2PMZC

Archaeal rna polymerase from sulfolobus solfataricus
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
385
structure length
279
Chain Sequence
b'PYLEEKVKQASNILPQKIVDDLKNLILNKEIIVTRDEIDKIFDLAIKEYSEGLIAPGEAIGIVAAQSVGEPGTQMTLGLPRLIEIVDAKKVPSTPMMTIYLTDEYKRDRDKALEVARKLEYKRAIVQKKGDEYIILTDGSNLSGVLSVKGVDVAKVETNNIREIEEVFGIEAAREIIIREISKVLAEQGLDVDIRHILLIADVMTRTGIVRQIGRHGVTGEKNSVLARAAFEVTVKHLLDAAARGDVEEFKGVVENIIIGHPIKLGTGMVELTMRPILR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit A
publication title The X-ray crystal structure of RNA polymerase from Archaea
pubmed doi rcsb
molecule tags Translation, transferase
total genus 43
structure length 279
sequence length 385
chains with identical sequence G
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04998 RNA_pol_Rpb1_5 RNA polymerase Rpb1, domain 5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.390 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2pmzC02
2Y0SC 2PMZC 3HKZC 4QIWC 4AYBC 2WAQC 2WB1C
chains in the Genus database with same CATH superfamily
3BZCA 2EQYA 2KIVA 4KITB 3Q8MA 5J0TA 2MRLA 1UHUA 3GIMA 8ICWA 5DLFA 4TUQA 4CRXA 4FZNA 4RQNA 4KLFA 3SMVA 3GQCA 5KT4A 4UB4A 4NJ8A 4OO1J 4M9JA 2H3ZA 3WK8A 1NK8A 3ZI4A 1JXLA 4Z6EA 2RDJA 2G06A 3H40A 1NK5A 4K4HA 5AI9A 1J2MA 4J9LA 3AL0B 5TZVA 4M9LA 8ICXA 3JPSA 5J0WA 1MQ2A 3CW2C 2ZJAA 2HBMA 1S0NA 2Q0ZX 5B66U 5ALGA 2O6KA 9ICLA 2EZZA 5J2HA 5J2EA 5KFUA 1U45A 2HOFA 3NVWA 2LYHA 4I29A 2Q4TA 4ICAA 4YN4A 5KFIA 3F2CA 1ZQAA 7ICTA 4RNOA 2KTQA 4F5RA 9ICBA 3UMGA 3NASA 2KN7A 4I2FA 3QUBA 4P0PB 2LHTA 5CEHA 5KAFU 4BXOB 1QCKA 2RHFA 4BJQA 4DSLA 2WFAA 9ICOA 2AGQA 3ISCA 3WKDA 2XCAA 2KJ8A 5AM4A 3PSIA 5ALIA 4PL2A 3RRHA 4P4MA 3M8RA 9ICHA 1FFVA 2R8JA 4UARA 4O5EA 1S5LU 4RU9A 3Q8SB 4UB6U 3N4MB 4B9MA 4UAVA 1TK5A 1L5UA 4JK1A 9ICTA 4DLGA 3T3FA 3C5GA 3F2DA 5EWEA 1ZD4A 5KFTA 3LVWA 3EUB2 2G08A 9ICGA 5DBBA 2VKQA 1S0VA 5HHHA 3WK5A 1PVPA 3MFIA 1RQLA 1SWWA 2GOLA 3AQEA 5J0UA 4QWCA 2EANA 1S8OA 9ICNA 4F4XA 5KFZA 2JEFA 2AXTU 2YQEA 2BGWA 4XUSA 2LM1A 3VCBA 3EPGA 5L1MA 3Q8QB 1XU4A 4FS2A 5BOLA 4BWJA 4GLXA 4EZ6A 2KKVA 1CRXA 4R65A 3JPRA 1YT3A 5AKYA 2WF6A 2XGQA 2F76X 2ISPA 3PW4A 5CWRA 4ED1A 4Z6FA 5KFMA 2F8LA 1KW4A 4PHEA 2K8BB 5AKJA 3BQ1A 2K89A 1SZHA 2JEGA 2ZTEA 5KG3A 3KHGA 3GV8B 5J2FA 1B0XA 2DF4B 4M9HA 3N28A 3CP8A 2BDPA 1N56A 1ZQWA 1VDVA 2V4RA 4QNLA 5CR0A 3C2MA 4MF2A 3H4BA 2KVCA 2PXIA 5D4BA 2C28A 2NRZA 3V7KA 2HHSA 3C23A 2BZFA 1O08A 1L3SA 1IV8A 2VA2A 2ASLA 1HUZA 3PNCA 2MUTB 3H0LB 8ICPA 3QZ8A 4F4WA 4Q8EA 1HUOA 4M9GA 3QX7A 1JROA 1XSNA 5G5HA 4NLCA 5JTIA 4PPXA 1ZQXA 8ICYA 3MR6A 2DPIA 4RQ6A 1C7YA 2JHDA 2BPCA 3K1RB 2HOQA 2BCRA 4YMOA 3TANA 2ZTDA 4RPXA 1Q8KA 7ICJA 2K4PA 3D2SA 2YY6A 3G6YA 4Y2YA 2ZG6A 3QU2A 2JV3A 2L5YA 3B0XA 2G0AA 3KZIU 4OJ6A 3M8SA 4KLSA 5IINA 1SKSA 2YX8A 2EZYA 3SAHA 5KFLA 4Y2VA 2KJ5A 1S9FA 1WYGA 3L5KA 1RQNA 5GTIU 2VJ4A 4C80A 4M04A 4I28A 4MHVA 8ICKA 4JUZA 2HI0A 1KQQA 4YD1A 2WF5A 5ALEA 4O3QA 2WF7A 4KLIA 2NRXA 8ICQA 4Y2QA 1BVSA 4DSJA 3NVYA 4ZOHC 2KSOA 3T5KA 3OGUA 5J2DA 3PX6A 3UXPA 3C2KA 3MABA 5AI0A 4KLQA 1PUZA 4DFDA 4DOAA 1B22A 2XY7A 2J6SA 2ATLA 2DGZA 3TADA 4FE3A 5ALDA 4RQ3A 4PH5A 8ICGA 4HAIA 3PW5A 5CP2A 4PZOA 4K4IA 3TADC 4K4GA 2W9CA 3WK7A 3EPIA 1J97A 2F44A 2CXYA 4YMMA 4P0PA 5J2AA 1PK1A 2OXOA 2WAQC 3HKZF 1ZQTA 4UBBA 2CN1A 5L1KA 4DSKA 1Y88A 2Y9UA 3BS7A 1ZQMA 1NJWA 5JU5A 1RG6A 5AKKA 4F72A 2HVIA 4DSEA 4OJ5A 1KFSA 2IOFK 3PZPA 1ZYQA 5KFDA 2JMGA 2ASJA 3ZDAA 1LB2B 1T3QA 3AMZA 1Z3EB 2PMZF 9ICUA 3JPTA 4RQ7A 1SL0A 1WUDA 2KVSA 5CA7A 2W55A 1AQ6A 2W8LA 3PMNA 2EAOA 2YMQA 3PSPA 4U7CA 1TVAA 2HHUA 3RJEA 1DOQA 3RB3A 4CF5A 1MA7A 1BPBA 2KZZA 5KFGA 2BHNA 2WB1F 3IP4B 2AU0A 1X9SA 3EZ5A 4ECSA 1JMSA 1L7OA 2G5IB 3L4PA 1Q3VA 4YR2A 1SXDA 3C28A 2BR0A 4QZHA 2KV2A 3IG8A 4FS1A 3WK4A 3RJHA 4RT2A 4B9NA 5L9XA 5T14A 1KBUA 2XCPA 3ONNA 2KMDA 4P2HA 1ZQQA 8ICFA 3QXGA 4PHDA 2QARB 2PI5A 4MFCA 5ALJA 5AHXA 4UB1A 2QLTA 2KFZA 4ECYA 8ICSA 4KLHA 2IOFA 3JPNA 2AHOB 4DQQA 2YB4A 3RH6A 2BCUA 4ED3A 4F93B 2LPEA 1QLNA 1D8YA 4KLMA 1UT5A 3H8WA 1N48A 3CYMA 1N2XA 4I2AA 5KG6A 1N5XA 4BWMA 3F53A 1L7MA 3EYZA 4C8LA 2ZIXB 3OHBA 1NK0A 2IHMA 4DWIA 3LWLA 9ICAA 1XO0A 2MA1A 4PL1A 4YMNA 4O3OA 4UB2A 3OPXA 3NVVA 4QWBA 8ICVA 1TAMA 4DL7A 1NKBA 3T5LA 4FO6A 2R18A 5KFWA 2MSNA 2C2EA 2QB0A 2MUTA 