2PMZC

Archaeal rna polymerase from sulfolobus solfataricus
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
385
structure length
279
Chain Sequence
PYLEEKVKQASNILPQKIVDDLKNLILNKEIIVTRDEIDKIFDLAIKEYSEGLIAPGEAIGIVAAQSVGEPGTQMTLGLPRLIEIVDAKKVPSTPMMTIYLTDEYKRDRDKALEVARKLEYKRAIVQKKGDEYIILTDGSNLSGVLSVKGVDVAKVETNNIREIEEVFGIEAAREIIIREISKVLAEQGLDVDIRHILLIADVMTRTGIVRQIGRHGVTGEKNSVLARAAFEVTVKHLLDAAARGDVEEFKGVVENIIIGHPIKLGTGMVELTMRPILR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit A
publication title The X-ray crystal structure of RNA polymerase from Archaea
pubmed doi rcsb
molecule tags Translation, transferase
total genus 43
structure length 279
sequence length 385
chains with identical sequence G
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04998 RNA_pol_Rpb1_5 RNA polymerase Rpb1, domain 5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.390 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2pmzC02
2WB1C 2WAQC 3HKZC 4AYBC 4QIWC 2PMZC 2Y0SC
chains in the Genus database with same CATH superfamily
1TAQA 1BPXA 3RH6A 2B21A 2HW3A 5J29A 8ICBA 3LWLA 2W9AA 3N97B 1NI3A 9ICMA 3QUTA 1N2XA 1UT5A 4QZEA 2VA2A 2HVHA 3NRZA 4GLXA 2DQNB 5EOZA 2ZJ8A 2FLNA 2PFPA 2KG5A 2AH5A 2KKVA 1DGSA 5KFFA 1KFTA 4NLCA 2G07A 3RAQA 2KZZA 3WK9A 5JRTA 3GV5B 2ZTEA 2FLLA 3PW0A 5AM2A 2Y0SC 3N28A 1JIHA 4KLQA 5KFQA 4DO9A 1HIWA 4BDPA 4EYIB 1QH9A 2BKEA 4I28A 2BDPA 4PZOA 4RUAA 2KIVA 4F93B 3QX7A 4UB3A 4FZMA 8ICRA 4QWDA 1NKBA 2JV3A 4QZBA 2WB1C 3OHAA 1QSYA 4B9NA 1DOQA 2F1IA 5AKEA 5ALHA 3GFKB 5CWRA 1JXEA 1A76A 5ALOA 5BOMA 4DL2A 4JV2A 2W9CB 1NK6A 2BPGA 4DEZA 1Q3VA 4F50A 8ICJA 2PKEA 1ZQGA 3A0BU 1NKEA 3N7RC 1NK7A 9ICCA 8ICVA 1FEZA 1ZJMA 5CRXA 4RNOA 7ICNA 3QU7A 4ELVA 4BJQA 3H8WA 3T79A 2YMQA 1Q8KA 1TVAA 2E8OA 1U45A 5AKGA 3RJFA 4P0QB 5TZVA 8ICIA 5DG8A 5J0XA 1KBUA 3JPRA 2KK0A 1L3TA 5AKKA 2KE7A 3PNCA 3KFUF 2ZIVA 3TACB 1U4BA 1SKWA 2DKXA 3Q8QB 3BQ2A 3UQ0A 4PPXA 1LKYA 2ZIXB 3SAGA 5DB9A 5J2AA 2OWOA 3TFSA 4EEYA 1D8YA 2WF9A 4ED2A 3MR5A 3GIIA 3R9KA 3B0XA 1SZHA 2G09A 3BZKA 5BPCA 4DLGA 3RTVA 4RQ5A 1ZQFA 1U9LA 2CN1A 3EZ5A 9ICAA 3SV4A 4PHAA 5AI8A 2BDUA 2GH1A 3ETLA 4DSLA 2MAXA 4F91B 2BCVA 3OPXA 2ALZA 2KHQA 4IQVA 4ECRA 3PZPA 2ISOA 4JWMA 9ICBA 1SXDA 2KN7A 2F1JA 3PX4A 3H4DA 2KJ8A 7ICJA 9ICSA 1H38A 3AU2A 4RQ7A 2KFNA 5AK3A 5KNIA 4US9A 4KLSA 3KBBA 1TKDA 4FO6A 4C4TA 4R64A 5ALEA 5DQGA 4PHEA 5C5JA 2F8KA 4CNQA 3V72A 1MN8A 2AQ0A 2BCUA 5ALFA 5ALUA 3F2BA 1IM4A 1CEZA 5AKIA 4UB6U 4JK1A 3GV8B 3ED5A 2M0NA 2YMPA 2K8BB 5AIBA 4KLDA 4YR0A 5G5HA 4OJLA 4C0ZA 1V9PA 3M7DA 5HR6A 2KKPA 3T5JA 3NVZA 2PFOA 1S97A 3J81j 2WF5A 1B4FA 2L5YA 1F44A 2RHFA 2G06A 2JZBB 1DK2A 2JH1A 4YVZA 4BXOB 1ZYQA 2CPRA 4IR1A 2NV3A 2ODGA 1ZD5A 3AUOA 1WWVA 4ZH4A 1XC9A 3PR5B 3GQCA 2K4HA 1DRGA 3PSFA 1YZ7A 2AU0A 2J6UA 4DFJA 2YMMA 4F72A 1PK1B 4DS4A 3RJKA 4P0PB 1XNSA 1URJA 1SGGA 1C20A 3OJSA 4OJOA 3AL0B 5DBBA 5AI0A 2R8GA 2H3FA 1X66A 4ED6A 4K4HA 2UVVA 2KMDA 3KOOA 5HHHA 2XGPA 2ASDA 5J2IA 5DB8A 2ZXHA 3OSPA 3Q8PB 4JUZA 3C1YA 1ZQHA 2C2EA 2JH7A 2H3VA 5KT5A 2V4RA 1DXSA 2BHNA 4NJ8A 1X9XA 3TAPA 3N4MB 1Z1BA 5AIAA 4PGQA 4C4RA 4KMOB 3LVVA 3B0YA 1ZQYA 3QNMA 3C1ZA 1NK9A 3ZDDA 5L1KA 2W9CA 2YQEA 5KFMA 5ALWA 4PL1A 5KFPA 2WAQF 1C7YA 3EPIA 1NOMA 3N7SC 4DL7A 1DGJA 2EQYA 5KFWA 1CRXA 1SV0A 4ZOHC 4DCCA 4PZNA 2W7OA 2HBLA 1COOA 1RXVA 5T14A 2JGAA 1XO0A 2ZJ5A 3H0MB 7ICVA 2W9MA 3QU2A 4P0QA 4RQ1A 3M9MB 2KTQA 4EZ9A 4DSKA 2IOFA 4IQTA 2F2AB 4CCHA 4QW8A 4KX3A 5J2BA 3C28A 1JALA 3NS1A 5KG5A 1KQQA 4YD2A 1KEJA 4EBEA 1SL1A 5KG7A 2C28A 5EE3A 3H8MA 4ED1A 1ZJNA 2WAQC 3M6KA 2DGZA 2K8AA 4I2CA 4Y2TA 4Y2UA 5KT2A 1OXJA 2A19A 5KFKA 3KKAC 3UMGA 1WWUA 5L1LA 3QYPA 1ZXIA 5L1IA 3H4BA 1QSLA 3I76A 2RLTA 3QZ8A 4KLHA 8ICPA 4ECXA 3TFRA 3D2QA 2VA3A 3MGIA 4RQ3A 2B6GA 2ISPA 3CNHA 4EYHB 2E1FA 5J0RA 5HHIA 3OSNA 2E8NA 8ICGA 3HW8A 3Q8MA 4JWNA 4IL6U 3RJJA 2NO4A 4KLLA 3GU3A 4KLMA 4UBCA 3L4PA 3ICXA 2BCSA 4EENA 1D8LA 1BPYA 5KFEA 2KVSA 3MR6A 4F4ZA 3H40A 1T7PA 3HKZF 4QZAA 2W43A 4QNLA 3RB6A 5KFTA 3LK9A 4YQWA 3H8JA 5J2CA 4Q43A 1S9FA 4G3IA 3PVXA 1NKCA 2Y9TA 1RQLA 5F9LA 4CF3A 4NLBA 1V85A 1WCLA 1S8OA 1Z00B 1ZD3A 3OTQA 4KN7A 3M9OB 3RR8A 2ESEA 4KLEA 1Q3UA 9ICUA 5AM4A 2FPLA 2JZBA 4A8EA 1BPBA 4RT2A 2MRLA 9ICIA 2H3ZA 4QZGA 2VKQA 5AKJA 4FS1A 1RQNA 3TANA 1SV4A 3JPQA 