2PMZF

Archaeal rna polymerase from sulfolobus solfataricus
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
89
structure length
89
Chain Sequence
MSSVYIVEEHYIPYSVAKKLLTDVIRSGGSSNLLQRTYDYLNSVEKCDAESAQKVIEELSNIVSREDVRAILASICPTTSDEVRSILVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-ray crystal structure of RNA polymerase from Archaea
pubmed doi rcsb
molecule tags Translation, transferase
molecule keywords DNA-directed RNA polymerase subunit A
total genus 16
structure length 89
sequence length 89
chains with identical sequence U
ec nomenclature
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF03874 RNA_pol_Rpb4 RNA polymerase Rpb4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.820 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2pmzF02
2WAQF 2PMZF 2Y0SF 3HKZF 4AYBF 2WB1F
chains in the Genus database with same CATH superfamily
2E3TA 1RYSA 1QCKA 2PFPA 4YFKA 5AM3A 5DB6A 5ALOA 3AU6A 4I2AA 3RRGA 2BCSA 2W9BA 1LB2B 1RXVA 5CRXA 2XC9A 3MDAA 4LVSA 2NV3A 3G6YA 1CI4A 4UAYA 2ZIWA 2MU2A 2K89A 1ZQWA 5ALSA 3PX4A 1JROA 4O5CA 2BKEA 3C23A 4PL2A 3KHLA 3H8WA 1BPBA 1QQ5A 4RQ8A 2F77X 4RUCA 1N56A 9ICWA 2VA2A 3H0MB 3ALRA 3C29A 1SL2A 2FMPA 1KBUA 2B0CA 1TV9A 5AKKA 2NRZA 4GXIA 2F1HA 4J9KA 3C28A 4KX5A 4QZCA 1NK0A 4F4KA 4M2YA 3DDHA 3A0HU 4QWCA 1V97A 2HHUA 2HI0A 4DFPA 2KG5A 1NK7A 4I29A 9ICFA 5GTIU 4DL2A 1HJPA 1V85A 2Y1JA 2WAQC 5IILA 3F53A 2FE9A 5C0YA 5BOLA 5K4LA 2ZUBA 2I6XA 1L7OA 4NY8A 7ICQA 1KFDA 1K1SA 2G06A 3M8RA 2RHFA 8ICPA 1SV4A 3EYZA 3NRZA 4F3OA 1BGXT 3S6JA 5FP0A 7ICJA 4RNNA 3L4PA 3IN5A 1HIWA 4Z6FA 4IL6U 4Y2UA 3MABA 1FFUA 2XY6A 4F5PA 4GIBA 2OYYA 1FFVA 2HSZA 3T79A 2WF9A 4KLUA 4F5NA 2GLEA 5D4BA 1BPYA 1SKSA 1ZETA 4JV2A 4Y2XA 3T5JA 1ZQOA 4BUGA 1ZQEA 1ZQ1C 5ALUA 3UXNA 2QARA 4LJXA 4PZOA 3KHGA 3PMNA 3AL0B 4Y2PA 4QIWF 5KT6A 5DBBA 1S10A 2G08A 2FLNA 2F8KA 8ICZA 5DG8A 4RPXA 2JRZA 2MRLA 3FYHA 3TADC 3PW5A 4XUSA 3PV8A 3N97B 2HCFA 2FMSA 1ZJMA 5KFUA 2PFNA 2JXJA 2Q4TA 3MGVA 2C22A 1NJZA 1KQQA 1D8YA 1JRPA 5ALDA 4YMOA 