;  9ICB A;  4G3I A;  3EW9 A;  4J9L A;  3PV8 A;  2KMD A;  3G6Y A;  4GXI A;  2P6R A;  5EWG A;  4KLJ A;  1KDH A;  1SL0 A;  4FZN A;  3H8S A;  3KBB A;  4NLG A;  3PX0 A;  1ZD2 P;  3F5E A;  3GIM A;  2K8B B;  5D4B A;  1ZQY A;  1XSL A;  1QQ5 A;  2LI6 A;  4HAI A;  1ZQW A;  5AIC A;  3TAD A;  3AL0 B;  2OM6 A;  2XCA A;  4KTQ A;  9ICX A;  4Y2Y A;  5HNK A;  3UMB A;  2YB4 A;  1Z00 A;  1VDV A;  3NAS A;  4RQ7 A;  3ZD8 A;  5CEH A;  1UA0 A;  1X6I A;  5AI0 A;  2PFP A;  4O5K A;  3UXP A;  2HI0 A;  4DOB A;  2JEJ A;  4C4S A;  5KTQ A;  2P6U A;  4QWB A;  4DLE A;  8ICR A;  4DWI A;  2IA6 A;  1NK6 A;  2LPE A;  4YFK A;  1X9M A;  1S0M A;  4F8R A;  4UAY A;  3ZDC A;  4KLG A;  2XGQ A;  4O0I A;  2QAR A;  4X5V A;  2W8K A;  1TK5 A;  3PST A;  4P4O A;  1Q8K A;  1ZQT A;  2NRV A;  3SD7 A;  4B9U A;  2DBY A;  3R9K A;  3SR6 A;  1S77 D;  3MBY A;  2AHO B;  4I2H A;  4DO9 A;  2UVV A;  4Y2P A;  1QSY A;  3IG5 A;  2DFL A;  2K89 A;  5EE0 A;  1JRO A;  4PJ0 U;  1KRP A;  2BPC A;  5AKE A;  4TUS A;  8ICP A;  5JU5 A;  2J6T A;  1MQ2 A;  2D8C A;  3AU2 A;  2CRX A;  3C2L A;  2W04 A;  4O3N A;  1ZQP A;  1SV0 C;  7ICS A;  1FFV A;  2DWQ A;  5J8Y A;  4IRC A;  1IXR A;  2A1J A;  2MUT A;  2AQ4 A;  1F5S A;  2C28 A;  4PZN A;  3RF9 A;  3Q8Q B;  4KMO B;  4QZI A;  3EZ5 A;  2WF9 A;  2W9B B;  9ICM A;  4FS2 A;  5KFP A;  5KFU A;  2B0C A;  2NRW A;  1B43 A;  3BJY A;  2E1F A;  5III A;  1NK0 A;  4F93 B;  5AM5 A;  2PXI A;  2E1E A;  2QB0 B;  5HHI A;  3DEE A;  2K4E A;  1FO4 A;  1B22 A;  5KFH A;  5KFA A;  2WF5 A;  4FZL A;  1VJ5 A;  4YN4 A;  4Q8F A;  3NVV A;  2KSO A;  4M9J A;  1PK1 B;  1DOQ A;  2EQY A;  3V6H A;  1N60 A;  3MR6 A;  5JTI A;  4DEZ A;  2ZUD A;  3WK5 A;  2K8A A;  2KFZ A;  5KFQ A;  2KN7 A;  4GIB A;  2FI1 A;  4ED1 A;  1LV5 A;  4C8K A;  2RDI A;  3RJH A;  4DS5 A;  3VC8 A;  5KFS A;  1ZQF A;  5KFW A;  7ICN A;  5ALT A;  5AM1 A;  2B21 A;  3IM1 A;  4RQ4 A;  5D49 A;  2A1J B;  3SZ2 A;  5L1K A;  4A8E A;  2VJ4 A;  3KKA C;  3H40 A;  1TAQ A;  3RJG A;  1TK8 A;  1ZQB A;  3GDX A;  3MR2 A;  4K4H A;  4YR0 A;  2KZM A;  4J9P A;  2F76 X;  4KLT A;  4J9Q A;  8ICC A;  4IRK A;  2ASL A;  2HBJ A;  5AKK A;  4CCH A;  1FEZ A;  1NNL A;  4NLC A;  1S5L U;  3GFK B;  3ZDE A;  5DBA A;  4MFF A;  5F9L A;  1ZET A;  2R8K A;  3D6J A;  5ALR A;  3OPX A;  2Y9T A;  2OXO A;  4KLF A;  1S97 A;  5ALF A;  4CRX A;  8ICQ A;  2RHF A;  1N56 A;  2FPL A;  4P4M A;  2YQE A;  3NVW A;  3ETR A;  9ICL A;  1RQN A;  4I27 A;  5J2B A;  5KFZ A;  3C1Z A;  4PL2 A;  2VA2 A;  3MDA A;  2BR0 A;  4M47 A;  1ZQV A;  3QZ8 A;  3BS5 B;  5DDM A;  4Q43 A;  5F9N A;  4M2Y A;  2E8O A;  5AKL A;  5AKJ A;  4P0Q B;  4UBB A;  4CF3 A;  1UT5 A;  4OJ6 A;  2ALZ A;  2V4Q A;  1L6N A;  1SWW A;  4UAR A;  3GZF A;  4OCZ A;  1KQQ A;  4RQM A;  4TQR A;  1X9S A;  3GV8 B;  3PSP A;  3M6K A;  1T8E A;  4C80 A;  4UBC A;  1IIP A;  3D2N A;  4O3P A;  1NK7 A;  4I29 A;  4ZH4 A;  1LKY B;  1CI4 A;  4BX9 C;  1CRX A;  1KLN A;  5H2F U;  3U26 A;  1JMS A;  1Z4N A;  5HMM A;  2N1R A;  3PW5 A;  2LKY A;  4Y2R A;  3MFH A;  3HP6 A;  1IM4 A;  1NK4 A;  9ICC A;  1ZRN A;  1BPD A;  5ALI A;  3PY8 A;  3D2S A;  4B9N A;  2D3D A;  5ALK A;  4DL7 A;  4YR3 A;  1SKS A;  2BDU A;  4C8M A;  3QU9 A;  1L3T A;  3NTU A;  1NK9 A;  3MGV A;  1QQ7 A;  3CP8 A;  5KFN A;  2AH5 A;  4UAS A;  4JV0 A;  2RRD A;  2KFN A;  5KG5 A;  3HKZ F;  5DGB A;  1NKC A;  9ICI A;  1SGG A;  3H0R B;  3K1R B;  4F5N A;  4AP9 A;  4RPX A;  2LM4 A;  1ZQE A;  5ALG A;  3BQ2 A;  2W9B A;  7ICU A;  8ICW A;  1JRP A;  3ORY A;  1DRG A;  3TAN A;  2Y0S F;  2DKZ A;  5ALV A;  1NZP A;  1S76 D;  1COK A;  4BWJ A;  1ZD3 A;  1ZQC A;  1S0V A;  4QZE A;  1S10 A;  5GTI U;  4DFP A;  5DBB A;  4RUA A;  4IS7 A;  4US8 A;  4ECR A;  4K4G A;  4M6W B;  4NV0 A;  4FBU A;  4YXJ A;  4DFK A;  3PMN A;  9ICP A;  2H3F A;  4UB8 U;  2ODG A;  1RYU A;  5DB8 A;  2W55 A;  4CDG A;  4QZ8 A;  8ICA A;  2KZ3 A;  4MFC A;  3LVV A;  5T14 A;  2F8L A;  4EEN A;  4DFJ A;  9ICJ A;  7ICJ A;  5KFT A;  2BCU A;  4YCX A;  2RP5 A;  2KJ9 A;  2KVS A;  5CP2 A;  2ZJ5 A;  2R18 A;  3LVW A;  2JZB B;  2K4I A;  4Z6E A;  1ZJN A;  3BS7 A;  1URJ A;  3I1Y A;  3WK6 A;  9ICR A;  5J0T A;  5AK5 A;  1NOM A;  1COO A;  3SV4 A;  4YG2 A;  1IV8 A;  4QNL A;  3QEA Z;  3KHG A;  1D8B A;  2WF7 A;  9ICN A;  4LZD A;  4JUZ A;  3EWA A;  2ISO A;  1IG6 A;  4I2C A;  1L5U A;  4DQP A;  3FC4 A;  1ZQK A;  4IQT A;  1SXD A;  4DL6 A;  2ZTE A;  1CEZ A;  2AGO A;  4IQW A;  1U48 A;  1T3N A;  2KD1 A;  3V7J A;  1PUZ A;  4RQ0 A;  1K5O A;  1SKW A;  2LYB A;  2MSN A;  2E8M A;  5ALX A;  4FO6 A;  3QU4 A;  4MHV A;  4J9N A;  