2G5IB 3RH4A 3RJHA 4FFDA 1GO3F 1LVHA 1RDFA 2K8CB 3UXNA 4KLUA 3FM9A 2UVUA 4ELUA 3KHLA 2DBYA 5ALQA 4F71A 5ALTA 4DFMA 4P0PA 3G6VA 2FJ6A 4RQ8A 3ZDEA 5J2HA 4Z6CA 3UMCA 3H8SA 2HHUA 3KHRA 4M9NA 4QZHA 1PUZA 4I2GA 3A0HU 1ZQCA 5AI9A 3MDCA 4UB1A 2F77X 5GTHU 4QJFB 2KD1A 7ICSA 1NJWA 5KFZA 4F4XA 4I2AA 2B0CA 4RQ4A 3Q8RB 3SENA 2JHDA 5ALRA 8ICHA 4EX6A 2FMSA 5J8YC 3ZDCA 8ICQA 2BGWA 3MC1A 3SR6A 2KV2A 5AI6A 5AKZA 2W55A 2G08A 4UATA 4QWAA 5E79U 3PSPA 1SB3C 4R8UB 4RT3A 1JRPA 5ALJA 4OJ5A 3IHQB 5IIOA 4J9NA 3TI0A 3MR3A 5AK4A 3MFHA 4MF2A 2DPJA 2WF7A 3ISDA 5KFVA 4DL3A 1L3SA 2NRVA 3T5HA 3KD3A 4DFKA 4FZNA 3IP4B 4DOCA 4M6WB 1L7NA 2Z7JA 4J9RA 4OCZA 3LDAA 5J2KA 7ICIA 4RU9A 2PXIA 2KZ3A 3ETRA 2HBJA 2E1EA 4O0IA 5KL1B 4F5RA 4BWMA 1A0PA 2WHEA 1UQVA 3WK7A 1D9DA 5ALLA 5KT4A 3MFIA 3UM9A 2LPEA 5KFUA 4Q45A 2FMPA 1BGXT 4RPXA 1OW5A 2ZTDA 3PY8A 3IG8A 3HT3A 1MC8A 2PMZF 1T8EA 1L8OA 1HUZA 5KFIA 2WF8A 1L3UA 2HVIA 4P2HA 2W8LA 3PW2A 4TQRA 2OEHA 2GLEA 4FBUA 3RFAA 4ECYA 3KHHA 4ED0A 1MA7A 4IR9A 1S0VA 3T5LA 2KICA 1IV8A 2LBOA 2W9BB 3ZDAA 3U26A 5J2FA 4IRDA 3ORYA 3AU6A 2FDRA 4RNNA 3BQ0A 4QWBA 4PH5A 3M1YA 1BNPA 3JPSA 2LYAA 4O3SA 5EE1A 2YTUA 4CGZA 4I2HA 3EWAA 2AXTU 8ICLA 3N7PD 1DK3A 2OYYA 4NY8A 3GIKA 1SKSA 3H7IA 2A3VA 4Y2PA 5ALYA 3GDXA 1ZQDA 3E58A 1OUQA 5KT6A 4J9SA 4MFFA 4OO1J 4R66A 3HRDD 4YXJA 3I28A 2FI1A 1ZQWA 4EEKA 3FC4A 4ECZA 2EZYA 3RBDA 9ICJA 4DF8A 4JV0A 2HHXA 2K4IA 1ZQNA 1TAUA 1T3NA 4M2YA 4DSJA 8ICNA 2W11A 3OHBA 1B0XA 2NRWA 1CUKA 3WKAA 4F92B 3FDSA 5KFCA 4QZDA 2W03A 4KLJA 1ZQPA 1KW4A 2E3TA 3RJEA 3TADC 4Q44A 5ALZA 2HHVA 4KTQA 1ZOLA 4DQIA 2HDOA 5KFDA 2XI9A 2IOFK 5HP4A 1TE2A 3TAQA 4US8A 4TUPA 4DL6A 2ZXIA 8ICFA 5AICA 3NUQA 1QTMA 5ALMA 5J2GA 2YMLA 1ZQJA 4M9HA 3WK4A 2I6XA 4O9MA 3QEBZ 4FBTA 2Y9UA 2AHOB 2I5HA 2AQ4A 5IIMA 1X40A 3WKDA 2GWSA 4DFPA 1ZQLA 1Q46A 2EAOA 4ED8A 9ICLA 1HJPA 1N5WA 4B9UA 2XC9A 4DOBA 3PSIA 1JI7A 2A1JB 4LJXA 5DKWA 5K4LA 2QB0B 4DQPA 2BQUA 4TUSA 3K1ZA 1ZRMA 2RP5A 4XA5A 4B9MA 2XIDA 3KKAA 4I29A 4FZLA 9ICKA 1TK8A 1QLNA 3IRUA 2F44A 2QARB 5DG9A 4M9JA 3THVA 5ALDA 1NK0A 2MA1A 1YZ6A 5ALXA 4R8UA 5HNKA 5KG6A 4FE3A 2UVWA 4C80A 5KFRA 8ICXA 1UA1A 5J2JA 1WG8A 3F5EA 3SZ2A 2E8MA 4MEYA 3RRGA 2OH2A 4DQSA 4ED3A 1RYSA 1Z19A 1T94A 2W3SA 3V6HA 3V7KA 4F8RA 3K75D 4M6WA 1ZQMA 5KFNA 4Z6FA 4UB5A 2YY6A 2VIXA 4QWEA 4C8LA 1UCVA 1N60A 1ZQIA 2PI4A 5F9NA 2ASJA 1NNLA 1VDVA 1KTQA 2LMRA 1A6SA 3C2KA 1TK5A 8ICAA 4DL5A 1N63A 4U7CA 3PW5A 3SV3A 2NYVA 2ZJAA 1BVSA 5BOLA 1L5UA 3E0FA 1FFVA 5KFSA 1CI4A 4RQ6A 1ZQRA 3AM9A 3S6JA 3SAHA 1QQ5A 2QB1A 2XY5A 3QZ7A 3M6ZA 4B9VA 4JMUA 1NK5A 4P4PA 4IQWA 4Q8EA 1ZQAA 4HYKA 3ZD9A 1ZRNA 4I2BA 2LHTA 4C4SA 1P7DA 1L8LA 3ONNA 7ICMA 2NO5A 1SL2A 2W9BA 2RDJA 4QW9A 3HJEA 4UB8U 3DEEA 9ICXA 3MABA 1T3QA 1HUOA 3QUBA 1Z4OA 1RM6C 4F5QA 1ZD2P 1UHUA 3WK8A 5AKLA 3ZD8A 4KLOA 4O3QA 5DBAA 1L6NA 4ECQA 4IS7A 7ICUA 4DSFA 1T4GA 2R18A 3BS7A 4QZIA 2MU2A 3SQIA 2RQ5A 4Y2RA 1MSWD 2HOQA 1U48A 1TAMA 2ZIUB 1RPLA 3NVWA 2XY7A 4UB4A 3H0LB 5KAIU 3UQ2A 2KIWA 5KFHA 5KFAA 2W7PA 5KL8B 2HSZA 5AM3A 1B43A 3KTQA 4OJ6A 4RQ2A 1B22A 2RRDA 5J8YA 4YMOA 9ICFA 7ICTA 4C8OA 2ZIXA 2BR0A 5AM1A 3C2MA 2K4EA 5AM5A 4C8MA 2YB4A 1NZBA 4DSIA 1KL9A 1ZQUA 9ICPA 1QQ7A 3H0RB 9ICGA 4ACOA 4KLTA 1WCNA 2KEYA 4UASA 5KFGA 1NZPA 3HPOA 1L7OA 5KAFU 4MFCA 5D4BA 5C0YA 2EZXA 9ICOA 2H3QA 2IA6A 3UMBA 3KHGA 1Z4NA 2KFZA 4WJ3B 3SAFA 1XWLA 5DB6A 5IIIA 4EBDA 2A1AA 5KFBA 2HHTA 4JB3A 4J9LA 1BPZA 4O5KA 7ICGA 2MUTB 1VLBA 1XO1A 4CE6A 3HP6A 2OM6A 5DQHA 1ZQVA 7ICPA 1IG6A 4PHPA 3LWMA 3BQ7A 1LB2B 4DSEA 4GC6A 4O5EA 2AGPA 2IMWP 4P4OA 3MBYA 3ZI4A 4C7YA 4GFJA 5EWFA 2A1JA 1SWWA 4TUQA 3NVVA 3QUCA 3AQEA 1RG6A 1L7MA 2F3NA 3AEVA 4AYBF 4R63A 2H5XA 5DB7A 3C23A 4RZRA 3QU5A 2QARA 2G5HB 4GIBA 3E2EA 4NL9C 1L3VA 8ICSA 5ALIA 5ALVA 2FLPA 4ECVA 3PO5A 4BXOA 5FP0A 1UT8A 2LYBA 1RZTA 3RAXA 3JPOA 5AKXA 4UQGA 1S0NA 2KJ5A 3JPTA 1LKYB 3BZCA 4J9OA 1X42A 4DQRA 3HKZC 2WFAA 3CRXA 3PO4A 1N56A 2F1HA 2FPKA 5DLFA 4Y2XA 2HHSA 2IHNA 1ZQQA 2V4QA 1XSLA 9ICNA 1JROA 9ICWA 5JTIA 1SWVA 5HMMA 1WYGA 1PK1A 4AYBC 4NWIA 4NLKA 9ICEA 4I2FA 1WUDA 4XRHA 4ICAA 4LZDA 2ZTCA 3F5AA 9ICQA 1PVRA 3EW9A 4B9TA 4NLZA 3AMZA 3BQ1A 4K4IA 3SI8A 1KFSA 2HCFA 3RRHA 3D2SA 2K89A 1YT3A 5EE9A 1U47A 1LV5A 4PJ0U 3SEIA 3SYZA 3PX0A 3F53A 4Q8FA 3AN1A 4J9QA 5KG4A 3CW2C 2P6RA 2ZIWB 2ES6A 4UAZA 1X9WA 5JU5A 