3H0RB 4CRXA 1FEZA 2WTFA 2GWSA 2I5HA 2ZIWB 2LYBA 4QNLA 2IHMA 3OHBA 1UPHA 4I28A 3GIMA 5JTIA 1VLBA 2F8LA 3IV6A 3M8SA 3WKDA 3MGHA 4ECSA 2W8KA 1NK8A 5DG7A 5KFOA 4ACOA 2W9AA 5KFKA 4Z6DA 3SV4A 4F72A 2ZUDA 2KTQA 1J2NA 5DLGA 5ALPA 1U9LA 2Q0ZX 5AM4A 4DEZA 4GFJA 4US9A 1DK3A 3MC1A 9ICEA 3AMZA 3BQTA 2KJ9A 1H38A 4M9JA 5B66U 4J9RA 2R8JA 4UQGA 4C8NA 4Q44A 5KFCA 2WF7A 5J2FA 3G6VA 4ED1A 2HBKA 4P0PB 4M04A 5DBCA 1B22A 3WKBA 1S0VA 2BQUA 1K5OA 4XA5A 5KT4A 4Q8FA 1LVHA 4CDGA 3NUQA 4CF4A 5C5JA 2UVUA 3NVYA 2WF8A 4KLMA 1LKYB 1B43A 3N7SC 4EELA 2KSOA 1SL0A 3H8MA 4LZGA 3PW0A 3AQFA 4O3SA 5JUMA 5CA7A 3GIJA 1SV0C 2QARB 4FZLA 2HHXA 2ZUCA 1XS9D 1L3SA 1JUDA 1Z19A 1ZQVA 1A6SA 1NJXA 2C2EA 1DGSA 1RYUA 4EEKA 3T3FA 2XGPA 2CXYA 1A0PA 4DLGA 1TAUA 3QUTA 2IHNA 4RT2A 4GC7A 1L3TA 8ICAA 2KVCA 1YZ7A 1ZQBA 2AGPA 1TK0A 1ZQTA 2QKQA 2YY6A 2ISPA 3HJEA 4BXOB 3BDPA 1S0MA 3C5GA 3KKAA 9ICGA 2YMPA 5KT5A 7ICEA 5ALRA 2JGAA 4BGDA 2HOQA 3C1YA 4BX9C 4ZH4A 2E1FA 5CEHA 2JEIA 1N48A 2A1JA 3JPPA 3BS7A 5IIKA 3V6HA 5ALVA 2NYVA 5TZVA 5F9NA 5EE3A 2DQNB 1U45A 1Q3UA 3HILA 3Q8QB 4R64A 4Z6EA 4QZIA 3WKAA 4ECXA 3G6XA 4C8KA 4UB1A 2GH1A 4ECVA 2H3ZA 3F2DA 7ICSA 2HVHA 3HRDD 5DGBA 5J0PA 3OTQA 2R8KA 4PH5A 3NGDA 2MSNA 1JX4A 2KSOB 3QU4A 4Y2VA 2IMWP 3RB3A 3IG5A 4P4MA 4AYBC 2RDJA 3TFRA 2JEGA 5ALZA 2F2AB 2KK0A 1PK3A 3BS5A 4IR9A 2W9BB 2BCRA 4KN4A 1UQVA 5AI0A 4FBUA 1RYRA 4RNMA 2AXTU 2VJ4A 2NRTA 3TARA 3ED5A 2BZFA 1MSWD 5DG9A 4Y2TA 5AK3A 1T8EA 3ISBA 1ZQCA 2KZ3A 3GV5B 3UMCA 3QEBZ 2FMQA 7ICRA 5IINA 1T3NA 1ZQZA 4C7ZA 2D8CA 3PO4A 1F0MA 1IM4A 3E0FA 1X6JA 1N61A 5ALHA 4USAA 5KFVA 2HDOA 5KFLA 3RFAA 3FM9A 3GIKA 5J0OA 2C28A 8ICKA 3HKZF 2PFOA 8ICTA 2KMDA 2M0NA 3C1ZA 8ICNA 1V38A 3V6KA 4C4RA 4TUPA 3BS5B 3Q8MA 1S0NA 3LWLA 1COKA 1ZQNA 5IIJA 1XSPA 4F8RA 1KDHA 1M6YA 3KZIU 4ED8A 5KFXA 1Z00A 4YQWA 4C8LA 1BPDA 4DSKA 1KW4A 2C2DA 3OJUA 2P6UA 1N62A 2W54A 1SB3C 4P0QB 3H4DA 3CP8A 1ZQJA 2KHQA 4OJOA 4R8UA 5CWRA 4O3RA 2YB4A 4QZDA 5J2EA 4QZEA 3RH4A 2PKEA 5AIAA 4QIWC 4ICAA 4ED3A 2H3IA 4QW9A 1D8LA 4NLCA 2P35A 4ELTA 1QLNA 