2PMZF

Archaeal rna polymerase from sulfolobus solfataricus
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
89
structure length
89
Chain Sequence
b'MSSVYIVEEHYIPYSVAKKLLTDVIRSGGSSNLLQRTYDYLNSVEKCDAESAQKVIEELSNIVSREDVRAILASICPTTSDEVRSILVM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit A
publication title The X-ray crystal structure of RNA polymerase from Archaea
pubmed doi rcsb
molecule tags Translation, transferase
total genus 16
structure length 89
sequence length 89
chains with identical sequence U
ec nomenclature
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF03874 RNA_pol_Rpb4 RNA polymerase Rpb4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.820 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2pmzF02
3HKZF 4AYBF 2PMZF 2Y0SF 2WAQF 2WB1F
chains in the Genus database with same CATH superfamily
3CNHA 3QXGA 1HUOA 1RQLA 4DF4A 1QH9A 3A0BU 4QIWC 2PI5A 4PHAA 1IXRA 4R65A 1PUZA 1SV0C 1JROA 5DGAA 2H3ZA 2K4HA 2PXIA 2R18A 2A1JA 1PZNA 3V72A 2BQUA 2HHQA 4I29A 5AI0A 5KL8B 5J8YC 1S9FA 4JMUA 4DL7A 4IR1A 1L3TA 3SYZA 4MFAA 3QE9Y 2QB0B 5L1JA 2VANA 4DS5A 3SV3A 4F4KA 1NNLA 3WU2U 7ICJA 4QWCA 2JV3A 3RH5A 3MABA 3BQTA 5KFDA 4JB3A 4BDPA 1MQ2A 3SD7A 2KZMA 4MHVA 1SL1A 4MEXA 1TKDA 2F76X 5F3XB 4KX3A 4C8OA 2IOFA 4RU9A 3BQ7A 2FLPA 4Q8EA 1CUKA 3WK7A 2BPCA 4DSEA 3ZDAA 5EE9A 2IBKA 3PW5A 3I28A 2CXYA 3T79A 1MC8A 1D9DA 5ALJA 3PO4A 4QZCA 5C0YA 5KFNA 4ECTA 7ICTA 3UMCA 1KKXA 2BCUA 5CP2A 3SAHA 4O5EA 1BPBA 4QW9A 1ZD5A 2MRLA 5AKGA 4F5OA 4F92B 5AI9A 3VCBA 2OEHA 2MAXA 2WF8A 5KL1B 4ECSA 4DQSA 2AH5A 2KFNA 1WCNA 4C7YA 2W7OA 3QZ7A 2EZZA 1T94A 3JPQA 3AQFA 3E58A 2CRXA 5AKXA 8ICXA 5F9NA 7ICUA 3T3FA 1RM6C 4US8A 9ICJA 1UA0A 1O03A 2AU0A 4UAWA 2V9WA 3L5KA 4B6JA 2W03A 4DFPA 2KV2A 1N2XA 1V85A 3BZKA 4C7ZA 1SV0A 1L8OA 5JUMA 1Z19A 3Q8SB 3QUQA 2ZIWA 3NVWA 4P4MA 2Y0SF 1NK4A 4C80A 5AM5A 3JPNA 2BR0A 2WFAA 4HAIA 3H4DA 1V9PA 4I2AA 1B43A 5J8YA 3KHHA 2HBKA 5DGBA 1L3VA 1SXEA 2NRTA 4RQ0A 2C22A 1XO1A 4JV2A 3F2CA 4JV0A 3PX6A 1U4BA 4FZNA 3ZI4A 3ISDA 1BNOA 1XC9A 3KZIU 2ZUDA 3GV8B 4F2SA 2ZIUA 4DQRA 1BPZA 2KHVA 3ZD8A 5KFQA 4YCXA 2VKQA 4NLKA 2W7PA 3ZDEA 2HSZA 5J0TA 4X5VA 2XGQA 8ICKA 1NK0A 2PI4A 3MR6A 1ZD4A 1Z00B 5J0YA 4O3QA 2JR5A 4CDGA 3H8WA 3T5JA 2ZXIA 5JU5A 1T7PA 3KOOA 2C2DA 2KN7A 4CF3A 7ICEA 4DL3A 1B22A 1SXDA 3AQEA 2YTUA 1WG8A 2DUYA 2ZIVA 2DFLA 4O3NA 2E8NA 4B9SA 1P7DA 3OPXA 1T4GA 4KN4A 3UQ0A 4JWNA 4YR3A 2F1IA 3MFIA 3GDXA 3GZFA 4PPXA 1Z1BA 1IIPA 1RXWA 4ECQA 4Y2TA 2H3FA 2NYVA 2I5HA 3SI8A 3C2KA 7ICPA 5T14A 3V6HA 2C2EA 4CGZA 1DRGA 2K4PA 1X9MA 1KDHA 1COKA 2BCVA 4DF8A 3PW4A 4C8MA 3MBYA 4ELUA 1GO3F 5CRXA 2W9AA 2LM1A 2OHFA 3M1YA 5DLFA 4JK1A 5KG7A 4B9UA 2K60A 2OYYA 5KFFA 1PK1B 3B0XA 3K4GA 1LV5A 2A19A 3UM9A 2NO4A 2W9CB 1ZETA 4EZ6A 3JPSA 2LPEA 4ED6A 7ICFA 2YMMA 2Y0SC 3ZDCA 2P66A 1SKRA 4UAYA 4DWIA 2VJ4A 3MFHA 4P0PB 1L3UA 3J81j 1BNPA 4Y2RA 3SEIA 2XCPA 9ICUA 3WKDA 4I2IA 2KOBA 2FMPA 1S0VA 4KLGA 1JXLA 5AK5A 3AEVA 2RDJA 1T3QA 5ALYA 4USAA 4QZEA 4RNMA 4QZ8A 4DL4A 2EAOA 4AP9A 4DSKA 4JV1A 5DQIA 1Q8KA 1X42A 7ICLA 2V4RA 5AHXA 2Q4TA 4KLHA 4FBUA 5KFUA 3KZXA 1QTMA 1PVRA 3UMGA 4Q45A 7ICIA 3FC4A 2OH2A 4EX6A 3V7KA 2WHEA 2YMLA 3ZD9A 1ZYQA 1SGGA 1UHUA 1U49A 5KFVA 1JRPA 2EAMA 2XVTA 2HI0A 1V97A 2DWQA 5DDYA 3OGUA 1KTQA 2AXTU 2R8HA 4BJQA 1KRPA 1ZOLA 5J29A 3RJGA 2WTFA 4RQNA 4UB3A 2VJ5A 5AICA 1ZQWA 7ICHA 4RNOA 5DBCA 3TQ1A 1NKBA 1ZQMA 4TUQA 4DCCA 1S8OA 1TK0A 2XI9A 2YB4A 4UB6U 4C0ZA 3RH6A 5CJ7A 3T5KA 1H38A 8ICVA 1ZD3A 5K4LA 1N60A 2BZFA 3C1ZA 2EQYA 4KLEA 2W9BA 4XRHA 4I2BA 2ZJ8A 1F0MA 4YD2A 2K4EA 2ZUBA 1AQ6A 3IN5A 1Z3EB 3MDAA 4C8LA 3EZ5A 9ICOA 2XCAA 2R8KA 3OHAA 4KLUA 2K8AA 4UQGA 3OTQA 3TADC 3D2NA 1NOMA 1KBUA 7ICOA 5KFHA 2ZJAA 4ECRA 8ICIA 3GU3A 3QYPA 2XY5A 1XO0A 1NZBA 4M9JA 4R8UA 3Q8QB 5AI4A 4O9MA 3SQIA 5KFEA 4C8KA 3RJKA 4I27A 3NS1A 4F5PA 4KLQA 2I9GA 4AYBF 2L5YA 9ICHA 4I28A 1B0XA 4IQVA 2ATLA 2DF4B 3TAQA 1S5LU 1X9SA 4NY8A 5KT4A 2W8KA 2E8PA 4EEYA 5KFMA 2C28A 1ZQEA 2KJ8A 5AI8A 5AKIA 2W8LA 2KIVA 1VJ5A 7ICVA 2LYHA 1O08A 1NJXA 2B21A 3QEAZ 1F5SA 5AKJA 3IHQB 4UB5A 1ZQHA 4I2CA 1JI7A 4J9RA 4GC7A 2G09A 4DQPA 1ZRNA 4NM1A 3SAGA 1KL9A 2AGOA 7ICMA 1CRXA 2B0CA 4C4TA 4RNNA 2W43A 4R64A 3F2DA 3QEBZ 8ICLA 1S0MA 5G5HA 1S0NA 4Q43A 4BXOA 2EZYA 3LDAA 2KG5A 