5IIKA 1IIPA 4BGDA 8ICTA 4DQQA 3TADA 4F5OA 2BQRA 4UAVA 2EAMA 5J0YA 4C7ZA 2VANA 4P4MA 4USAA 4ECTA 4QZFA 3RH5A 5IINA 3M8RA 1NJXA 2LM4A 5AHXA 2C2DA 3G6XA 4KX5A 2NRXA 1ZQOA 3PV8A 1BPDA 1F0MA 2XY6A 5DBCA 1D9FA 2FMQA 4KLIA 4F4WA 3QU4A 5DLGA 2DPIA 8ICMA 2WF6A 5EWEA 1HEKA 2LM1A 3HILA 3Q8KA 2K60A 2BQ3A 3DV9A 2WB1F 2VJ5A 2KNJA 3CP8A 3Q8SB 1JX4A 5G5GA 1RYRA 2VJ4A 4CDGA 1NK8A 2J6SA 4C8KA 2HMXA 4KMUA 5J0QA 2YB1A 2G0AA 4Y2QA 1S5LU 4RQ0A 2HBMA 5ALNA 4Z6DA 3QUQA 3RB0A 3QE9Y 5KG1A 4NV0A 4I2EA 1S0MA 2D8CA 2YX8A 4RNMA 3RBEA 1XSPA 8ICEA 4LVSA 4B9LA 2R8IA 5JUMA 2KSOB 2JEIA 1K1QA 9ICTA 3F2DA 3BS5B 5D49A 2JR5A 2JRZA 2BCQA 2P35A 1O03A 2MUTA 2W04A 5IILA 1NK4A 1ZETA 8ICYA 3G6YA 1JUDA 3RB4A 3PW7A 2HHQA 3TARA 3M9NB 1ZD4A 4MFAA 5AKHA 2KZMA 2PMZC 8ICZA 4DLEA 4K4GA 4RQMA 4J9KA 3GV7B 5J0PA 4M9LA 4NM1A 3C21A 4YFKA 3WKBA 3ALRA 4YR3A 3VCBA 4M47A 2PFNA 1S10A 5KG2A 4ECUA 4EZ6A 4M04A 4O3PA 7ICEA 2VA8A 1Z00A 3QU9A 4DL4A 2YN4A 3O0FA 5L1MA 1SL0A 1COKA 4F2RA 3NRWA 4G9BA 5DDMA 3Q8LA 2HOIA 2GO7A 3RB3A 3EPGA 3NTUA 4KLGA 2XCPA 4Y2JA 3T5KA 4I2DA 5EE0A 1UPHA 2BPFA 1KFDA 7ICRA 1BNOA 5DGAA 5B66U 3V6JA 4KLFA 1TK0A 4NLGA 3HX0A 3ISCA 1XS9D 1L7PA 3IDWA 8ICKA 8ICCA 1S77D 1D8BA 3GIJA 5CHGA 1X6JA 2ZUDA 2KOBA 2PFQA 1X9MA 4OD0A 1Z1VA 4J9MA 4ELTA 4MHVA 4F2SA 1M6YA 1RYUA 3M8SA 1ZQBA 2H3IA 3UPQA 1A77A 5D46A 4YG2A 2UVRA 3FAHA 4GXIA 3NGDA 1ZQKA 3F2CA 4X5VA 5DDYA 4RUCA 4O3NA 4QWCA 1QSSA 2KVCA 3K4GA 4DOAA 2P6UA 4HAIA 4I2IA 5F3XB 2WTFA 4J9PA 3QEAZ 2LI6A 2JMGA 4UW9A 1ECWA 2DL0A 4U6PA 1J2NA 1X6IA 2CRXA 3CYMA 3T3FA 3ZDBA 2Y1IA 1MQ2A 4BUGA 2ZIWA 1Z3EB 3GZFA 2XVTA 4IC9A 3C2LA 4CF4A 7ICFA 7ICLA 5AI5A 5AK5A 5KFXA 3MR2A 2OCEA 2AJQA 2I9GA 3C29A 4Z6EA 4NXZA 3UXOA 3KZXA 3WK5A 1AQ6A 2F76X 1Y88A 4UBBA 3RJGA 2EZZA 4CRXA 5TISU 2OHFA 2JEJA 3KZIU 2P66A 1KDHA 2HBKA 3EYZA 3PSTA 4Y2VA 3B9JA 4M9GA 1K5OA 4UAUA 5KG0A 2DUYA 1TFRA 2D6FC 4DWIA 4QZCA 5KT3A 4AP9A 5EWGA 4E0DA 1J97A 4F4KA 4QIWF 4EX7A 3TQ1A 1N48A 2XICA 1ZQZA 2Q4TA 4I27A 3HWTA 1X9SA 4YP3A 3PR4A 2ZUBA 5CB1A 7ICOA 5KT7A 3EUB2 2HI0A 3D2NA 4O3OA 8ICWA 1SXEA 4YMNA 1KKXA 5ALKA 2KHVA 1SIJA 4NL9A 4FS2A 5CJ7A 2GOLA 1BPEA 4YR2A 3OJUA 4PL2A 1JN3A 1KRPA 1XU4A 2ZG6A 1QQ6A 5KFOA 4I2JA 3IM1A 9ICHA 2KSOA 3C5FA 4OJPA 2R8KA 3BS5A 1J2MA 4QIWC 1ED1A 5A0LA 1S0OA 3IG5A 1X2IA 4F5NA 1IXRA 1UA0A 2IOHA 3JPPA 2MSNA 4F3OA 3WKEA 5AI4A 2PI5A 1PZNA 1ZQEA 4JV1A 5KFLA 5ALPA 4DS5A 2DWQA 2W8KA 3WK6A 1PK3A 3SD7A 5ALGA 1ZQ1C 2F8LA 5KFYA 5KFJA 2O6KA 3NASA 7ICQA 2HOFA 4GXKA 4YXMA 4YN4A 4Y2SA 2K4PA 2EDUA 2XCAA 7ICHA 5J2DA 9ICVA 4RQNA 2Y1JA 2DFLA 2R8JA 3OGUA 2QKQA 4IQUA 4CF5A 4KN4A 5DQIA 2E8PA 2IHMA 4ECSA 5J0TA 3PX6A 5CA7A 3LYSA 1U49A 2JXJA 3VC8A 2DF4B 4R65A 7ICKA 5J0OA 3DDHA 3JPNA 2KJ9A 5J0SA 4UARA 3RR7A 2RDIA 2FE9A 3L5KA 2FPMA 9ICRA 5KG3A 3BDPA 2ATLA 4MF8A 3ISBA 4ED7A 4DFDA 1EXNA 3MGVA 4B6JA 4LZGA 1RXWA 2I1QA 2QLTA 3BJYA 1PVQA 3NVYA 1ZQXA 4XUSA 1FFUA 1TV9A 2HHWA 2JEGA 3K1RB 2Q0ZX 5HR7A 3V7LA 4BX9C 4TQSA 3V7JA 1NJYA 4QZ8A 4UAWA 1SKRA 2NRTA 5KTQA 4RPZA 5AKYA 2J6TA 5AK6A 5ALSA 4NLNA 5J0WA 4F4YA 2DKZA 2C22A 4B9SA 1KN5A 1FO4A 1QCKA 2QB0A 2BCRA 2OXOA 2EAPA 3LVWA 4KITB 5J2EA 3GIMA 1F5SA 3L3FX 3PW4A 1V38A 3MDAA 4GXJA 1FIQA 2M9NA 2ZIVB 1N62A 4O3MA 1ZQSA 2BPCA 1PVPA 4C8NA 4DF4A 3D6JA 3I1YA 2E5SA 1V97A 2AGOA 4Y2YA 2W54A 2NRZA 4IRCA 4O3RA 3MGHA 4YMMA 1JMSA 4PGXA 3QXGA 2R8HA 3RJIA 5CR0A 3WU2U 5CEHA 3IN5A 2LKYA 1NJZA 4F5PA 4TURA 2CXYA 4EBCA 3IV6A 5IIJA 4EELA 3WKCA 5CP2A 1ZQTA 2XGQA 2EH9A 3FYHA 4UB2A 3UXPA 2C2RA 2AGQA 4PGYA 4GC7A 3RF9A 3V6KA 3PMLA 1O08A 4PHDA 3C5GA 1SV0C 5J0UA 2ASLA 1K1SA 5B5EU 2D3DA 5L1JA 3SMVA 5AM0A 2JEFA 3TKAA 5HMLA 4XQ8A 2N1RA 2IBKA 4NM2A 1JXLA 4YCXA 5DG7A 3PMNA 3GILA 5DGBA 4IRKA 4J03A 4RPYA 1KSPA 1N5XA 2W3RA 2XO7A 5H2FU 2V9WA 1AROP 2ZUCA 4M0AA 8ICOA 4MEXA 5L9XA 4YD1A 1N61A 2EANA 4UAYA 2BZFA 1S76D 1KLNA 3AQFA 4QZ9A 1MQ3A 2KP7A 4O5CA 2Y0SF 3BQTA 1SZPA 2LYHA 4BWJA 1VJ5A 2ZIUA 5GTIU 4ECWA 8ICUA 1XSNA
chains in the Genus database with same CATH topology