3IDWA 1KFDA 1B43A 3RTVA 3D6JA 4IR1A 4FBUA 3HRDD 2A1AA 3F5EA 5CB1A 5KNIA 4TUSA 2I9GA 3PW7A 5KFAA 4EBDA 2HSZA 4C7ZA 3K4GA 1A77A 1D9DA 4NLZA 5KFVA 4NY8A 5HMMA 1MSWD 1SXEA 5KFPA 4DFPA 3ZD8A 5ALPA 3ED5A 5ALVA 2EDUA 3WKAA 5AK6A 3AU6A 3MGVA 3AUOA 1PVQA 3LYSA 1X66A 5AI5A 2HBKA 1S97A 4FFDA 4LZDA 4UASA 1ZQSA 1CI4A 2PFQA 1ZQIA 8ICCA 3RJGA 3BS5A 4Y2TA 1X9XA 4F4YA 2XY6A 4OJLA 5AM5A 1LVHA 2UVVA 3M6KA 3IG5A 2DKXA 4J9SA 4UBCA 2H5XA 3FM9A 4JV0A 5F3XB 1Z00A 2R8HA 3V7JA 3T79A 2VA3A 2W03A 7ICGA 3TQ1A 2FLPA 2UVUA 4NLGA 3RBEA 3OSPA 3SV4A 3JPQA 5L1JA 4NL9C 5IIKA 2W3SA 5KFHA 2AGPA 2AJQA 3RAXA 1ZQRA 4F4KA 1CEZA 2KICA 7ICKA 4Y2RA 5AM3A 4CF3A 4EBCA 2MU2A 2YMPA 1L3TA 4M6WA 2FPLA 3SENA 2NO5A 3PSTA 4I2BA 1YZ7A 2K60A 2E8NA 2NRWA 4IR9A 4QZIA 5J0PA 4UB5A 1D9FA 2HBLA 4RQ1A 8ICUA 5KAIU 1NJXA 2BDUA 3O0FA 4YXMA 4RQMA 4EYHB 4P4OA 4LVSA 2KOBA 2OYYA 1SKRA 2LKYA 3ETRA 2A1JB 2W04A 4IL6U 4CGZA 4UATA 3KZXA 2KD1A 5DQHA 2GWSA 1D8LA 3H8MA 3AQFA 1NNLA 1QQ6A 4KLOA 1N61A 4GC7A 3GU3A 1NKCA 5ALLA 2WF8A 3C1YA 4PHAA 2RQ5A 7ICUA 2WHEA 4ECRA 2OM6A 4Y2XA 1XSPA 2OWOA 2JEJA 1BPXA 3NGDA 3GIIA 2C2RA 3BQ7A 1WCLA 1XNSA 5AK3A 4A8EA 1ZQKA 2WTFA 3DV9A 4R64A 1B4FA 4Z6CA 8ICAA 5HP4A 2QARA 3HWTA 2JZBB 1NK9A 3NTUA 1PZNA 4AYBF 4AYBC 4YD2A 4RQ8A 1RYRA 1Q46A 4IQWA 1DXSA 4RPYA 9ICIA 1RM6C 4MFAA 4ECVA 4C7YA 1SV0A 1BPYA 4OCZA 5ALHA 5HR7A 1SV0C 4O3MA 5KG1A 1TKDA 4DS5A 3TAQA 1KN5A 4M9NA 1KSPA 1JRPA 3AN1A 4O3SA 7ICFA 5CHGA 3IHQB 4KN4A 5D49A 1V97A 1JUDA 5DKWA 3QZ7A 4J9MA 5KT6A 2CPRA 1A76A 1X9WA 5C5JA 2EH9A 2BCSA 2F1IA 3RH4A 4RQ4A 4PGYA 4CNQA 5KG2A 5J2BA 7ICQA 1ZQ1C 5L1IA 2HDOA 3T5JA 4IQUA 2M0NA 2KKPA 1KTQA 8ICRA 4P4PA 3HJEA 3GV7B 3DEEA 3FAHA 4JMUA 2I6XA 5KG4A 4ZH4A 2ZXIA 5BOMA 4C4TA 3N7SC 4M0AA 2ES6A 3WKBA 2VIXA 4RPZA 5GTHU 2F2AB 5ALKA 4O3RA 5G5GA 5J0RA 1X6JA 4YR0A 3HT3A 4R8UB 4ACOA 5J2GA 1LKYA 1RPLA 4NLKA 3UPQA 5KG5A 4YQWA 4US8A 3V7LA 3HW8A 3RJKA 4F2SA 1YZ6A 4F91B 4QZCA 2NV3A 1Z1VA 1F5SA 4DOBA 4WJ3B 1T94A 1ZQZA 4JB3A 9ICCA 2HMXA 2DPJA 1ZQGA 3TFSA 4CF4A 3SZ2A 4IS7A 1ZQFA 3RAQA 1ZJNA 1BNOA 5JRTA 4NM2A 2KZMA 3ZDEA 1JIHA 2GH1A 1Z4OA 3NRWA 1HJPA 4DL5A 4YVZA 5ALNA 1NK7A 7ICPA 2FDRA 1DK2A 1OW5A 2RDIA 3ORYA 4I2EA 5HMLA 3MGHA 4Y2PA 2K4EA 3TARA 8ICIA 2F77X 4J9PA 1TK0A 1X2IA 1ZQDA 2R8GA 2DUYA 4KLDA 5HR6A 1SIJA 2BCVA 2HHQA 1ZOLA 1ZQUA 2LI6A 1TAQA 2RLTA 3UMBA 3H4DA 3ZD9A 1PK3A 2FI1A 3C29A 4KN7A 4J9RA 3BDPA 2CRXA 4RUCA 1UT8A 4PHPA 4DF4A 3M7DA 4Q8FA 1TAUA 1X6IA 1RYSA 3MC1A 2YMLA 1Q3UA 4J9QA 5J2JA 2IHNA 1UA1A 1QSLA 4BX9C 9ICKA 4JWMA 4UAZA 1H38A 2UVRA 4IQTA 4CCHA 3KOOA 5ALUA 2A1JA 3IV6A 2F8KA 4FZMA 3ALRA 1FFUA 1V9PA 4AP9A 3KKAA 4F8RA 3I28A 4Z6DA 2DWQA 2LM4A 5TISU 4LZGA 3PW0A 3OJSA 4GC6A 2F1HA 5KFEA 1BPZA 2LYBA 3KD3A 3KKAC 1OUQA 4F71A 4BDPA 2WAQF 4QW9A 3T5HA 1K1QA 4BXOA 5J2IA 4ECUA 2AQ4A 2Y0SC 2XI9A 4O9MA 4G3IA 1COKA 1S0MA 8ICHA 1N5WA 3H0RB 4XQ8A 5KFFA 4DL2A 5KT5A 2ALZA 4NXZA 1TFRA 5KTQA 2W11A 5EOZA 2JR5A 2Y1IA 5AKGA 4B9UA 3JPPA 2E8MA 5KFQA 1RXWA 4X5VA 5KG0A 4BUGA 3V6HA 3OHAA 3QUCA 3MR5A 4I2JA 3QYPA 3H0MB 1U9LA 1PVRA 5KFNA 4PGQA 5KFSA 3MR2A 3NRZA 4QZ8A 4YFKA 1SKWA 1NK6A 3QEAZ 1QTMA 1X40A 1A0PA 2WF9A 2VANA 5DDYA 4QWAA 4KLGA 3PV8A 4DQIA 3NS1A 2FMPA 3AM9A 2JEIA 1ED1A 3K1ZA 2PI4A 4KLTA 8ICZA 3OJUA 2HBJA 3RJFA 3E2EA 4QWEA 5AM1A 2JGAA 5F9LA 5AI6A 4TUPA 2K8CB 3ZDBA 3SD7A 4ED7A 2W7OA 4DL6A 2Z7JA 1MN8A 8ICJA 5AK4A 2W8KA 4RNNA 2W3RA 5AKHA 3TKAA 1GO3F 3WK9A 5HNKA 3RH5A 4I27A 1C20A 1WWVA 2JH1A 3GFKB 2GO7A 2C22A 1ZQBA 2I1QA 1BPEA 2E3TA 4KX3A 3PX4A 2C2DA 1TV9A 2FPMA 2B0CA 3PR5B 2AGOA 2H3FA 2BQ3A 3OSNA 3SQIA 1ZQYA 2IA6A 2G07A 1RDFA 2E1EA 4QZFA 1RZTA 7ICEA 1P7DA 3IN5A 2ZUDA 3EWAA 4O0IA 2K4HA 7ICMA 5J0QA 2BPFA 4EX6A 4F4ZA 3BZKA 2QKQA 3KHRA 8ICNA 2OCEA 4EX7A 4QJFB 1NK4A 4O3PA 3BQ2A 3KHHA 4QIWC 4M2YA 2XICA 3AU2A 4MEXA 1NI3A 5AM0A 2E1FA 4DQSA 5DBAA 3QU7A 4G9BA 9ICWA 4DL4A 4HYKA 2KK0A 4O3NA 3HP6A 4C8KA 3U26A 1K1SA 1O03A 5DB9A 4DFKA 4CE6A 1BPDA 5E79U 2N1RA 1S0OA 4DSFA 5L1LA 4BGDA 9ICPA 5AM2A 5DB8A 2PKEA 3RRGA 5F9NA 1NOMA 1ZRMA 1SGGA 4USAA 4Q44A 1ZQPA 1DRGA 2LMRA 2ODGA 3G6XA 3QE9Y 3SAFA 4MEYA 5AIBA 3MDAA 2W9AA 1IG6A 5HHIA 3B0YA 1FO4A 4F5QA 1FEZA 4GFJA 2NYVA 5DQIA 3NVZA 1ZQVA 2BCQA 3RB4A 3NUQA 3D2NA 4KLLA 4F5NA 2UVWA 1XWLA 1BNPA 2ZIVB 4NL9A 2HCFA 5DG7A 1D8BA 5AKLA 1KRPA 1QH9A 1Z19A 1AROP 