4UASA 3C5GA 2KZZA 3C2MA 3WK8A 4PHDA 4F4XA 2HHTA 5KTQA 7ICQA 3PSFA 1S97A 2JEIA 4QWBA 4UAZA 3HKZF 1NJYA 2KHQA 5ALGA 1K1SA 1UPHA 3V6JA 2LMRA 2KNJA 2HHWA 3SMVA 3RJFA 3RB6A 2F77X 3H0RB 2VA3A 2YMPA 2YMQA 3UXNA 4M6WA 5AIBA 5HP4A 4ACOA 4KMUA 2HOFA 4ZH4A 3TADA 4M47A 2MUTA 4GC6A 4O0IA 1K1QA 2A1JB 5KFIA 1NK8A 5IIKA 4ED3A 3RTVA 1D8YA 3H40A 4RQ5A 4J9MA 4F4WA 2Z7JA 3PVXA 2MA1A 4O3MA 9ICBA 3UXPA 2LYBA 2DKZA 3IP4B 4OJPA 1UA1A 2KJ5A 5J2HA 5DG8A 4TUPA 2OWOA 3RB3A 3C1YA 5KG5A 5DB9A 1X9WA 1VDVA 3C5FA 2XICA 5AM0A 5ALOA 4AYBC 1LKYA 5J2IA 2YN4A 4Y2XA 5TISU 2AJQA 5D49A 5KFSA 4ED1A 4PL1A 2WF7A 1WUDA 3JPRA 5AKHA 1T8EA 5ALPA 3LK9A 8ICEA 1L7PA 1N61A 1VLBA 5KG4A 2ZUCA 4YP3A 2XGPA 4OJ6A 4Q44A 4FS1A 4OO1J 3QUBA 4RUCA 8ICWA 4O3OA 5KAFU 8ICZA 3EUB2 3H0MB 3RRHA 4F93B 5L1KA 3M6KA 2XO7A 4YXMA 5CWRA 2JEJA 4JWMA 5DG7A 4PL2A 5KFWA 1JN3A 3LYSA 5TZVA 5DB6A 3ETLA 5J2FA 1NKEA 1L7NA 2GWSA 5DG9A 3KTQA 3HW8A 4R66A 5J0WA 4O3SA 2HMXA 4UBCA 4F91B 4LZGA 2KP7A 1OXJA 2N1RA 3H8SA 3MR3A 3EW9A 2M9NA 4FO6A 2XIDA 3QU2A 3HKZC 4QZBA 9ICNA 4K4HA 4Z6EA 5ALMA 1KLNA 4WJ3B 1DXSA 4DLEA 5H2FU 3BJYA 3EPIA 2MU2A 3M9MB 3HJEA 1ECWA 3NRZA 2R8GA 2HHXA 2NV3A 3PV8A 4BGDA 2PMZF 2BHNA 1ZD2P 5ALEA 5A0LA 4LZDA 1N48A 4DFJA 3EPGA 4B9VA 3OJUA 2HW3A 2RP5A 2ZIWB 2QLTA 8ICUA 5HNKA 2HDOA 2W54A 5EOZA 3PX4A 5F9LA 3DV9A 2F2AB 2KE7A 1ZQBA 3BQ1A 3PSIA 1ZQZA 1QSYA 3TAPA 3UMBA 4BWJA 2BQRA 4DL5A 3ED5A 3AN1A 2KVCA 5J2BA 2K8CB 3QUTA 2ZIUB 1TK8A 3WK4A 2NRVA 2JGAA 2YQEA 2A1AA 3Q8PB 1KSPA 1KFDA 3F2BA 9ICCA 8ICMA 3BQ2A 3RBDA 3DDHA 5ALQA 8ICYA 5J2DA 2QB1A 4Y2YA 3D2SA 5EWFA 2JEGA 2I1QA 4G9BA 1HUZA 2LM4A 5J0XA 4B9TA 1QCKA 5BOMA 1K5OA 3RAQA 2ESEA 1D9FA 2ZIVB 4IRCA 2Y1IA 1X40A 3PMLA 4EYIB 1X9XA 4C8NA 3IRUA 5ALXA 5D4BA 2VA2A 4EX7A 4YD1A 1MA7A 3KKAC 3M7DA 2HOQA 2YY6A 2CN1A 4Y2VA 1JX4A 4Y2JA 2YX8A 4ECVA 2HOIA 4CRXA 2F8LA 2BKEA 8ICJA 5J2CA 4Y2UA 2XY7A 4IR9A 8ICPA 2KSOA 1IV8A 4Y2QA 1ZQKA 1ZRMA 2KKPA 4YFKA 4TURA 4B9NA 3U26A 1SZHA 2NO5A 3HPOA 3FDSA 3SZ2A 1X66A 3GIMA 3N97B 2KIWA 2PMZC 2NRZA 2H3QA 1Z4NA 2AQ4A 2W3SA 3BQ0A 2DKXA 2HBLA 2ZTCA 4B9MA 1BVSA 5EWEA 4MFFA 2FE9A 2E5SA 5AK4A 1SL2A 3LWMA 2K8BB 4ZOHC 2WF5A 5KG2A 3OJSA 4NJ8A 1QQ6A 9ICTA 4UBBA 2ISOA 2JH1A 1M6YA 3T5HA 3AU2A 2NRXA 4DOAA 2DGZA 2HBJA 3NRWA 2RDIA 3V6KA 2RLTA 4XQ8A 3MR5A 4M9GA 3RFAA 2GOLA 1X6JA 4FZLA 4KLTA 1RDFA 2PFQA 1URJA 2RQ5A 3F5AA 3TARA 1ED1A 3QU5A 1SB3C 5ALHA 4RUAA 4DSLA 3LVWA 3K75D 4NLGA 4NV0A 1Z1VA 4JUZA 4RQ3A 3M8RA 2AGQA 1NJWA 4RPXA 1ZQXA 2IA6A 1ZQTA 4XA5A 3RBEA 2R8JA 3N7SC 7ICGA 2FPLA 2WF9A 1XU4A 1NK5A 1JIHA 2ZIXA 2ODGA 3T5LA 2W3RA 5C5JA 1FIQA 4F4YA 5EWGA 2AGPA 3KFUF 2Y1JA 4QZDA 1Q46A 3CW2C 4F50A 3Q8LA 5ALZA 3WKBA 1SV4A 2PFNA 3BDPA 3S6JA 3MGIA 2DBYA 3KKAA 2F1JA 2B6GA 3TI0A 2KMDA 3KHLA 3O0FA 1DOQA 5GTIU 5J0OA 4RPZA 3PSPA 4YMOA 4NWIA 5KG0A 3TFRA 2J6UA 3PNCA 1QQ7A 4OJOA 1J2NA 2JXJA 4U6PA 2W9BB 3K1RB 1ZQOA 4GXIA 4DOCA 1ZXIA 4PJ0U 1RYRA 5DQHA 4LVSA 2EDUA 4EBDA 2M0NA 3G6YA 5HHHA 4K4GA 5D46A 9ICMA 2JHDA 4M0AA 3HP6A 4UB8U 5JTIA 1ZQDA 9ICLA 2AQ0A 4O5KA 1MN8A 2ZJ5A 5AKYA 3IG5A 5KFCA 4BX9C 3ZDDA 5KG1A 1ZQRA 3HX0A 4KLFA 5L1IA 4EBCA 4R8UB 2JZBA 3LVVA 3MC1A 2K89A 4C4SA 3GIIA 1PVPA 1JALA 3EYZA 5ALUA 3GILA 4OJLA 1U47A 3RAXA 4O3PA 5HHIA 4IRDA 4KLDA 3BS5A 1L3SA 9ICIA 3NTUA 2HHVA 5KFTA 4NLBA 1BGXT 4KLIA 3C21A 1N5WA 8ICRA 5EE1A 8ICCA 2CPRA 3AM9A 1ZQCA 1FFUA 1N63A 3M8SA 5KFYA 3C29A 4P4PA 4IQTA 2ZG6A 2KJ9A 2G0AA 4J9PA 5AK3A 1JUDA 4ED8A 5KFRA 2ZTEA 4QWDA 1XSLA 4PZOA 4YR2A 1QSLA 3GIKA 1XNSA 7ICKA 2DPIA 4UAUA 1KFTA 1UT5A 1ZQYA 4BXOB 5AKKA 1TFRA 3SV4A 7ICSA 5B66U 1S76D 2IHMA 3KD3A 3PSTA 2FLLA 2WF6A 2JH7A 3V7LA 2JRZA 2OCEA 4EELA 4KITB 4KX5A 4YG2A 4GXJA 2D8CA 1YZ7A 5AM1A 3QUCA 2EANA 3M9NB 1J2MA 4GIBA 5CB1A 4YXJA 1TAMA 3TANA 4QWAA 3RR7A 1C20A 3TFSA 5ALSA 2LYAA 4M6WB 3ISBA 5J2JA 1N5XA 2E1FA 5IILA 2RHFA 3B0YA 4KLLA 2MUTB 2E1EA 2BCRA 5KG6A 1Q3UA 2MSNA 1FO4A 3MGVA 3H4BA 2QARA 4RQ8A 1U48A 3IDWA 4KTQA 3C23A 3RJHA 3F53A 4QZFA 4DFKA 2GO7A 3RF9A 3PW2A 3RH4A 5KT3A 5ALTA 1LKYB 4RZRA 3AU6A 1RYSA 1L5UA 3TKAA 5IINA 5KFXA 4IRKA 4ECUA 3K1ZA 4QZHA 1TAQA 4RT3A 4KN7A 5AK6A 1BPDA 3UPQA 4I2GA 4BWMA 1KEJA 5ALFA 4DFMA 2H5XA 2BCSA 5AIAA 3PMNA 4F5RA 4ECZA 5AM3A 4NL9C 8ICAA 1ZQAA 2RRDA 4P0QA 5J2EA 3QU7A 9ICAA 2LI6A 2KKVA 2DL0A 2J6TA 4F8RA 