1WUDA 2K8BB 2G0AA 2E5SA 2HBMA 4JMUA 4ICAA 4P0QB 4PL1A 3HKZF 3F5AA 4OJLA 4C0ZA 1PVRA 2WAQF 4NV0A 1KBUA 3M7DA 1D8BA 2XICA 4QNLA 2KV2A 3N7SC 5HR6A 2KKPA 2KOBA 2Q4TA 3KFUF 2LHTA 1P7DA 2G08A 1CRXA 3ONNA 2YX8A 2LYAA 2ZIVA 3LYSA 2OM6A 3VC8A 1F44A 2RHFA 3PSIA 2G06A 2W7OA 2DF4B 2HBLA 3DEEA 2JH1A 3D2NA 3PSPA 2H3IA 4CGZA 3D2SA 2K89A 2ZIXB 2CPRA 1YT3A 2JGAA 2DQNB 3SAGA 5T14A 3F2DA 1XO0A 2KJ9A 3N7PD 2OYYA 3H0MB 4NLBA 2NV3A 4OJ5A 2KHVA 2LKYA 3IN5A 3K1ZA 2RP5A 4P0QA 2YB1A 3F53A 2XIDA 2KKVA 4FZLA 2A3VA 4NLCA 2G07A 1Q3UA 3F2CA 2GOLA 2W04A 1SZHA 2F2AB 2G09A 2ZIWB 4PL2A 5HR7A 1OUQA 3MGVA 2KVCA 2Y0SC 4KX3A 3C28A 4GFJA 2ZG6A 1IIPA 2K4HA 4A8EA 1DRGA 4FZNA 3IP4B 2CN1A 3PSFA 1HIWA 4OO1J 1L6NA 2MA1A 2Z7JA 4FE3A 2MRLA 2R18A 4OJPA 2H3ZA 3AQEA 1PVQA 2BDUA 2GH1A 2JMGA 2VKQA 3RF9A 3SQIA 1ECWA 4QIWC 4U6PA 2PMZC 1ED1A 2HOQA 1TAMA 2ZIUB 5A0LA 2CRXA 3IG5A 1XNSA 3OPXA 4BX9C 4P0PB 2HBJA 2E1EA 3CYMA 1URJA 3F5EA 4AYBF 4FZMA 5KL1B 2WAQC 3M6KA 2DGZA 2K8AA 3H0LB 2G5IB 2KHQA 2K4IA 3SMVA 4OJOA 2KIWA 2ZIWA 1GO3F 4BUGA 3PZPA 2OH2A 1A0PA 2WB1C 3ALRA 2G5HB 2K8CB 2W7PA 4KX5A 3GZFA 5KL8B 1Z19A 1T94A 2XVTA 3AL0B 4IC9A 2KJ8A 2N1RA 3VCBA 4OJ6A 2H3FA 2VIXA 2RRDA 2LYBA 2ZIXA 2W03A 4P0PA 2KJ5A 3C29A 3IG8A 1A6SA 2PMZF 2ZXHA 2OXOA 2K4EA 1ZQ1C 2F8LA 3D2QA 3HKZC 3CRXA 2JH7A 3LVWA 2H3VA 2YB4A 3KZXA 3O0FA 1NZBA 2F76X 2HOFA 1Q3VA 3H0RB 3NRWA 2E1FA 3L3FX 1HEKA 2XI9A 4ACOA 4CRXA 4U7CA 2HOIA 1Z1BA 3RFAA 3N7RC 2KEYA 2F77X 2WB1F 2VJ5A 2KNJA 3CP8A 1MA7A 3AQFA 4QJFB 2HBKA 2KD1A 3F2BA 2VJ4A 3E0FA 1UPHA 2Y0SF 2ZXIA 3LVVA 2KICA 2ZIVB 3PSTA 4KMOB 4O3MA 5CRXA 3GU3A 5C0YA 1PVPA 3NUQA 2LBOA 2H3QA 2D6FC 3ICXA 4CDGA 4AYBC 2ZIUA 3SAHA 4NWIA 4BJQA 3T79A 2HMXA 2M0NA 2JHDA 4WJ3B 3SAFA 3M6ZA 4QIWF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WB1 C;  2WAQ C;  3HKZ C;  4AYB C;  4QIW C;  2PMZ C;  2Y0S C; 
#chains in the Genus database with same CATH topology
 1TAQ A;  1BPX A;  3RH6 A;  2B21 A;  2HW3 A;  5J29 A;  8ICB A;  3LWL A;  2W9A A;  3N97 B;  1NI3 A;  9ICM A;  3QUT A;  1N2X A;  1UT5 A;  4QZE A;  2VA2 A;  2HVH A;  3NRZ A;  4GLX A;  2DQN B;  5EOZ A;  2ZJ8 A;  2FLN A;  2PFP A;  2KG5 A;  2AH5 A;  2KKV A;  1DGS A;  5KFF A;  1KFT A;  4NLC A;  2G07 A;  3RAQ A;  2KZZ A;  3WK9 A;  5JRT A;  3GV5 B;  2ZTE A;  2FLL A;  3PW0 A;  5AM2 A;  2Y0S C;  3N28 A;  1JIH A;  4KLQ A;  5KFQ A;  4DO9 A;  1HIW A;  4BDP A;  4EYI B;  1QH9 A;  2BKE A;  4I28 A;  2BDP A;  4PZO A;  4RUA A;  2KIV A;  4F93 B;  3QX7 A;  4UB3 A;  4FZM A;  8ICR A;  4QWD A;  1NKB A;  2JV3 A;  4QZB A;  2WB1 C;  3OHA A;  1QSY A;  4B9N A;  1DOQ A;  2F1I A;  5AKE A;  5ALH A;  3GFK B;  5CWR A;  1JXE A;  1A76 A;  5ALO A;  5BOM A;  4DL2 A;  4JV2 A;  2W9C B;  1NK6 A;  2BPG A;  4DEZ A;  1Q3V A;  4F50 A;  8ICJ A;  2PKE A;  1ZQG A;  3A0B U;  1NKE A;  3N7R C;  1NK7 A;  9ICC A;  8ICV A;  1FEZ A;  1ZJM A;  5CRX A;  4RNO A;  7ICN A;  3QU7 A;  4ELV A;  4BJQ A;  3H8W A;  3T79 A;  2YMQ A;  1Q8K A;  1TVA A;  2E8O A;  1U45 A;  5AKG A;  3RJF A;  4P0Q B;  5TZV A;  8ICI A;  5DG8 A;  5J0X A;  1KBU A;  3JPR A;  2KK0 A;  1L3T A;  5AKK A;  2KE7 A;  3PNC A;  3KFU F;  2ZIV A;  3TAC B;  1U4B A;  1SKW A;  2DKX A;  3Q8Q B;  3BQ2 A;  3UQ0 A;  4PPX A;  1LKY A;  2ZIX B;  3SAG A;  5DB9 A;  5J2A A;  2OWO A;  3TFS A;  4EEY A;  1D8Y A;  2WF9 A;  4ED2 A;  3MR5 A;  3GII A;  3R9K A;  3B0X A;  1SZH A;  2G09 A;  3BZK A;  5BPC A;  4DLG A;  3RTV A;  4RQ5 A;  1ZQF A;  1U9L A;  2CN1 A;  3EZ5 A;  9ICA A;  3SV4 A;  4PHA A;  5AI8 A;  2BDU A;  2GH1 A;  3ETL A;  4DSL A;  2MAX A;  4F91 B;  2BCV A;  3OPX A;  2ALZ A;  2KHQ A;  4IQV A;  4ECR A;  3PZP A;  2ISO A;  4JWM A;  9ICB A;  1SXD A;  2KN7 A;  2F1J A;  3PX4 A;  3H4D A;  2KJ8 A;  7ICJ A;  9ICS A;  1H38 A;  3AU2 A;  4RQ7 A;  2KFN A;  5AK3 A;  5KNI A;  4US9 A;  4KLS A;  3KBB A;  1TKD A;  4FO6 A;  4C4T A;  4R64 A;  5ALE A;  5DQG A;  4PHE A;  5C5J A;  2F8K A;  4CNQ A;  3V72 A;  1MN8 A;  2AQ0 A;  2BCU A;  5ALF A;  5ALU A;  3F2B A;  1IM4 A;  1CEZ A;  5AKI A;  4UB6 U;  4JK1 A;  3GV8 B;  3ED5 A;  2M0N A;  2YMP A;  2K8B B;  5AIB A;  4KLD A;  4YR0 A;  5G5H A;  4OJL A;  4C0Z A;  1V9P A;  3M7D A;  5HR6 A;  2KKP A;  3T5J A;  3NVZ A;  2PFO A;  1S97 A;  3J81 j;  2WF5 A;  1B4F A;  2L5Y A;  1F44 A;  2RHF A;  2G06 A;  2JZB B;  1DK2 A;  2JH1 A;  4YVZ A;  4BXO B;  1ZYQ A;  2CPR A;  4IR1 A;  2NV3 A;  2ODG A;  1ZD5 A;  3AUO A;  1WWV A;  4ZH4 A;  1XC9 A;  3PR5 B;  3GQC A;  2K4H A;  1DRG A;  3PSF A;  1YZ7 A;  2AU0 A;  2J6U A;  4DFJ A;  2YMM A;  4F72 A;  1PK1 B;  4DS4 A;  3RJK A;  4P0P B;  1XNS A;  1URJ A;  1SGG A;  