2PMZF

Archaeal rna polymerase from sulfolobus solfataricus
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
89
structure length
89
Chain Sequence
MSSVYIVEEHYIPYSVAKKLLTDVIRSGGSSNLLQRTYDYLNSVEKCDAESAQKVIEELSNIVSREDVRAILASICPTTSDEVRSILVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-ray crystal structure of RNA polymerase from Archaea
pubmed doi rcsb
molecule tags Translation, transferase
molecule keywords DNA-directed RNA polymerase subunit A
total genus 16
structure length 89
sequence length 89
chains with identical sequence U
ec nomenclature
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF03874 RNA_pol_Rpb4 RNA polymerase Rpb4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.820 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2pmzF02
4AYBF 2WB1F 2WAQF 3HKZF 2PMZF 2Y0SF
chains in the Genus database with same CATH superfamily
2PKEA 1SV4A 2NRWA 4GFJA 3F2DA 1L7MA 5KL8B 8ICIA 3WK8A 5IIOA 4KLQA 1JX4A 1ZQWA 4ECZA 2OEHA 2ZTCA 2XO7A 4J9MA 2QLTA 2KTQA 3V7KA 2HHTA 4TUPA 1X6JA 2ASJA 1JALA 1LVHA 2Z7JA 3C1ZA 2F2AB 3KHHA 3V6JA 2XY5A 2KHQA 5B66U 4NL9A 2ZUBA 3QXGA 5J2EA 5AKEA 4E0DA 2AGQA 2E8NA 3OJSA 3BQTA 2O6KA 3HJEA 3MFHA 4EBEA 2Y1JA 4KLJA 2XY6A 3ALRA 2YY6A 4GXKA 4PHPA 2BR0A 1NKCA 5C5JA 5HR6A 2EAMA 1Z00B 1V97A 4NLBA 5KFEA 2ISPA 1TVAA 2R8GA 4DQIA 7ICPA 1V9PA 3TANA 4ED2A 4CCHA 2N1RA 1FEZA 4C7ZA 1ZQOA 4NV0A 9ICGA 2IOFK 2JH7A 1IIPA 5ALMA 4PGYA 9ICAA 5JRTA 4TURA 5IILA 3EYZA 2BCRA 3MABA 5AIAA 1KKXA 2JEIA 1ZJMA 4K4HA 1S0VA 7ICGA 3SV4A 4QIWC 4DQRA 4I29A 8ICKA 2HDOA 4R8UA 1JXLA 3QU2A 2NYVA 3RJKA 4GXIA 4QNLA 1J2MA 2P6UA 1BPEA 9ICKA 2K89A 5J2IA 3BJYA 5KFGA 2A1JA 4DF4A 4FZMA 5ALLA 5ALUA 2HHWA 5KTQA 4DLGA 1ZQNA 4RQ4A 1X9WA 2H3QA 3RJFA 3KOOA 1ZQGA 3F53A 2V4QA 2Y0SC 5IIKA 5J2HA 2ZXIA 2F3NA 4DL3A 3H8WA 5L1MA 3PNCA 1X9MA 4R66A 2KEYA 5F9NA 1ZQIA 2Y9TA 3GILA 5D4BA 2KIWA 3MC1A 2WF8A 3SV3A 2KZZA 2DKZA 3IDWA 2UVVA 2V4RA 4FO6A 3MR3A 4J9QA 5C0YA 4XUSA 1T4GA 2G5IB 3C21A 3SMVA 1NJWA 4EZ9A 1T94A 1WWUA 1O08A 3IRUA 5HR7A 5AKZA 4EX7A 7ICQA 3QZ8A 3N28A 2DUYA 2UVWA 1WYGA 3SAFA 3WK4A 5KFAA 4CE6A 3OHAA 2VA8A 4Q43A 2HHVA 4YD2A 3U26A 1ZQCA 3A0HU 4UB2A 1JROA 1ZQHA 3J81j 2XIDA 5KFSA 5TZVA 4J03A 1N61A 1KW4A 4RU9A 1TAUA 4UB4A 1S8OA 2IBKA 3SEIA 3E0FA 4M04A 2GLEA 4BXOA 2MUTB 1CUKA 2LI6A 5HHHA 5ALTA 2R8JA 4TQRA 4DF8A 4ECQA 1U47A 5DKWA 4OJOA 1L5UA 4TUSA 3TAPA 1SKRA 2XCPA 3DDHA 3CNHA 3HP6A 2PXIA 1BPZA 4Q8EA 8ICOA 1SIJA 4EX6A 3RJIA 3Q8PB 4F4ZA 5K4LA 5KT6A 4I2CA 1QLNA 1ZQMA 5ALJA 1XWLA 1O03A 2E8MA 5D49A 3PSIA 2OXOA 4C8MA 2FLNA 2ZJAA 3BDPA 1Z19A 4DS5A 7ICOA 3PSFA 2WF5A 2BPGA 1S97A 1QCKA 2UVUA 1JXEA 3Q8RB 4KLEA 4XQ8A 3TACB 4ECTA 2F1HA 2OHFA 4QWEA 4ELTA 1Z4OA 4I27A 8ICZA 4IR1A 1NJZA 5BOMA 4B9UA 5HHIA 3G6VA 1ECWA 4IQUA 1X40A 4US9A 1XO1A 4C8NA 4EELA 4OJPA 5AM3A 1SL2A 2KZ3A 1QTMA 1RXVA 5AK4A 5J2BA 1ZQ1C 5J2DA 4QZGA 3EPIA 3T5HA 3QZ7A 2F1IA 5KFMA 1K1SA 3GIMA 3O0FA 2E8OA 2A3VA 3PVXA 1LB2B 2F8KA 1D8YA 5J8YC 1NI3A 3LYSA 1EXNA 3M7DA 4F2RA 5EE9A 4Y2TA 2RDIA 3NVZA 4DS4A 2M9NA 3SZ2A 4IQVA 2KMDA 5AK5A 1NZPA 1DRGA 1TE2A 2WB1C 4ECXA 4F4KA 5KG4A 3QEBZ 3PW2A 2NRZA 1PVPA 3RJGA 2JEJA 2ZTEA 1PUZA 2MA1A 3HILA 2OCEA 1DOQA 3NTUA 1D9FA 1TFRA 1TK8A 5ALIA 5AHXA 3WU2U 5KFWA 3UXPA 2KFZA 2HHQA 3GDXA 3I1YA 2RQ5A 3Q8LA 2C22A 5KFXA 5AM5A 4UB1A 1CEZA 5KFQA 5AKLA 1ZQUA 4MFCA 1RYRA 3BQ0A 3NASA 1TAMA 4ECYA 4RZRA 3ZDCA 5ALRA 5J2GA 3I76A 2PI4A 1S5LU 5KFNA 4XA5A 3NVWA 2I5HA 3BQ7A 1NJYA 4AYBC 8ICXA 3TADA 2BQRA 1SB3C 4JV2A 4QZHA 4RNOA 1KRPA 1PK1A 4IC9A 1L8LA 4PHAA 5AM2A 3GIJA 3V72A 4YR2A 3AEVA 3K1RB 2KVSA 4DOCA 1WCNA 4J9KA 2IA6A 1NNLA 4K4GA 5AKHA 1JMSA 2F76X 3MDCA 3Q8KA 2BCQA 4FS1A 4P4OA 4C4SA 5KFZA 5KT2A 3B0XA 2HOFA 3MGHA 5AKKA 5L1LA 2KVCA 3BZKA 4RT3A 4M9NA 3ED5A 3SYZA 4IRKA 2EAOA 4Y2XA 2DL0A 3WK7A 3UMGA 3BQ1A 2W9CB 2VANA 3MR2A 2CRXA 8ICFA 3H40A 2E5SA 3WKBA 4QWCA 1C20A 1QSSA 5KG2A 4UASA 3FAHA 4C8KA 1ZOLA 4QZIA 4NXZA 1S76D 4G9BA 4X5VA 3QX7A 5ALPA 5DGAA 4DQSA 4YCXA 3LK9A 2BDPA 4I2DA 4YMOA 1A6SA 5G5GA 1ZXIA 1LV5A 3C2LA 4UW9A 4G3IA 4DL6A 2KK0A 3KBBA 4JB3A 2W9BB 5KFLA 5BOLA 5J0UA 4QZ9A 2RRDA 3B9JA 3EUB2 5ALNA 1QQ6A 5DBCA 3JPPA 5EE3A 3UXOA 3M9NB 3HKZC 1WWVA 4F71A 4CNQA 8ICBA 5A0LA 3PY8A 5AM1A 4M9GA 3H7IA 2AXTU 4Y2RA 1XSLA 5CHGA 3KKAC 