3KHGA 2ALZA 1LVHA 5DBAA 5ALIA 3R9KA 4I2HA 8ICSA 3V7JA 1Y88A 5KFLA 3CRXA 5J2KA 1ZQJA 5BOLA 4R63A 1FFVA 3MGHA 4EBEA 1DK2A 5ALKA 1UT8A 4J9LA 3AMZA 3RJEA 5KFBA 2IMWP 3MDCA 5ALRA 4IQUA 3IG8A 1NK9A 2F3NA 1BPEA 1WYGA 2Q0ZX 9ICQA 9ICFA 4P2HA 2BPFA 3WKCA 2JEFA 3RB0A 3RB4A 4US9A 2VIXA 2DQNB 2LBOA 2HVHA 4OJ5A 3Q8KA 5KT2A 1BPYA 1OW5A 3ICXA 1AROP 4ED2A 1S0OA 4M04A 4CF4A 3D2QA 5AKLA 4ICAA 1NK7A 3PX0A 4YMNA 1UCVA 2BCQA 3UQ2A 1ZQSA 2QB0A 4UB1A 2E3TA 5J0SA 4UB4A 3QU9A 5IIOA 1TVAA 9ICPA 1SKWA 3RRGA 3GFKB 4RT2A 8ICGA 4Y2SA 4OD0A 2JMGA 5BPCA 2BDUA 3RJIA 1L6NA 1FEZA 1ZQUA 4NM2A 2W04A 4B9LA 5JRTA 4PHPA 1IM4A 5J0UA 1A76A 4Z6DA 2G5HB 2KFZA 4YQWA 1S77D 2OXOA 4PGYA 1ZJNA 3HT3A 1TE2A 1WWUA 2KICA 5DB7A 3JPPA 2WB1F 3ONNA 1X6IA 3H7IA 3G6VA 1RQNA 3H8JA 4YN4A 4GFJA 4PGXA 3I76A 4NLCA 4RQ4A 3AUOA 3H0LB 2KK0A 5J2GA 3ZDBA 4NL9A 3DEEA 4DEZA 4QZ9A 2G5IB 4LJXA 3ORYA 1U9LA 5KNIA 4GLXA 4DO9A 5CA7A 2G07A 2W11A 4PHEA 2PFOA 3Q8RB 2KZ3A 5IIMA 1HJPA 1MSWD 4MEYA 1RYUA 3PO5A 1TK5A 2BDPA 2GLEA 3L4PA 4F72A 8ICBA 1NKCA 4F3OA 4PGQA 2V4QA 1OUQA 4MF2A 2LHTA 2HHUA 4F2RA 2IHNA 5J0RA 1ZQFA 4QZGA 4YR0A 3HWTA 4QWEA 2O6KA 5DQGA 4UARA 4EYHB 1YZ6A 2KSOB 2KVSA 5CHGA 4KMOB 4NLZA 5HR7A 4I2FA 5KFJA 5G5GA 3PR5B 4DFDA 3A0HU 5AM4A 4EEKA 5AKZA 4A8EA 2HVIA 1TV9A 4QJFB 4UATA 4OCZA 2W9MA 2W55A 4TQSA 3IV6A 5DKWA 3I1YA 2ASLA 3QNMA 5IIJA 1KQQA 3QU4A 5AI6A 2Y9TA 4CE6A 1L7OA 1T3NA 3AL0B 5KFGA 9ICWA 9ICXA 1SZPA 1PVQA 1NJZA 2IOFK 1A6SA 8ICHA 1QLNA 4QZIA 4M2YA 2FMQA 5HR6A 3N7PD 4KLSA 5DBBA 1RPLA 3N28A 1ZJMA 1KW4A 2FI1A 4E0DA 4J9QA 2D3DA 4ECWA 3L3FX 4ELTA 3E0FA 2K4IA 2PFPA 2ASDA 3PY8A 1Z00A 2P35A 3D6JA 8ICFA 3RR8A 4KLOA 1DGSA 5ALNA 1IG6A 3NASA 3QX7A 4I2DA 2XY6A 2WB1C 4UW9A 3ALRA 4MF8A 5L1LA 5KFKA 3KHRA 2FLNA 1EXNA 1SWWA 4J9KA 3G6XA 1Q3VA 3B9JA 5ALVA 3WKEA 4RQ7A 4I2EA 3C28A 1ZQPA 3NUQA 5CR0A 2LKYA 3Q8MA 4DSJA 4NLNA 2HHSA 4RPYA 3CYMA 2ZIXB 1F44A 4DQIA 4XUSA 1DK3A 2EH9A 1PK3A 4J9OA 4KLMA 2H3VA 5KFAA 3NGDA 3F5EA 5KFOA 3C2LA 2EAPA 5IIIA 5ALLA 4F71A 2BPGA 3KBBA 1ZQIA 2ISPA 2WAQF 2ZXHA 5AKEA 3PR4A 2C2RA 4J9NA 5E79U 5ALDA 9ICGA 3HRDD 3NVYA 1J97A 4DL2A 1JXEA 5KFPA 3GV5B 3OSPA 2GH1A 3N4MB 1RXVA 4DSIA 2Y9UA 1V38A 3THVA 1PK1A 2UVRA 1B4FA 4ECXA 5AI5A 4DL6A 2W9CA 1WWVA 4FFDA 8ICOA 3EWAA 3N7RC 1XWLA 4Y2PA 4UB2A 2XC9A 1YT3A 4P0PA 3JPTA 2HCFA 3OSNA 5L1MA 1JMSA 4U7CA 2FMSA 5KG3A 5J0PA 3E2EA 4Z6CA 9ICKA 2AHOB 2JZBB 4J03A 4TUSA 4EZ9A 4G3IA 4F5NA 2FJ6A 2PKEA 5J2AA 1HIWA 3MR2A 1SKSA 3PZPA 1ZQLA 3WK6A 1WCLA 2F1HA 3WKAA 3BS7A 4M9HA 5B5EU 3NVZA 4FBTA 5DDMA 3BS5B 1SL0A 5EE3A 1A0PA 4IL6U 5L9XA 2I6XA 4DOBA 2R8IA 4O3RA 3WK9A 2ASJA 2UVVA 1ZQ1C 3HILA 4FZMA 1COOA 7ICRA 5J0QA 2P6RA 4RQ1A 1U45A 1SIJA 1XSPA 2YB1A 3WK5A 9ICVA 3CP8A 5KFZA 7ICNA 5EE0A 5FP0A 3GQCA 3FAHA 4DLGA 1N62A 4DS4A 4CNQA 4TQRA 4ED7A 1HEKA 3GIJA 4EENA 3NVVA 1UQVA 4FS2A 3TACB 1QQ5A 2FDRA 1MQ3A 1BPXA 1L7MA 4RQMA 4M9NA 4YVZA 4I2JA 2ZTDA 2NRWA 1L8LA 8ICTA 9ICRA 2G08A 2ES6A 5ALWA 2BGWA 2KTQA 2WAQC 2IOHA 4HYKA 1SWVA 2F44A 2P6UA 4PH5A 4QIWF 2DPJA 1A77A 3IM1A 1KFSA 1D8LA 2F8KA 2EZXA 2KD1A 1D8BA 4DSFA 4IC9A 1XSNA 5KT5A 4MFCA 3M9OB 9ICEA 1NZPA 5KAIU 4RQ2A 1KN5A 4NXZA 1NI3A 2H3IA 5DLGA 2D6FC 4IQWA 1CEZA 2E8OA 1LB2B 3UXOA 4BUGA 1ZQQA 3LWLA 1DGJA 5DB8A 1S10A 8ICQA 2J6SA 5GTHU 1TAUA 2UVUA 2QARB 5HMMA 4IS7A 1RG6A 2E8MA 3FM9A 3BZCA 2QKQA 4ECYA 4F4ZA 1QSSA 4DQQA 3FYHA 4UAVA 4C4RA 5CEHA 1ZQGA 3SR6A 3ETRA 2VA8A 3M6ZA 4ELVA 3VC8A 4KLJA 3SENA 1ZQNA 2FPMA 2KEYA 3H8MA 3QZ8A 4Z6FA 5KT6A 5HMLA 4QZAA 1RZTA 2UVWA 4ED0A 3OHBA 4J9SA 2HBMA 2FPKA 1ZQVA 4M9LA 4P0QB 4CF5A 4QW8A 4P4OA 1NK6A 4Q8FA 4PZNA 4QNLA 1Z4OA 3JPOA 4RQ6A 5AM2A 1X2IA 4K4IA 3PW7A 1CI4A 4O5CA 8ICNA 1C7YA 3GV7B 3PW0A 4FE3A 4YMMA 2A3VA 3SAFA 1XS9D 3ISCA 4GXKA 4F5QA 1N56A 4CCHA 2BQ3A 3RJJA 5KT7A 2G06A 2OM6A 9ICSA
chains in the Genus database with same CATH topology