1C20 A;  3OJS A;  4OJO A;  3AL0 B;  5DBB A;  5AI0 A;  2R8G A;  2H3F A;  1X66 A;  4ED6 A;  4K4H A;  2UVV A;  2KMD A;  3KOO A;  5HHH A;  2XGP A;  2ASD A;  5J2I A;  5DB8 A;  2ZXH A;  3OSP A;  3Q8P B;  4JUZ A;  3C1Y A;  1ZQH A;  2C2E A;  2JH7 A;  2H3V A;  5KT5 A;  2V4R A;  1DXS A;  2BHN A;  4NJ8 A;  1X9X A;  3TAP A;  3N4M B;  1Z1B A;  5AIA A;  4PGQ A;  4C4R A;  4KMO B;  3LVV A;  3B0Y A;  1ZQY A;  3QNM A;  3C1Z A;  1NK9 A;  3ZDD A;  5L1K A;  2W9C A;  2YQE A;  5KFM A;  5ALW A;  4PL1 A;  5KFP A;  2WAQ F;  1C7Y A;  3EPI A;  1NOM A;  3N7S C;  4DL7 A;  1DGJ A;  2EQY A;  5KFW A;  1CRX A;  1SV0 A;  4ZOH C;  4DCC A;  4PZN A;  2W7O A;  2HBL A;  1COO A;  1RXV A;  5T14 A;  2JGA A;  1XO0 A;  2ZJ5 A;  3H0M B;  7ICV A;  2W9M A;  3QU2 A;  4P0Q A;  4RQ1 A;  3M9M B;  2KTQ A;  4EZ9 A;  4DSK A;  2IOF A;  4IQT A;  2F2A B;  4CCH A;  4QW8 A;  4KX3 A;  5J2B A;  3C28 A;  1JAL A;  3NS1 A;  5KG5 A;  1KQQ A;  4YD2 A;  1KEJ A;  4EBE A;  1SL1 A;  5KG7 A;  2C28 A;  5EE3 A;  3H8M A;  4ED1 A;  1ZJN A;  2WAQ C;  3M6K A;  2DGZ A;  2K8A A;  4I2C A;  4Y2T A;  4Y2U A;  5KT2 A;  1OXJ A;  2A19 A;  5KFK A;  3KKA C;  3UMG A;  1WWU A;  5L1L A;  3QYP A;  1ZXI A;  5L1I A;  3H4B A;  1QSL A;  3I76 A;  2RLT A;  3QZ8 A;  4KLH A;  8ICP A;  4ECX A;  3TFR A;  3D2Q A;  2VA3 A;  3MGI A;  4RQ3 A;  2B6G A;  2ISP A;  3CNH A;  4EYH B;  2E1F A;  5J0R A;  5HHI A;  3OSN A;  2E8N A;  8ICG A;  3HW8 A;  3Q8M A;  4JWN A;  4IL6 U;  3RJJ A;  2NO4 A;  4KLL A;  3GU3 A;  4KLM A;  4UBC A;  3L4P A;  3ICX A;  2BCS A;  4EEN A;  1D8L A;  1BPY A;  5KFE A;  2KVS A;  3MR6 A;  4F4Z A;  3H40 A;  1T7P A;  3HKZ F;  4QZA A;  2W43 A;  4QNL A;  3RB6 A;  5KFT A;  3LK9 A;  4YQW A;  3H8J A;  5J2C A;  4Q43 A;  1S9F A;  4G3I A;  3PVX A;  1NKC A;  2Y9T A;  1RQL A;  5F9L A;  4CF3 A;  4NLB A;  1V85 A;  1WCL A;  1S8O A;  1Z00 B;  1ZD3 A;  3OTQ A;  4KN7 A;  3M9O B;  3RR8 A;  2ESE A;  4KLE A;  1Q3U A;  9ICU A;  5AM4 A;  2FPL A;  2JZB A;  4A8E A;  1BPB A;  4RT2 A;  2MRL A;  9ICI A;  2H3Z A;  4QZG A;  2VKQ A;  5AKJ A;  4FS1 A;  1RQN A;  3TAN A;  1SV4 A;  3JPQ A;  2G5I B;  3RH4 A;  3RJH A;  4FFD A;  1GO3 F;  1LVH A;  1RDF A;  2K8C B;  3UXN A;  4KLU A;  3FM9 A;  2UVU A;  4ELU A;  3KHL A;  2DBY A;  5ALQ A;  4F71 A;  5ALT A;  4DFM A;  4P0P A;  3G6V A;  2FJ6 A;  4RQ8 A;  3ZDE A;  5J2H A;  4Z6C A;  3UMC A;  3H8S A;  2HHU A;  3KHR A;  4M9N A;  4QZH A;  1PUZ A;  4I2G A;  3A0H U;  1ZQC A;  5AI9 A;  3MDC A;  4UB1 A;  2F77 X;  5GTH U;  4QJF B;  2KD1 A;  7ICS A;  1NJW A;  5KFZ A;  4F4X A;  4I2A A;  2B0C A;  4RQ4 A;  3Q8R B;  3SEN A;  2JHD A;  5ALR A;  8ICH A;  4EX6 A;  2FMS A;  5J8Y C;  3ZDC A;  8ICQ A;  2BGW A;  3MC1 A;  3SR6 A;  2KV2 A;  5AI6 A;  5AKZ A;  2W55 A;  2G08 A;  4UAT A;  4QWA A;  5E79 U;  3PSP A;  1SB3 C;  4R8U B;  4RT3 A;  1JRP A;  5ALJ A;  4OJ5 A;  3IHQ B;  5IIO A;  4J9N A;  3TI0 A;  3MR3 A;  5AK4 A;  3MFH A;  4MF2 A;  2DPJ A;  2WF7 A;  3ISD A;  5KFV A;  4DL3 A;  1L3S A;  2NRV A;  3T5H A;  3KD3 A;  4DFK A;  4FZN A;  3IP4 B;  4DOC A;  4M6W B;  1L7N A;  2Z7J A;  4J9R A;  4OCZ A;  3LDA A;  5J2K A;  7ICI A;  4RU9 A;  2PXI A;  2KZ3 A;  3ETR A;  2HBJ A;  2E1E A;  4O0I A;  5KL1 B;  4F5R A;  4BWM A;  1A0P A;  2WHE A;  1UQV A;  3WK7 A;  1D9D A;  5ALL A;  5KT4 A;  3MFI A;  3UM9 A;  2LPE A;  5KFU A;  4Q45 A;  2FMP A;  1BGX T;  4RPX A;  1OW5 A;  2ZTD A;  3PY8 A;  3IG8 A;  3HT3 A;  1MC8 A;  2PMZ F;  1T8E A;  1L8O A;  1HUZ A;  5KFI A;  2WF8 A;  1L3U A;  2HVI A;  4P2H A;  2W8L A;  3PW2 A;  4TQR A;  2OEH A;  2GLE A;  4FBU A;  3RFA A;  4ECY A;  3KHH A;  4ED0 A;  1MA7 A;  4IR9 A;  1S0V A;  3T5L A;  2KIC A;  1IV8 A;  2LBO A;  2W9B B;  3ZDA A;  3U26 A;  5J2F A;  4IRD A;  3ORY A;  3AU6 A;  2FDR A;  4RNN A;  3BQ0 A;  4QWB A;  4PH5 A;  3M1Y A;  1BNP A;  3JPS A;  2LYA A;  4O3S A;  5EE1 A;  2YTU A;  4CGZ A;  4I2H A;  3EWA A;  2AXT U;  8ICL A;  3N7P D;  1DK3 A;  2OYY A;  4NY8 A;  3GIK A;  1SKS A;  3H7I A;  2A3V A;  4Y2P A;  5ALY A;  3GDX A;  1ZQD A;  3E58 A;  1OUQ A;  5KT6 A;  4J9S A;  4MFF A;  4OO1 J;  4R66 A;  3HRD D;  4YXJ A;  3I28 A;  2FI1 A;  1ZQW A;  4EEK A;  3FC4 A;  4ECZ A;  2EZY A;  3RBD A;  9ICJ A;  4DF8 A;  4JV0 A;  2HHX A;  2K4I A;  1ZQN A;  1TAU A;  1T3N A;  4M2Y A;  4DSJ A;  8ICN A;  