3RB0A 4ECUA 2W3SA 3B9JA 2ZTEA 1F5SA 4I2IA 5J29A 3UQ0A 1JALA 3WK9A 4F93B 3SV3A 3MR5A 3BZKA 3KBBA 4M47A 4JUZA 2DPIA 2G09A 1WWUA 1ZQHA 2R8HA 3EWAA 3PW4A 2RRDA 2BDPA 2XCPA 1U48A 9ICXA 5ALYA 3KD3A 1S76D 3M9OB 3MR6A 1XNSA 1RQNA 4J9QA 5L9XA 2G5IB 5KFHA 4M9HA 3TANA 4CCHA 3KFUF 3SENA 3I28A 2KIWA 4QWEA 2BHNA 4FE3A 4WJ3B 7ICGA 4U6PA 4DQSA 2PFQA 2BCQA 2HHWA 3GU3A 4C0ZA 3PW2A 3UXPA 5KNIA 5E79U 3KZXA 1N5WA 5KFMA 5J2HA 4QW8A 1T94A 5J2BA 4AYBF 1WUDA 4I2EA 3I1YA 1KTQA 3JPNA 5HHIA 1ZQYA 4GLXA 3GDXA 4TUQA 1JXEA 4J9SA 4M9NA 2WF5A 2ZXHA 1NZBA 1ZQDA 4QWAA 1QSLA 2DFLA 3PR5B 2FJ6A 2K8BB 3M1YA 5ALTA 5HNKA 3WK6A 1ZYQA 4ZOHC 2VKQA 2V4RA 1SWWA 1X40A 3H8JA 3NVVA 1MQ3A 2W11A 1B0XA 3RBEA 1HUOA 4TURA 4QZ8A 3B0XA 5J8YC 4JB3A 3QYPA 4RQ5A 5AK4A 4PGQA 1IXRA 1L5UA 2XIDA 7ICMA 4UASA 8ICGA 1SKWA 5J2DA 5J2JA 4KLDA 5DKWA 1OUQA 5B5EU 3IRUA 4DOCA 3RR7A 5L1LA 2HOFA 4MEYA 4ECRA 5ALFA 3V7JA 1WCLA 4I27A 5CJ7A 3PMLA 2ZTCA 1J2MA 2I1QA 8ICJA 4AP9A 1HEKA 2BPGA 1GO3F 2W04A 5EWEA 4GXJA 4F2SA 4C7YA 2VA3A 2MUTA 1KL9A 1Z1VA 1RDFA 3CNHA 3PW7A 3CW2C 5J2KA 4E0DA 2HBLA 4YR3A 2XY5A 4I2HA 3RR8A 3NS1A 2R18A 4UAWA 3F2BA 5IIMA 4DWIA 2BDUA 2KKPA 4DL7A 2WB1F 4I2DA 4KLSA 2HHTA 4TUSA 5ALJA 1KKXA 4YXJA 3RF9A 1NK4A 4PPXA 4Y2QA 4PHEA 1U49A 4NLBA 3RJIA 3QU9A 4DLEA 1Q8KA 5CB1A 3WK4A 2P6RA 4ED7A 2NRXA 5DDYA 4ED0A 3BQ0A 5D49A 2P66A 3SI8A 2IA6A 2OEHA 2OWOA 4C8MA 4DQQA 8ICXA 3TAPA 2KHVA 4Q43A 4EZ9A 5G5HA 1BNPA 1BPZA 5KT2A 4FZMA 8ICBA 2ZIVB 3RRHA 1LV5A 4ELUA 2ZIUB 1A76A 4KMOB 4P4OA 5EWGA 4B9LA 1DOQA 2QB1A 1ZD5A 1X9MA 3DV9A 2MUTB 4ECZA 4PHAA 4PL1A 7ICFA 7ICTA 4O3OA 3SR6A 4EBEA 3WK7A 3H8SA 4DFMA 5EE9A 1XO1A 2J6UA 2LKYA 3CYMA 2K4EA 1CEZA 3QUQA 1D9DA 2XICA 5AKJA 3LK9A 2W03A 4DL4A 4XQ8A 3JPOA 2XI9A 5KFZA 2DGZA 3ZDBA 2J6SA 1ZD2P 2K4IA 4US8A 3TFSA 4R65A 1ZQAA 1IV8A 3L3FX 5ALEA 5KL8B 4PGXA 2ATLA 4F92B 3GV7B 2KVSA 3Q8RB 1PK1A 3C2MA 7ICKA 4QZAA 4M9GA 1B4FA 3LVWA 2RQ5A 3FDSA 4OJPA 4UW9A 4KLFA 3IP4B 2ZTDA 5HHHA 5IIIA 1NK9A 4BDPA 4UARA 1X42A 1V9PA 4RUAA 3BQ2A 3E58A 3IDWA 4QZFA 1UA1A 4NLZA 3M9NB 