3RFAA 2LYAA 2GOLA 2N1RA 2WB1C 2G07A 1PVRA 4FZLA 3ALRA 2XIDA 3AQEA 3PZPA 2ZIVB 5KL1B 2H3IA 1PVPA 3SQIA 2E1FA 2D6FC 1URJA 2ZIVA 3F5AA 4ACOA 3KZXA 1ED1A 3HKZC 2RHFA 4QIWC 4BUGA 2W7OA 2HOFA 1P7DA 2OH2A 3OPXA 1T94A 3LVWA 4WJ3B 1Q3VA 4AYBF 2H3ZA 4NV0A 2E1EA 2VIXA 3AQFA 2K4HA 4OJLA 1OUQA 1MA7A 2DQNB 1Q3UA 2R18A 2LBOA 2LHTA 2DF4B 3M7DA 2HOQA 3MGVA 2CRXA 2CN1A 3C28A 4OJ5A 1A0PA 1ECWA 2XVTA 2YX8A 3ICXA 2Z7JA 3NUQA 2LKYA 3GZFA 2NV3A 4NLBA 2HOIA 4CRXA 3N7SC 2F8LA 1Z1BA 5KL8B 2MA1A 3D2QA 4O3MA 1IIPA 4ICAA 4JMUA 1ZQ1C 2PMZF 2LYBA 2CPRA 2ZIXB 3CYMA 3F53A 4BJQA 3IP4B 4OJPA 2KJ8A 1F44A 4FZMA 2KJ5A 2ZIXA 4KMOB 5HR7A 3RF9A 2H3FA 5A0LA 2W03A 3M6ZA 2KKPA 2KV2A 2YB1A 2VJ5A 3C29A 3KFUF 2XICA 3VC8A 5T14A 3CP8A 4A8EA 4AYBC 2RP5A 2KEYA 1SZHA 2ZIWB 4QJFB 2ZG6A 2KJ9A 2H3VA 1Z19A 2G0AA 1DRGA 4CGZA 2ZIWA 3F5EA 2G09A 2JMGA 2BDUA 2Y0SF 1L6NA 4PL1A 2WAQF 2F2AB 2XI9A 2YB4A 4C0ZA 3SAGA 1WUDA 3O0FA 3K1ZA 2KIWA 1HEKA 2W04A 3PSIA 2ZXHA 1CRXA 2PMZC 1GO3F 2H3QA 3PSPA 2HBKA 4NWIA 5CRXA 2F76X 2HBLA 1XNSA 4KX3A 3F2DA 4OJOA 4U6PA 3F2CA 2HBMA 4FZNA 2KVCA 2GH1A 4OJ6A 2OYYA 3AL0B 4OO1J 4P0QB 2RRDA 2E5SA 2K8CB 2G5HB 1PVQA 4P0QA 2G08A 2K8BB 2ZIUB 3PSTA 2K4EA 2KKVA 2OXOA 2M0NA 2ZIUA 3H0MB 1A6SA 3IN5A 4QNLA 2Y0SC 2KHVA 2KICA 3N7RC 3M6KA 2JGAA 2WB1F 2JH7A 2WAQC 2VJ4A 3ONNA 2JHDA 5HR6A 3PSFA 2K8AA 2VKQA 3N7PD 4KX5A 4P0PB 2W7PA 1YT3A 4PL2A 3F2BA 4P0PA 3HKZF 3T79A 4QIWF 2KOBA 3IG5A 2KHQA 3D2NA 2JH1A 3LYSA 1KBUA 1UPHA 4U7CA 3CRXA 4GFJA 4BX9C 5C0YA 4NLCA 2DGZA 2HBJA 3NRWA 2KNJA 2KD1A 3H0LB 3L3FX 1D8BA 3SMVA 3E0FA 2K4IA 4FE3A 3GU3A 2A3VA 3SAFA 4IC9A 3SAHA 1TAMA 2F77X 4CDGA 3H0RB 3DEEA 3D2SA 1XO0A 1NZBA 2G5IB 2Q4TA 3VCBA 2HMXA 2MRLA 2ZXIA 3IG8A 3LVVA 2G06A 2OM6A 2K89A 1HIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HKZ F;  4AYB F;  2PMZ F;  2Y0S F;  2WAQ F;  2WB1 F; 
#chains in the Genus database with same CATH topology
 3CNH A;  3QXG A;  1HUO A;  1RQL A;  4DF4 A;  1QH9 A;  3A0B U;  4QIW C;  2PI5 A;  4PHA A;  1IXR A;  4R65 A;  1PUZ A;  1SV0 C;  1JRO A;  5DGA A;  2H3Z A;  2K4H A;  2PXI A;  2R18 A;  2A1J A;  1PZN A;  3V72 A;  2BQU A;  2HHQ A;  4I29 A;  5AI0 A;  5KL8 B;  5J8Y C;  1S9F A;  4JMU A;  4DL7 A;  4IR1 A;  1L3T A;  3SYZ A;  4MFA A;  3QE9 Y;  2QB0 B;  5L1J A;  2VAN A;  4DS5 A;  3SV3 A;  4F4K A;  1NNL A;  3WU2 U;  7ICJ A;  4QWC A;  2JV3 A;  3RH5 A;  3MAB A;  3BQT A;  5KFD A;  4JB3 A;  4BDP A;  1MQ2 A;  3SD7 A;  2KZM A;  4MHV A;  1SL1 A;  4MEX A;  1TKD A;  2F76 X;  5F3X B;  4KX3 A;  4C8O A;  2IOF A;  4RU9 A;  3BQ7 A;  2FLP A;  4Q8E A;  1CUK A;  3WK7 A;  2BPC A;  4DSE A;  3ZDA A;  5EE9 A;  2IBK A;  3PW5 A;  3I28 A;  2CXY A;  3T79 A;  1MC8 A;  1D9D A;  5ALJ A;  3PO4 A;  4QZC A;  5C0Y A;  5KFN A;  4ECT A;  7ICT A;  3UMC A;  1KKX A;  2BCU A;  5CP2 A;  3SAH A;  4O5E A;  1BPB A;  4QW9 A;  1ZD5 A;  2MRL A;  5AKG A;  4F5O A;  4F92 B;  5AI9 A;  3VCB A;  2OEH A;  2MAX A;  2WF8 A;  5KL1 B;  4ECS A;  4DQS A;  2AH5 A;  2KFN A;  1WCN A;  4C7Y A;  2W7O A;  3QZ7 A;  2EZZ A;  1T94 A;  3JPQ A;  3AQF A;  3E58 A;  2CRX A;  5AKX A;  8ICX A;  5F9N A;  7ICU A;  3T3F A;  1RM6 C;  4US8 A;  9ICJ A;  1UA0 A;  1O03 A;  2AU0 A;  4UAW A;  2V9W A;  3L5K A;  4B6J A;  2W03 A;  4DFP A;  2KV2 A;  1N2X A;  1V85 A;  3BZK A;  4C7Z A;  1SV0 A;  1L8O A;  5JUM A;  1Z19 A;  3Q8S B;  3QUQ A;  2ZIW A;  3NVW A;  4P4M A;  2Y0S F;  1NK4 A;  4C80 A;  5AM5 A;  3JPN A;  2BR0 A;  2WFA A;  4HAI A;  3H4D A;  1V9P A;  4I2A A;  1B43 A;  5J8Y A;  3KHH A;  2HBK A;  5DGB A;  1L3V A;  1SXE A;  2NRT A;  4RQ0 A;  2C22 A;  1XO1 A;  4JV2 A;  3F2C A;  4JV0 A;  3PX6 A;  1U4B A;  4FZN A;  3ZI4 A;  3ISD A;  1BNO A;  1XC9 A;  3KZI U;  2ZUD A;  3GV8 B;  4F2S A;  2ZIU A;  4DQR A;  1BPZ A;  2KHV A;  3ZD8 A;  5KFQ A;  4YCX A;  2VKQ A;  4NLK A;  2W7P A;  3ZDE A;  2HSZ A;  5J0T A;  4X5V A;  2XGQ A;  8ICK A;  1NK0 A;  2PI4 A;  3MR6 A;  1ZD4 A;  1Z00 B;  5J0Y A;  4O3Q A;  2JR5 A;  4CDG A;  3H8W A;  3T5J A;  2ZXI A;  5JU5 A;  1T7P A;  3KOO A;  2C2D A;  2KN7 A;  4CF3 A;  7ICE A;  4DL3 A;  1B22 A;  1SXD A;  3AQE A;  2YTU A;  1WG8 A;  2DUY A;  2ZIV A;  2DFL A;  4O3N A;  2E8N A;  4B9S A;  1P7D A;  3OPX A;  1T4G A;  4KN4 A;  3UQ0 A;  4JWN A;  4YR3 A;  2F1I A;  3MFI A;  3GDX A;  3GZF A;  4PPX A;  1Z1B A;  1IIP A;  1RXW A;  4ECQ A;  4Y2T A;  2H3F A;  2NYV A;  2I5H A;  3SI8 A;  3C2K A;  7ICP A;  5T14 A;  3V6H A;  2C2E A;  4CGZ A;  1DRG A;  2K4P A;  1X9M A;  1KDH A;  1COK A;  2BCV A;  4DF8 A;  3PW4 A;  4C8M A;  3MBY A;  4ELU A;  1GO3 F;  5CRX A;  2W9A A;  2LM1 A;  2OHF A;  3M1Y A;  5DLF A;  4JK1 A;  5KG7 A;  4B9U A;  2K60 A;  2OYY A;  5KFF A;  1PK1 B;  3B0X A;  3K4G A;  1LV5 A;  2A19 