5DQIA 4M9LA 1S0OA 1C7YA 2W7OA 1ZQSA 1S0MA 8ICSA 3MGVA 2JEFA 1MQ2A 4KLFA 2KIVA 2C2RA 2EDUA 1L6NA 2DF4B 4DL5A 4RNNA 1ZQAA 4Z6CA 1BNOA 2LM4A 4PGXA 5ALGA 3H0MB 5J0OA 3WKDA 3D6JA 7ICSA 2R8HA 3C5GA 3GV7B 2ZTDA 2HW3A 3QE9Y 2W54A 3OPXA 2PFOA 5HNKA 3IG8A 2RLTA 3ZI4A 5AKIA 3RAXA 5KNIA 5KT5A 3FM9A 4IRCA 4I2HA 1DGSA 3PV8A 1HUZA 4CRXA 5EE1A 9ICLA 1ZQKA 4UAUA 1D9DA 2KD1A 9ICCA 4UB8U 3RF9A 1RYSA 1FFUA 4KITB 4Y2PA 5BPCA 3TI0A 4OCZA 3VCBA 1RXWA 1ZQRA 4OJ5A 1WG8A 3GU3A 3H8MA 3TADC 8ICUA 5DLFA 1UHUA 1U4BA 2YN4A 3BZCA 3E58A 3EWAA 1T7PA 4UARA 5J0PA 2CPRA 1L7NA 2FI1A 7ICLA 1PK3A 8ICMA 1Q8KA 2AH5A 1COOA 3IN5A 1ZQZA 1WCLA 4GLXA 1KTQA 1H38A 9ICMA 4AYBF 2WB1F 2H3FA 2ATLA 4DOAA 5HP4A 5ALHA 2G5HB 2LPEA 3NS1A 4K4IA 2D6FC 2MUTA 1B4FA 1A77A 1VJ5A 2G07A 4Z6FA 1ZQVA 1XSNA 4O3PA 1QSLA 1L3SA 5J2AA 1FO4A 4F91B 4DEZA 4ZH4A 3RRGA 3H0RB 2XGPA 2JR5A 4Y2UA 1K5OA 3QEAZ 5CA7A 3S6JA 1KDHA 4MEXA 5KFJA 5CRXA 3NUQA 1DGJA 1BPYA 3RRHA 3F2CA 2YTUA 4UB6U 1JRPA 3AL0B 1ZRMA 2BCUA 7ICNA 5KFHA 1KQQA 1QQ7A 3K1ZA 4YR0A 4UAVA 1RDFA 3BS5A 4KLTA 7ICRA 3BS7A 4YMMA 2EZYA 2UVRA 3TFRA 3V7LA 3B0YA 3GV5B 4PL2A 2K4HA 2D8CA 4I2FA 9ICTA 3NRZA 4FBTA 3D2NA 3QUCA 4KMOB 1KFDA 4CF5A 1Q3UA 5KT3A 3WKAA 2MAXA 5IIIA 1U9LA 7ICHA 1MSWD 4KN7A 4JWMA 7ICIA 3K4GA 4O3RA 4U6PA 1DK2A 4OJLA 3SAGA 3HKZF 1RPLA 1KBUA 4RQNA 3QU7A 9ICPA 4QZDA 4MF8A 3H4DA 7ICMA 1XC9A 3AU2A 5CP2A 4TUQA 2YQEA 9ICIA 2HSZA 4DFKA 3OHBA 4GXJA 1U49A 2FMQA 4MF2A 5KFPA 5L1JA 1ZD3A 1ZQQA 3RB0A 1IM4A 1N56A 1RM6C 4YVZA 1YZ7A 1SV0A 3C28A 3RB4A 5KFRA 4OO1J 2JMGA 5IIJA 2ASLA 4F4YA 1S10A 1OUQA 3MGIA 1BNPA 1HEKA 2H3VA 4OJ6A 1MQ3A 4P0PB 2GH1A 3ZDDA 8ICCA 4DFMA 4NLZA 2VKQA 4KLHA 5KAFU 2YX8A 1NJXA 2FMSA 4KLMA 2L5YA 4DO9A 4NLNA 4R64A 1NK0A 1QQ5A 2W11A 1SWWA 2KNJA 2DWQA 4GC6A 1Z4NA 1U45A 2FLPA 3PSPA 5KG1A 3PW4A 2VA2A 2JV3A 4BUGA 4ED6A 2E3TA 4NY8A 4RQ1A 3HPOA 2ASDA 9ICEA 2EQYA 5CWRA 3ZDEA 4M9JA 2K60A 2KHVA 3GFKB 2YMLA 3ISBA 5DBAA 4DCCA 1P7DA 4Z6DA 2LYAA 1KLNA 4Y2YA 2K8CB 2HHXA 4KLIA 1RZTA 2ZIUA 9ICHA 3NVYA 2ES6A 4ZOHC 2YB1A 3D2QA 5AM0A 3ZDAA 1B0XA 4RQ3A 3CW2C 4C0ZA 3KD3A 1TKDA 2BKEA 4EYIB 4ED1A 8ICEA 2ZUDA 4RQMA 5KFOA 3OGUA 4F72A 3I28A 3G6XA 4P2HA 7ICJA 1L7OA 3RBEA 1IXRA 3ZD8A 4RNMA 3C2MA 2CN1A 2JEGA 2KSOB 3SQIA 3GV8B 2HBKA 3C5FA 9ICUA 4NM2A 3MBYA 3RH4A 3OSNA 5KG0A 3N97B 5F3XB 5JU5A 1T8EA 4NLKA 4RPXA 5J2FA 2W8KA 4EBCA 1MN8A 3LWLA 5J2JA 5E79U 2XVTA 1X42A 1SKSA 1NOMA 5FP0A 3UMBA 1NK7A 5HMMA 4B9VA 1SZHA 4RQ5A 1KEJA 8ICGA 2AQ0A 3EZ5A 4J9PA 4UAZA 2WF6A 1ZQFA 4DQPA 3PR4A 2W43A 1KN5A 4QIWF 5CB1A 1Z3EB 3JPRA 1N62A 3FDSA 1ZD4A 2D3DA 3RTVA 8ICQA 1AQ6A 4C7YA 4M47A 4O0IA 1SKWA 1YT3A 3NRWA 4USAA 4PH5A 4O5EA 2Y9UA 3C1YA 4YFKA 2H3ZA 1NK9A 4DSIA 4FS2A 3H0LB 4XRHA 9ICJA 4DOBA 4EZ6A 2PMZF 1SL1A 2W8LA 5KFYA 2VA3A 2P66A 2B0CA 4BDPA 5KFBA 3JPQA 2MU2A 1BPDA 1B43A 2WHEA 2FLLA 2ZJ5A 4I2EA 5J29A 1S9FA 1HJPA 5J0WA 5G5HA 1Z1BA 3ISCA 2ODGA 4RQ0A 3PW0A 3ICXA 2ZIVA 3DV9A 4NM1A 2HBMA 1NKBA 2KOBA 3M6ZA 1ZJNA 2F1JA 4U7CA 1TK5A 4F5OA 4BGDA 2KG5A 1NKEA 5DG9A 3GQCA 1COKA 3SAHA 2W9AA 2IOFA 5DQGA 2F77X 2BPFA 3L3FX 4FZLA 4I2JA 1SXEA 3QU9A 3T5LA 2DGZA 2ZIUB 2XY7A 5J2CA 3KKAA 5J2KA 4PHDA 2DQNB 4YMNA 2FPMA 3ONNA 2XCAA 2EZZA 2QB1A 1N63A 3PR5B 3WKCA 2JHDA 2NO4A 4RQ2A 5ALOA 4AP9A 4DSKA 2WFAA 9ICRA 5AKGA 3AMZA 5KG7A 4WJ3B 4I2GA 5IIMA 5ALYA 4DL2A 1L3UA 3HT3A 2A1JB 1XO0A 3KZIU 1QSYA 5J8YA 4C8LA 4FZNA 2R18A 3HWTA 5KFUA 5KT7A 4JUZA 4B9LA 5GTIU 4NL9C 2CXYA 3UM9A 3ETLA 3N7RC 4KLLA 1SGGA 5D46A 3M1YA 7ICVA 4B9NA 4UAYA 1ZQJA 3R9KA 3QYPA 2F44A 4DSEA 5KL1B 2HVIA 4YD1A 3AM9A 1RG6A 4FE3A 1ZETA 2EZXA 1T3NA 4YG2A 3UQ2A 2RP5A 3JPOA 3BQ2A 1XSPA 4IQTA 5J0SA 9ICNA 5AI8A 1XNSA 5KFIA 5AKYA 4Q44A 3PO4A 1NK4A 1L7PA 3KHLA 4Y2QA 1AROP 1IV8A 1RQLA 4F5PA 3AN1A 4J9NA 4UQGA 1M6YA 1K1QA 5ALSA 5DB7A 4YXMA 5CEHA 4KLUA 3AQEA 9ICWA 4EEKA 2Y0SF 1RQNA 3C23A 5AK3A 2JH1A 3PMNA 3OJUA 3JPTA 4NJ8A 2BGWA 3HRDD 3N7PD 2JZBB 2ZIWA 4F93B 2FPKA 1N60A 5J0XA 5ALDA 1N2XA 4Y2VA 4IRDA 2NV3A 2XGQA 4B9MA 2R8IA 5ALWA 4R63A 2W55A 1UT8A 3LWMA 3CYMA 1NK5A 2PFPA 3MDAA 2JXJA 2ZIVB 2Q0ZX 1QH9A 3LDAA 3TAQA 1URJA 1NZBA 3QUBA 2QARA 2GWSA 3CRXA 5KFTA 4PJ0U 3MR6A 1OXJA 4M6WA 4RT2A 5ALFA 2G06A 4ICAA 2HCFA 3M6KA 1B22A 2DKXA 3TKAA 1WUDA 5DB6A 8ICNA 4Y2JA 5DGBA 2PI5A 4RPZA 1T3QA 5AI6A 1HIWA 8ICPA 