5L1JA 2HHSA 4Z6CA 3K4GA 5H2FU 2DBYA 4I2CA 3HWTA 3PR4A 3BJYA 2ISOA 4IS7A 1IIPA 3SMVA 2FPKA 1N60A 8ICCA 1UT8A 4DSIA 2L5YA 3ISDA 1OXJA 1ZQPA 3N4MB 3WKEA 5D46A 4O5EA 4K4GA 5KFAA 2W55A 4NLKA 3ICXA 5AKEA 4I2GA 2HHVA 2HBJA 3PSIA 2ZXIA 2ZIXA 4J9LA 3D6JA 4UATA 5J0TA 2K4PA 4JWMA 2AH5A 5EWFA 2KV2A 9ICHA 4KN7A 4JV1A 1ZD4A 5JRTA 4DSJA 1L8LA 2KFNA 2HHQA 2LM1A 8ICOA 5AKLA 1PK1B 1ZQUA 5KG3A 2JMGA 8ICQA 1NZPA 3PSPA 1RPLA 2Y1IA 1SZPA 1NK6A 4RQ4A 2F1IA 2RLTA 2FLLA 1KLNA 1J97A 1T7PA 1NKCA 5DB7A 3UPQA 3FC4A 5EE0A 1QH9A 4FFDA 3FAHA 2F76X 3PX0A 5BOMA 1SXEA 2KN7A 5AI4A 2Y0SF 4KX3A 1UT5A 2E5SA 2HW3A 5AI8A 8ICUA 2JEFA 3MBYA 4DSLA 3KKAC 5BPCA 1L8OA 2LBOA 5IIOA 3TQ1A 1AROP 1Q46A 8ICMA 7ICPA 5J2IA 5AI9A 1ZQXA 5AM0A 5AK5A 5KG2A 4C4SA 3RBDA 3JPTA 4BJQA 4EYHB 4ECTA 4Y2SA 4EX6A 1N2XA 1ZQLA 2E8OA 3ISCA 3HKZC 3F5AA 2K8AA 1WCNA 1JXLA 3JPQA 2KZZA 3GV8B 4RT3A 5J2GA 4J9OA 4RPZA 2V4QA 3EPIA 4FO6A 4M9LA 4K4HA 3RAQA 5KG5A 4QWDA 2W7PA 4DF4A 2EZXA 4GXKA 5ALWA 3U26A 2WB1C 9ICLA 2KKVA 1TE2A 5ALGA 2I9GA 9ICKA 3ZDDA 3B0YA 3ORYA 4P0QA 3SAHA 4DOBA 5G5GA 4MEXA 2PI4A 9ICJA 3PSFA 4I2FA 4O5KA 2WF6A 2KP7A 3NTUA 2EQYA 4RQ3A 5KFBA 3OJSA 7ICUA 4RQ2A 3J81j 4DO9A 3F5EA 2ZJ8A 3WU2U 9ICPA 1RZTA 4YP3A 2OM6A 1TAQA 4MFCA 1IG6A 1SL1A 1ZQGA 1SWVA 5KFQA 4TQSA 3BQ7A 4F50A 3M6ZA 4KLTA 2V9WA 5KL1B 3KHRA 2C2RA 4NV0A 2EAPA 9ICVA 4IQVA 2O6KA 1NK5A 5J0UA 3NASA 1K1QA 1L3UA 1MC8A 2EZZA 5KFFA 4F4YA 3GILA 2JEJA 4KLHA 3RAXA 5AK6A 4RPYA 1U4BA 4K4IA 4IRCA 4UAZA 2ALZA 1N5XA 2G07A 3UM9A 4R8UB 1ZQKA 7ICLA 1TVAA 3TKAA 3N7RC 4MF2A 5AM5A 4FBTA 2KD1A 2BCVA 7ICHA 4CF5A 1X9WA 3ETLA 5DB8A 2LMRA 2KE7A 3RB4A 2EH9A 3T5HA 3KTQA 5KFGA 1DGJA 5ALIA 5KFTA 3H7IA 4EBDA 1TFRA 2DKXA 3RH6A 4UB3A 5DQHA 4QZBA 4M0AA 4UBCA 4BXOA 3M6KA 5J0YA 3THVA 3D2QA 3QU7A 3RJKA 2PMZC 4Q45A 2BCUA 2A1AA 3TADA 4RQ7A 4F2RA 2QB0A 1QSSA 4NLNA 2BPCA 2J6TA 1DK2A 4UBBA 5EE1A 1NJYA 4BWJA 5CP2A 3SAGA 9ICCA 4Y2YA 2H5XA 4C8OA 4O3NA 3KHHA 2VA8A 2FI1A 3H0LB 2W9CB 3IG8A 1A77A 3RJEA 2AQ0A 4MFFA 4B9VA 1PVPA 3EW9A 2VJ5A 3N7PD 1BNOA 2DKZA 