4F2R A;  5KFL A;  2F8K A;  1RZT A;  1ZQO A;  3RJJ A;  2P35 A;  2H3V A;  2WHE A;  4ECS A;  4KLU A;  3RAQ A;  3HJE A;  4NL9 A;  1XSN A;  5AKH A;  1JUD A;  4ED6 A;  3M7D A;  4F4Z A;  3V6J A;  4J03 A;  5EWE A;  3AUO A;  1U49 A;  3GIK A;  2ZIW B;  2R8G A;  2KTQ A;  3PZP A;  2O6K A;  9ICE A;  4I2D A;  2JRZ A;  3WU2 U;  2JXJ A;  5CA7 A;  9ICQ A;  3QUB A;  4F71 A;  2PKE A;  3RJI A;  3RJF A;  1X42 A;  3LK9 A;  1ZYQ A;  4QIW C;  1V38 A;  1X9W A;  1SKR A;  1DGJ A;  2XY7 A;  1HIW A;  4AYB F;  3H8W A;  4I2E A;  4GXK A;  4B9L A;  5KL8 B;  4NXZ A;  3IHQ B;  3JPR A;  4ED8 A;  2HBM A;  4DSF A;  4KX3 A;  1XO1 A;  4Y2U A;  3BZC A;  4IR9 A;  3OTQ A;  1JAL A;  3GII A;  2I9G A;  2CXY A;  4WJ3 B;  4UB5 A;  3K75 D;  2W3S A;  3QU7 A;  2BQR A;  4F4Y A;  3HX0 A;  1C20 A;  2VAN A;  5KT5 A;  4IRD A;  3ZDA A;  1PZN A;  8ICS A;  3GIL A;  5ALZ A;  2YMP A;  4DCC A;  2NYV A;  1KKX A;  1X2I A;  2EZX A;  5IIN A;  5KG3 A;  4RQ6 A;  2W9A A;  5J0X A;  2XGP A;  4EBE A;  1NJY A;  4R8U B;  1K1Q A;  2V4R A;  5GTH U;  3ETL A;  4O5E A;  4XQ8 A;  5BPC A;  2ASJ A;  4UW9 A;  3ZI4 A;  3PNC A;  2FLP A;  4KLS A;  2F44 A;  2Y0S C;  3AU6 A;  5ALS A;  4XRH A;  4M04 A;  4O3Q A;  1U45 A;  4KMU A;  1HUZ A;  2EZY A;  2ES6 A;  2H3Z A;  4UB4 A;  5J2D A;  2ISP A;  3PX4 A;  2FPK A;  3QUT A;  2FDR A;  4B6J A;  3SV3 A;  1QCK A;  4YMN A;  5DQH A;  5KL1 B;  4NLZ A;  1ZRM A;  2BZF A;  5L9X A;  3TFS A;  2F1J A;  3C2M A;  5DLF A;  4M9L A;  3JPN A;  3J81 j;  4UAT A;  4CGZ A;  3EYZ A;  4IC9 A;  3TAQ A;  2EAP A;  3HWT A;  2QB1 A;  2QKQ A;  3O0F A;  4TQS A;  5J2E A;  2LBO A;  1ZJM A;  2EDU A;  4RQ8 A;  5KFB A;  2Y9U A;  2WAQ C;  3A0H U;  3I28 A;  4XUS A;  2HDO A;  4Y2J A;  5J0R A;  2ZTC A;  2OCE A;  3MGH A;  1ED1 A;  1SB3 C;  1MN8 A;  5TIS U;  4Z6C A;  4BDP A;  2JEG A;  4UB3 A;  1T7P A;  3MGI A;  3LWM A;  2GLE A;  5HML A;  2UVR A;  1XSP A;  4Q8E A;  3TAP A;  1BNO A;  1YT3 A;  4EEL A;  2A3V A;  1N5X A;  3T3F A;  3QNM A;  4IQV A;  5J8Y C;  8ICY A;  4C8L A;  2YX8 A;  5BOM A;  3AEV A;  3BQ1 A;  4MEY A;  4QWC A;  4M6W A;  5ALH A;  4DOC A;  4PGX A;  2WAQ F;  3A0B U;  3MC1 A;  4Z6F A;  3AQE A;  3JPP A;  4RQN A;  2EH9 A;  2K4P A;  1L7N A;  3CNH A;  3E58 A;  1S8O A;  1BGX T;  2EAO A;  4J9K A;  3M9O B;  1ZQQ A;  5ALY A;  4DOA A;  1QSS A;  1NKE A;  4ED0 A;  4UQG A;  3RR8 A;  2OHF A;  3EPI A;  2XO7 A;  3KHL A;  4U6P A;  4B9S A;  3SAF A;  3WK7 A;  1NI3 A;  2DF4 B;  2ZIV B;  1RXV A;  2YB1 A;  3B0Y A;  5ALP A;  4DF4 A;  4DL2 A;  5FP0 A;  2HVH A;  3GU3 A;  3KOO A;  3BQ7 A;  3SYZ A;  5AKZ A;  3E0F A;  4ECT A;  5J0U A;  4IQU A;  2KHV A;  1L7O A;  3ISD A;  3TFR A;  3HKZ C;  4GFJ A;  2IOH A;  5AI8 A;  3JPT A;  5KFM A;  2NV3 A;  3WK4 A;  5E79 U;  4P0Q A;  4I2I A;  1S0N A;  9ICT A;  2NRX A;  2F1H A;  4FE3 A;  2BDP A;  3OGU A;  4YQW A;  3KHH A;  1F44 A;  4DFD A;  2K8C B;  2IMW P;  3K4G A;  2IOF K;  2NRZ A;  4F91 B;  4Y2Q A;  3BDP A;  4C4T A;  2FMQ A;  4UAU A;  2W7P A;  5JRT A;  4Y2V A;  1XWL A;  3IDW A;  3RRG A;  4DSK A;  8ICU A;  5L1I A;  3N4M B;  4BWM A;  5DGA A;  2DGZ A;  3DDH A;  5KT4 A;  4O3M A;  1ZQD A;  2WB1 C;  4NLK A;  3PR5 B;  4I2B A;  1QLN A;  3L4P A;  5HR6 A;  5AM4 A;  4FS1 A;  5D46 A;  1QSL A;  2DUY A;  5AI9 A;  2G09 A;  3WKC A;  1UHU A;  3F2D A;  3N7S C;  3PR4 A;  2ATL A;  4YVZ A;  4DQS A;  3N97 B;  2OEH A;  4RQ1 A;  5ALU A;  3LWL A;  1TKD A;  2HHV A;  4EZ6 A;  4QZA A;  5J2C A;  2C2E A;  4BXO B;  3H4B A;  1JIH A;  4F5Q A;  4Y2S A;  5KFD A;  1MQ3 A;  1BPB A;  2ZXI A;  3QYP A;  5CB1 A;  4ZOH C;  4YMO A;  3ZDB A;  2KHQ A;  2EAM A;  2A19 A;  5J2H A;  2I5H A;  3C2K A;  3I76 A;  1LVH A;  5KT2 A;  1UPH A;  1PK3 A;  4RQ3 A;  2R8H A;  2E3T A;  8ICF A;  4DSL A;  2M9N A;  5CWR A;  3WKA A;  5ALO A;  3IP4 B;  4MFA A;  2WF6 A;  2MAX A;  5ALL A;  2BCR A;  3UPQ A;  3KZI U;  5L1M A;  3G6X A;  3BQ0 A;  1L8L A;  4ACO A;  4EYI B;  4RPY A;  2HHU A;  5A0L A;  3FYH A;  1A6S A;  5DBC A;  4CNQ A;  4IL6 U;  3H8J A;  5L1L A;  1TVA A;  4F3O A;  4F5O A;  5ALW A;  1LB2 B;  5KFG A;  2IBK A;  4DS4 A;  3V6K A;  4DQI A;  3M8S A;  4DQQ A;  7ICE A;  3Q8R B;  1CUK A;  3QZ7 A;  2LYA A;  8ICL A;  5DB6 A;  4R66 A;  9ICW A;  3PW0 A;  4UB2 A;  4KIT B;  1BNP A;  5KFE A;  4I2J A;  5AM2 A;  1Z00 B;  1HUO A;  4TUQ A;  8ICO A;  2DPJ A;  4KLH A;  3RH4 A;  2I1Q A;  2WFA A;  2KKV A;  1BPY A;  5KFO A;  2YY6 A;  8ICK A;  3QU2 A;  3RB3 A;  3C29 A;  5DKW A;  3TAD C;  1UCV A;  4BUG A;  1ZQU A;  2W3R A;  4JK1 A;  1N48 A;  1RQL A;  2BKE A;  2MRL A;  4RQ5 A;  1D9D A;  1VLB A;  1XS9 D;  