2W11 A;  3OHB A;  1B0X A;  2NRW A;  1CUK A;  3WKA A;  4F92 B;  3FDS A;  5KFC A;  4QZD A;  2W03 A;  4KLJ A;  1ZQP A;  1KW4 A;  2E3T A;  3RJE A;  3TAD C;  4Q44 A;  5ALZ A;  2HHV A;  4KTQ A;  1ZOL A;  4DQI A;  2HDO A;  5KFD A;  2XI9 A;  2IOF K;  5HP4 A;  1TE2 A;  3TAQ A;  4US8 A;  4TUP A;  4DL6 A;  2ZXI A;  8ICF A;  5AIC A;  3NUQ A;  1QTM A;  5ALM A;  5J2G A;  2YML A;  1ZQJ A;  4M9H A;  3WK4 A;  2I6X A;  4O9M A;  3QEB Z;  4FBT A;  2Y9U A;  2AHO B;  2I5H A;  2AQ4 A;  5IIM A;  1X40 A;  3WKD A;  2GWS A;  4DFP A;  1ZQL A;  1Q46 A;  2EAO A;  4ED8 A;  9ICL A;  1HJP A;  1N5W A;  4B9U A;  2XC9 A;  4DOB A;  3PSI A;  1JI7 A;  2A1J B;  4LJX A;  5DKW A;  5K4L A;  2QB0 B;  4DQP A;  2BQU A;  4TUS A;  3K1Z A;  1ZRM A;  2RP5 A;  4XA5 A;  4B9M A;  2XID A;  3KKA A;  4I29 A;  4FZL A;  9ICK A;  1TK8 A;  1QLN A;  3IRU A;  2F44 A;  2QAR B;  5DG9 A;  4M9J A;  3THV A;  5ALD A;  1NK0 A;  2MA1 A;  1YZ6 A;  5ALX A;  4R8U A;  5HNK A;  5KG6 A;  4FE3 A;  2UVW A;  4C80 A;  5KFR A;  8ICX A;  1UA1 A;  5J2J A;  1WG8 A;  3F5E A;  3SZ2 A;  2E8M A;  4MEY A;  3RRG A;  2OH2 A;  4DQS A;  4ED3 A;  1RYS A;  1Z19 A;  1T94 A;  2W3S A;  3V6H A;  3V7K A;  4F8R A;  3K75 D;  4M6W A;  1ZQM A;  5KFN A;  4Z6F A;  4UB5 A;  2YY6 A;  2VIX A;  4QWE A;  4C8L A;  1UCV A;  1N60 A;  1ZQI A;  2PI4 A;  5F9N A;  2ASJ A;  1NNL A;  1VDV A;  1KTQ A;  2LMR A;  1A6S A;  3C2K A;  1TK5 A;  8ICA A;  4DL5 A;  1N63 A;  4U7C A;  3PW5 A;  3SV3 A;  2NYV A;  2ZJA A;  1BVS A;  5BOL A;  1L5U A;  3E0F A;  1FFV A;  5KFS A;  1CI4 A;  4RQ6 A;  1ZQR A;  3AM9 A;  3S6J A;  3SAH A;  1QQ5 A;  2QB1 A;  2XY5 A;  3QZ7 A;  3M6Z A;  4B9V A;  4JMU A;  1NK5 A;  4P4P A;  4IQW A;  4Q8E A;  1ZQA A;  4HYK A;  3ZD9 A;  1ZRN A;  4I2B A;  2LHT A;  4C4S A;  1P7D A;  1L8L A;  3ONN A;  7ICM A;  2NO5 A;  1SL2 A;  2W9B A;  2RDJ A;  4QW9 A;  3HJE A;  4UB8 U;  3DEE A;  9ICX A;  3MAB A;  1T3Q A;  1HUO A;  3QUB A;  1Z4O A;  1RM6 C;  4F5Q A;  1ZD2 P;  1UHU A;  3WK8 A;  5AKL A;  3ZD8 A;  4KLO A;  4O3Q A;  5DBA A;  1L6N A;  4ECQ A;  4IS7 A;  7ICU A;  4DSF A;  1T4G A;  2R18 A;  3BS7 A;  4QZI A;  2MU2 A;  3SQI A;  2RQ5 A;  4Y2R A;  1MSW D;  2HOQ A;  1U48 A;  1TAM A;  2ZIU B;  1RPL A;  3NVW A;  2XY7 A;  4UB4 A;  3H0L B;  5KAI U;  3UQ2 A;  2KIW A;  5KFH A;  5KFA A;  2W7P A;  5KL8 B;  2HSZ A;  5AM3 A;  1B43 A;  3KTQ A;  4OJ6 A;  4RQ2 A;  1B22 A;  2RRD A;  5J8Y A;  4YMO A;  9ICF A;  7ICT A;  4C8O A;  2ZIX A;  2BR0 A;  5AM1 A;  3C2M A;  2K4E A;  5AM5 A;  4C8M A;  2YB4 A;  1NZB A;  4DSI A;  1KL9 A;  1ZQU A;  9ICP A;  1QQ7 A;  3H0R B;  9ICG A;  4ACO A;  4KLT A;  1WCN A;  2KEY A;  4UAS A;  5KFG A;  1NZP A;  3HPO A;  1L7O A;  5KAF U;  4MFC A;  5D4B A;  5C0Y A;  2EZX A;  9ICO A;  2H3Q A;  2IA6 A;  3UMB A;  3KHG A;  1Z4N A;  2KFZ A;  4WJ3 B;  3SAF A;  1XWL A;  5DB6 A;  5III A;  4EBD A;  2A1A A;  5KFB A;  2HHT A;  4JB3 A;  4J9L A;  1BPZ A;  4O5K A;  7ICG A;  2MUT B;  1VLB A;  1XO1 A;  4CE6 A;  3HP6 A;  2OM6 A;  5DQH A;  1ZQV A;  7ICP A;  1IG6 A;  4PHP A;  3LWM A;  3BQ7 A;  1LB2 B;  4DSE A;  4GC6 A;  4O5E A;  2AGP A;  2IMW P;  4P4O A;  3MBY A;  3ZI4 A;  4C7Y A;  4GFJ A;  5EWF A;  2A1J A;  1SWW A;  4TUQ A;  3NVV A;  3QUC A;  3AQE A;  1RG6 A;  1L7M A;  2F3N A;  3AEV A;  4AYB F;  4R63 A;  2H5X A;  5DB7 A;  3C23 A;  4RZR A;  3QU5 A;  2QAR A;  2G5H B;  4GIB A;  3E2E A;  4NL9 C;  1L3V A;  8ICS A;  5ALI A;  5ALV A;  2FLP A;  4ECV A;  3PO5 A;  4BXO A;  5FP0 A;  1UT8 A;  2LYB A;  1RZT A;  3RAX A;  3JPO A;  5AKX A;  4UQG A;  1S0N A;  2KJ5 A;  3JPT A;  1LKY B;  3BZC A;  4J9O A;  1X42 A;  4DQR A;  3HKZ C;  2WFA A;  3CRX A;  3PO4 A;  1N56 A;  2F1H A;  2FPK A;  5DLF A;  4Y2X A;  2HHS A;  2IHN A;  1ZQQ A;  2V4Q A;  1XSL A;  9ICN A;  1JRO A;  9ICW A;  5JTI A;  1SWV A;  5HMM A;  1WYG A;  1PK1 A;  4AYB C;  4NWI A;  4NLK A;  9ICE A;  4I2F A;  1WUD A;  4XRH A;  4ICA A;  4LZD A;  2ZTC A;  3F5A A;  9ICQ A;  1PVR A;  3EW9 A;  4B9T A;  4NLZ A;  3AMZ A;  3BQ1 A;  4K4I A;  3SI8 A;  1KFS A;  2HCF A;  3RRH A;  3D2S A;  2K89 A;  1YT3 A;  5EE9 A;  1U47 A;  1LV5 A;  4PJ0 U;  3SEI A;  3SYZ A;  3PX0 A;  3F53 A;  4Q8F A;  3AN1 A;  4J9Q A;  5KG4 A;  3CW2 C;  2P6R A;  2ZIW B;  2ES6 A;  4UAZ A;  1X9W A;  5JU5 A;  5IIK A;  1IIP A;  4BGD A;  