3SENA 3E2EA 2QKQA 4MFFA 1FIQA 2I6XA 4I2AA 1UCVA 4PL1A 5DB8A 2C2DA 2OWOA 2WF7A 4UBCA 2I1QA 5EE0A 1OW5A 4O3SA 1L8OA 3WK5A 2LM1A 3T5KA 3JPNA 4F8RA 3UMCA 2KFNA 4BJQA 7ICKA 4QWDA 2KZMA 5EOZA 3UPQA 4P0QA 3QNMA 4QZEA 8ICHA 1N48A 4B9SA 7ICFA 8ICLA 4LJXA 4HAIA 5EWGA 3RB3A 2HOIA 2PMZC 1ZQPA 1TV9A 1BVSA 2W3RA 5J0TA 2KV2A 2JGAA 4IS7A 4ECSA 3GIKA 4M2YA 2HI0A 2VJ5A 4EBDA 4O9MA 2WAQF 5DDMA 3KZXA 2J6SA 5IINA 9ICOA 2ZJ8A 4YN4A 2I9GA 3G6YA 3KHRA 1Z1VA 5J0RA 1PVRA 2BQ3A 4JV0A 3FC4A 1S0NA 2PFNA 2DFLA 4KX5A 1DXSA 2XI9A 2XC9A 4ED8A 1ZYQA 2G09A 5AKXA 4BXOB 4GC7A 3QU4A 2ZUCA 1J97A 2FJ6A 4UB5A 4HYKA 4ED0A 5EWFA 4I2IA 2K4EA 8ICVA 2Y1IA 7ICEA 4ELUA 1ZQBA 4OD0A 3F5EA 4O5CA 3V6KA 4C80A 3V6HA 5JTIA 4YP3A 4BWMA 5J0YA 5GTHU 4NLGA 2XICA 4DSFA 4J9RA 4PGQA 3M9MB 4KLSA 2RDJA 1JIHA 4DFJA 1SL0A 5L1IA 4EEYA 2P35A 4PZNA 5KFKA 3ORYA 2W9BA 4F2SA 4RUAA 2ZXHA 4CDGA 4M0AA 2LBOA 9ICFA 3GZFA 5ALZA 5KFCA 1SZPA 5J0QA 2EAPA 2J6UA 4F5NA 2EH9A 4ACOA 3QUQA 3EPGA 2LYHA 1A0PA 4KLDA 2ISOA 4QZAA 2P6RA 1X9XA 4QJFB 4GIBA 1KFSA 2PFQA 2DBYA 3RJJA 4KX3A 1DK3A 2EANA 2W9CA 2K4PA 2AU0A 4DL4A 3OSPA 4P4MA 1MC8A 1UT5A 2E8PA 3KTQA 4RQ8A 1Q46A 3SR6A 4Q8FA 4QZ8A 1ZQLA 5B5EU 2KN7A 3RJEA 3ETRA 4CGZA 2Q4TA 2DPIA 5DLGA 3C29A 3Q8SB 4BX9C 4ED7A 3T5JA 4JK1A 2F8LA 2LKYA 2HMXA 2YMMA 3M9OB 4P0QB 3C2KA 4PPXA 4DLEA 5ALQA 1XU4A 3PMLA 2HHUA 3ZD9A 4Z6EA 1LKYA 3NGDA 5EWEA 2FMPA 2H5XA 2WF9A 4QW9A 2ALZA 2DPJA 3LVVA 1PZNA 1F44A 1Q3VA 3IHQB 2IHNA 4UBBA 3RH6A 1ZQDA 5AI9A 5DG8A 5L1KA 4LZDA 1KSPA 5JUMA 5KG3A 4TQSA 1JN3A 2V9WA 2AGPA 2NRTA 2HOQA 2KJ8A 1PK1B 4J9LA 3PO5A 1SWVA 4DWIA 3IG5A 3F2BA 2NO5A 3N7SC 4EYHB 4F5QA 1TK0A 8ICTA 2A19A 2WAQC 3HX0A 2MSNA 4DSJA 7ICUA 3RBDA 1UA1A 4RPYA 2GO7A 2RHFA 3OTQA 4P0PA 1ZQTA 2KKVA 2GOLA 2BZFA 4MEYA 5KG5A 2KICA 5AM4A 2YB4A 1X66A 3PSTA 2ZIWB 2W04A 4DL7A 5DG7A 1ED1A 4DFPA 3RB6A 2NRVA 4LZGA 2ZG6A 3MR5A 4BWJA 3JPSA 4LVSA 5T14A 1FFVA 3ISDA 2K8AA 5KFVA 4UB3A 2HVHA 5CR0A 4ECUA 4FFDA 4C4RA 4QZCA 5ALXA 2KKPA 3PX6A 1JUDA 1SV0C 2BHNA 1ZQXA 1S77D 3Q8MA 2G08A 5TISU 4O3QA 3M8SA 4M6WB 2OYYA 3KFUF 1F0MA 2K8BB 2BDUA 4Y2SA 4B9TA 3PW7A 1VLBA 4ECVA 2LMRA 2HBLA 4I2BA 2BQUA 3FYHA 4RQ6A 5AKJA 4NLCA 3BS5B 3SD7A 4DFDA 2QB0A 1UQVA 4O3NA 1ZRNA 4US8A 3UQ0A 1MA7A 4ECRA 5KT4A 4CF4A 4ELVA 3HW8A 1KFTA 3IM1A 2AJQA 3CP8A 1L3TA 1V85A 2JZBA 4QWBA 1XS9D 3KHGA 4QZFA 1PVQA 5L9XA 2B6GA 4YXJA 3ZDBA 2OH2A 2MRLA 1UA0A 5KFFA 4C4TA 2LYBA 3TARA 1V38A 4O3MA 4F4XA 1BPBA 1CRXA 3D2SA 2KJ9A 2FDRA 4NWIA 3F5AA 4IR9A 5AICA 4KLOA 1JI7A 5AI4A 3IV6A 4YQWA 3WK9A 4EENA 8ICJA 5AK6A 3A0BU 1KL9A 5KAIU 1GO3F 2E1EA 3L5KA 7ICTA 4IL6U 5DDYA 3AUOA 2YMQA 3RH5A 4RQ7A 3H4BA 1L3VA 4ED3A 4J9OA 1ZQEA 2R8KA 2NRXA 2M0NA 2IHMA 4F3OA 2IOHA 4IQWA 2J6TA 4UATA 3PW5A 8ICRA 4B6JA 2H3IA 3TFSA 1N5XA 1N5WA 2KJ5A 4F50A 2C28A 1U48A 3V7JA 5DB9A 2JRZA 3EW9A 4ECWA 2KP7A 2ESEA 5CJ7A 3WK6A 2ZIXA 4UAWA 1A76A 4QZBA 2W03A 3K75D 3L4PA 2W7PA 3TQ1A 4P4PA 2B21A 5DQHA 2HBJA 1D8BA 3RAQA 1X9SA 4JWNA 4R65A 1D8LA 4KTQA 3T79A 3GIIA 5ALKA 1BPXA 9ICVA 5AI0A 2G0AA 2A1AA 3QU5A 1LKYB 3THVA 3RJHA 3RR7A 2FPLA 5AIBA 3WKEA 4PHEA 1ZQYA 4JV1A 1SXDA 8ICWA 1TAQA 4MFAA 5F9LA 9ICQA 1X6IA 1F5SA 4Q45A 2HHSA 2ZIXB 2BCVA 4C8OA 4F5RA 4DQQA 3PX0A 5H2FU 2YMPA 4I28A 2BCSA 1ZD5A 8ICYA 2W9MA 5HMLA 9ICXA 4YR3A 1ZD2P 5ALEA 1NK8A 2BPCA 2LHTA 2AHOB 4CF3A 4M9HA 4PZOA 3UXNA 5KG6A 4RUCA 4F4WA 3PX4A 5KFDA 3AU6A 3QUTA 1Y88A 3RFAA 2W3SA 3MFIA 4F92B 2QB0B 1BGXT 3AQFA 4O3OA 3H8JA 3N4MB 3VC8A 1UPHA 4JMUA 1X2IA 3H8SA 3T3FA 2K4IA 2C2EA 1RYUA 3IP4B 2IMWP 1VDVA 5AI5A 4QW8A 8ICAA 1Z00A 2QARB 1NK6A 4KMUA 4O5KA 3Q8QB 2KE7A 3DEEA 3NVVA 4R8UB 4DSLA 1IG6A 4J9SA 3SI8A 2VJ4A 4KN4A 3PZPA 2OM6A 4KLGA 5ALVA 9ICBA 3M8RA 1HUOA 9ICSA 4MHVA 4A8EA 4QWAA 2E1FA 1CI4A 5DBBA 2AQ4A 3RR8A 3LVWA 4FBUA 1J2NA 2VIXA 2WTFA 1YZ6A 2KSOA 2AGOA 2FE9A
chains in the Genus database with same CATH topology