4EYIB 4CGZA 4YCXA 1ZRNA 1EXNA 3OPXA 1X9SA 7ICNA 3ZDAA 2OHFA 4B9NA 2N1RA 4F5OA 5L1MA 1KEJA 2F1JA 2DF4B 5JU5A 2ESEA 1X2IA 1DRGA 5F9LA 1KFTA 3V7KA 2JZBB 4DS4A 4B9TA 3K1ZA 2F3NA 2D6FC 4Y2JA 5AKZA 1NOMA 5ALQA 2Y9UA 4NL9A 9ICRA 4YR0A 4J03A 2H3FA 2JHDA 3R9KA 2DL0A 2FPMA 4Y2RA 1CRXA 1Z00B 1QTMA 5KFWA 3ZDCA 2W43A 1MN8A 4C4TA 4TQRA 3AUOA 3CRXA 3EPGA 2W9MA 4P0PA 3HP6A 1ECWA 4X5VA 1PVRA 4RNOA 3K75D 4NM1A 2LHTA 4J9NA 1AQ6A 1VJ5A 4O3QA 1YT3A 3RTVA 9ICBA 4U7CA 3RJGA 2B21A 4EENA 9ICOA 5TISU 4C80A 1KFSA 5EOZA 3T5KA 4O3MA 1WYGA 1L7PA 4DS5A 1RM6C 1S9FA 5GTHU 1TAMA 4DQPA 1TK8A 1UCVA 4MHVA 2ZIUA 4DL3A 3MGIA 2ES6A 1XSLA 4UB4A 3HPOA 1S97A 4YG2A 2YN4A 4A8EA 5L1IA 2ZJ5A 5KG4A 2MAXA 1JN3A 2ASLA 4PJ0U 5HR6A 5KG7A 5J0WA 1KSPA 2JV3A 8ICRA 2AGQA 3QXGA 1Y88A 5ALLA 5DB9A 4RQ0A 3OGUA 1QQ7A 4DOAA 3HT3A 5KFNA 3SYZA 3V7LA 3QE9Y 1WWVA 1T4GA 4XRHA 1PUZA 1S8OA 3O0FA 1FO4A 8ICFA 1NJWA 2OCEA 9ICIA 4IQTA 2Z7JA 1OW5A 3NVWA 3QZ7A 2IOHA 4BWMA 2HBMA 3N28A 2DUYA 3SQIA 4ED6A 4JK1A 4NXZA 4YD1A 3EUB2 4KLGA 4KLOA 4NLGA 4YMNA 1X9XA 5DGAA 5AIBA 2KOBA 3IHQB 3AM9A 4QWBA 4CE6A 3F2CA 2IOFK 4NM2A 2AU0A 4B9MA 3QEAZ 1SKRA 3ZD9A 2UVWA 3AEVA 4YXMA 5KFSA 2XVTA 4I2BA 2A1JB 3H4BA 5J2CA 1BPEA 3ZDEA 3RB6A 5KFIA 3HX0A 5AICA 1CUKA 3PO5A 1ZJNA 2K60A 4DCCA 2AQ4A 4M6WA 2JZBA 2QLTA 2UVVA 2E8NA 1XU4A 5J2AA 4RU9A 8ICYA 4JWNA 2Y0SC 1X6IA 4UB5A 4M6WB 4KITB 3DEEA 5AKXA 3AU2A 5J0QA 9ICAA 5KFDA 1D9FA 3KOOA 4DQRA 4EZ6A 2K8CB 2HOIA 2E8MA 5KG6A 2CN1A 2A3VA 1RG6A 4OCZA 2OXOA 3QNMA 2KIVA 2FPLA 4P4PA 1ZQIA 4F5QA 8ICEA 3OSNA 2AGOA 4DF8A 2W8LA 3I76A 3TI0A 1QSYA 7ICIA 1U47A 1SZHA 3VC8A 4DSFA 4Q8EA 3JPRA 3SAFA 4R66A 4KLEA 5ALXA 1PVQA 2EANA 2AHOB 5ALMA 1L7MA 5AKYA 2VIXA 4KLLA 3PNCA 4UB6U 5ALNA 2G5HB 4R63A 4UB8U 1S5LU 3AN1A 1UA0A 4NJ8A 8ICWA 2K4HA 2KZMA 2ZIXB 3MR2A 3UQ2A 5AI6A 5AKHA 1O08A 1PZNA 5HMLA 4F4ZA 2KICA 4KLQA 2LPEA 3WK8A 4OO1J 4ECQA 1Z1BA 4YVZA 2W7OA 3BQ1A 2MA1A 4F71A 4HYKA 4DQIA 4EEYA 3LDAA 4MFAA 1TK5A 7ICOA 4YMMA 5DQGA 2GOLA 3UMGA 3A0BU 1TKDA 2ZIVA 2LI6A 3AQEA 4JMUA 2A19A 3RH5A 