8ICT A;  4DQQ A;  3TAD A;  4F5O A;  2BQR A;  4UAV A;  2EAM A;  5J0Y A;  4C7Z A;  2VAN A;  4P4M A;  4USA A;  4ECT A;  4QZF A;  3RH5 A;  5IIN A;  3M8R A;  1NJX A;  2LM4 A;  5AHX A;  2C2D A;  3G6X A;  4KX5 A;  2NRX A;  1ZQO A;  3PV8 A;  1BPD A;  1F0M A;  2XY6 A;  5DBC A;  1D9F A;  2FMQ A;  4KLI A;  4F4W A;  3QU4 A;  5DLG A;  2DPI A;  8ICM A;  2WF6 A;  5EWE A;  1HEK A;  2LM1 A;  3HIL A;  3Q8K A;  2K60 A;  2BQ3 A;  3DV9 A;  2WB1 F;  2VJ5 A;  2KNJ A;  3CP8 A;  3Q8S B;  1JX4 A;  5G5G A;  1RYR A;  2VJ4 A;  4CDG A;  1NK8 A;  2J6S A;  4C8K A;  2HMX A;  4KMU A;  5J0Q A;  2YB1 A;  2G0A A;  4Y2Q A;  1S5L U;  4RQ0 A;  2HBM A;  5ALN A;  4Z6D A;  3QUQ A;  3RB0 A;  3QE9 Y;  5KG1 A;  4NV0 A;  4I2E A;  1S0M A;  2D8C A;  2YX8 A;  4RNM A;  3RBE A;  1XSP A;  8ICE A;  4LVS A;  4B9L A;  2R8I A;  5JUM A;  2KSO B;  2JEI A;  1K1Q A;  9ICT A;  3F2D A;  3BS5 B;  5D49 A;  2JR5 A;  2JRZ A;  2BCQ A;  2P35 A;  1O03 A;  2MUT A;  2W04 A;  5IIL A;  1NK4 A;  1ZET A;  8ICY A;  3G6Y A;  1JUD A;  3RB4 A;  3PW7 A;  2HHQ A;  3TAR A;  3M9N B;  1ZD4 A;  4MFA A;  5AKH A;  2KZM A;  2PMZ C;  8ICZ A;  4DLE A;  4K4G A;  4RQM A;  4J9K A;  3GV7 B;  5J0P A;  4M9L A;  4NM1 A;  3C21 A;  4YFK A;  3WKB A;  3ALR A;  4YR3 A;  3VCB A;  4M47 A;  2PFN A;  1S10 A;  5KG2 A;  4ECU A;  4EZ6 A;  4M04 A;  4O3P A;  7ICE A;  2VA8 A;  1Z00 A;  3QU9 A;  4DL4 A;  2YN4 A;  3O0F A;  5L1M A;  1SL0 A;  1COK A;  4F2R A;  3NRW A;  4G9B A;  5DDM A;  3Q8L A;  2HOI A;  2GO7 A;  3RB3 A;  3EPG A;  3NTU A;  4KLG A;  2XCP A;  4Y2J A;  3T5K A;  4I2D A;  5EE0 A;  1UPH A;  2BPF A;  1KFD A;  7ICR A;  1BNO A;  5DGA A;  5B66 U;  3V6J A;  4KLF A;  1TK0 A;  4NLG A;  3HX0 A;  3ISC A;  1XS9 D;  1L7P A;  3IDW A;  8ICK A;  8ICC A;  1S77 D;  1D8B A;  3GIJ A;  5CHG A;  1X6J A;  2ZUD A;  2KOB A;  2PFQ A;  1X9M A;  4OD0 A;  1Z1V A;  4J9M A;  4ELT A;  4MHV A;  4F2S A;  1M6Y A;  1RYU A;  3M8S A;  1ZQB A;  2H3I A;  3UPQ A;  1A77 A;  5D46 A;  4YG2 A;  2UVR A;  3FAH A;  4GXI A;  3NGD A;  1ZQK A;  3F2C A;  4X5V A;  5DDY A;  4RUC A;  4O3N A;  4QWC A;  1QSS A;  2KVC A;  3K4G A;  4DOA A;  2P6U A;  4HAI A;  4I2I A;  5F3X B;  2WTF A;  4J9P A;  3QEA Z;  2LI6 A;  2JMG A;  4UW9 A;  1ECW A;  2DL0 A;  4U6P A;  1J2N A;  1X6I A;  2CRX A;  3CYM A;  3T3F A;  3ZDB A;  2Y1I A;  1MQ2 A;  4BUG A;  2ZIW A;  1Z3E B;  3GZF A;  2XVT A;  4IC9 A;  3C2L A;  4CF4 A;  7ICF A;  7ICL A;  5AI5 A;  5AK5 A;  5KFX A;  3MR2 A;  2OCE A;  2AJQ A;  2I9G A;  3C29 A;  4Z6E A;  4NXZ A;  3UXO A;  3KZX A;  3WK5 A;  1AQ6 A;  2F76 X;  1Y88 A;  4UBB A;  3RJG A;  2EZZ A;  4CRX A;  5TIS U;  2OHF A;  2JEJ A;  3KZI U;  2P66 A;  1KDH A;  2HBK A;  3EYZ A;  3PST A;  4Y2V A;  3B9J A;  4M9G A;  1K5O A;  4UAU A;  5KG0 A;  2DUY A;  1TFR A;  2D6F C;  4DWI A;  4QZC A;  5KT3 A;  4AP9 A;  5EWG A;  4E0D A;  1J97 A;  4F4K A;  4QIW F;  4EX7 A;  3TQ1 A;  1N48 A;  2XIC A;  1ZQZ A;  2Q4T A;  4I27 A;  3HWT A;  1X9S A;  4YP3 A;  3PR4 A;  2ZUB A;  5CB1 A;  7ICO A;  5KT7 A;  3EUB 2;  2HI0 A;  3D2N A;  4O3O A;  8ICW A;  1SXE A;  4YMN A;  1KKX A;  5ALK A;  2KHV A;  1SIJ A;  4NL9 A;  4FS2 A;  5CJ7 A;  2GOL A;  1BPE A;  4YR2 A;  3OJU A;  4PL2 A;  1JN3 A;  1KRP A;  1XU4 A;  2ZG6 A;  1QQ6 A;  5KFO A;  4I2J A;  3IM1 A;  9ICH A;  2KSO A;  3C5F A;  4OJP A;  2R8K A;  3BS5 A;  1J2M A;  4QIW C;  1ED1 A;  5A0L A;  1S0O A;  3IG5 A;  1X2I A;  4F5N A;  1IXR A;  1UA0 A;  2IOH A;  3JPP A;  2MSN A;  4F3O A;  3WKE A;  5AI4 A;  2PI5 A;  1PZN A;  1ZQE A;  4JV1 A;  5KFL A;  5ALP A;  4DS5 A;  2DWQ A;  2W8K A;  3WK6 A;  1PK3 A;  3SD7 A;  5ALG A;  1ZQ1 C;  2F8L A;  5KFY A;  5KFJ A;  2O6K A;  3NAS A;  7ICQ A;  2HOF A;  4GXK A;  4YXM A;  4YN4 A;  4Y2S A;  2K4P A;  2EDU A;  2XCA A;  7ICH A;  5J2D A;  9ICV A;  4RQN A;  2Y1J A;  2DFL A;  2R8J A;  3OGU A;  2QKQ A;  4IQU A;  4CF5 A;  4KN4 A;  5DQI A;  2E8P A;  2IHM A;  4ECS A;  5J0T A;  3PX6 A;  5CA7 A;  3LYS A;  1U49 A;  2JXJ A;  3VC8 A;  2DF4 B;  4R65 A;  7ICK A;  5J0O A;  3DDH A;  3JPN A;  2KJ9 A;  5J0S A;  4UAR A;  3RR7 A;  2RDI A;  2FE9 A;  3L5K A;  2FPM A;  9ICR A;  5KG3 A;  3BDP A;  2ATL A;  4MF8 A;  3ISB A;  4ED7 A;  4DFD A;  1EXN A;  3MGV A;  4B6J A;  4LZG A;  1RXW A;  2I1Q A;  2QLT A;  3BJY A;  1PVQ A;  3NVY A;  1ZQX A;  