1ZQCA 4NV0A 3V6JA 1V85A 9ICRA 8ICTA 5IIMA 4F5OA 1KDHA 4XRHA 2ZJ8A 5DGAA 7ICNA 5EE3A 4JV1A 1T3NA 2ZIWB 3Q8PB 3LK9A 4DOCA 1HIWA 3ISBA 3LVVA 4PZNA 5IILA 3I1YA 5IIJA 4DFJA 4EEYA 2HW3A 1N62A 5KFJA 9ICSA 3ETLA 3SAGA 2ZJ5A 4Y2JA 1ZRNA 4QZ9A 4B9VA 4RT3A 2LBOA 3F5AA 1ZD5A 2E5SA 2EAMA 5C0YA 5AKEA 2DQNB 2KSOB 4UAUA 1JALA 2K4IA 2J6UA 4CDGA 1SZPA 5KL8B 2KE7A 5AI8A 2YB1A 3H7IA 2HHWA 1ZD3A 2GLEA 4B9TA 4GIBA 4IC9A 1HEKA 5EE9A 1U48A 3I76A 3M9NB 2V9WA 4J03A 5ALZA 3WKEA 2OH2A 5DG8A 9ICQA 3Q8LA 1EXNA 2DKZA 5KFYA 4UAYA 4NLBA 1ZXIA 5KG7A 3M6ZA 2KNJA 4ELTA 4C8NA 2W9CB 2BKEA 4DS4A 2DBYA 2LYAA 1WWUA 3BJYA 3KTQA 5CJ7A 5J0OA 3BQ0A 2XGPA 1PK1B 1XO1A 5J0XA 2KJ9A 4QW8A 8ICMA 7ICLA 5J2KA 4F50A 4EYIB 2FMSA 4MF8A 3RB6A 3DDHA 3S6JA 2I5HA 3TAPA 9ICXA 1NKEA 2P6RA 3QU9A 4F2RA 4J9OA 2XIDA 3GIJA 3QNMA 2FLLA 7ICOA 4EBEA 1WG8A 4QZDA 1ZQLA 5AI4A 4ECTA 3SR6A 3QEBZ 5ALFA 4O5CA 2ZIXA 8ICBA 5H2FU 2E8PA 4ELUA 5J0SA 2G5HB 4C4RA 1QQ5A 3BQTA 3MDCA 2KEYA 2ZXHA 4RZRA 4TURA 4YG2A 1UPHA 2XVTA 3ISDA 4DF8A 1S77D 1N60A 5DLGA 5J2CA 2FE9A 4C0ZA 5DQGA 5ALRA 4YXJA 1ZQJA 2VA8A 7ICRA 2HOIA 5BPCA 2OHFA 1QQ7A 1J2NA 2FJ6A 3SI8A 2W7PA 3C5FA 5AKXA 3SYZA 4NLNA 3PO4A 1X42A 2IBKA 1RYUA 4DQPA 3M9OB 2V4QA 5ALSA 4US9A 3V6KA 1UCVA 3HX0A 1OXJA 3C1ZA 3TI0A 4B9SA 1VLBA 4B6JA 3RB0A 3UXOA 5ALTA 5KFKA 4J9KA 1TK8A 2AH5A 2DL0A 1A6SA 5ALYA 3V72A 4KTQA 3AEVA 5KT7A 3FYHA 1ZQHA 3SEIA 2EZXA 3HPOA 1JI7A 4RUAA 3SV3A 7ICVA 1KFTA 2RP5A 4F92B 2B6GA 3RJIA 2H3IA 5KFXA 5CRXA 1URJA 4ECWA 1L7PA 1MC8A 4EEKA 2F3NA 4Q43A 1U47A 4KLEA 1L6NA 4P0QB 2YTUA 1KLNA 4UAWA 3D2QA 2HHTA 2P66A 1WCNA 3C2LA 3PO5A 4EENA 1JXEA 3Q8KA 1L3UA 4I2GA 2E8OA 4ED0A 5DBCA 2QB1A 3WK6A 4IRKA 2KHVA 4YP3A 2K8AA 2QB0B 1JX4A 2ZIVA 4DCCA 5JUMA 4UB8U 4E0DA 2ZIUB 4ECQA 2NRTA 1V38A 3GILA 4FBTA 3UXNA 1ZD2P 1Z4NA 3QUTA 4C4SA 4RQ5A 3PVXA 3OTQA 3RF9A 1DGSA 9ICJA 2HHXA 4I2DA 1ZQNA 2ZIWA 3VC8A 2JH7A 1K5OA 4NWIA 9ICMA 3PW2A 3J81j 4C8OA 3THVA 4J9NA 4YCXA 1IM4A 4KMOB 3A0BU 1N63A 4ELVA 3RBDA 4U6PA 1U49A 4JWNA 4RQ2A 1ZQOA 1BGXT 2FPKA 4RNMA 9ICEA 5ALQA 2ASDA 1COOA 4C8MA 1T7PA 4YR3A 4MFFA 2DFLA 5AKZA 3RR8A 5EWFA 3BS5B 1ZJMA 2KP7A 3H8JA 2W9BB 2W9MA 4EELA 4JV2A 2NO4A 3GV5B 5FP0A 2PFNA 1KL9A 5K4LA 2P6UA 3M9MB 2KG5A 4ED8A 2D3DA 5KFCA 1ZQEA 2Y0SF 2H3VA 1FIQA 3CRXA 1Z00B 1M6YA 2ZUBA 3WU2U 5KFBA 1IIPA 2KIWA 2R8KA 3JPOA 9ICVA 4ED6A 2H3QA 5ALMA 3RFAA 2BQRA 2JZBA 4I2CA 1S10A 2XC9A 3HKZC 4EZ9A 4XA5A 2XY5A 1XS9D 1DGJA 1KKXA 4OJOA 3RJJA 2IOHA 3N97B 4M6WB 1L8LA 3PMLA 3CNHA 1S76D 1VJ5A 4LJXA 3KFUF 5AK5A 3MFHA 1QSYA 2YN4A 2JXJA 3ZDCA 3R9KA 2J6TA 2F1JA 3GZFA 4QZAA 2PMZC 3QU4A 4GXJA 4DFMA 3MGIA 7ICHA 1NZPA 4OD0A 4KX5A 2BQUA 4DEZA 3RR7A 2XO7A 5DGBA 2KHQA 8ICEA 5DB7A 5KL1B 4DLEA 5KT2A 4QZEA 2WB1C 3GDXA 2Y9TA 1SB3C 2ESEA 4QZBA 4Q45A 4IRDA 2HHVA 4FZLA 3A0HU 1SL2A 4F5PA 1UA0A 1F0MA 2ZTCA 2BPGA 2W43A 4I2IA 1QSSA 1IXRA 1T4GA 2RRDA 5DB6A 3H8SA 4IRCA 1CUKA 1RXVA 3E58A 4UQGA 3GIKA 5DDMA 3TFRA 3IM1A 3G6VA 2Y1JA 4ECZA 1XC9A 4DQRA 4UB3A 2G09A 3LWMA 2JRZA 3UQ2A 1SL1A 2NRVA 2ISOA 2ZUCA 2HVHA 5AIAA 3PX0A 4R8UA 4R66A 2KFNA 7ICSA 4UW9A 5EE1A 4B9LA 2EAPA 3FC4A 4OJPA 4Y2UA 5DG9A 3FDSA 4IQVA 4ED2A 3E0FA 4ECXA 1ECWA 1L7NA 4TQSA 5J29A 4PGXA 5D46A 2VJ5A 5KFRA 1KEJA 2M9NA 4KLJA 1T8EA 3QU5A 3M1YA 5A0LA 2P35A 4O5KA 4P0QA 2PFOA 3LDAA 1SWVA 4QIWF 3PR4A 3MR3A 2W54A 4I2HA 1TE2A 4F3OA 4GXKA 3UMCA 1U4BA 4R63A 1Z1BA 4QZGA 3Q8RB 3K75D 3ICXA 1L8OA 3N7PD 3ZDDA 3F2BA 5KFOA 2ZIUA 4M47A 2D6FC 3EW9A 3TACB 2YMMA 1DK3A 1UQVA 4KMUA 2A19A 4GXIA 3MBYA 1XSLA 5ALXA 7ICIA 1NJYA 4TQRA 3N7RC 9ICFA 3HILA 1JN3A 5EWGA 4DL3A 5IIIA 5AKIA 1ZETA 1LV5A 5B5EU 2OEHA 1LKYB 2D8CA 1SV4A 5ALOA 4KLUA 3C21A 1MQ3A 2R8IA 2MAXA 3B9JA 3L3FX 1X9MA 2AQ0A 5AICA 3QUQA 3KHLA 4DO9A 5IIOA 3IRUA 5KT3A 4DSIA 8ICOA 4NM1A 3UQ0A 3PSFA 2A3VA 4PJ0U 5J8YA 5ALWA 4QWDA 5J0YA 2FMQA 2IMWP 3KBBA 2FLNA 2W9BA 4Y2SA 8ICLA 1L3VA 1F44A 5EE0A 2PFPA 2B21A 5J8YC 1NZBA 3PY8A 3UM9A 2KZ3A 4RQ0A 1NJZA 3WKCA
chains in the Genus database with same CATH topology