2ASDA 3QUBA 3C2LA 1ZXIA 2JR5A 4J9MA 1UHUA 2UVRA 1BVSA 3UXOA 2IBKA 5HR7A 4JV0A 1O03A 2YTUA 2RDIA 3GQCA 5CHGA 3RJHA 2KNJA 1RQLA 2WAQF 1NKBA 2GO7A 1Z4NA 1SV0A 2NRVA 4NL9C 1BPXA 1ZQQA 5KTQA 1L3VA 4EX7A 4B9UA 1Z3EB 3QX7A 4IQUA 9ICUA 1Q3VA 8ICVA 4YD2A 2PXIA 5KT3A 1ZQRA 4DL6A 8ICSA 2R8IA 3HW8A 2IOFA 1ZD3A 4B9SA 3M7DA 9ICSA 4O0IA 2PI5A 3PVXA 2PMZF 3OSPA 5KFEA 1URJA 4OJ6A 2KJ8A 4YR2A 2WHEA 3NRWA 4ECYA 2W9CA 1COOA 1ZOLA 4F4WA 8ICIA 5KAFU 3LWMA 9ICMA 3V6JA 5DDMA 1MQ2A 2BQRA 2JH7A 4B6JA 4IRKA 2D3DA 1WG8A 5KAIU 2NO4A 5KFPA 1KN5A 3C21A 4KLIA 3MFHA 5ALKA 4ELVA 4FS1A 2EAOA 2XCAA 1L6NA 4QJFB 2FLPA 3Q8LA 4DFKA 4P2HA 2ASJA 4ED2A 3PX6A 1XSNA 1FIQA 4J9PA 3V72A 4RQMA 3TAQA 4RZRA 3Q8PB 2VANA 2EZYA 1RXWA 1ZQSA 4PHPA 3WK5A 4ECWA 4CNQA 1SGGA 5HP4A 2M9NA 3LVVA 3ETRA 1HUZA 2YMMA 1P7DA 2ZJAA 4KTQA 1T3QA 4I2JA 4FZNA 4QZHA 2H3QA 3RJFA 5DLFA 1ZQMA 5AHXA 2BGWA 1ZQFA 5KG0A 4FS2A 2QB0B 2KEYA 3Q8SB 4UAVA 1DXSA 1C7YA 3BZCA 4IC9A 5AM1A 5KFYA 1NI3A 1S77D 2BR0A 3PSTA 1VDVA 1NKEA 1JI7A 3SEIA 5AM2A 4YN4A 2G0AA 1L7NA 5DQIA 3QU2A 4UAUA 4UB2A 2BPFA 1KRPA 3Q8KA 1XO0A 4EBCA 2RP5A 4PHDA 1ED1A 5L1KA 3QU5A 3TACB 2BQ3A 2KFZA 2AJQA 2HMXA 5AKIA 2DWQA 3LYSA 3L5KA 5KT7A 1X66A 3GIIA 3GZFA 4QZ9A 2YX8A 5KFRA 2E8PA 3JPSA 2XO7A 8ICHA 4GC6A 1QQ6A 8ICLA 3EZ5A 1SXDA 5J8YA 3PY8A 3K1RB 2Y9TA 3PZPA 3SD7A 3QZ8A 3RJJA 2ODGA 3MDCA 3QUCA 3VCBA 2NO5A 4DL5A 2YMQA 3NVZA 2NRWA 5T14A 2H3VA 3ZI4A 3MFIA 3C2KA 2LYHA 4IRDA 1NNLA 4QZGA 4RQ6A 3M9MB 2B6GA 2FDRA 2JH1A 1LKYA 4OJ5A 1JMSA 2R8GA 4CF3A 2CPRA 4DFDA 9ICQA 5F3XB 2CRXA 1MA7A 2OH2A 3UMBA 4PZNA 4O9MA 1ZRMA 2ZG6A 5J0SA 5AKGA 2YB1A 4KLJA 4F5RA 5J0XA 3WKCA 1C20A 3ZD8A 4LZDA 2YMLA 2WFAA 2F44A 2E1EA 1S0OA 3D2NA 2KJ5A 2HVIA 4O3PA 1JIHA 2YQEA 4PGYA 3OHAA 9ICTA 3ONNA 4NWIA 4RQ1A 1F44A 5A0LA 1Z4OA 5AI5A 2W3RA 1XC9A 2LM4A 3E2EA 3MR3A 1SIJA 4F4XA 3H40A 2DPJA 4KMUA 1YZ6A 4OD0A 1XWLA 4IR1A 5J0RA 4G9BA 5DBAA 4DFJA 3D2SA 2EDUA 5KG1A 4F91B 4G3IA 5KFJA 4OJLA 2EAMA 3T5LA 4IQWA 2LYAA 4RQNA 7ICVA 2XGQA 4DSEA 9ICNA 3SZ2A 4MF8A 3GFKB 2XY7A 5CR0A 3C5FA 1N63A 3IM1A 5HMMA 1D8BA 4HAIA