5EWF A;  1S0O A;  2XID A;  4QW8 A;  2YMM A;  4P0P A;  4M9G A;  5ALM A;  2UVU A;  2M0N A;  1WWV A;  2E8P A;  5AM0 A;  3MDC A;  2KKP A;  3N7R C;  2PI4 A;  4OJL A;  1SL2 A;  3H0M B;  3WK8 A;  4DFM A;  4JV2 A;  4NLB A;  2NO4 A;  2LYH A;  1D8Y A;  3Q8S B;  2HMX A;  1WUD A;  5KAF U;  2ZIU A;  1ZD4 A;  1Q3V A;  1WCL A;  1SXE A;  4NJ8 A;  5KFX A;  5J2I A;  1YZ7 A;  2HSZ A;  3QX7 A;  5J2J A;  3KD3 A;  3OJS A;  1FIQ A;  3Q8P B;  3PO5 A;  2R8I A;  4J9O A;  1KTQ A;  1NJX A;  3UMC A;  7ICI A;  1TAU A;  5KT3 A;  2P66 A;  4PGY A;  5B66 U;  1ZQZ A;  5KG1 A;  5AM3 A;  2HW3 A;  2AGQ A;  1XC9 A;  2W03 A;  2BGW A;  5AHX A;  3ISC A;  2QLT A;  7ICK A;  4YD1 A;  1T3Q A;  3UMG A;  2K4H A;  2OYY A;  3UXN A;  1L3V A;  7ICP A;  5ALE A;  4I28 A;  2JGA A;  1N63 A;  2YML A;  3ZD9 A;  1ZQM A;  4O3O A;  1N2X A;  2B6G A;  2NO5 A;  2NRT A;  2BHN A;  3Q8M A;  2E5S A;  1S9F A;  4C7Z A;  3B0X A;  1T4G A;  3T5L A;  5EE9 A;  5CHG A;  5KFR A;  8ICB A;  4QZG A;  3KTQ A;  1MSW D;  2HBK A;  3AMZ A;  4F72 A;  4GC7 A;  2RQ5 A;  3M9M B;  4OJ5 A;  2W43 A;  5DLG A;  1ZQL A;  1ZQX A;  1D9F A;  1B0X A;  3NVY A;  3DV9 A;  3OSP A;  2HHT A;  5J0W A;  2C22 A;  3ALR A;  1SL1 A;  1A77 A;  1A0P A;  5IIL A;  4O9M A;  2WB1 F;  1O03 A;  4ECV A;  3QEB Z;  4ECX A;  5HHH A;  2ASD A;  4ECQ A;  2LM1 A;  1O08 A;  1WG8 A;  8ICZ A;  4Y2X A;  4PZO A;  1J2N A;  4EZ9 A;  3RB0 A;  3B9J A;  3T5K A;  2KNJ A;  3PX6 A;  4F2S A;  5K4L A;  4Z6D A;  9ICF A;  5IIJ A;  4ECU A;  2F3N A;  3Q8K A;  1AQ6 A;  2AGP A;  1PVP A;  1TFR A;  4NM1 A;  1UA1 A;  2L5Y A;  2DKX A;  9ICU A;  7ICQ A;  2YTU A;  3FM9 A;  2XY6 A;  4Y2T A;  2PMZ C;  4R64 A;  1Z19 A;  1RXW A;  3HIL A;  1Q3U A;  4AYB C;  2KIC A;  1YZ6 A;  5J2K A;  2LHT A;  3VCB A;  2I6X A;  5CR0 A;  5EE1 A;  2FMP A;  2KG5 A;  1ZQS A;  4O3R A;  4RPZ A;  4YR2 A;  4KLO A;  1JX4 A;  4B9V A;  4ECZ A;  2MU2 A;  4I2A A;  3SAH A;  1BVS A;  4MF8 A;  4M9N A;  4IR1 A;  4GXJ A;  5CRX A;  3K1Z A;  1XU4 A;  4R8U A;  4KLM A;  4F4K A;  4UAV A;  1L7P A;  1M6Y A;  1DXS A;  8ICG A;  1EXN A;  5AK3 A;  3RRH A;  4JB3 A;  5KAI U;  1X6J A;  1ZQA A;  1XO0 A;  4OJO A;  4I2F A;  2ZUC A;  4PHE A;  1J97 A;  4F5R A;  1Z3E B;  4P2H A;  4GLX A;  2F77 X;  2JH7 A;  2XVT A;  1QH9 A;  2V9W A;  3UQ2 A;  