3T79A 2HOQA 2KJ8A 4CRXA 3CP8A 2XVTA 4BJQA 2DGZA 2ZIUB 2ZXHA 4CDGA 4GFJA 2G0AA 2KD1A 2KNJA 2LBOA 3F2DA 5KL8B 3IG5A 3F2BA 3K1ZA 4FZMA 3PSPA 3GZFA 3N7SC 3PSIA 3RF9A 2OXOA 4P0QA 1SZHA 2DQNB 1PVQA 1A6SA 4BUGA 3ONNA 1Z19A 2WAQC 3AQEA 2Y0SF 3PSFA 2OH2A 2MRLA 2HOIA 3VCBA 1TAMA 2JH1A 2PMZC 2H3QA 4OJ5A 2LYBA 3GU3A 2ZIXB 4ACOA 4O3MA 1CRXA 2Z7JA 3D2SA 2JHDA 2F2AB 2K4HA 2KV2A 1A0PA 2JGAA 2KJ9A 2RHFA 2RRDA 2Y0SC 3N7PD 2KHVA 3F5AA 4NWIA 4QIWF 2ZIWA 2KHQA 2VJ5A 2ZXIA 4P0PA 3D2NA 4KMOB 2KKVA 4AYBC 2GOLA 4QJFB 1P7DA 2CPRA 2KEYA 1ECWA 1Q3UA 2LYAA 4WJ3B 2WAQF 2KICA 3HKZC 1YT3A 2YB4A 1GO3F 3NRWA 2K8CB 3PSTA 2E1EA 2NV3A 3KZXA 2KIWA 2LHTA 2ZIWB 2ZIUA 2W04A 5A0LA 3IN5A 4IC9A 4KX3A 1XO0A 2H3ZA 4OJPA 1ED1A 3ALRA 2YB1A 3H0LB 2ZG6A 1PVRA 3CYMA 4PL2A 3D2QA 2PMZF 5C0YA 5T14A 1ZQ1C 2WB1F 2G5IB 4FZNA 3RFAA 2ZIVB 3SMVA 2K8AA 4OJLA 2R18A 2H3FA 4C0ZA 5HR6A 4NLBA 1URJA 1NZBA 3SAGA 1T94A 2M0NA 3AQFA 3HKZF 4KX5A 2F76X 3CRXA 2XI9A 1KBUA 2W7OA 3O0FA 1UPHA 2G09A 3VC8A 2G06A 4ICAA 4JMUA 2G5HB 2A3VA 2N1RA 5HR7A 3N7RC 2K4IA 4CGZA 2D6FC 2Q4TA 4NV0A 2KKPA 3SAFA 2HOFA 3C29A 3MGVA 3AL0B 3IP4B 3M6KA 4BX9C 2JH7A 2G07A 3LYSA 1IIPA 2KVCA 3M7DA 2H3IA 2G08A 4AYBF 1Z1BA 1WUDA 1L6NA 2DF4B 2OYYA 2CN1A 4U6PA 2K4EA 3KFUF 2F8LA 2LKYA 2HMXA 3SQIA 2KJ5A 2XIDA 4P0QB 2K8BB 3ICXA 2BDUA 2ZIVA 3DEEA 2HBKA 1DRGA 5KL1B 2HBMA 3F5EA 1HIWA 2WB1C 2KOBA 3M6ZA 3H0MB 2VJ4A 2CRXA 3F53A 4U7CA 3E0FA 3PZPA 3C28A 2E5SA 4FE3A 3H0RB 2OM6A 2HBLA 4OO1J 2ZIXA 2JMGA 2XICA 4QIWC 2RP5A 3LVVA 4PL1A 4A8EA 1PVPA 2E1FA 2W03A 2W7PA 3OPXA 4NLCA 3SAHA 1F44A 4OJOA 1OUQA 2MA1A 1HEKA 2H3VA 3IG8A 4OJ6A 1XNSA 1Q3VA 4P0PB 4QNLA 5CRXA 2HBJA 3NUQA 1D8BA 2GH1A 3LVWA 2F77X 1MA7A 3L3FX 2VIXA 3F2CA 2VKQA 4FZLA 2YX8A 2K89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AYB F;  2WB1 F;  2WAQ F;  3HKZ F;  2PMZ F;  2Y0S F; 
#chains in the Genus database with same CATH topology
 2PKE A;  1SV4 A;  2NRW A;  4GFJ A;  3F2D A;  1L7M A;  5KL8 B;  8ICI A;  3WK8 A;  5IIO A;  4KLQ A;  1JX4 A;  1ZQW A;  4ECZ A;  2OEH A;  2ZTC A;  2XO7 A;  4J9M A;  2QLT A;  2KTQ A;  3V7K A;  2HHT A;  4TUP A;  1X6J A;  2ASJ A;  1JAL A;  1LVH A;  2Z7J A;  3C1Z A;  2F2A B;  3KHH A;  3V6J A;  2XY5 A;  2KHQ A;  5B66 U;  4NL9 A;  2ZUB A;  3QXG A;  5J2E A;  5AKE A;  4E0D A;  2AGQ A;  2E8N A;  3OJS A;  3BQT A;  2O6K A;  3HJE A;  3MFH A;  4EBE A;  2Y1J A;  4KLJ A;  2XY6 A;  3ALR A;  2YY6 A;  4GXK A;  4PHP A;  2BR0 A;  1NKC A;  5C5J A;  5HR6 A;  2EAM A;  1Z00 B;  1V97 A;  4NLB A;  5KFE A;  2ISP A;  1TVA A;  2R8G A;  4DQI A;  7ICP A;  1V9P A;  3TAN A;  4ED2 A;  4CCH A;  2N1R A;  1FEZ A;  4C7Z A;  1ZQO A;  4NV0 A;  9ICG A;  2IOF K;  2JH7 A;  1IIP A;  5ALM A;  4PGY A;  9ICA A;  5JRT A;  4TUR A;  5IIL A;  3EYZ A;  2BCR A;  3MAB A;  5AIA A;  1KKX A;  2JEI A;  1ZJM A;  4K4H A;  1S0V A;  7ICG A;  3SV4 A;  4QIW C;  4DQR A;  4I29 A;  8ICK A;  2HDO A;  4R8U A;  1JXL A;  3QU2 A;  2NYV A;  3RJK A;  4GXI A;  4QNL A;  1J2M A;  2P6U A;  1BPE A;  9ICK A;  2K89 A;  5J2I A;  3BJY A;  5KFG A;  2A1J A;  4DF4 A;  4FZM A;  5ALL A;  5ALU A;  2HHW A;  5KTQ A;  4DLG A;  1ZQN A;  4RQ4 A;  1X9W A;  2H3Q A;  3RJF A;  3KOO A;  1ZQG A;  3F53 A;  2V4Q A;  2Y0S C;  5IIK A;  5J2H A;  2ZXI A;  2F3N A;  4DL3 A;  3H8W A;  5L1M A;  3PNC A;  1X9M A;  4R66 A;  2KEY A;  5F9N A;  1ZQI A;  2Y9T A;  3GIL A;  5D4B A;  2KIW A;  3MC1 A;  2WF8 A;  3SV3 A;  2KZZ A;  2DKZ A;  3IDW A;  2UVV A;  2V4R A;  4FO6 A;  3MR3 A;  4J9Q A;  5C0Y A;  4XUS A;  1T4G A;  2G5I B;  3C21 A;  3SMV A;  1NJW A;  4EZ9 A;  1T94 A;  1WWU A;  1O08 A;  3IRU A;  5HR7 A;  5AKZ A;  4EX7 A;  7ICQ A;  3QZ8 A;  3N28 A;  2DUY A;  2UVW A;  1WYG A;  3SAF A;  3WK4 A;  5KFA A;  4CE6 A;  3OHA A;  2VA8 A;  4Q43 A;  2HHV A;  4YD2 A;  3U26 A;  1ZQC A;  3A0H U;  4UB2 A;  1JRO A;  1ZQH A;  3J81 j;  2XID A;  5KFS A;  5TZV A;  4J03 A;  1N61 A;  1KW4 A;  4RU9 A;  1TAU A;  4UB4 A;  1S8O A;  2IBK A;  3SEI A;  3E0F A;  4M04 A;  2GLE A;  4BXO A;  2MUT B;  1CUK A;  2LI6 A;  5HHH A;  5ALT A;  2R8J A;  4TQR A;  4DF8 A;  4ECQ A;  1U47 A;  5DKW A;  4OJO A;  1L5U A;  4TUS A;  3TAP A;  1SKR A;  2XCP A;  3DDH A;  3CNH A;  3HP6 A;  2PXI A;  1BPZ A;  4Q8E A;  8ICO A;  1SIJ A;  4EX6 A;  3RJI A;  3Q8P B;  4F4Z A;  5K4L A;  5KT6 A;  4I2C A;  1QLN A;  1ZQM A;  5ALJ A;  1XWL A;  1O03 A;  2E8M A;  5D49 A;  3PSI A;  2OXO A;  4C8M A;  2FLN A;  2ZJA A;  3BDP A;  1Z19 A;  4DS5 A;  7ICO A;  3PSF A;  2WF5 A;  2BPG A;  1S97 A;  1QCK A;  2UVU A;  1JXE A;  3Q8R B;  4KLE A;  4XQ8 A;  3TAC B;  4ECT A;  2F1H A;  2OHF A;  4QWE A;  4ELT A;  1Z4O A;  4I27 A;  8ICZ A;  4IR1 A;  1NJZ A;  5BOM A;  4B9U A;  5HHI A;  