A;  3UM9 A;  2NO4 A;  2W9C B;  1ZET A;  4EZ6 A;  3JPS A;  2LPE A;  4ED6 A;  7ICF A;  2YMM A;  2Y0S C;  3ZDC A;  2P66 A;  1SKR A;  4UAY A;  4DWI A;  2VJ4 A;  3MFH A;  4P0P B;  1L3U A;  3J81 j;  1BNP A;  4Y2R A;  3SEI A;  2XCP A;  9ICU A;  3WKD A;  4I2I A;  2KOB A;  2FMP A;  1S0V A;  4KLG A;  1JXL A;  5AK5 A;  3AEV A;  2RDJ A;  1T3Q A;  5ALY A;  4USA A;  4QZE A;  4RNM A;  4QZ8 A;  4DL4 A;  2EAO A;  4AP9 A;  4DSK A;  4JV1 A;  5DQI A;  1Q8K A;  1X42 A;  7ICL A;  2V4R A;  5AHX A;  2Q4T A;  4KLH A;  4FBU A;  5KFU A;  3KZX A;  1QTM A;  1PVR A;  3UMG A;  4Q45 A;  7ICI A;  3FC4 A;  2OH2 A;  4EX6 A;  3V7K A;  2WHE A;  2YML A;  3ZD9 A;  1ZYQ A;  1SGG A;  1UHU A;  1U49 A;  5KFV A;  1JRP A;  2EAM A;  2XVT A;  2HI0 A;  1V97 A;  2DWQ A;  5DDY A;  3OGU A;  1KTQ A;  2AXT U;  2R8H A;  4BJQ A;  1KRP A;  1ZOL A;  5J29 A;  3RJG A;  2WTF A;  4RQN A;  4UB3 A;  2VJ5 A;  5AIC A;  1ZQW A;  7ICH A;  4RNO A;  5DBC A;  3TQ1 A;  1NKB A;  1ZQM A;  4TUQ A;  4DCC A;  1S8O A;  1TK0 A;  2XI9 A;  2YB4 A;  4UB6 U;  4C0Z A;  3RH6 A;  5CJ7 A;  3T5K A;  1H38 A;  8ICV A;  1ZD3 A;  5K4L A;  1N60 A;  2BZF A;  3C1Z A;  2EQY A;  4KLE A;  2W9B A;  4XRH A;  4I2B A;  2ZJ8 A;  1F0M A;  4YD2 A;  2K4E A;  2ZUB A;  1AQ6 A;  3IN5 A;  1Z3E B;  3MDA A;  4C8L A;  3EZ5 A;  9ICO A;  2XCA A;  2R8K A;  3OHA A;  4KLU A;  2K8A A;  4UQG A;  3OTQ A;  3TAD C;  3D2N A;  1NOM A;  1KBU A;  7ICO A;  5KFH A;  2ZJA A;  4ECR A;  8ICI A;  3GU3 A;  3QYP A;  2XY5 A;  1XO0 A;  1NZB A;  4M9J A;  4R8U A;  3Q8Q B;  5AI4 A;  4O9M A;  3SQI A;  5KFE A;  4C8K A;  3RJK A;  4I27 A;  3NS1 A;  4F5P A;  4KLQ A;  2I9G A;  4AYB F;  2L5Y A;  9ICH A;  4I28 A;  1B0X A;  4IQV A;  2ATL A;  2DF4 B;  3TAQ A;  1S5L U;  1X9S A;  4NY8 A;  5KT4 A;  2W8K A;  2E8P A;  4EEY A;  5KFM A;  2C28 A;  1ZQE A;  2KJ8 A;  5AI8 A;  5AKI A;  2W8L A;  2KIV A;  1VJ5 A;  7ICV A;  2LYH A;  1O08 A;  1NJX A;  2B21 A;  3QEA Z;  1F5S A;  5AKJ A;  3IHQ B;  4UB5 A;  1ZQH A;  4I2C A;  1JI7 A;  4J9R A;  4GC7 A;  2G09 A;  4DQP A;  1ZRN A;  4NM1 A;  3SAG A;  1KL9 A;  2AGO A;  7ICM A;  1CRX A;  2B0C A;  4C4T A;  4RNN A;  2W43 A;  4R64 A;  3F2D A;  3QEB Z;  8ICL A;  1S0M A;  5G5H A;  1S0N A;  4Q43 A;  4BXO A;  2EZY A;  3LDA A;  2KG5 A;  4UAS A;  3C5G A;  2KZZ A;  3C2M A;  3WK8 A;  4PHD A;  4F4X A;  2HHT A;  5KTQ A;  7ICQ A;  3PSF A;  1S97 A;  2JEI A;  4QWB A;  4UAZ A;  3HKZ F;  1NJY A;  2KHQ A;  5ALG A;  1K1S A;  1UPH A;  3V6J A;  2LMR A;  2KNJ A;  2HHW A;  3SMV A;  3RJF A;  3RB6 A;  2F77 X;  3H0R B;  2VA3 A;  2YMP A;  2YMQ A;  3UXN A;  4M6W A;  5AIB A;  5HP4 A;  4ACO A;  4KMU A;  2HOF A;  4ZH4 A;  3TAD A;  4M47 A;  2MUT A;  4GC6 A;  4O0I A;  1K1Q A;  2A1J B;  5KFI A;  1NK8 A;  5IIK A;  4ED3 A;  3RTV A;  1D8Y A;  3H40 A;  4RQ5 A;  4J9M A;  4F4W A;  2Z7J A;  3PVX A;  2MA1 A;  4O3M A;  9ICB A;  3UXP A;  2LYB A;  2DKZ A;  3IP4 B;  4OJP A;  1UA1 A;  2KJ5 A;  5J2H A;  5DG8 A;  4TUP A;  2OWO A;  3RB3 A;  3C1Y A;  5KG5 A;  5DB9 A;  1X9W A;  1VDV A;  3C5F A;  2XIC A;  5AM0 A;  5ALO A;  4AYB C;  1LKY A;  5J2I A;  2YN4 A;  4Y2X A;  5TIS U;  2AJQ A;  5D49 A;  5KFS A;  4ED1 A;  4PL1 A;  2WF7 A;  1WUD A;  3JPR A;  5AKH A;  1T8E A;  5ALP A;  3LK9 A;  8ICE A;  1L7P A;  1N61 A;  1VLB A;  5KG4 A;  2ZUC A;  4YP3 A;  2XGP A;  4OJ6 A;  4Q44 A;  4FS1 A;  4OO1 J;  3QUB A;  4RUC A;  8ICW A;  4O3O A;  5KAF U;  8ICZ A;  3EUB 2;  3H0M B;  3RRH A;  4F93 B;  5L1K A;  3M6K A;  2XO7 A;  4YXM A;  5CWR A;  2JEJ A;  4JWM A;  5DG7 A;  4PL2 A;  5KFW A;  1JN3 A;  3LYS A;  5TZV A;  5DB6 A;  3ETL A;  5J2F A;  1NKE A;  1L7N A;  2GWS A;  5DG9 A;  3KTQ A;  3HW8 A;  4R66 A;  5J0W A;  4O3S A;  2HMX A;  4UBC A;  4F91 B;  4LZG A;  2KP7 A;  1OXJ A;  2N1R A;  3H8S A;  3MR3 A;  3EW9 A;  2M9N A;  4FO6 A;  2XID A;  3QU2 A;  3HKZ C;  4QZB A;  9ICN A;  4K4H A;  4Z6E A;  5ALM A;  1KLN A;  4WJ3 B;  1DXS A;  4DLE A;  5H2F U;  3BJY A;  3EPI A;  2MU2 A;  3M9M B;  3HJE A;  1ECW A;  3NRZ A;  2R8G A;  2HHX A;  2NV3 A;  3PV8 A;  4BGD A;  2PMZ F;  2BHN A;  1ZD2 P;  5ALE A;  5A0L A;  4LZD A;  1N48 A;  4DFJ A;  3EPG A;  4B9V A;  3OJU A;  2HW3 A;  2RP5 A;  2ZIW B;  2QLT A;  8ICU A;  5HNK A;  2HDO A;  2W54 A;  5EOZ A;  3PX4 A;  5F9L A;  3DV9 