2HBJA 2YB4A 3N7SC 4P0PA 2MRLA 4QIWF 4BX9C 3RF9A 2VIXA 2OXOA 2WAQC 3GZFA 4C0ZA 2LBOA 2JGAA 2PMZC 2F2AB 2K8CB 3F5AA 3HKZF 2E5SA 4OJLA 1XNSA 2CN1A 3CYMA 4A8EA 4CRXA 4FZNA 3M6KA 2HOIA 5C0YA 2W7OA 4KX5A 3IG5A 2DQNB 1Z1BA 4FZMA 3H0LB 2Z7JA 3ALRA 4ACOA 2K4IA 4CDGA 3SMVA 4OO1J 2KHQA 2ZIWA 2W7PA 5KL8B 4OJ5A 1DRGA 4NLCA 2H3ZA 5KL1B 2YB1A 3VC8A 3F53A 3ICXA 2JH7A 3N7PD 4NWIA 3F2BA 3PZPA 2ZIUA 1GO3F 4AYBF 4IC9A 1HEKA 2ZIXB 3F2DA 4AYBC 2JHDA 2D6FC 2JMGA 2WB1C 2NV3A 2HOQA 3LVWA 3SAFA 2G06A 2LYBA 2G08A 4KMOB 1OUQA 2VKQA 3T79A 4WJ3B 2W03A 4U6PA 2WAQF 1XO0A 1T94A 2OH2A 2MA1A 4PL1A 3AL0B 2PMZF 4FZLA 1PVPA 2JH1A 3D2SA 2HMXA 2GOLA 3AQEA 3OPXA 4NLBA 2XVTA 2ZG6A 2KNJA 3M6ZA 2Y0SC 1TAMA 2HBMA 1WUDA 2XI9A 3KFUF 4GFJA 4KX3A 2G0AA 2LYAA 2R18A 4OJ6A 3N7RC 3PSPA 5HR7A 4U7CA 2GH1A 3VCBA 1A6SA 2H3FA 2RRDA 2KICA 2YX8A 4O3MA 3SAHA 3SQIA 1MA7A 3H0RB 3NRWA 3NUQA 2KJ9A 2HOFA 2WB1F 3IP4B 3D2NA 2G07A 2KJ5A 3F5EA 2RP5A 2KKVA 2E1EA 1CRXA 2H3IA 5CRXA 1URJA 2ZIVB 3PSTA 2VJ4A 2G5IB 2Q4TA 1Q3VA 1P7DA 3IN5A 1YT3A 4ICAA 1D8BA 3F2CA 3C28A 3L3FX 2G09A 2K4EA 2HBLA 2K4HA 2Y0SF 2CPRA 2H3VA 2F77X 2BDUA 2KV2A 4BUGA 2F76X 1Z19A 3CRXA 4P0QB 1L6NA 3IG8A 2XIDA 3D2QA 3O0FA 3K1ZA 4NV0A 4P0PB 2LHTA 3H0MB 5HR6A 1IIPA 2KOBA 2KIWA 2F8LA 5T14A 2OYYA 1PVRA 2K8BB 4QJFB 1ZQ1C 2H3QA 2LKYA 3PSFA 3RFAA 2RHFA 2M0NA 4BJQA 2A3VA 2K89A 2W04A 4QIWC 2XICA 1KBUA 1SZHA 3ONNA 2KKPA 4CGZA 3KZXA 2KD1A 3C29A 2KHVA 2ZIXA 4OJPA 3HKZC 2E1FA 1F44A 1A0PA 2K8AA 2DF4B 2ZIWB 2KJ8A 3AQFA 3E0FA 2DGZA 3PSIA 4FE3A 2CRXA 2ZIVA 1HIWA 3CP8A 3DEEA 1ECWA 2G5HB 2ZIUB 3GU3A 4JMUA 3M7DA 4OJOA 3LVVA 3MGVA 1PVQA 1NZBA 3LYSA 2VJ5A 4PL2A 2HBKA 4QNLA 2KEYA 2ZXHA 2ZXIA 2OM6A 5A0LA 2KVCA 1Q3UA 1ED1A 4P0QA 3SAGA 1UPHA 2N1RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y0S C;  2PMZ C;  3HKZ C;  4QIW C;  4AYB C;  2WAQ C;  2WB1 C; 
#chains in the Genus database with same CATH topology
 3BZC A;  2EQY A;  2KIV A;  4KIT B;  3Q8M A;  5J0T A;  2MRL A;  1UHU A;  3GIM A;  8ICW A;  5DLF A;  4TUQ A;  4CRX A;  4FZN A;  4RQN A;  4KLF A;  3SMV A;  3GQC A;  5KT4 A;  4UB4 A;  4NJ8 A;  4OO1 J;  4M9J A;  2H3Z A;  3WK8 A;  1NK8 A;  3ZI4 A;  1JXL A;  4Z6E A;  2RDJ A;  2G06 A;  3H40 A;  1NK5 A;  4K4H A;  5AI9 A;  1J2M A;  4J9L A;  3AL0 B;  5TZV A;  4M9L A;  8ICX A;  3JPS A;  5J0W A;  1MQ2 A;  3CW2 C;  2ZJA A;  2HBM A;  1S0N A;  2Q0Z X;  5B66 U;  5ALG A;  2O6K A;  9ICL A;  2EZZ A;  5J2H A;  5J2E A;  5KFU A;  1U45 A;  2HOF A;  3NVW A;  2LYH A;  4I29 A;  2Q4T A;  4ICA A;  4YN4 A;  5KFI A;  3F2C A;  1ZQA A;  7ICT A;  4RNO A;  2KTQ A;  4F5R A;  9ICB A;  3UMG A;  3NAS A;  2KN7 A;  4I2F A;  3QUB A;  4P0P B;  2LHT A;  5CEH A;  5KAF U;  4BXO B;  1QCK A;  2RHF A;  4BJQ A;  4DSL A;  2WFA A;  9ICO A;  2AGQ A;  3ISC A;  3WKD A;  2XCA A;  2KJ8 A;  5AM4 A;  3PSI A;  5ALI A;  4PL2 A;  3RRH A;  4P4M A;  3M8R A;  9ICH A;  1FFV A;  2R8J A;  4UAR A;  4O5E A;  1S5L U;  4RU9 A;  3Q8S B;  4UB6 U;  3N4M B;  4B9M A;  4UAV A;  1TK5 A;  1L5U A;  4JK1 A;  9ICT A;  4DLG A;  3T3F A;  3C5G A;  3F2D A;  5EWE A;  1ZD4 A;  5KFT A;  3LVW A;  3EUB 2;  2G08 A;  9ICG A;  5DBB A;  2VKQ A;  1S0V A;  5HHH A;  3WK5 A;  1PVP A;  3MFI A;  1RQL A;  1SWW A;  2GOL A;  3AQE A;  5J0U A;  4QWC A;  2EAN A;  1S8O A;  9ICN A;  4F4X A;  5KFZ A;  2JEF A;  2AXT U;  2YQE A;  2BGW A;  4XUS A;  2LM1 A;  3VCB A;  3EPG A;  5L1M A;  3Q8Q B;  1XU4 A;  4FS2 A;  5BOL A;  4BWJ A;  4GLX A;  4EZ6 A;  2KKV A;  1CRX A;  4R65 A;  3JPR A;  1YT3 A;  5AKY A;  2WF6 A;  2XGQ A;  2F76 X;  2ISP A;  3PW4 A;  5CWR A;  4ED1 A;  4Z6F A;  5KFM A;  2F8L A;  1KW4 A;  4PHE A;  2K8B B;  5AKJ A;  3BQ1 A;  2K89 A;  1SZH A;  2JEG A;  2ZTE A;  5KG3 A;  3KHG A;  3GV8 B;  5J2F A;  1B0X A;  2DF4 B;  4M9H A;  3N28 A;  3CP8 A;  2BDP A;  1N56 A;  1ZQW A;  1VDV A;  2V4R A;  4QNL A;  5CR0 A;  3C2M A;  4MF2 A;  3H4B A;  2KVC A;  2PXI A;  5D4B A;  2C28 A;  2NRZ A;  3V7K A;  2HHS A;  3C23 A;  2BZF A;  1O08 A;  1L3S A;  1IV8 A;  2VA2 A;  2ASL A;  1HUZ A;  3PNC A;  2MUT B;  3H0L B;  8ICP A;  3QZ8 A;  4F4W A;  4Q8E A;  1HUO A;  4M9G A;  3QX7 A;  1JRO A;  1XSN A;  5G5H A;  4NLC A;  5JTI A;  4PPX A;  1ZQX A;  8ICY A;  3MR6 A;  2DPI A;  4RQ6 A;  1C7Y A;  2JHD A;  2BPC A;  3K1R B;  2HOQ A;  2BCR A;  4YMO A;  3TAN A;  2ZTD A;  4RPX A;  1Q8K A;  7ICJ A;  2K4P A;  3D2S A;  2YY6 A;  3G6Y A;  4Y2Y A;  2ZG6 A;  3QU2 A;  2JV3 A;  2L5Y A;  3B0X A;  2G0A A;  3KZI U;  4OJ6 A;  3M8S A;  4KLS A;  5IIN A;  1SKS A;  2YX8 A;  2EZY A;  3SAH A;  5KFL A;  4Y2V A;  2KJ5 A;  1S9F A;  1WYG A;  3L5K A;  1RQN A;  5GTI U;  2VJ4 A;  4C80 A;  4M04 A;  4I28 A;  4MHV A;  8ICK A;  4JUZ A;  2HI0 A;  1KQQ A;  4YD1 A;  2WF5 A;  5ALE A;  4O3Q A;  2WF7 A;  4KLI A;  2NRX A;  8ICQ A;  4Y2Q A;  1BVS A;  4DSJ A;  3NVY A;  4ZOH C;  2KSO A;  3T5K A;  3OGU A;  5J2D A;  3PX6 A;  3UXP A;  3C2K A;  3MAB A;  5AI0 A;  4KLQ A;  1PUZ A;  4DFD A;  4DOA A;  1B22 A;  2XY7 A;  2J6S A;  2ATL A;  2DGZ A;  3TAD A;  4FE3 A;  5ALD A;  4RQ3 A;  4PH5 A;  8ICG A;  4HAI A;  3PW5 A;  5CP2 A;  4PZO A;  4K4I A;  3TAD C;  4K4G A;  2W9C A;  3WK7 A;  3EPI A;  1J97 A;  2F44 A;  2CXY A;  4YMM A;  4P0P A;  5J2A A;  1PK1 A;  2OXO A;  2WAQ C;  3HKZ F;  1ZQT A;  4UBB A;  2CN1 A;  5L1K A;  4DSK A;  1Y88 A;  2Y9U A;  3BS7 A;  1ZQM A;  1NJW A;  5JU5 A;  1RG6 A;  5AKK A;  4F72 A;  2HVI A;  4DSE A;  4OJ5 A;  1KFS A;  2IOF K;  3PZP A;  1ZYQ A;  5KFD A;  2JMG A;  2ASJ A;  3ZDA A;  1LB2 B;  1T3Q A;  3AMZ A;  1Z3E B;  2PMZ F;  9ICU A;  3JPT A;  4RQ7 A;  1SL0 A;  1WUD A;  2KVS A;  5CA7 A;  2W55 A;  1AQ6 A;  2W8L A;  3PMN A;  2EAO A;  2YMQ A;  3PSP A;  4U7C A;  1TVA A;  2HHU A;  3RJE A;  1DOQ A;  3RB3 A;  4CF5 A;  1MA7 A;  1BPB A;  2KZZ A;  5KFG A;  2BHN A;  2WB1 F;  3IP4 B;  2AU0 A;  1X9S A;  3EZ5 A;  4ECS A;  1JMS A;  1L7O A;  2G5I B;  3L4P A;  1Q3V A;  4YR2 A;  1SXD A;  3C28 A;  2BR0 A;  4QZH A;  2KV2 A;  3IG8 A;  4FS1 A;  3WK4 A;  3RJH A;  4RT2 A;  4B9N A;  5L9X A;  5T14 A;  1KBU A;  2XCP A;  3ONN A;  2KMD A;  4P2H A;  1ZQQ A;  8ICF A;  3QXG A;  4PHD A;  2QAR B;  2PI5 A;  4MFC A;  5ALJ A;  5AHX A;  4UB1 A;  2QLT A;  2KFZ A;  4ECY A;  8ICS A;  4KLH A;  2IOF A;  3JPN A;  2AHO B;  4DQQ A;  2YB4 A;  3RH6 A;  2BCU A;  4ED3 A;  4F93 B;  2LPE A;  1QLN A;  1D8Y A;  4KLM A;  1UT5 A;  3H8W A;  1N48 A;  3CYM A;  1N2X A;  4I2A A;  5KG6 A;  1N5X A;  4BWM A;  3F53 A;  1L7M A;  3EYZ A;  4C8L A;  2ZIX B;  3OHB A;  1NK0 A;  2IHM A;  4DWI A;  3LWL A;  9ICA A;  1XO0 A;  2MA1 A;  4PL1 A;  4YMN A;  4O3O A;  4UB2 A;  3OPX A;  3NVV A;  4QWB A;  8ICV A;  1TAM A;  4DL7 A;  1NKB A;  3T5L A;  4FO6 A;  2R18 A;  5KFW A;  2MSN A;  2C2E A;  2QB0 A;  2MUT A;  3IDW A;  1KFD A;  1B43 A;  3RTV A;  3D6J A;  4IR1 A;  4FBU A;  3HRD D;  2A1A A;  3F5E A;  5CB1 A;  5KNI A;  4TUS A;  2I9G A;  3PW7 A;  5KFA A;  4EBD A;  2HSZ A;  4C7Z A;  3K4G A;  1A77 A;  1D9D A;  4NLZ A;  5KFV A;  4NY8 A;  5HMM A;  1MSW D;  1SXE A;  5KFP A;  4DFP A;  3ZD8 A;  5ALP A;  3ED5 A;  5ALV A;  2EDU A;  3WKA A;  5AK6 A;  3AU6 A;  3MGV A;  3AUO A;  1PVQ A;  3LYS A;  1X66 A;  5AI5 A;  2HBK A;  1S97 A;  4FFD A;  4LZD A;  4UAS A;  1ZQS A;  1CI4 A;  2PFQ A;  1ZQI A;  8ICC A;  3RJG A;  3BS5 A;  4Y2T A;  1X9X A;  4F4Y A;  2XY6 A;  4OJL A;  5AM5 A;  1LVH A;  2UVV A;  3M6K A;  3IG5 A;  2DKX A;  4J9S A;  4UBC A;  2H5X A;  3FM9 A;  4JV0 A;  5F3X B;  1Z00 A;  2R8H A;  3V7J A;  3T79 A;  2VA3 A;  2W03 A;  7ICG A;  3TQ1 A;  2FLP A;  2UVU A;  4NLG A;  3RBE A;  3OSP A;  3SV4 A;  3JPQ A;  5L1J A;  4NL9 C;  5IIK A;  2W3S A;  5KFH A;  2AGP A;  2AJQ A;  3RAX A;  1ZQR A;  4F4K A;  1CEZ A;  2KIC A;  7ICK A;  4Y2R A;  5AM3 A;  4CF3 A;  4EBC A;  2MU2 A;  2YMP A;  1L3T A;  4M6W A;  2FPL A;  3SEN A;  2NO5 A;  3PST A;  4I2B A;  1YZ7 A;  2K60 A;  2E8N A;  2NRW A;  4IR9 A;  4QZI A;  5J0P A;  4UB5 A;  1D9F A;  2HBL A;  4RQ1 A;  8ICU A;  5KAI U;  1NJX A;  2BDU A;  3O0F A;  4YXM A;  4RQM A;  4EYH B;  4P4O A;  4LVS A;  2KOB A;  2OYY A;  1SKR A;  2LKY A;  3ETR A;  2A1J B;  2W04 A;  4IL6 U;  4CGZ A;  4UAT A;  3KZX A;  2KD1 A;  5DQH A;  2GWS A;  1D8L A;  3H8M A;  3AQF A;  1NNL A;  1QQ6 A;  4KLO A;  1N61 A;  4GC7 A;  3GU3 A;  1NKC A;  5ALL A;  2WF8 A;  3C1Y A;  4PHA A;  2RQ5 A;  7ICU A;  2WHE A;  4ECR A;  2OM6 A;  4Y2X A;  1XSP A;  2OWO A;  2JEJ A;  1BPX A;  3NGD A;  3GII A;  2C2R A;  3BQ7 A;  1WCL A;  1XNS A;  5AK3 A;  4A8E A;  1ZQK A;  2WTF A;  3DV9 A;  4R64 A;  1B4F A;  4Z6C A;  8ICA A;  5HP4 A;  2QAR A;  3HWT A;  2JZB B;  1NK9 A;  3NTU A;  1PZN A;  4AYB F;  4AYB C;  4YD2 A;  4RQ8 A;  1RYR A;  1Q46 A;  4IQW A;  1DXS A;  4RPY A;  9ICI A;  1RM6 C;  4MFA A;  4ECV A;  4C7Y A;  1SV0 A;  1BPY A;  4OCZ A;  5ALH A;  5HR7 A;  1SV0 C;  4O3M A;  5KG1 A;  1TKD A;  4DS5 A;  3TAQ A;  1KN5 A;  4M9N A;  1KSP A;  1JRP A;  3AN1 A;  4O3S A;  7ICF A;  5CHG A;  