3T5H A;  1KFS A;  2QB0 A;  1NK8 A;  3H4D A;  2FJ6 A;  4MEX A;  3F2C A;  1ZXI A;  4TUR A;  1TK0 A;  4C8N A;  4J9S A;  3CW2 C;  1RDF A;  1RYR A;  3AM9 A;  3H0L B;  3UQ0 A;  1UQV A;  3V72 A;  3C5G A;  4RU9 A;  5AK4 A;  4CE6 A;  2JEI A;  4TUP A;  1TAM A;  1PVR A;  2FE9 A;  2R8J A;  1KL9 A;  4QWE A;  3SQI A;  2W9C A;  2G5H B;  3SI8 A;  3E2E A;  9ICO A;  2OH2 A;  3JPS A;  1L3U A;  2KJ8 A;  1WCN A;  4DL5 A;  3UM9 A;  4NL9 C;  3D2Q A;  5EE3 A;  4JWM A;  3UXO A;  1RG6 A;  3LDA A;  3THV A;  5G5H A;  2J6U A;  5KFV A;  1X40 A;  2XIC A;  3TAC B;  4PHD A;  3F53 A;  1JXE A;  1Y88 A;  4KLI A;  3BZK A;  3F2B A;  3OHB A;  4KLD A;  5BOL A;  2QAR B;  3N7P D;  1K1S A;  4ELV A;  1NK5 A;  5EOZ A;  1KBU A;  1PVQ A;  3ZDD A;  4ICA A;  4RQ2 A;  3RJE A;  5AI6 A;  3EPG A;  3SAG A;  1L3S A;  4OD0 A;  2JH1 A;  3RAX A;  4K4I A;  3F5A A;  3IV6 A;  3WKB A;  1SV4 A;  2Q0Z X;  5KFK A;  2KK0 A;  4ECW A;  2KSO B;  4RT2 A;  4PGQ A;  3M6Z A;  4LJX A;  4CF4 A;  3RFA A;  5ALN A;  3H8M A;  4F92 B;  2HHX A;  1L7M A;  2W8L A;  4NM2 A;  2H5X A;  3HW8 A;  2WF8 A;  1JXL A;  3HPO A;  3PW4 A;  2FLN A;  2JMG A;  2BCV A;  1RPL A;  5J2A A;  1N62 A;  4DSI A;  3L5K A;  7ICF A;  9ICV A;  2RLT A;  1MC8 A;  4R63 A;  4EBD A;  3ICX A;  4ED3 A;  7ICG A;  4GC6 A;  4QJF B;  2IHN A;  2MUT B;  1KEJ A;  3NRZ A;  2C2R A;  8ICN A;  2KZZ A;  5KFY A;  2XCP A;  5DG8 A;  5DB9 A;  2ZIV A;  4XA5 A;  7ICH A;  2Y1I A;  4EX7 A;  1N61 A;  2D6F C;  2AU0 A;  2AXT U;  3BS5 A;  5KFJ A;  2F2A B;  2HHQ A;  4U7C A;  3V7K A;  4UB6 U;  3RB4 A;  5KFI A;  2BCS A;  5HR7 A;  4KLE A;  3V7L A;  4QZF A;  1Z1V A;  5DG7 A;  1H38 A;  1JI7 A;  4FBT A;  2HOF A;  1RYS A;  1ZQI A;  1BPZ A;  4DSE A;  4HYK A;  4PPX A;  4PL1 A;  2F1I A;  2G07 A;  2HBL A;  3L3F X;  2YMQ A;  3RH5 A;  3KZX A;  2BQ3 A;  5AIA A;  2KJ5 A;  4OJP A;  4NY8 A;  3RH6 A;  2PI5 A;  7ICV A;  3MR3 A;  7ICO A;  5ALD A;  2JV3 A;  4I2G A;  4YD2 A;  3S6J A;  2ZTD A;  5KFF A;  3GV7 B;  3PW2 A;  3CRX A;  4PH5 A;  2C2D A;  4MF2 A;  5J0O A;  3IRU A;  5DB7 A;  3QU5 A;  8ICV A;  9ICS A;  3IN5 A;  5L1J A;  2PFO A;  1JN3 A;  1OW5 A;  3TI0 A;  2HHW A;  4ELU A;  1GO3 F;  2HHS A;  1DK3 A;  3FDS A;  4J9M A;  4O3S A;  1Z4O A;  3OSN A;  3RR7 A;  2W7O A;  5J29 A;  2ESE A;  1PK1 