A;  2F2A B;  2KE7 A;  1ZQB A;  3BQ1 A;  3PSI A;  1ZQZ A;  1QSY A;  3TAP A;  3UMB A;  4BWJ A;  2BQR A;  4DL5 A;  3ED5 A;  3AN1 A;  2KVC A;  5J2B A;  2K8C B;  3QUT A;  2ZIU B;  1TK8 A;  3WK4 A;  2NRV A;  2JGA A;  2YQE A;  2A1A A;  3Q8P B;  1KSP A;  1KFD A;  3F2B A;  9ICC A;  8ICM A;  3BQ2 A;  3RBD A;  3DDH A;  5ALQ A;  8ICY A;  5J2D A;  2QB1 A;  4Y2Y A;  3D2S A;  5EWF A;  2JEG A;  2I1Q A;  4G9B A;  1HUZ A;  2LM4 A;  5J0X A;  4B9T A;  1QCK A;  5BOM A;  1K5O A;  3RAQ A;  2ESE A;  1D9F A;  2ZIV B;  4IRC A;  2Y1I A;  1X40 A;  3PML A;  4EYI B;  1X9X A;  4C8N A;  3IRU A;  5ALX A;  5D4B A;  2VA2 A;  4EX7 A;  4YD1 A;  1MA7 A;  3KKA C;  3M7D A;  2HOQ A;  2YY6 A;  2CN1 A;  4Y2V A;  1JX4 A;  4Y2J A;  2YX8 A;  4ECV A;  2HOI A;  4CRX A;  2F8L A;  2BKE A;  8ICJ A;  5J2C A;  4Y2U A;  2XY7 A;  4IR9 A;  8ICP A;  2KSO A;  1IV8 A;  4Y2Q A;  1ZQK A;  1ZRM A;  2KKP A;  4YFK A;  4TUR A;  4B9N A;  3U26 A;  1SZH A;  2NO5 A;  3HPO A;  3FDS A;  3SZ2 A;  1X66 A;  3GIM A;  3N97 B;  2KIW A;  2PMZ C;  2NRZ A;  2H3Q A;  1Z4N A;  2AQ4 A;  2W3S A;  3BQ0 A;  2DKX A;  2HBL A;  2ZTC A;  4B9M A;  1BVS A;  5EWE A;  4MFF A;  2FE9 A;  2E5S A;  5AK4 A;  1SL2 A;  3LWM A;  2K8B B;  4ZOH C;  2WF5 A;  5KG2 A;  3OJS A;  4NJ8 A;  1QQ6 A;  9ICT A;  4UBB A;  2ISO A;  2JH1 A;  1M6Y A;  3T5H A;  3AU2 A;  2NRX A;  4DOA A;  2DGZ A;  2HBJ A;  3NRW A;  2RDI A;  3V6K A;  2RLT A;  4XQ8 A;  3MR5 A;  4M9G A;  3RFA A;  2GOL A;  1X6J A;  4FZL A;  4KLT A;  1RDF A;  2PFQ A;  1URJ A;  2RQ5 A;  3F5A A;  3TAR A;  1ED1 A;  3QU5 A;  1SB3 C;  5ALH A;  4RUA A;  4DSL A;  3LVW A;  3K75 D;  4NLG A;  4NV0 A;  1Z1V A;  4JUZ A;  4RQ3 A;  3M8R A;  2AGQ A;  1NJW A;  4RPX A;  1ZQX A;  2IA6 A;  1ZQT A;  4XA5 A;  3RBE A;  2R8J A;  3N7S C;  7ICG A;  2FPL A;  2WF9 A;  1XU4 A;  1NK5 A;  1JIH A;  2ZIX A;  2ODG A;  3T5L A;  2W3R A;  5C5J A;  1FIQ A;  4F4Y A;  5EWG A;  2AGP A;  3KFU F;  2Y1J A;  4QZD A;  1Q46 A;  3CW2 C;  4F50 A;  3Q8L A;  5ALZ A;  3WKB A;  1SV4 A;  2PFN A;  3BDP A;  3S6J A;  3MGI A;  2DBY A;  3KKA A;  2F1J A;  2B6G A;  3TI0 A;  2KMD A;  3KHL A;  3O0F A;  1DOQ A;  5GTI U;  5J0O A;  4RPZ A;  3PSP A;  4YMO A;  4NWI A;  5KG0 A;  3TFR A;  2J6U A;  3PNC A;  1QQ7 A;  4OJO A;  1J2N A;  2JXJ A;  4U6P A;  2W9B B;  3K1R B;  1ZQO A;  4GXI A;  4DOC A;  1ZXI A;  4PJ0 U;  1RYR A;  5DQH A;  4LVS A;  2EDU A;  4EBD A;  2M0N A;  3G6Y A;  5HHH A;  4K4G A;  5D46 A;  9ICM A;  2JHD A;  4M0A A;  3HP6 A;  4UB8 U;  5JTI A;  1ZQD A;  9ICL A;  2AQ0 A;  4O5K A;  1MN8 A;  2ZJ5 A;  5AKY A;  3IG5 A;  5KFC A;  4BX9 C;  3ZDD A;  5KG1 A;  1ZQR A;  3HX0 A;  4KLF A;  5L1I A;  4EBC A;  4R8U B;  2JZB A;  3LVV A;  3MC1 A;  2K89 A;  4C4S A;  3GII A;  1PVP A;  1JAL A;  3EYZ A;  5ALU A;  3GIL A;  4OJL A;  1U47 A;  3RAX A;  4O3P A;  5HHI A;  4IRD A;  4KLD A;  3BS5 A;  1L3S A;  9ICI A;  3NTU A;  2HHV A;  5KFT A;  4NLB A;  1BGX T;  4KLI A;  3C21 A;  1N5W A;  8ICR A;  5EE1 A;  8ICC A;  2CPR A;  3AM9 A;  1ZQC A;  1FFU A;  1N63 A;  3M8S A;  5KFY A;  3C29 A;  4P4P A;  4IQT A;  2ZG6 A;  2KJ9 A;  2G0A A;  4J9P A;  5AK3 A;  1JUD A;  4ED8 A;  5KFR A;  2ZTE A;  4QWD A;  1XSL A;  4PZO A;  4YR2 A;  1QSL A;  3GIK A;  1XNS A;  7ICK A;  2DPI A;  4UAU A;  1KFT A;  1UT5 A;  1ZQY A;  4BXO B;  5AKK A;  1TFR A;  3SV4 A;  7ICS A;  5B66 U;  1S76 D;  2IHM A;  3KD3 A;  3PST A;  2FLL A;  2WF6 A;  2JH7 A;  3V7L A;  2JRZ A;  2OCE A;  4EEL A;  4KIT B;  4KX5 A;  4YG2 A;  4GXJ A;  2D8C A;  1YZ7 A;  5AM1 A;  3QUC A;  2EAN A;  3M9N B;  1J2M A;  4GIB A;  5CB1 A;  4YXJ A;  1TAM A;  3TAN A;  4QWA A;  3RR7 A;  1C20 A;  3TFS A;  5ALS A;  2LYA A;  4M6W B;  3ISB A;  5J2J A;  1N5X A;  2E1F A;  5IIL A;  2RHF A;  3B0Y A;  4KLL A;  2MUT B;  2E1E A;  2BCR A;  5KG6 A;  1Q3U A;  2MSN A;  1FO4 A;  3MGV A;  3H4B A;  2QAR A;  4RQ8 A;  1U48 A;  3IDW A;  4KTQ A;  3C23 A;  3RJH A;  3F53 A;  4QZF A;  4DFK A;  2GO7 A;  3RF9 A;  3PW2 A;  3RH4 A;  5KT3 A;  5ALT A;  1LKY B;  4RZR A;  3AU6 A;  1RYS A;  1L5U A;  3TKA A;  5IIN A;  5KFX A;  4IRK A;  4ECU A;  3K1Z A;  4QZH A;  1TAQ A;  4RT3 A;  4KN7 A;  5AK6 A;  1BPD A;  3UPQ A;  4I2G A;  4BWM A;  1KEJ A;  5ALF A;  4DFM A;  2H5X A;  2BCS A;  5AIA A;  3PMN A;  4F5R A;  4ECZ A;  5AM3 A;  4NL9 C;  8ICA A;  1ZQA A;  2RRD A;  4P0Q A;  5J2E A;  3QU7 A;  9ICA A;  2LI6 A;  2KKV A;  2DL0 A;  2J6T A;  4F8R A;  3KHG A;  2ALZ A;  1LVH A;  5DBA A;  5ALI A;  3R9K A;  4I2H A;  8ICS A;  3V7J A;  1Y88 A;  5KFL A;  3CRX A;  5J2K A;  1ZQJ A;  5BOL A;  4R63 A;  1FFV A;  3MGH A;  4EBE A;  1DK2 A;  5ALK A;  1UT8 A;  4J9L A;  3AMZ A;  3RJE A;  5KFB A;  2IMW P;  3MDC A;  5ALR A;  4IQU A;  3IG8 A;  1NK9 A;  2F3N A;  1BPE A;  1WYG A;  2Q0Z X;  9ICQ A;  9ICF A;  4P2H A;  2BPF A;  3WKC A;  2JEF A;  3RB0 A;  3RB4 A;  4US9 A;  2VIX A;  2DQN B;  2LBO A;  2HVH A;  4OJ5 A;  3Q8K A;  5KT2 A;  1BPY A;  1OW5 A;  3ICX A;  1ARO P;  4ED2 A;  1S0O A;  4M04 A;  4CF4 A;  3D2Q A;  5AKL A;  4ICA A;  1NK7 A;  3PX0 A;  4YMN A;  1UCV A;  2BCQ A;  3UQ2 A;  1ZQS A;  2QB0 A;  4UB1 A;  2E3T A;  5J0S A;  4UB4 A;  3QU9 A;  5IIO A;  1TVA A;  9ICP A;  1SKW A;  3RRG A;  3GFK B;  4RT2 A;  8ICG A;  4Y2S A;  4OD0 A;  2JMG A;  5BPC A;  2BDU A;  3RJI A;  1L6N A;  1FEZ A;  1ZQU A;  4NM2 A;  2W04 A;  4B9L A;  5JRT A;  4PHP A;  1IM4 A;  5J0U A;  1A76 A;  4Z6D A;  2G5H B;  2KFZ A;  4YQW A;  1S77 D;  2OXO A;  4PGY A;  1ZJN A;  3HT3 A;  1TE2 A;  1WWU A;  2KIC A;  5DB7 A;  3JPP A;  2WB1 F;  3ONN A;  1X6I A;  3H7I A;  3G6V A;  1RQN A;  3H8J A;  4YN4 A;  4GFJ A;  4PGX A;  3I76 A;  4NLC A;  4RQ4 A;  3AUO A;  3H0L B;  2KK0 A;  5J2G A;  3ZDB A;  4NL9 A;  3DEE A;  4DEZ A;  4QZ9 A;  2G5I B;  4LJX A;  3ORY A;  1U9L A;  5KNI A;  4GLX A;  4DO9 A;  5CA7 A;  2G07 A;  2W11 A;  4PHE A;  2PFO A;  3Q8R B;  2KZ3 A;  5IIM A;  1HJP A;  1MSW D;  4MEY A;  1RYU A;  3PO5 A;  1TK5 A;  2BDP A;  2GLE A;  3L4P A;  4F72 A;  8ICB A;  1NKC A;  4F3O A;  4PGQ A;  2V4Q A;  1OUQ A;  4MF2 A;  2LHT A;  2HHU A;  4F2R A;  2IHN A;  5J0R A;  1ZQF A;  4QZG A;  4YR0 A;  3HWT A;  4QWE A;  2O6K A;  5DQG A;  4UAR A;  4EYH B;  1YZ6 A;  2KSO B;  2KVS A;  5CHG A;  4KMO B;  4NLZ A;  5HR7 A;  4I2F A;  5KFJ A;  5G5G A;  3PR5 B;  4DFD A;  3A0H U;  5AM4 A;  4EEK A;  5AKZ A;  4A8E A;  2HVI A;  1TV9 A;  4QJF B;  4UAT A;  4OCZ A;  2W9M A;  2W55 A;  4TQS A;  3IV6 A;  5DKW A;  3I1Y A;  2ASL A;  3QNM A;  5IIJ A;  1KQQ A;  3QU4 A;  5AI6 A;  2Y9T A;  4CE6 A;  1L7O A;  1T3N A;  3AL0 B;  5KFG A;  9ICW A;  9ICX A;  1SZP A;  1PVQ A;  1NJZ A;  2IOF K;  1A6S A;  8ICH A;  1QLN A;  4QZI A;  4M2Y A;  2FMQ A;  5HR6 A;  3N7P D;  4KLS A;  5DBB A;  1RPL A;  3N28 A;  1ZJM A;  1KW4 A;  2FI1 A;  4E0D A;  4J9Q A;  2D3D A;  4ECW A;  3L3F X;  4ELT A;  3E0F A;  2K4I A;  2PFP A;  2ASD A;  3PY8 A;  1Z00 A;  2P35 A;  3D6J A;  8ICF A;  3RR8 A;  4KLO A;  1DGS A;  5ALN A;  1IG6 A;  3NAS A;  3QX7 A;  4I2D A;  2XY6 A;  2WB1 C;  4UW9 A;  3ALR A;  4MF8 A;  5L1L A;  5KFK A;  3KHR A;  2FLN A;  1EXN A;  1SWW A;  4J9K A;  3G6X A;  1Q3V A;  3B9J A;  5ALV A;  3WKE A;  4RQ7 A;  4I2E A;  3C28 A;  1ZQP A;  3NUQ A;  5CR0 A;  2LKY A;  3Q8M A;  4DSJ A;  4NLN A;  2HHS A;  4RPY A;  3CYM A;  2ZIX B;  1F44 A;  4DQI A;  4XUS A;  1DK3 A;  2EH9 A;  1PK3 A;  4J9O A;  4KLM A;  2H3V A;  5KFA A;  3NGD A;  3F5E A;  5KFO A;  3C2L A;  2EAP A;  5III A;  5ALL A;  4F71 A;  2BPG A;  3KBB A;  1ZQI A;  2ISP A;  2WAQ F;  2ZXH A;  5AKE A;  3PR4 A;  2C2R A;  4J9N A;  5E79 U;  5ALD A;  9ICG A;  3HRD D;  3NVY A;  1J97 A;  4DL2 A;  1JXE A;  5KFP A;  3GV5 B;  3OSP A;  2GH1 A;  3N4M B;  1RXV A;  4DSI A;  2Y9U A;  1V38 A;  3THV A;  1PK1 A;  2UVR A;  1B4F A;  4ECX A;  5AI5 A;  4DL6 A;  2W9C A;  1WWV A;  4FFD A;  8ICO A;  3EWA A;  3N7R C;  1XWL A;  4Y2P A;  4UB2 A;  2XC9 A;  1YT3 A;  4P0P A;  3JPT A;  2HCF A;  3OSN A;  5L1M A;  1JMS A;  4U7C A;  2FMS A;  5KG3 A;  5J0P A;  3E2E A;  4Z6C A;  9ICK A;  2AHO B;  2JZB B;  4J03 A;  4TUS A;  4EZ9 A;  4G3I A;  4F5N A;  2FJ6 A;  2PKE A;  5J2A A;  1HIW A;  3MR2 A;  1SKS A;  3PZP A;  1ZQL A;  3WK6 A;  1WCL A;  2F1H A;  3WKA A;  3BS7 A;  4M9H A;  5B5E U;  3NVZ A;  4FBT A;  5DDM A;  3BS5 B;  1SL0 A;  5EE3 A;  1A0P A;  4IL6 U;  5L9X A;  2I6X A;  4DOB A;  2R8I A;  4O3R A;  3WK9 A;  2ASJ A;  2UVV A;  1ZQ1 C;  3HIL A;  4FZM A;  1COO A;  7ICR A;  5J0Q A;  2P6R A;  4RQ1 A;  1U45 A;  1SIJ A;  1XSP A;  2YB1 A;  3WK5 A;  9ICV A;  3CP8 A;  5KFZ A;  7ICN A;  5EE0 A;  5FP0 A;  3GQC A;  3FAH