3IHQ B;  4KN4 A;  5D49 A;  1V97 A;  1JUD A;  5DKW A;  3QZ7 A;  4J9M A;  5KT6 A;  2CPR A;  1A76 A;  1X9W A;  5C5J A;  2EH9 A;  2BCS A;  2F1I A;  3RH4 A;  4RQ4 A;  4PGY A;  4CNQ A;  5KG2 A;  5J2B A;  7ICQ A;  1ZQ1 C;  5L1I A;  2HDO A;  3T5J A;  4IQU A;  2M0N A;  2KKP A;  1KTQ A;  8ICR A;  4P4P A;  3HJE A;  3GV7 B;  3DEE A;  3FAH A;  4JMU A;  2I6X A;  5KG4 A;  4ZH4 A;  2ZXI A;  5BOM A;  4C4T A;  3N7S C;  4M0A A;  2ES6 A;  3WKB A;  2VIX A;  4RPZ A;  5GTH U;  2F2A B;  5ALK A;  4O3R A;  5G5G A;  5J0R A;  1X6J A;  4YR0 A;  3HT3 A;  4R8U B;  4ACO A;  5J2G A;  1LKY A;  1RPL A;  4NLK A;  3UPQ A;  5KG5 A;  4YQW A;  4US8 A;  3V7L A;  3HW8 A;  3RJK A;  4F2S A;  1YZ6 A;  4F91 B;  4QZC A;  2NV3 A;  1Z1V A;  1F5S A;  4DOB A;  4WJ3 B;  1T94 A;  1ZQZ A;  4JB3 A;  9ICC A;  2HMX A;  2DPJ A;  1ZQG A;  3TFS A;  4CF4 A;  3SZ2 A;  4IS7 A;  1ZQF A;  3RAQ A;  1ZJN A;  1BNO A;  5JRT A;  4NM2 A;  2KZM A;  3ZDE A;  1JIH A;  2GH1 A;  1Z4O A;  3NRW A;  1HJP A;  4DL5 A;  4YVZ A;  5ALN A;  1NK7 A;  7ICP A;  2FDR A;  1DK2 A;  1OW5 A;  2RDI A;  3ORY A;  4I2E A;  5HML A;  3MGH A;  4Y2P A;  2K4E A;  3TAR A;  8ICI A;  2F77 X;  4J9P A;  1TK0 A;  1X2I A;  1ZQD A;  2R8G A;  2DUY A;  4KLD A;  5HR6 A;  1SIJ A;  2BCV A;  2HHQ A;  1ZOL A;  1ZQU A;  2LI6 A;  1TAQ A;  2RLT A;  3UMB A;  3H4D A;  3ZD9 A;  1PK3 A;  2FI1 A;  3C29 A;  4KN7 A;  4J9R A;  3BDP A;  2CRX A;  4RUC A;  1UT8 A;  4PHP A;  4DF4 A;  3M7D A;  4Q8F A;  1TAU A;  1X6I A;  1RYS A;  3MC1 A;  2YML A;  1Q3U A;  4J9Q A;  5J2J A;  2IHN A;  1UA1 A;  1QSL A;  4BX9 C;  9ICK A;  4JWM A;  4UAZ A;  1H38 A;  2UVR A;  4IQT A;  4CCH A;  3KOO A;  5ALU A;  2A1J A;  3IV6 A;  2F8K A;  4FZM A;  3ALR A;  1FFU A;  1V9P A;  4AP9 A;  3KKA A;  4F8R A;  3I28 A;  4Z6D A;  2DWQ A;  2LM4 A;  5TIS U;  4LZG A;  3PW0 A;  3OJS A;  4GC6 A;  2F1H A;  5KFE A;  1BPZ A;  2LYB A;  3KD3 A;  3KKA C;  1OUQ A;  4F71 A;  4BDP A;  2WAQ F;  4QW9 A;  3T5H A;  1K1Q A;  4BXO A;  5J2I A;  4ECU A;  2AQ4 A;  2Y0S C;  2XI9 A;  4O9M A;  4G3I A;  1COK A;  1S0M A;  8ICH A;  1N5W A;  3H0R B;  4XQ8 A;  5KFF A;  4DL2 A;  5KT5 A;  2ALZ A;  4NXZ A;  1TFR A;  5KTQ A;  2W11 A;  5EOZ A;  2JR5 A;  2Y1I A;  5AKG A;  4B9U A;  3JPP A;  2E8M A;  5KFQ A;  1RXW A;  4X5V A;  5KG0 A;  4BUG A;  3V6H A;  3OHA A;  3QUC A;  3MR5 A;  4I2J A;  3QYP A;  3H0M B;  1U9L A;  1PVR A;  5KFN A;  4PGQ A;  5KFS A;  3MR2 A;  3NRZ A;  4QZ8 A;  4YFK A;  1SKW A;  1NK6 A;  3QEA Z;  1QTM A;  1X40 A;  1A0P A;  2WF9 A;  2VAN A;  5DDY A;  4QWA A;  4KLG A;  3PV8 A;  4DQI A;  3NS1 A;  2FMP A;  3AM9 A;  2JEI A;  1ED1 A;  3K1Z A;  2PI4 A;  4KLT A;  8ICZ A;  3OJU A;  2HBJ A;  3RJF A;  3E2E A;  4QWE A;  5AM1 A;  2JGA A;  5F9L A;  5AI6 A;  4TUP A;  2K8C B;  3ZDB A;  3SD7 A;  4ED7 A;  2W7O A;  4DL6 A;  2Z7J A;  1MN8 A;  8ICJ A;  5AK4 A;  2W8K A;  4RNN A;  2W3R A;  5AKH A;  3TKA A;  1GO3 F;  3WK9 A;  5HNK A;  3RH5 A;  4I27 A;  1C20 A;  1WWV A;  2JH1 A;  3GFK B;  2GO7 A;  2C22 A;  1ZQB A;  2I1Q A;  1BPE A;  2E3T A;  4KX3 A;  3PX4 A;  2C2D A;  1TV9 A;  2FPM A;  2B0C A;  3PR5 B;  2AGO A;  2H3F A;  2BQ3 A;  3OSN A;  3SQI A;  1ZQY A;  2IA6 A;  2G07 A;  1RDF A;  2E1E A;  4QZF A;  1RZT A;  7ICE A;  1P7D A;  3IN5 A;  2ZUD A;  3EWA A;  4O0I A;  2K4H A;  7ICM A;  5J0Q A;  2BPF A;  4EX6 A;  4F4Z A;  3BZK A;  2QKQ A;  3KHR A;  8ICN A;  2OCE A;  4EX7 A;  4QJF B;  1NK4 A;  4O3P A;  3BQ2 A;  3KHH A;  4QIW C;  4M2Y A;  2XIC A;  3AU2 A;  4MEX A;  1NI3 A;  5AM0 A;  2E1F A;  4DQS A;  5DBA A;  3QU7 A;  4G9B A;  9ICW A;  4DL4 A;  4HYK A;  2KK0 A;  4O3N A;  3HP6 A;  4C8K A;  3U26 A;  1K1S A;  1O03 A;  5DB9 A;  4DFK A;  4CE6 A;  1BPD A;  5E79 U;  2N1R A;  1S0O A;  4DSF A;  5L1L A;  4BGD A;  9ICP A;  5AM2 A;  5DB8 A;  2PKE A;  3RRG A;  5F9N A;  1NOM A;  1ZRM A;  1SGG A;  4USA A;  4Q44 A;  1ZQP A;  1DRG A;  2LMR A;  2ODG A;  3G6X A;  3QE9 Y;  3SAF A;  4MEY A;  5AIB A;  3MDA A;  2W9A A;  1IG6 A;  5HHI A;  3B0Y A;  1FO4 A;  4F5Q A;  1FEZ A;  4GFJ A;  2NYV A;  5DQI A;  3NVZ A;  1ZQV A;  2BCQ A;  3RB4 A;  3NUQ A;  3D2N A;  4KLL A;  4F5N A;  2UVW A;  1XWL A;  1BNP A;  2ZIV B;  4NL9 A;  2HCF A;  5DG7 A;  1D8B A;  5AKL A;  1KRP A;  1QH9 A;  1Z19 A;  1ARO P;  1ZQC A;  4NV0 A;  3V6J A;  1V85 A;  