3G6V A;  1ECW A;  4IQU A;  1X40 A;  4US9 A;  1XO1 A;  4C8N A;  4EEL A;  4OJP A;  5AM3 A;  1SL2 A;  2KZ3 A;  1QTM A;  1RXV A;  5AK4 A;  5J2B A;  1ZQ1 C;  5J2D A;  4QZG A;  3EPI A;  3T5H A;  3QZ7 A;  2F1I A;  5KFM A;  1K1S A;  3GIM A;  3O0F A;  2E8O A;  2A3V A;  3PVX A;  1LB2 B;  2F8K A;  1D8Y A;  5J8Y C;  1NI3 A;  3LYS A;  1EXN A;  3M7D A;  4F2R A;  5EE9 A;  4Y2T A;  2RDI A;  3NVZ A;  4DS4 A;  2M9N A;  3SZ2 A;  4IQV A;  2KMD A;  5AK5 A;  1NZP A;  1DRG A;  1TE2 A;  2WB1 C;  4ECX A;  4F4K A;  5KG4 A;  3QEB Z;  3PW2 A;  2NRZ A;  1PVP A;  3RJG A;  2JEJ A;  2ZTE A;  1PUZ A;  2MA1 A;  3HIL A;  2OCE A;  1DOQ A;  3NTU A;  1D9F A;  1TFR A;  1TK8 A;  5ALI A;  5AHX A;  3WU2 U;  5KFW A;  3UXP A;  2KFZ A;  2HHQ A;  3GDX A;  3I1Y A;  2RQ5 A;  3Q8L A;  2C22 A;  5KFX A;  5AM5 A;  4UB1 A;  1CEZ A;  5KFQ A;  5AKL A;  1ZQU A;  4MFC A;  1RYR A;  3BQ0 A;  3NAS A;  1TAM A;  4ECY A;  4RZR A;  3ZDC A;  5ALR A;  5J2G A;  3I76 A;  2PI4 A;  1S5L U;  5KFN A;  4XA5 A;  3NVW A;  2I5H A;  3BQ7 A;  1NJY A;  4AYB C;  8ICX A;  3TAD A;  2BQR A;  1SB3 C;  4JV2 A;  4QZH A;  4RNO A;  1KRP A;  1PK1 A;  4IC9 A;  1L8L A;  4PHA A;  5AM2 A;  3GIJ A;  3V72 A;  4YR2 A;  3AEV A;  3K1R B;  2KVS A;  4DOC A;  1WCN A;  4J9K A;  2IA6 A;  1NNL A;  4K4G A;  5AKH A;  1JMS A;  2F76 X;  3MDC A;  3Q8K A;  2BCQ A;  4FS1 A;  4P4O A;  4C4S A;  5KFZ A;  5KT2 A;  3B0X A;  2HOF A;  3MGH A;  5AKK A;  5L1L A;  2KVC A;  3BZK A;  4RT3 A;  4M9N A;  3ED5 A;  3SYZ A;  4IRK A;  2EAO A;  4Y2X A;  2DL0 A;  3WK7 A;  3UMG A;  3BQ1 A;  2W9C B;  2VAN A;  3MR2 A;  2CRX A;  8ICF A;  3H40 A;  2E5S A;  3WKB A;  4QWC A;  1C20 A;  1QSS A;  5KG2 A;  4UAS A;  3FAH A;  4C8K A;  1ZOL A;  4QZI A;  4NXZ A;  1S76 D;  4G9B A;  4X5V A;  3QX7 A;  5ALP A;  5DGA A;  4DQS A;  4YCX A;  3LK9 A;  2BDP A;  4I2D A;  4YMO A;  1A6S A;  5G5G A;  1ZXI A;  1LV5 A;  3C2L A;  4UW9 A;  4G3I A;  4DL6 A;  2KK0 A;  3KBB A;  4JB3 A;  2W9B B;  5KFL A;  5BOL A;  5J0U A;  4QZ9 A;  2RRD A;  3B9J A;  3EUB 2;  5ALN A;  1QQ6 A;  5DBC A;  3JPP A;  5EE3 A;  3UXO A;  3M9N B;  3HKZ C;  1WWV A;  4F71 A;  4CNQ A;  8ICB A;  5A0L A;  3PY8 A;  5AM1 A;  4M9G A;  3H7I A;  2AXT U;  4Y2R A;  1XSL A;  5CHG A;  3KKA C;  5DQI A;  4M9L A;  1S0O A;  1C7Y A;  2W7O A;  1ZQS A;  1S0M A;  8ICS A;  3MGV A;  2JEF A;  1MQ2 A;  4KLF A;  2KIV A;  2C2R A;  2EDU A;  1L6N A;  2DF4 B;  4DL5 A;  4RNN A;  1ZQA A;  4Z6C A;  1BNO A;  2LM4 A;  4PGX A;  5ALG A;  3H0M B;  5J0O A;  3WKD A;  3D6J A;  7ICS A;  2R8H A;  3C5G A;  3GV7 B;  2ZTD A;  2HW3 A;  3QE9 Y;  2W54 A;  3OPX A;  2PFO A;  5HNK A;  3IG8 A;  2RLT A;  3ZI4 A;  5AKI A;  3RAX A;  5KNI A;  5KT5 A;  3FM9 A;  4IRC A;  4I2H A;  1DGS A;  3PV8 A;  1HUZ A;  4CRX A;  5EE1 A;  9ICL A;  1ZQK A;  4UAU A;  1D9D A;  2KD1 A;  9ICC A;  4UB8 U;  3RF9 A;  1RYS A;  1FFU A;  4KIT B;  4Y2P A;  5BPC A;  3TI0 A;  4OCZ A;  3VCB A;  1RXW A;  1ZQR A;  4OJ5 A;  1WG8 A;  3GU3 A;  3H8M A;  3TAD C;  8ICU A;  5DLF A;  1UHU A;  1U4B A;  2YN4 A;  3BZC A;  3E58 A;  3EWA A;  1T7P A;  4UAR A;  5J0P A;  2CPR A;  1L7N A;  2FI1 A;  7ICL A;  1PK3 A;  8ICM A;  1Q8K A;  2AH5 A;  1COO A;  3IN5 A;  1ZQZ A;  1WCL A;  4GLX A;  1KTQ A;  1H38 A;  9ICM A;  4AYB F;  2WB1 F;  2H3F A;  2ATL A;  4DOA A;  5HP4 A;  5ALH A;  2G5H B;  2LPE A;  3NS1 A;  4K4I A;  2D6F C;  2MUT A;  1B4F A;  1A77 A;  1VJ5 A;  2G07 A;  4Z6F A;  1ZQV A;  1XSN A;  4O3P A;  1QSL A;  1L3S A;  5J2A A;  1FO4 A;  4F91 B;  4DEZ A;  4ZH4 A;  3RRG A;  3H0R B;  2XGP A;  2JR5 A;  4Y2U A;  1K5O A;  3QEA Z;  5CA7 A;  3S6J A;  1KDH A;  4MEX A;  5KFJ A;  5CRX A;  3NUQ A;  1DGJ A;  1BPY A;  3RRH A;  3F2C A;  2YTU A;  4UB6 U;  1JRP A;  3AL0 B;  1ZRM A;  2BCU A;  7ICN A;  5KFH A;  1KQQ A;  1QQ7 A;  3K1Z A;  4YR0 A;  4UAV A;  1RDF A;  3BS5 A;  4KLT A;  7ICR A;  3BS7 A;  4YMM A;  2EZY A;  2UVR A;  3TFR A;  3V7L A;  3B0Y A;  3GV5 B;  4PL2 A;  2K4H A;  2D8C A;  4I2F A;  9ICT A;  3NRZ A;  4FBT A;  3D2N A;  3QUC A;  4KMO B;  1KFD A;  4CF5 A;  1Q3U A;  5KT3 A;  3WKA A;  2MAX A;  5III A;  1U9L A;  7ICH A;  1MSW D;  4KN7 A;  4JWM A;  7ICI A;  3K4G A;  4O3R A;  4U6P A;  1DK2 A;  4OJL A;  3SAG A;  3HKZ F;  1RPL A;  1KBU A;  4RQN A;  3QU7 A;  9ICP A;  4QZD