chains in the Genus database with same CATH topology
4JMUA 2G5IB 3L3FX 3VCBA 3M6ZA 5KL8B 3IN5A 1HIWA 2JGAA 1PVPA 3RFAA 5KL1B 2HOQA 4NV0A 4BX9C 3KFUF 5T14A 1TAMA 1HEKA 2E1FA 2H3VA 2VJ5A 3N7PD 2KIWA 1GO3F 2ZIUA 3HKZF 2F76X 2Y0SC 2M0NA 2W04A 4CGZA 2OYYA 3OPXA 3LVWA 2HBKA 4FE3A 2JH1A 2Y0SF 4KX3A 3DEEA 4A8EA 4U6PA 3T79A 4P0PB 4OJ5A 5CRXA 2E5SA 4WJ3B 5HR7A 2CPRA 4OJPA 2CRXA 5HR6A 2NV3A 1MA7A 3IP4B 2OH2A 2N1RA 2ZIWA 2DQNB 3GU3A 3LVVA 2HBLA 4C0ZA 1Q3UA 2KNJA 2DF4B 2LBOA 1P7DA 2K8CB 2HOIA 2WAQF 2R18A 3F2BA 2G07A 2K89A 2ZG6A 4BUGA 4CDGA 3KZXA 3NUQA 2BDUA 1ZQ1C 2CN1A 2KKPA 2WB1F 2YB1A 4FZNA 1F44A 2A3VA 2H3QA 1DRGA 1T94A 3AL0B 4P0QB 4PL2A 2OXOA 3CP8A 4QIWF 4AYBF 2GH1A 4BJQA 1WUDA 2G08A 2KHQA 3N7SC 3N7RC 3RF9A 2H3ZA 4OJOA 3F2DA 4NLBA 2E1EA 2MRLA 2F77X 2KD1A 2YB4A 3D2NA 2KJ5A 1Q3VA 2KEYA 3HKZC 3F5AA 2ZXHA 3O0FA 3ONNA 3K1ZA 2K8AA 3IG5A 3AQFA 4NWIA 3H0MB 3ALRA 4AYBC 5A0LA 1IIPA 3C29A 4QIWC 2Z7JA 1NZBA 2D6FC 4IC9A 3SMVA 1KBUA 4ICAA 2Q4TA 2H3IA 3MGVA 3PSTA 1SZHA 3VC8A 2F2AB 4NLCA 2K8BB 3H0RB 3C28A 4KX5A 4CRXA 2HBMA 4FZLA 3SAFA 2W7PA 2H3FA 2JHDA 2G0AA 3ICXA 3M7DA 2ZIWB 3SQIA 1PVQA 2LYBA 4QNLA 2VKQA 2HBJA 2VJ4A 3PSIA 1UPHA 2KHVA 2WB1C 1Z19A 1CRXA 2PMZF 2ZXIA 2VIXA 3M6KA 1URJA 2KKVA 2KOBA 2ZIXA 3D2QA 1A6SA 2F8LA 4FZMA 4OJ6A 2PMZC 2G5HB 2KJ8A 2ZIVB 1XO0A 2RP5A 3D2SA 3NRWA 3F2CA 1ED1A 2ZIUB 4KMOB 4P0QA 3SAHA 2KV2A 3CRXA 3PSFA 1A0PA 4OJLA 4ACOA 2K4HA 4P0PA 2WAQC 3F53A 1ECWA 4PL1A 2LYAA 2ZIXB 1PVRA 5C0YA 2LHTA 2JH7A 2HMXA 2XIDA 2XVTA 2G09A 1YT3A 3F5EA 2KICA 2KVCA 3LYSA 3SAGA 2JMGA 2LKYA 3CYMA 3PSPA 2RRDA 2K4EA 4U7CA 1OUQA 4OO1J 1Z1BA 2OM6A 3GZFA 4GFJA 2W7OA 2YX8A 2XICA 2G06A 2RHFA 2W03A 2MA1A 2HOFA 2XI9A 4O3MA 2DGZA 1L6NA 4QJFB 2GOLA 2K4IA 3E0FA 2KJ9A 3H0LB 3IG8A 1D8BA 2ZIVA 1XNSA 3PZPA 3AQEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WAQ F;  2PMZ F;  2Y0S F;  3HKZ F;  4AYB F;  2WB1 F; 
#chains in the Genus database with same CATH topology