9ICR A;  8ICT A;  5IIM A;  4F5O A;  1KDH A;  4XRH A;  2ZJ8 A;  5DGA A;  7ICN A;  5EE3 A;  4JV1 A;  1T3N A;  2ZIW B;  3Q8P B;  3LK9 A;  4DOC A;  1HIW A;  3ISB A;  3LVV A;  4PZN A;  5IIL A;  3I1Y A;  5IIJ A;  4DFJ A;  4EEY A;  2HW3 A;  1N62 A;  5KFJ A;  9ICS A;  3ETL A;  3SAG A;  2ZJ5 A;  4Y2J A;  1ZRN A;  4QZ9 A;  4B9V A;  4RT3 A;  2LBO A;  3F5A A;  1ZD5 A;  2E5S A;  2EAM A;  5C0Y A;  5AKE A;  2DQN B;  2KSO B;  4UAU A;  1JAL A;  2K4I A;  2J6U A;  4CDG A;  1SZP A;  5KL8 B;  2KE7 A;  5AI8 A;  2YB1 A;  3H7I A;  2HHW A;  1ZD3 A;  2GLE A;  4B9T A;  4GIB A;  4IC9 A;  1HEK A;  5EE9 A;  1U48 A;  3I76 A;  3M9N B;  2V9W A;  4J03 A;  5ALZ A;  3WKE A;  2OH2 A;  5DG8 A;  9ICQ A;  3Q8L A;  1EXN A;  2DKZ A;  5KFY A;  4UAY A;  4NLB A;  1ZXI A;  5KG7 A;  3M6Z A;  2KNJ A;  4ELT A;  4C8N A;  2W9C B;  2BKE A;  4DS4 A;  2DBY A;  2LYA A;  1WWU A;  3BJY A;  3KTQ A;  5CJ7 A;  5J0O A;  3BQ0 A;  2XGP A;  1PK1 B;  1XO1 A;  5J0X A;  2KJ9 A;  4QW8 A;  8ICM A;  7ICL A;  5J2K A;  4F50 A;  4EYI B;  2FMS A;  4MF8 A;  3RB6 A;  3DDH A;  3S6J A;  2I5H A;  3TAP A;  9ICX A;  1NKE A;  2P6R A;  3QU9 A;  4F2R A;  4J9O A;  2XID A;  3GIJ A;  3QNM A;  2FLL A;  7ICO A;  4EBE A;  1WG8 A;  4QZD A;  1ZQL A;  5AI4 A;  4ECT A;  3SR6 A;  3QEB Z;  5ALF A;  4O5C A;  2ZIX A;  8ICB A;  5H2F U;  2E8P A;  4ELU A;  5J0S A;  2G5H B;  4C4R A;  1QQ5 A;  3BQT A;  3MDC A;  2KEY A;  2ZXH A;  4RZR A;  4TUR A;  4YG2 A;  1UPH A;  2XVT A;  3ISD A;  4DF8 A;  1S77 D;  1N60 A;  5DLG A;  5J2C A;  2FE9 A;  4C0Z A;  5DQG A;  5ALR A;  4YXJ A;  1ZQJ A;  2VA8 A;  7ICR A;  2HOI A;  5BPC A;  2OHF A;  1QQ7 A;  1J2N A;  2FJ6 A;  3SI8 A;  2W7P A;  3C5F A;  5AKX A;  3SYZ A;  4NLN A;  3PO4 A;  1X42 A;  2IBK A;  1RYU A;  4DQP A;  3M9O B;  2V4Q A;  5ALS A;  4US9 A;  3V6K A;  1UCV A;  3HX0 A;  1OXJ A;  3C1Z A;  3TI0 A;  4B9S A;  1VLB A;  4B6J A;  3RB0 A;  3UXO A;  5ALT A;  5KFK A;  4J9K A;  1TK8 A;  2AH5 A;  2DL0 A;  1A6S A;  5ALY A;  3V72 A;  4KTQ A;  3AEV A;  5KT7 A;  3FYH A;  1ZQH A;  3SEI A;  2EZX A;  3HPO A;  1JI7 A;  4RUA A;  3SV3 A;  7ICV A;  1KFT A;  2RP5 A;  4F92 B;  2B6G A;  3RJI A;  2H3I A;  5KFX A;  5CRX A;  1URJ A;  4ECW A;  1L7P A;  1MC8 A;  4EEK A;  2F3N A;  4Q43 A;  1U47 A;  4KLE A;  1L6N A;  4P0Q B;  2YTU A;  1KLN A;  4UAW A;  3D2Q A;  2HHT A;  2P66 A;  1WCN A;  3C2L A;  3PO5 A;  4EEN A;  1JXE A;  3Q8K A;  1L3U A;  4I2G A;  2E8O A;  4ED0 A;  5DBC A;  2QB1 A;  3WK6 A;  4IRK A;  2KHV A;  4YP3 A;  2K8A A;  2QB0 B;  1JX4 A;  2ZIV A;  4DCC A;  5JUM A;  4UB8 U;  4E0D A;  2ZIU B;  4ECQ A;  2NRT A;  1V38 A;  3GIL A;  4FBT A;  3UXN A;  1ZD2 P;  1Z4N A;  3QUT A;  4C4S A;  4RQ5 A;  3PVX A;  3OTQ A;  3RF9 A;  1DGS A;  9ICJ A;  2HHX A;  4I2D A;  1ZQN A;  2ZIW A;  3VC8 A;  2JH7 A;  1K5O A;  4NWI A;  9ICM A;  3PW2 A;  3J81 j;  4C8O A;  3THV A;  4J9N A;  4YCX A;  1IM4 A;  4KMO B;  3A0B U;  1N63 A;  4ELV A;  3RBD A;  4U6P A;  1U49 A;  4JWN A;  4RQ2 A;  1ZQO A;  1BGX T;  2FPK A;  4RNM A;  9ICE A;  5ALQ A;  2ASD A;  1COO A;  4C8M A;  1T7P A;  4YR3 A;  4MFF A;  2DFL A;  5AKZ A;  3RR8 A;  5EWF A;  3BS5 B;  1ZJM A;  2KP7 A;  3H8J A;  2W9B B;  2W9M A;  4EEL A;  4JV2 A;  2NO4 A;  3GV5 B;  5FP0 A;  2PFN A;  1KL9 A;  5K4L A;  2P6U A;  3M9M B;  2KG5 A;  4ED8 A;  2D3D A;  5KFC A;  1ZQE A;  2Y0S F;  2H3V A;  1FIQ A;  3CRX A;  1Z00 B;  1M6Y A;  2ZUB A;  3WU2 U;  5KFB A;  1IIP A;  2KIW A;  2R8K A;  3JPO A;  9ICV A;  4ED6 A;  2H3Q A;  5ALM A;  3RFA A;  2BQR A;  2JZB A;  4I2C A;  1S10 A;  2XC9 A;  3HKZ C;  4EZ9 A;  4XA5 A;  2XY5 A;  1XS9 D;  1DGJ A;  1KKX A;  4OJO A;  3RJJ A;  2IOH A;  3N97 B;  4M6W B;  1L8L A;  3PML A;  3CNH A;  1S76 D;  1VJ5 A;  4LJX A;  3KFU F;  5AK5 A;  3MFH A;  1QSY A;  2YN4 A;  2JXJ A;  3ZDC A;  3R9K A;  2J6T A;  2F1J A;  3GZF A;  4QZA A;  2PMZ C;  3QU4 A;  4GXJ A;  4DFM A;  3MGI A;  7ICH A;  1NZP A;  4OD0 A;  4KX5 A;  2BQU A;  4DEZ A;  3RR7 A;  2XO7 A;  5DGB A;  2KHQ A;  8ICE A;  5DB7 A;  5KL1 B;  4DLE A;  5KT2 A;  4QZE A;  2WB1 C;  3GDX A;  2Y9T A;  1SB3 C;  2ESE A;  4QZB A;  4Q45 A;  4IRD A;  2HHV A;  4FZL A;  3A0H U;  1SL2 A;  4F5P A;  1UA0 A;  1F0M A;  2ZTC A;  2BPG A;  2W43 A;  4I2I A;  1QSS A;  1IXR A;  1T4G A;  2RRD A;  5DB6 A;  3H8S A;  4IRC A;  