A;  4MF8 A;  3H4D A;  7ICM A;  1XC9 A;  3AU2 A;  5CP2 A;  4TUQ A;  2YQE A;  9ICI A;  2HSZ A;  4DFK A;  3OHB A;  4GXJ A;  1U49 A;  2FMQ A;  4MF2 A;  5KFP A;  5L1J A;  1ZD3 A;  1ZQQ A;  3RB0 A;  1IM4 A;  1N56 A;  1RM6 C;  4YVZ A;  1YZ7 A;  1SV0 A;  3C28 A;  3RB4 A;  5KFR A;  4OO1 J;  2JMG A;  5IIJ A;  2ASL A;  4F4Y A;  1S10 A;  1OUQ A;  3MGI A;  1BNP A;  1HEK A;  2H3V A;  4OJ6 A;  1MQ3 A;  4P0P B;  2GH1 A;  3ZDD A;  8ICC A;  4DFM A;  4NLZ A;  2VKQ A;  4KLH A;  5KAF U;  2YX8 A;  1NJX A;  2FMS A;  4KLM A;  2L5Y A;  4DO9 A;  4NLN A;  4R64 A;  1NK0 A;  1QQ5 A;  2W11 A;  1SWW A;  2KNJ A;  2DWQ A;  4GC6 A;  1Z4N A;  1U45 A;  2FLP A;  3PSP A;  5KG1 A;  3PW4 A;  2VA2 A;  2JV3 A;  4BUG A;  4ED6 A;  2E3T A;  4NY8 A;  4RQ1 A;  3HPO A;  2ASD A;  9ICE A;  2EQY A;  5CWR A;  3ZDE A;  4M9J A;  2K60 A;  2KHV A;  3GFK B;  2YML A;  3ISB A;  5DBA A;  4DCC A;  1P7D A;  4Z6D A;  2LYA A;  1KLN A;  4Y2Y A;  2K8C B;  2HHX A;  4KLI A;  1RZT A;  2ZIU A;  9ICH A;  3NVY A;  2ES6 A;  4ZOH C;  2YB1 A;  3D2Q A;  5AM0 A;  3ZDA A;  1B0X A;  4RQ3 A;  3CW2 C;  4C0Z A;  3KD3 A;  1TKD A;  2BKE A;  4EYI B;  4ED1 A;  8ICE A;  2ZUD A;  4RQM A;  5KFO A;  3OGU A;  4F72 A;  3I28 A;  3G6X A;  4P2H A;  7ICJ A;  1L7O A;  3RBE A;  1IXR A;  3ZD8 A;  4RNM A;  3C2M A;  2CN1 A;  2JEG A;  2KSO B;  3SQI A;  3GV8 B;  2HBK A;  3C5F A;  9ICU A;  4NM2 A;  3MBY A;  3RH4 A;  3OSN A;  5KG0 A;  3N97 B;  5F3X B;  5JU5 A;  1T8E A;  4NLK A;  4RPX A;  5J2F A;  2W8K A;  4EBC A;  1MN8 A;  3LWL A;  5J2J A;  5E79 U;  2XVT A;  1X42 A;  1SKS A;  1NOM A;  5FP0 A;  3UMB A;  1NK7 A;  5HMM A;  4B9V A;  1SZH A;  4RQ5 A;  1KEJ A;  8ICG A;  2AQ0 A;  3EZ5 A;  4J9P A;  4UAZ A;  2WF6 A;  1ZQF A;  4DQP A;  3PR4 A;  2W43 A;  1KN5 A;  4QIW F;  5CB1 A;  1Z3E B;  3JPR A;  1N62 A;  3FDS A;  1ZD4 A;  2D3D A;  3RTV A;  8ICQ A;  1AQ6 A;  4C7Y A;  4M47 A;  4O0I A;  1SKW A;  1YT3 A;  3NRW A;  4USA A;  4PH5 A;  4O5E A;  2Y9U A;  3C1Y A;  4YFK A;  2H3Z A;  1NK9 A;  4DSI A;  4FS2 A;  3H0L B;  4XRH A;  9ICJ A;  4DOB A;  4EZ6 A;  2PMZ F;  1SL1 A;  2W8L A;  5KFY A;  2VA3 A;  2P66 A;  2B0C A;  4BDP A;  5KFB A;  3JPQ A;  2MU2 A;  1BPD A;  1B43 A;  2WHE A;  2FLL A;  2ZJ5 A;  4I2E A;  5J29 A;  1S9F A;  1HJP A;  5J0W A;  5G5H A;  1Z1B A;  3ISC A;  2ODG A;  4RQ0 A;  3PW0 A;  3ICX A;  2ZIV A;  3DV9 A;  4NM1 A;  2HBM A;  1NKB A;  2KOB A;  3M6Z A;  1ZJN A;  2F1J A;  4U7C A;  1TK5 A;  4F5O A;  4BGD A;  2KG5 A;  1NKE A;  5DG9 A;  3GQC A;  1COK A;  3SAH A;  2W9A A;  2IOF A;  5DQG A;  2F77 X;  2BPF A;  3L3F X;  4FZL A;  4I2J A;  1SXE A;  3QU9 A;  3T5L A;  2DGZ A;  2ZIU B;  2XY7 A;  5J2C A;  3KKA A;  5J2K A;  4PHD A;  2DQN B;  4YMN A;  2FPM A;  3ONN A;  2XCA A;  2EZZ A;  2QB1 A;  1N63 A;  3PR5 B;  3WKC A;  2JHD A;  2NO4 A;  4RQ2 A;  5ALO A;  4AP9 A;  4DSK A;  2WFA A;  9ICR A;  5AKG A;  3AMZ A;  5KG7 A;  4WJ3 B;  4I2G A;  5IIM A;  5ALY A;  4DL2 A;  1L3U A;  3HT3 A;  2A1J B;  1XO0 A;  3KZI U;  1QSY A;  5J8Y A;  4C8L A;  4FZN A;  2R18 A;  3HWT A;  5KFU A;  5KT7 A;  4JUZ A;  4B9L A;  5GTI U;  4NL9 C;  2CXY A;  3UM9 A;  3ETL A;  3N7R C;  4KLL A;  1SGG A;  5D46 A;  3M1Y A;  7ICV A;  4B9N A;  4UAY A;  1ZQJ A;  3R9K A;  3QYP A;  2F44 A;  4DSE A;  5KL1 B;  2HVI A;  4YD1 A;  3AM9 A;  1RG6 A;  4FE3 A;  1ZET A;  2EZX A;  1T3N A;  4YG2 A;  3UQ2 A;  2RP5 A;  3JPO A;  3BQ2 A;  1XSP A;  4IQT A;  5J0S A;  9ICN A;  5AI8 A;  1XNS A;  5KFI A;  5AKY A;  4Q44 A;  3PO4 A;  1NK4 A;  1L7P A;  3KHL A;  4Y2Q A;  1ARO P;  1IV8 A;  1RQL A;  4F5P A;  3AN1 A;  4J9N A;  4UQG A;  1M6Y A;  1K1Q A;  5ALS A;  5DB7 A;  4YXM A;  5CEH A;  4KLU A;  3AQE A;  9ICW A;  4EEK A;  2Y0S F;  1RQN A;  3C23 A;  5AK3 A;  2JH1 A;  3PMN A;  3OJU A;  3JPT A;  4NJ8 A;  2BGW A;  3HRD D;  3N7P D;  2JZB B;  2ZIW A;  4F93 B;  2FPK A;  1N60 A;  5J0X A;  5ALD A;  1N2X A;  4Y2V A;  4IRD A;  2NV3 A;  2XGQ A;  4B9M A;  2R8I A;  5ALW A;  4R63 A;  2W55 A;  1UT8 A;  3LWM A;  3CYM A;  1NK5 A;  2PFP A;  3MDA A;  2JXJ A;  2ZIV B;  2Q0Z X;  1QH9 A;  3LDA A;  3TAQ A;  1URJ A;  1NZB A;  3QUB A;  2QAR A;  2GWS A;  3CRX A;  5KFT A;  4PJ0 U;  3MR6 A;  1OXJ A;  4M6W A;  4RT2 A;  5ALF A;  2G06 A;  4ICA A;  2HCF A;  3M6K A;  1B22 A;  2DKX A;  