A;  1BPX A;  3C23 A;  3T79 A;  3JPQ A;  4KLQ A;  4C0Z A;  4PHP A;  2KE7 A;  9ICH A;  3NVZ A;  3KFU F;  3ONN A;  5G5G A;  4F50 A;  1ECW A;  3MAB A;  3TAR A;  2G08 A;  3PSI A;  8ICM A;  2JEF A;  5J0P A;  3GQC A;  3HT3 A;  8ICX A;  5AKG A;  3PO4 A;  4EEK A;  2VA8 A;  1J2M A;  1T94 A;  4LVS A;  7ICM A;  3FAH A;  4CF5 A;  4QZC A;  5J0Y A;  1ZQR A;  2XI9 A;  2WTF A;  3NUQ A;  5KG6 A;  4P4P A;  3IG8 A;  3T5J A;  4JMU A;  2ZIU B;  4UAZ A;  2KVC A;  2HCF A;  4O5C A;  4PHA A;  3BQT A;  3C5F A;  4LZG A;  3WK9 A;  3QUQ A;  1ZQH A;  3NGD A;  2W9M A;  3M9N B;  8ICJ A;  2GOL A;  1WYG A;  2VIX A;  2FMS A;  9ICA A;  4F5P A;  2PMZ F;  4QZD A;  2ZJ8 A;  8ICI A;  1N5W A;  1ZQG A;  4RZR A;  2BPG A;  2EZZ A;  5JUM A;  3N28 A;  1ZD5 A;  2HVI A;  5B5E U;  1QTM A;  3QUC A;  4QW9 A;  3NRW A;  8ICE A;  4KN7 A;  1V9P A;  4J9R A;  2IOF A;  2GO7 A;  3PVX A;  2ZG6 A;  2IHM A;  5J2G A;  5KG7 A;  2ZIX B;  3PSF A;  5KT7 A;  1X66 A;  4DSJ A;  8ICH A;  1C7Y A;  3NS1 A;  3OJU A;  5AIB A;  3OHA A;  5AI5 A;  4DL4 A;  3SEI A;  1HJP A;  1Z1B A;  3PW7 A;  2GH1 A;  1WWU A;  4NLN A;  4UB1 A;  2RDJ A;  4JWN A;  4BJQ A;  5KFC A;  2KOB A;  2BCQ A;  5C5J A;  3G6V A;  2W11 A;  3AN1 A;  7ICL A;  4EYH B;  4ELT A;  3QE9 Y;  2VA3 A;  4BGD A;  1TV9 A;  4QZ9 A;  1KN5 A;  2Z7J A;  1U4B A;  1SV0 A;  4G9B A;  1KFD A;  3M1Y A;  2G06 A;  3SEN A;  5J2F A;  2FPM A;  4KX5 A;  4R65 A;  5IIM A;  5AKI A;  5AKY A;  5DG9 A;  2J6S A;  1SZP A;  3EUB 2;  1Q46 A;  1RM6 C;  2CPR A;  2G0A A;  3WKE A;  3KHR A;  1UT8 A;  8ICT A;  3Q8L A;  2DQN B;  2KP7 A;  4OO1 J;  4FFD A;  4M9H A;  3TKA A;  2XC9 A;  2ZUB A;  4USA A;  3MR5 A;  1U9L A;  1XNS A;  1NZB A;  4C7Y A;  2CN1 A;  4B9T A;  2DL0 A;  4EX6 A;  5CJ7 A;  3ISB A;  1MA7 A;  3GV5 B;  2UVW A;  2HOI A;  4ECY A;  1ZQ1 C;  2BPF A;  3MFI A;  3M8R A;  3RTV A; 
#chains in the Genus database with same CATH homology
 2ZIW B;  3E0F A;  2M0N A;  2ZIX A;  3DEE A;  2K4E A;  2KKP A;  3N7R C;  4NV0 A;  3PZP A;  4CGZ A;  2JHD A;  2F77 X;  2JH7 A;  2KHV A;  2XVT A;  3ALR A;  4FZL A;  2H3F A;  2HOQ A;  4IC9 A;  3IN5 A;  1A0P A;  2ZG6 A;  3H0M B;  1OUQ A;  3IP4 B;  2JMG A;  2ZXH A;  1HEK A;  3HKZ C;  2ZIX B;  4NLB A;  4GFJ A;  3PSF A;  4CDG A;  3O0F A;  2VKQ A;  1GO3 F;  