1CUK A;  1RXV A;  3E58 A;  4UQG A;  3GIK A;  5DDM A;  3TFR A;  3IM1 A;  3G6V A;  2Y1J A;  4ECZ A;  1XC9 A;  4DQR A;  4UB3 A;  2G09 A;  3LWM A;  2JRZ A;  3UQ2 A;  1SL1 A;  2NRV A;  2ISO A;  2ZUC A;  2HVH A;  5AIA A;  3PX0 A;  4R8U A;  4R66 A;  2KFN A;  7ICS A;  4UW9 A;  5EE1 A;  4B9L A;  2EAP A;  3FC4 A;  4OJP A;  4Y2U A;  5DG9 A;  3FDS A;  4IQV A;  4ED2 A;  3E0F A;  4ECX A;  1ECW A;  1L7N A;  4TQS A;  5J29 A;  4PGX A;  5D46 A;  2VJ5 A;  5KFR A;  1KEJ A;  2M9N A;  4KLJ A;  1T8E A;  3QU5 A;  3M1Y A;  5A0L A;  2P35 A;  4O5K A;  4P0Q A;  2PFO A;  3LDA A;  1SWV A;  4QIW F;  3PR4 A;  3MR3 A;  2W54 A;  4I2H A;  1TE2 A;  4F3O A;  4GXK A;  3UMC A;  1U4B A;  4R63 A;  1Z1B A;  4QZG A;  3Q8R B;  3K75 D;  3ICX A;  1L8O A;  3N7P D;  3ZDD A;  3F2B A;  5KFO A;  2ZIU A;  4M47 A;  2D6F C;  3EW9 A;  3TAC B;  2YMM A;  1DK3 A;  1UQV A;  4KMU A;  2A19 A;  4GXI A;  3MBY A;  1XSL A;  5ALX A;  7ICI A;  1NJY A;  4TQR A;  3N7R C;  9ICF A;  3HIL A;  1JN3 A;  5EWG A;  4DL3 A;  5III A;  5AKI A;  1ZET A;  1LV5 A;  5B5E U;  2OEH A;  1LKY B;  2D8C A;  1SV4 A;  5ALO A;  4KLU A;  3C21 A;  1MQ3 A;  2R8I A;  2MAX A;  3B9J A;  3L3F X;  1X9M A;  2AQ0 A;  5AIC A;  3QUQ A;  3KHL A;  4DO9 A;  5IIO A;  3IRU A;  5KT3 A;  4DSI A;  8ICO A;  4NM1 A;  3UQ0 A;  3PSF A;  2A3V A;  4PJ0 U;  5J8Y A;  5ALW A;  4QWD A;  5J0Y A;  2FMQ A;  2IMW P;  3KBB A;  2FLN A;  2W9B A;  4Y2S A;  8ICL A;  1L3V A;  1F44 A;  5EE0 A;  2PFP A;  2B21 A;  5J8Y C;  1NZB A;  3PY8 A;  3UM9 A;  2KZ3 A;  4RQ0 A;  1NJZ A;  3WKC A; 
#chains in the Genus database with same CATH homology
 2HBJ A;  2YB4 A;  3N7S C;  4P0P A;  2MRL A;  4QIW F;  4BX9 C;  3RF9 A;  2VIX A;  2OXO A;  2WAQ C;  3GZF A;  4C0Z A;  2LBO A;  2JGA A;  2PMZ C;  2F2A B;  2K8C B;  3F5A A;  3HKZ F;  2E5S A;  4OJL A;  1XNS A;  2CN1 A;  3CYM A;  4A8E A;  4CRX A;  4FZN A;  3M6K A;  2HOI A;  5C0Y A;  2W7O A;  4KX5 A;  3IG5 A;  2DQN B;  1Z1B A;  4FZM A;  3H0L B;  2Z7J A;  3ALR A;  4ACO A;  2K4I A;  4CDG A;  3SMV A;  4OO1 J;  2KHQ A;  2ZIW A;  2W7P A;  5KL8 B;  4OJ5 A;  1DRG A;  4NLC A;  2H3Z A;  5KL1 B;  2YB1 A;  3VC8 A;  3F53 A;  3ICX A;  2JH7 A;  3N7P D;  4NWI A;  3F2B A;  3PZP A;  2ZIU A;  1GO3 F;  4AYB F;  4IC9 A;  1HEK A;  2ZIX B;  3F2D A;  4AYB C;  2JHD A;  2D6F C;  2JMG A;  2WB1 C;  2NV3 A;  2HOQ A;  3LVW A;  3SAF A;  2G06 A;  2LYB A;  2G08 A;  4KMO B;  1OUQ A;  2VKQ A;  3T79 A;  4WJ3 B;  2W03 A;  4U6P A;  2WAQ F;  1XO0 A;  1T94 A;  2OH2 A;  2MA1 A;  4PL1 A;  3AL0 B;  2PMZ F;  4FZL A;  1PVP A;  2JH1 A;  3D2S A;  2HMX A;  2GOL A;  3AQE A;  3OPX A;  4NLB A;  2XVT A;  2ZG6 A;  2KNJ A;  3M6Z A;  2Y0S C;  1TAM A;  2HBM A;  1WUD A;  2XI9 A;  3KFU F;  4GFJ A;  4KX3 A;  2G0A A;  2LYA A;  2R18 A;  4OJ6 A;  3N7R C;  3PSP A;  5HR7 A;  4U7C A;  2GH1 A;  3VCB A;  1A6S A;  2H3F A;  2RRD A;  2KIC A;  2YX8 A;  4O3M A;  3SAH A;  3SQI A;  1MA7 A;  3H0R B;  3NRW A;  3NUQ A;  2KJ9 A;  2HOF A;  2WB1 F;  3IP4 B;  3D2N A;  2G07 A;  2KJ5 A;  3F5E A;  2RP5 A;  2KKV A;  2E1E A;  1CRX A;  2H3I A;  5CRX A;  1URJ A;  2ZIV B;  3PST A;  2VJ4 A;  2G5I B;  2Q4T A;  1Q3V A;  1P7D A;  3IN5 A;  1YT3 A;  4ICA A;  1D8B A;  3F2C A;  3C28 A;  3L3F X;  2G09 A;  2K4E A;  2HBL A;  2K4H A;  2Y0S F;  2CPR A;  2H3V A;  2F77 X;  2BDU A;  2KV2 A;  4BUG A;  2F76 X;  1Z19 A;  3CRX A;  4P0Q B;  1L6N A;  3IG8 A;  2XID A;  3D2Q A;  3O0F A;  3K1Z A;  4NV0 A;  4P0P B;  2LHT A;  3H0M B;  5HR6 A;  1IIP A;  2KOB A;  2KIW A;  2F8L A;  5T14 A;  2OYY A;  1PVR A;  2K8B B;  4QJF B;  1ZQ1 C;  2H3Q A;  2LKY A;  3PSF A;  3RFA A;  2RHF A;  2M0N A;  4BJQ A;  2A3V A;  2K89 A;  2W04 A;  4QIW C;  2XIC A;  1KBU A;  1SZH A;  3ONN A;  2KKP A;  4CGZ A;  3KZX A;  2KD1 A;  3C29 A;  2KHV A;  2ZIX A;  4OJP A;  3HKZ C;  2E1F A;  1F44 A;  1A0P A;  2K8A A;  2DF4 B;  2ZIW B;  2KJ8 A;  3AQF A;  3E0F A;  2DGZ A;  3PSI A;  4FE3 A;  2CRX A;  2ZIV A;  1HIW A;  3CP8 A;  3DEE A;  1ECW A;  2G5H B;  2ZIU B;  3GU3 A;  4JMU A;  3M7D A;  4OJO A;  3LVV A;  3MGV A;  1PVQ A;  1NZB A;  3LYS A;  2VJ5 A;  4PL2 A;  2HBK A;  4QNL A;  2KEY A;  2ZXH A;  2ZXI A;  2OM6 A;  5A0L A;  2KVC A;  1Q3U A;  1ED1 A;  4P0Q A;  3SAG A;  1UPH A;  2N1R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...