3TKA A;  1WUD A;  5DB6 A;  8ICN A;  4Y2J A;  5DGB A;  2PI5 A;  4RPZ A;  1T3Q A;  5AI6 A;  1HIW A;  8ICP A;  3SEN A;  3E2E A;  2QKQ A;  4MFF A;  1FIQ A;  2I6X A;  4I2A A;  1UCV A;  4PL1 A;  5DB8 A;  2C2D A;  2OWO A;  2WF7 A;  4UBC A;  2I1Q A;  5EE0 A;  1OW5 A;  4O3S A;  1L8O A;  3WK5 A;  2LM1 A;  3T5K A;  3JPN A;  4F8R A;  3UMC A;  2KFN A;  4BJQ A;  7ICK A;  4QWD A;  2KZM A;  5EOZ A;  3UPQ A;  4P0Q A;  3QNM A;  4QZE A;  8ICH A;  1N48 A;  4B9S A;  7ICF A;  8ICL A;  4LJX A;  4HAI A;  5EWG A;  3RB3 A;  2HOI A;  2PMZ C;  1ZQP A;  1TV9 A;  1BVS A;  2W3R A;  5J0T A;  2KV2 A;  2JGA A;  4IS7 A;  4ECS A;  3GIK A;  4M2Y A;  2HI0 A;  2VJ5 A;  4EBD A;  4O9M A;  2WAQ F;  5DDM A;  3KZX A;  2J6S A;  5IIN A;  9ICO A;  2ZJ8 A;  4YN4 A;  2I9G A;  3G6Y A;  3KHR A;  1Z1V A;  5J0R A;  1PVR A;  2BQ3 A;  4JV0 A;  3FC4 A;  1S0N A;  2PFN A;  2DFL A;  4KX5 A;  1DXS A;  2XI9 A;  2XC9 A;  4ED8 A;  1ZYQ A;  2G09 A;  5AKX A;  4BXO B;  4GC7 A;  3QU4 A;  2ZUC A;  1J97 A;  2FJ6 A;  4UB5 A;  4HYK A;  4ED0 A;  5EWF A;  4I2I A;  2K4E A;  8ICV A;  2Y1I A;  7ICE A;  4ELU A;  1ZQB A;  4OD0 A;  3F5E A;  4O5C A;  3V6K A;  4C80 A;  3V6H A;  5JTI A;  4YP3 A;  4BWM A;  5J0Y A;  5GTH U;  4NLG A;  2XIC A;  4DSF A;  4J9R A;  4PGQ A;  3M9M B;  4KLS A;  2RDJ A;  1JIH A;  4DFJ A;  1SL0 A;  5L1I A;  4EEY A;  2P35 A;  4PZN A;  5KFK A;  3ORY A;  2W9B A;  4F2S A;  4RUA A;  2ZXH A;  4CDG A;  4M0A A;  2LBO A;  9ICF A;  3GZF A;  5ALZ A;  5KFC A;  1SZP A;  5J0Q A;  2EAP A;  2J6U A;  4F5N A;  2EH9 A;  4ACO A;  3QUQ A;  3EPG A;  2LYH A;  1A0P A;  4KLD A;  2ISO A;  4QZA A;  2P6R A;  1X9X A;  4QJF B;  4GIB A;  1KFS A;  2PFQ A;  2DBY A;  3RJJ A;  4KX3 A;  1DK3 A;  2EAN A;  2W9C A;  2K4P A;  2AU0 A;  4DL4 A;  3OSP A;  4P4M A;  1MC8 A;  1UT5 A;  2E8P A;  3KTQ A;  4RQ8 A;  1Q46 A;  3SR6 A;  4Q8F A;  4QZ8 A;  1ZQL A;  5B5E U;  2KN7 A;  3RJE A;  3ETR A;  4CGZ A;  2Q4T A;  2DPI A;  5DLG A;  3C29 A;  3Q8S B;  4BX9 C;  4ED7 A;  3T5J A;  4JK1 A;  2F8L A;  2LKY A;  2HMX A;  2YMM A;  3M9O B;  4P0Q B;  3C2K A;  4PPX A;  4DLE A;  5ALQ A;  1XU4 A;  3PML A;  2HHU A;  3ZD9 A;  4Z6E A;  1LKY A;  3NGD A;  5EWE A;  2FMP A;  2H5X A;  2WF9 A;  4QW9 A;  2ALZ A;  2DPJ A;  3LVV A;  1PZN A;  1F44 A;  1Q3V A;  3IHQ B;  2IHN A;  4UBB A;  3RH6 A;  1ZQD A;  5AI9 A;  5DG8 A;  5L1K A;  4LZD A;  1KSP A;  5JUM A;  5KG3 A;  4TQS A;  1JN3 A;  2V9W A;  2AGP A;  2NRT A;  2HOQ A;  2KJ8 A;  1PK1 B;  4J9L A;  3PO5 A;  1SWV A;  4DWI A;  3IG5 A;  3F2B A;  2NO5 A;  3N7S C;  4EYH B;  4F5Q A;  1TK0 A;  8ICT A;  2A19 A;  2WAQ C;  3HX0 A;  2MSN A;  4DSJ A;  7ICU A;  3RBD A;  1UA1 A;  4RPY A;  2GO7 A;  2RHF A;  3OTQ A;  4P0P A;  1ZQT A;  2KKV A;  2GOL A;  2BZF A;  4MEY A;  5KG5 A;  2KIC A;  5AM4 A;  2YB4 A;  1X66 A;  3PST A;  2ZIW B;  2W04 A;  4DL7 A;  5DG7 A;  1ED1 A;  4DFP A;  3RB6 A;  2NRV A;  4LZG A;  2ZG6 A;  3MR5 A;  4BWJ A;  3JPS A;  4LVS A;  5T14 A;  1FFV A;  3ISD A;  2K8A A;  5KFV A;  4UB3 A;  2HVH A;  5CR0 A;  4ECU A;  4FFD A;  4C4R A;  4QZC A;  5ALX A;  2KKP A;  3PX6 A;  1JUD A;  1SV0 C;  2BHN A;  1ZQX A;  1S77 D;  3Q8M A;  2G08 A;  5TIS U;  4O3Q A;  3M8S A;  4M6W B;  2OYY A;  3KFU F;  1F0M A;  2K8B B;  2BDU A;  4Y2S A;  4B9T A;  3PW7 A;  1VLB A;  4ECV A;  2LMR A;  2HBL A;  4I2B A;  2BQU A;  3FYH A;  4RQ6 A;  5AKJ A;  4NLC A;  3BS5 B;  3SD7 A;  4DFD A;  2QB0 A;  1UQV A;  4O3N A;  1ZRN A;  4US8 A;  3UQ0 A;  1MA7 A;  4ECR A;  5KT4 A;  4CF4 A;  4ELV A;  3HW8 A;  1KFT A;  3IM1 A;  2AJQ A;  3CP8 A;  1L3T A;  1V85 A;  2JZB A;  4QWB A;  1XS9 D;  3KHG A;  4QZF A;  1PVQ A;  5L9X A;  2B6G A;  4YXJ A;  3ZDB A;  2OH2 A;  2MRL A;  1UA0 A;  5KFF A;  4C4T A;  2LYB A;  3TAR A;  1V38 A;  4O3M A;  4F4X A;  1BPB A;  1CRX A;  3D2S A;  2KJ9 A;  2FDR A;  4NWI A;  3F5A A;  4IR9 A;  5AIC A;  4KLO A;  1JI7 A;  5AI4 A;  3IV6 A;  4YQW A;  3WK9 A;  4EEN A;  8ICJ A;  5AK6 A;  3A0B U;  1KL9 A;  5KAI U;  1GO3 F;  2E1E A;  3L5K A;  7ICT A;  4IL6 U;  5DDY A;  3AUO A;  2YMQ A;  3RH5 A;  4RQ7 A;  3H4B A;  1L3V A;  4ED3 A;  4J9O A;  1ZQE A;  2R8K A;  2NRX A;  2M0N A;  2IHM A;  4F3O A;  2IOH A;  4IQW A;  2J6T A;  4UAT A;  3PW5 A;  8ICR A;  4B6J A;  2H3I A;  3TFS A;  1N5X A;  1N5W A;  2KJ5 