4XUS A;  1FFU A;  1TV9 A;  2HHW A;  2JEG A;  3K1R B;  2Q0Z X;  5HR7 A;  3V7L A;  4BX9 C;  4TQS A;  3V7J A;  1NJY A;  4QZ8 A;  4UAW A;  1SKR A;  2NRT A;  5KTQ A;  4RPZ A;  5AKY A;  2J6T A;  5AK6 A;  5ALS A;  4NLN A;  5J0W A;  4F4Y A;  2DKZ A;  2C22 A;  4B9S A;  1KN5 A;  1FO4 A;  1QCK A;  2QB0 A;  2BCR A;  2OXO A;  2EAP A;  3LVW A;  4KIT B;  5J2E A;  3GIM A;  1F5S A;  3L3F X;  3PW4 A;  1V38 A;  3MDA A;  4GXJ A;  1FIQ A;  2M9N A;  2ZIV B;  1N62 A;  4O3M A;  1ZQS A;  2BPC A;  1PVP A;  4C8N A;  4DF4 A;  3D6J A;  3I1Y A;  2E5S A;  1V97 A;  2AGO A;  4Y2Y A;  2W54 A;  2NRZ A;  4IRC A;  4O3R A;  3MGH A;  4YMM A;  1JMS A;  4PGX A;  3QXG A;  2R8H A;  3RJI A;  5CR0 A;  3WU2 U;  5CEH A;  3IN5 A;  2LKY A;  1NJZ A;  4F5P A;  4TUR A;  2CXY A;  4EBC A;  3IV6 A;  5IIJ A;  4EEL A;  3WKC A;  5CP2 A;  1ZQT A;  2XGQ A;  2EH9 A;  3FYH A;  4UB2 A;  3UXP A;  2C2R A;  2AGQ A;  4PGY A;  4GC7 A;  3RF9 A;  3V6K A;  3PML A;  1O08 A;  4PHD A;  3C5G A;  1SV0 C;  5J0U A;  2ASL A;  1K1S A;  5B5E U;  2D3D A;  5L1J A;  3SMV A;  5AM0 A;  2JEF A;  3TKA A;  5HML A;  4XQ8 A;  2N1R A;  2IBK A;  4NM2 A;  1JXL A;  4YCX A;  5DG7 A;  3PMN A;  3GIL A;  5DGB A;  4IRK A;  4J03 A;  4RPY A;  1KSP A;  1N5X A;  2W3R A;  2XO7 A;  5H2F U;  2V9W A;  1ARO P;  2ZUC A;  4M0A A;  8ICO A;  4MEX A;  5L9X A;  4YD1 A;  1N61 A;  2EAN A;  4UAY A;  2BZF A;  1S76 D;  1KLN A;  3AQF A;  4QZ9 A;  1MQ3 A;  2KP7 A;  4O5C A;  2Y0S F;  3BQT A;  1SZP A;  2LYH A;  4BWJ A;  1VJ5 A;  2ZIU A;  5GTI U;  4ECW A;  8ICU A;  1XSN A; 
#chains in the Genus database with same CATH homology
 1WUD A;  2K8B B;  2G0A A;  2E5S A;  2HBM A;  4JMU A;  4ICA A;  4P0Q B;  4PL1 A;  3HKZ F;  3F5A A;  4OJL A;  4C0Z A;  1PVR A;  2WAQ F;  4NV0 A;  1KBU A;  3M7D A;  1D8B A;  2XIC A;  4QNL A;  2KV2 A;  3N7S C;  5HR6 A;  2KKP A;  2KOB A;  2Q4T A;  3KFU F;  2LHT A;  1P7D A;  2G08 A;  1CRX A;  3ONN A;  2YX8 A;  2LYA A;  2ZIV A;  3LYS A;  2OM6 A;  3VC8 A;  1F44 A;  2RHF A;  3PSI A;  2G06 A;  2W7O A;  2DF4 B;  2HBL A;  3DEE A;  2JH1 A;  3D2N A;  3PSP A;  2H3I A;  4CGZ A;  3D2S A;  2K89 A;  2ZIX B;  2CPR A;  1YT3 A;  2JGA A;  2DQN B;  3SAG A;  5T14 A;  3F2D A;  1XO0 A;  2KJ9 A;  3N7P D;  2OYY A;  3H0M B;  4NLB A;  2NV3 A;  4OJ5 A;  2KHV A;  2LKY A;  3IN5 A;  3K1Z A;  2RP5 A;  4P0Q A;  2YB1 A;  3F53 A;  2XID A;  2KKV A;  4FZL A;  2A3V A;  4NLC A;  2G07 A;  1Q3U A;  3F2C A;  2GOL A;  2W04 A;  1SZH A;  2F2A B;  2G09 A;  2ZIW B;  4PL2 A;  5HR7 A;  1OUQ A;  3MGV A;  2KVC A;  2Y0S C;  4KX3 A;  3C28 A;  4GFJ A;  2ZG6 A;  1IIP A;  2K4H A;  4A8E A;  1DRG A;  4FZN A;  3IP4 B;  2CN1 A;  3PSF A;  1HIW A;  4OO1 J;  1L6N A;  2MA1 A;  2Z7J A;  4FE3 A;  2MRL A;  2R18 A;  4OJP A;  2H3Z A;  3AQE A;  1PVQ A;  2BDU A;  2GH1 A;  2JMG A;  2VKQ A;  3RF9 A;  3SQI A;  1ECW A;  4QIW C;  4U6P A;  2PMZ C;  1ED1 A;  2HOQ A;  1TAM A;  2ZIU B;  5A0L A;  2CRX A;  3IG5 A;  1XNS A;  3OPX A;  4BX9 C;  4P0P B;  2HBJ A;  2E1E A;  3CYM A;  1URJ A;  3F5E A;  4AYB F;  4FZM A;  5KL1 B;  2WAQ C;  3M6K A;  2DGZ A;  2K8A A;  3H0L B;  2G5I B;  2KHQ A;  2K4I A;  3SMV A;  4OJO A;  2KIW A;  2ZIW A;  1GO3 F;  4BUG A;  3PZP A;  2OH2 A;  1A0P A;  2WB1 C;  3ALR A;  2G5H B;  2K8C B;  2W7P A;  4KX5 A;  3GZF A;  5KL8 B;  1Z19 A;  1T94 A;  2XVT A;  3AL0 B;  4IC9 A;  2KJ8 A;  2N1R A;  3VCB A;  4OJ6 A;  2H3F A;  2VIX A;  2RRD A;  2LYB A;  2ZIX A;  2W03 A;  4P0P A;  2KJ5 A;  3C29 A;  3IG8 A;  1A6S A;  2PMZ F;  2ZXH A;  2OXO A;  2K4E A;  1ZQ1 C;  2F8L A;  3D2Q A;  3HKZ C;  3CRX A;  2JH7 A;  3LVW A;  2H3V A;  2YB4 A;  3KZX A;  3O0F A;  1NZB A;  2F76 X;  2HOF A;  1Q3V A;  3H0R B;  3NRW A;  2E1F A;  3L3F X;  1HEK A;  2XI9 A;  4ACO A;  4CRX A;  4U7C A;  2HOI A;  1Z1B A;  3RFA A;  3N7R C;  2KEY A;  2F77 X;  2WB1 F;  2VJ5 A;  2KNJ A;  3CP8 A;  1MA7 A;  3AQF A;  4QJF B;  2HBK A;  2KD1 A;  3F2B A;  2VJ4 A;  3E0F A;  1UPH A;  2Y0S F;  2ZXI A;  3LVV A;  2KIC A;  2ZIV B;  3PST A;  4KMO B;  4O3M A;  5CRX A;  3GU3 A;  5C0Y A;  1PVP A;  3NUQ A;  2LBO A;  2H3Q A;  2D6F C;  3ICX A;  4CDG A;  4AYB C;  2ZIU A;  3SAH A;  4NWI A;  4BJQ A;  3T79 A;  2HMX A;  2M0N A;  2JHD A;  4WJ3 B;  3SAF A;  3M6Z A;  4QIW F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...