A;  4DLG A;  1N62 A;  4DS4 A;  4CNQ A;  4TQR A;  4ED7 A;  1HEK A;  3GIJ A;  4EEN A;  3NVV A;  1UQV A;  4FS2 A;  3TAC B;  1QQ5 A;  2FDR A;  1MQ3 A;  1BPX A;  1L7M A;  4RQM A;  4M9N A;  4YVZ A;  4I2J A;  2ZTD A;  2NRW A;  1L8L A;  8ICT A;  9ICR A;  2G08 A;  2ES6 A;  5ALW A;  2BGW A;  2KTQ A;  2WAQ C;  2IOH A;  4HYK A;  1SWV A;  2F44 A;  2P6U A;  4PH5 A;  4QIW F;  2DPJ A;  1A77 A;  3IM1 A;  1KFS A;  1D8L A;  2F8K A;  2EZX A;  2KD1 A;  1D8B A;  4DSF A;  4IC9 A;  1XSN A;  5KT5 A;  4MFC A;  3M9O B;  9ICE A;  1NZP A;  5KAI U;  4RQ2 A;  1KN5 A;  4NXZ A;  1NI3 A;  2H3I A;  5DLG A;  2D6F C;  4IQW A;  1CEZ A;  2E8O A;  1LB2 B;  3UXO A;  4BUG A;  1ZQQ A;  3LWL A;  1DGJ A;  5DB8 A;  1S10 A;  8ICQ A;  2J6S A;  5GTH U;  1TAU A;  2UVU A;  2QAR B;  5HMM A;  4IS7 A;  1RG6 A;  2E8M A;  3FM9 A;  3BZC A;  2QKQ A;  4ECY A;  4F4Z A;  1QSS A;  4DQQ A;  3FYH A;  4UAV A;  4C4R A;  5CEH A;  1ZQG A;  3SR6 A;  3ETR A;  2VA8 A;  3M6Z A;  4ELV A;  3VC8 A;  4KLJ A;  3SEN A;  1ZQN A;  2FPM A;  2KEY A;  3H8M A;  3QZ8 A;  4Z6F A;  5KT6 A;  5HML A;  4QZA A;  1RZT A;  2UVW A;  4ED0 A;  3OHB A;  4J9S A;  2HBM A;  2FPK A;  1ZQV A;  4M9L A;  4P0Q B;  4CF5 A;  4QW8 A;  4P4O A;  1NK6 A;  4Q8F A;  4PZN A;  4QNL A;  1Z4O A;  3JPO A;  4RQ6 A;  5AM2 A;  1X2I A;  4K4I A;  3PW7 A;  1CI4 A;  4O5C A;  8ICN A;  1C7Y A;  3GV7 B;  3PW0 A;  4FE3 A;  4YMM A;  2A3V A;  3SAF A;  1XS9 D;  3ISC A;  4GXK A;  4F5Q A;  1N56 A;  4CCH A;  2BQ3 A;  3RJJ A;  5KT7 A;  2G06 A;  2OM6 A;  9ICS A; 
#chains in the Genus database with same CATH homology
 3RFA A;  2LYA A;  2GOL A;  2N1R A;  2WB1 C;  2G07 A;  1PVR A;  4FZL A;  3ALR A;  2XID A;  3AQE A;  3PZP A;  2ZIV B;  5KL1 B;  2H3I A;  1PVP A;  3SQI A;  2E1F A;  2D6F C;  1URJ A;  2ZIV A;  3F5A A;  4ACO A;  3KZX A;  1ED1 A;  3HKZ C;  2RHF A;  4QIW C;  4BUG A;  2W7O A;  2HOF A;  1P7D A;  2OH2 A;  3OPX A;  1T94 A;  3LVW A;  4WJ3 B;  1Q3V A;  4AYB F;  2H3Z A;  4NV0 A;  2E1E A;  2VIX A;  3AQF A;  2K4H A;  4OJL A;  1OUQ A;  1MA7 A;  2DQN B;  1Q3U A;  2R18 A;  2LBO A;  2LHT A;  2DF4 B;  3M7D A;  2HOQ A;  3MGV A;  2CRX A;  2CN1 A;  3C28 A;  4OJ5 A;  1A0P A;  1ECW A;  2XVT A;  2YX8 A;  3ICX A;  2Z7J A;  3NUQ A;  2LKY A;  3GZF A;  2NV3 A;  4NLB A;  2HOI A;  4CRX A;  3N7S C;  2F8L A;  1Z1B A;  5KL8 B;  2MA1 A;  3D2Q A;  4O3M A;  1IIP A;  4ICA A;  4JMU A;  1ZQ1 C;  2PMZ F;  2LYB A;  2CPR A;  2ZIX B;  3CYM A;  3F53 A;  4BJQ A;  3IP4 B;  4OJP A;  2KJ8 A;  1F44 A;  4FZM A;  2KJ5 A;  2ZIX A;  4KMO B;  5HR7 A;  3RF9 A;  2H3F A;  5A0L A;  2W03 A;  3M6Z A;  2KKP A;  2KV2 A;  2YB1 A;  2VJ5 A;  3C29 A;  3KFU F;  2XIC A;  3VC8 A;  5T14 A;  3CP8 A;  4A8E A;  4AYB C;  2RP5 A;  2KEY A;  1SZH A;  2ZIW B;  4QJF B;  2ZG6 A;  2KJ9 A;  2H3V A;  1Z19 A;  2G0A A;  1DRG A;  4CGZ A;  2ZIW A;  3F5E A;  2G09 A;  2JMG A;  2BDU A;  2Y0S F;  1L6N A;  4PL1 A;  2WAQ F;  2F2A B;  2XI9 A;  2YB4 A;  4C0Z A;  3SAG A;  1WUD A;  3O0F A;  3K1Z A;  2KIW A;  1HEK A;  2W04 A;  3PSI A;  2ZXH A;  1CRX A;  2PMZ C;  1GO3 F;  2H3Q A;  3PSP A;  2HBK A;  4NWI A;  5CRX A;  2F76 X;  2HBL A;  1XNS A;  4KX3 A;  3F2D A;  4OJO A;  4U6P A;  3F2C A;  2HBM A;  4FZN A;  2KVC A;  2GH1 A;  4OJ6 A;  2OYY A;  3AL0 B;  4OO1 J;  4P0Q B;  2RRD A;  2E5S A;  2K8C B;  2G5H B;  1PVQ A;  4P0Q A;  2G08 A;  2K8B B;  2ZIU B;  3PST A;  2K4E A;  2KKV A;  2OXO A;  2M0N A;  2ZIU A;  3H0M B;  1A6S A;  3IN5 A;  4QNL A;  2Y0S C;  2KHV A;  2KIC A;  3N7R C;  3M6K A;  2JGA A;  2WB1 F;  2JH7 A;  2WAQ C;  2VJ4 A;  3ONN A;  2JHD A;  5HR6 A;  3PSF A;  2K8A A;  2VKQ A;  3N7P D;  4KX5 A;  4P0P B;  2W7P A;  1YT3 A;  4PL2 A;  3F2B A;  4P0P A;  3HKZ F;  3T79 A;  4QIW F;  2KOB A;  3IG5 A;  2KHQ A;  3D2N A;  2JH1 A;  3LYS A;  1KBU A;  1UPH A;  4U7C A;  3CRX A;  4GFJ A;  4BX9 C;  5C0Y A;  4NLC A;  2DGZ A;  2HBJ A;  3NRW A;  2KNJ A;  2KD1 A;  3H0L B;  3L3F X;  1D8B A;  3SMV A;  3E0F A;  2K4I A;  4FE3 A;  3GU3 A;  2A3V A;  3SAF A;  4IC9 A;  3SAH A;  1TAM A;  2F77 X;  4CDG A;  3H0R B;  3DEE A;  3D2S A;  1XO0 A;  1NZB A;  2G5I B;  2Q4T A;  3VCB A;  2HMX A;  2MRL A;  2ZXI A;  3IG8 A;  3LVV A;  2G06 A;  2OM6 A;  2K89 A;  1HIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...