A;  4F50 A;  2C28 A;  1U48 A;  3V7J A;  5DB9 A;  2JRZ A;  3EW9 A;  4ECW A;  2KP7 A;  2ESE A;  5CJ7 A;  3WK6 A;  2ZIX A;  4UAW A;  1A76 A;  4QZB A;  2W03 A;  3K75 D;  3L4P A;  2W7P A;  3TQ1 A;  4P4P A;  2B21 A;  5DQH A;  2HBJ A;  1D8B A;  3RAQ A;  1X9S A;  4JWN A;  4R65 A;  1D8L A;  4KTQ A;  3T79 A;  3GII A;  5ALK A;  1BPX A;  9ICV A;  5AI0 A;  2G0A A;  2A1A A;  3QU5 A;  1LKY B;  3THV A;  3RJH A;  3RR7 A;  2FPL A;  5AIB A;  3WKE A;  4PHE A;  1ZQY A;  4JV1 A;  1SXD A;  8ICW A;  1TAQ A;  4MFA A;  5F9L A;  9ICQ A;  1X6I A;  1F5S A;  4Q45 A;  2HHS A;  2ZIX B;  2BCV A;  4C8O A;  4F5R A;  4DQQ A;  3PX0 A;  5H2F U;  2YMP A;  4I28 A;  2BCS A;  1ZD5 A;  8ICY A;  2W9M A;  5HML A;  9ICX A;  4YR3 A;  1ZD2 P;  5ALE A;  1NK8 A;  2BPC A;  2LHT A;  2AHO B;  4CF3 A;  4M9H A;  4PZO A;  3UXN A;  5KG6 A;  4RUC A;  4F4W A;  3PX4 A;  5KFD A;  3AU6 A;  3QUT A;  1Y88 A;  3RFA A;  2W3S A;  3MFI A;  4F92 B;  2QB0 B;  1BGX T;  3AQF A;  4O3O A;  3H8J A;  3N4M B;  3VC8 A;  1UPH A;  4JMU A;  1X2I A;  3H8S A;  3T3F A;  2K4I A;  2C2E A;  1RYU A;  3IP4 B;  2IMW P;  1VDV A;  5AI5 A;  4QW8 A;  8ICA A;  1Z00 A;  2QAR B;  1NK6 A;  4KMU A;  4O5K A;  3Q8Q B;  2KE7 A;  3DEE A;  3NVV A;  4R8U B;  4DSL A;  1IG6 A;  4J9S A;  3SI8 A;  2VJ4 A;  4KN4 A;  3PZP A;  2OM6 A;  4KLG A;  5ALV A;  9ICB A;  3M8R A;  1HUO A;  9ICS A;  4MHV A;  4A8E A;  4QWA A;  2E1F A;  1CI4 A;  5DBB A;  2AQ4 A;  3RR8 A;  3LVW A;  4FBU A;  1J2N A;  2VIX A;  2WTF A;  1YZ6 A;  2KSO A;  2AGO A;  2FE9 A; 
#chains in the Genus database with same CATH homology
 3T79 A;  2HOQ A;  2KJ8 A;  4CRX A;  3CP8 A;  2XVT A;  4BJQ A;  2DGZ A;  2ZIU B;  2ZXH A;  4CDG A;  4GFJ A;  2G0A A;  2KD1 A;  2KNJ A;  2LBO A;  3F2D A;  5KL8 B;  3IG5 A;  3F2B A;  3K1Z A;  4FZM A;  3PSP A;  3GZF A;  3N7S C;  3PSI A;  3RF9 A;  2OXO A;  4P0Q A;  1SZH A;  2DQN B;  1PVQ A;  1A6S A;  4BUG A;  3ONN A;  1Z19 A;  2WAQ C;  3AQE A;  2Y0S F;  3PSF A;  2OH2 A;  2MRL A;  2HOI A;  3VCB A;  1TAM A;  2JH1 A;  2PMZ C;  2H3Q A;  4OJ5 A;  2LYB A;  3GU3 A;  2ZIX B;  4ACO A;  4O3M A;  1CRX A;  2Z7J A;  3D2S A;  2JHD A;  2F2A B;  2K4H A;  2KV2 A;  1A0P A;  2JGA A;  2KJ9 A;  2RHF A;  2RRD A;  2Y0S C;  3N7P D;  2KHV A;  3F5A A;  4NWI A;  4QIW F;  2ZIW A;  2KHQ A;  2VJ5 A;  2ZXI A;  4P0P A;  3D2N A;  4KMO B;  2KKV A;  4AYB C;  2GOL A;  4QJF B;  1P7D A;  2CPR A;  2KEY A;  1ECW A;  1Q3U A;  2LYA A;  4WJ3 B;  2WAQ F;  2KIC A;  3HKZ C;  1YT3 A;  2YB4 A;  1GO3 F;  3NRW A;  2K8C B;  3PST A;  2E1E A;  2NV3 A;  3KZX A;  2KIW A;  2LHT A;  2ZIW B;  2ZIU A;  2W04 A;  5A0L A;  3IN5 A;  4IC9 A;  4KX3 A;  1XO0 A;  2H3Z A;  4OJP A;  1ED1 A;  3ALR A;  2YB1 A;  3H0L B;  2ZG6 A;  1PVR A;  3CYM A;  4PL2 A;  3D2Q A;  2PMZ F;  5C0Y A;  5T14 A;  1ZQ1 C;  2WB1 F;  2G5I B;  4FZN A;  3RFA A;  2ZIV B;  3SMV A;  2K8A A;  4OJL A;  2R18 A;  2H3F A;  4C0Z A;  5HR6 A;  4NLB A;  1URJ A;  1NZB A;  3SAG A;  1T94 A;  2M0N A;  3AQF A;  3HKZ F;  4KX5 A;  2F76 X;  3CRX A;  2XI9 A;  1KBU A;  2W7O A;  3O0F A;  1UPH A;  2G09 A;  3VC8 A;  2G06 A;  4ICA A;  4JMU A;  2G5H B;  2A3V A;  2N1R A;  5HR7 A;  3N7R C;  2K4I A;  4CGZ A;  2D6F C;  2Q4T A;  4NV0 A;  2KKP A;  3SAF A;  2HOF A;  3C29 A;  3MGV A;  3AL0 B;  3IP4 B;  3M6K A;  4BX9 C;  2JH7 A;  2G07 A;  3LYS A;  1IIP A;  2KVC A;  3M7D A;  2H3I A;  2G08 A;  4AYB F;  1Z1B A;  1WUD A;  1L6N A;  2DF4 B;  2OYY A;  2CN1 A;  4U6P A;  2K4E A;  3KFU F;  2F8L A;  2LKY A;  2HMX A;  3SQI A;  2KJ5 A;  2XID A;  4P0Q B;  2K8B B;  3ICX A;  2BDU A;  2ZIV A;  3DEE A;  2HBK A;  1DRG A;  5KL1 B;  2HBM A;  3F5E A;  1HIW A;  2WB1 C;  2KOB A;  3M6Z A;  3H0M B;  2VJ4 A;  2CRX A;  3F53 A;  4U7C A;  3E0F A;  3PZP A;  3C28 A;  2E5S A;  4FE3 A;  3H0R B;  2OM6 A;  2HBL A;  4OO1 J;  2ZIX A;  2JMG A;  2XIC A;  4QIW C;  2RP5 A;  3LVV A;  4PL1 A;  4A8E A;  1PVP A;  2E1F A;  2W03 A;  2W7P A;  3OPX A;  4NLC A;  3SAH A;  1F44 A;  4OJO A;  1OUQ A;  2MA1 A;  1HEK A;  2H3V A;  3IG8 A;  4OJ6 A;  1XNS A;  1Q3V A;  4P0P B;  4QNL A;  5CRX A;  2HBJ A;  3NUQ A;  1D8B A;  2GH1 A;  3LVW A;  2F77 X;  1MA7 A;  3L3F X;  2VIX A;  3F2C A;  2VKQ A;  4FZL A;  2YX8 A;  2K89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...