2KV2 A;  2WB1 F;  2HMX A;  4OJ6 A;  5KL1 B;  1WUD A;  4QIW F;  2ZIU A;  2NV3 A;  4OJL A;  1Q3V A;  1L6N A;  4P0Q A;  3LVV A;  3F2C A;  3GZF A;  2LBO A;  2W7O A;  5T14 A;  2F8L A;  3ICX A;  4FE3 A;  2WAQ C;  3PSP A;  2KEY A;  1F44 A;  2K8C B;  3T79 A;  2RP5 A;  2KJ9 A;  2K8A A;  4ACO A;  4QIW C;  3M6K A;  3H0L B;  4QJF B;  4C0Z A;  1IIP A;  2R18 A;  3D2N A;  3LVW A;  1Z1B A;  2GH1 A;  2K4I A;  3KFU F;  3PST A;  1ED1 A;  5A0L A;  2W7P A;  3C28 A;  3ONN A;  1HIW A;  1URJ A;  4P0P B;  4AYB F;  2KNJ A;  1A6S A;  1ECW A;  4BJQ A;  2G5I B;  3VC8 A;  5C0Y A;  2G08 A;  3PSI A;  5KL8 B;  2KOB A;  1PVP A;  1TAM A;  4BX9 C;  1PVR A;  1CRX A;  1YT3 A;  2A3V A;  2ZIV A;  4FZM A;  3CYM A;  2DGZ A;  4QNL A;  3SQI A;  2HBM A;  1D8B A;  3SMV A;  4O3M A;  2H3Q A;  2N1R A;  2LKY A;  2G5H B;  2MA1 A;  2WB1 C;  2W03 A;  4KX3 A;  2PMZ C;  3IG5 A;  2YX8 A;  2OH2 A;  4A8E A;  2VJ4 A;  2ZIW A;  2K89 A;  1Z19 A;  1P7D A;  3D2S A;  5HR6 A;  2LYA A;  2Z7J A;  4WJ3 B;  1Q3U A;  2KJ8 A;  4AYB C;  2KIC A;  2D6F C;  2LHT A;  2G09 A;  1T94 A;  2G06 A;  3D2Q A;  3VCB A;  4KX5 A;  2F2A B;  2WAQ F;  2BDU A;  3F2D A;  2XI9 A;  4U7C A;  2F76 X;  2K4H A;  2XIC A;  3AQE A;  2KD1 A;  3NUQ A;  2OYY A;  3N7S C;  3MGV A;  3F53 A;  3CP8 A;  3IG8 A;  5HR7 A;  2HBJ A;  2CRX A;  2RRD A;  2JGA A;  2W04 A;  3HKZ F;  2LYB A;  4JMU A;  4NLC A;  3H0R B;  2ZIU B;  2VJ5 A;  4FZN A;  3F2B A;  2CPR A;  2G0A A;  2HOF A;  2E5S A;  2DQN B;  3SAH A;  2KIW A;  4OO1 J;  2KVC A;  3N7P D;  3F5E A;  1KBU A;  2KKV A;  2Y0S C;  3LYS A;  4PL1 A;  3C29 A;  2G07 A;  3AQF A;  1DRG A;  1PVQ A;  2K8B B;  2HBL A;  3OPX A;  4ICA A;  3L3F X;  2ZXI A;  1XNS A;  1NZB A;  2CN1 A;  3KZX A;  2OXO A;  3RF9 A;  2KJ5 A;  2Y0S F;  4OJP A;  5CRX A;  3K1Z A;  4BUG A;  4CRX A;  2GOL A;  2H3V A;  4KMO B;  4U6P A;  2H3I A;  3SAF A;  2VIX A;  3SAG A;  2RHF A;  2H3Z A;  2DF4 B;  2HBK A;  2OM6 A;  2JH1 A;  2ZIV B;  3AL0 B;  3F5A A;  2YB1 A;  2MRL A;  2PMZ F;  3RFA A;  2KHQ A;  1MA7 A;  2HOI A;  2Q4T A;  1ZQ1 C;  3M7D A;  3GU3 A;  2E1F A;  4OJ5 A;  2YB4 A;  2XID A;  1XO0 A;  4OJO A;  4P0P A;  3M6Z A;  3NRW A;  1UPH A;  4PL2 A;  3CRX A;  2E1E A;  1SZH A;  4P0Q B;  4NWI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...