 2E3T A;  1RYS A;  1QCK A;  2PFP A;  4YFK A;  5AM3 A;  5DB6 A;  5ALO A;  3AU6 A;  4I2A A;  3RRG A;  2BCS A;  2W9B A;  1LB2 B;  1RXV A;  5CRX A;  2XC9 A;  3MDA A;  4LVS A;  2NV3 A;  3G6Y A;  1CI4 A;  4UAY A;  2ZIW A;  2MU2 A;  2K89 A;  1ZQW A;  5ALS A;  3PX4 A;  1JRO A;  4O5C A;  2BKE A;  3C23 A;  4PL2 A;  3KHL A;  3H8W A;  1BPB A;  1QQ5 A;  4RQ8 A;  2F77 X;  4RUC A;  1N56 A;  9ICW A;  2VA2 A;  3H0M B;  3ALR A;  3C29 A;  1SL2 A;  2FMP A;  1KBU A;  2B0C A;  1TV9 A;  5AKK A;  2NRZ A;  4GXI A;  2F1H A;  4J9K A;  3C28 A;  4KX5 A;  4QZC A;  1NK0 A;  4F4K A;  4M2Y A;  3DDH A;  3A0H U;  4QWC A;  1V97 A;  2HHU A;  2HI0 A;  4DFP A;  2KG5 A;  1NK7 A;  4I29 A;  9ICF A;  5GTI U;  4DL2 A;  1HJP A;  1V85 A;  2Y1J A;  2WAQ C;  5IIL A;  3F53 A;  2FE9 A;  5C0Y A;  5BOL A;  5K4L A;  2ZUB A;  2I6X A;  1L7O A;  4NY8 A;  7ICQ A;  1KFD A;  1K1S A;  2G06 A;  3M8R A;  2RHF A;  8ICP A;  1SV4 A;  3EYZ A;  3NRZ A;  4F3O A;  1BGX T;  3S6J A;  5FP0 A;  7ICJ A;  4RNN A;  3L4P A;  3IN5 A;  1HIW A;  4Z6F A;  4IL6 U;  4Y2U A;  3MAB A;  1FFU A;  2XY6 A;  4F5P A;  4GIB A;  2OYY A;  1FFV A;  2HSZ A;  3T79 A;  2WF9 A;  4KLU A;  4F5N A;  2GLE A;  5D4B A;  1BPY A;  1SKS A;  1ZET A;  4JV2 A;  4Y2X A;  3T5J A;  1ZQO A;  4BUG A;  1ZQE A;  1ZQ1 C;  5ALU A;  3UXN A;  2QAR A;  4LJX A;  4PZO A;  3KHG A;  3PMN A;  3AL0 B;  4Y2P A;  4QIW F;  5KT6 A;  5DBB A;  1S10 A;  2G08 A;  2FLN A;  2F8K A;  8ICZ A;  5DG8 A;  4RPX A;  2JRZ A;  2MRL A;  3FYH A;  3TAD C;  3PW5 A;  4XUS A;  3PV8 A;  3N97 B;  2HCF A;  2FMS A;  1ZJM A;  5KFU A;  2PFN A;  2JXJ A;  2Q4T A;  3MGV A;  2C22 A;  1NJZ A;  1KQQ A;  1D8Y A;  1JRP A;  5ALD A;  4YMO A;  3H0R B;  4CRX A;  1FEZ A;  2WTF A;  2GWS A;  2I5H A;  2ZIW B;  2LYB A;  4QNL A;  2IHM A;  3OHB A;  1UPH A;  4I28 A;  3GIM A;  5JTI A;  1VLB A;  2F8L A;  3IV6 A;  3M8S A;  3WKD A;  3MGH A;  4ECS A;  2W8K A;  1NK8 A;  5DG7 A;  5KFO A;  4ACO A;  2W9A A;  5KFK A;  4Z6D A;  3SV4 A;  4F72 A;  2ZUD A;  2KTQ A;  1J2N A;  5DLG A;  5ALP A;  1U9L A;  2Q0Z X;  5AM4 A;  4DEZ A;  4GFJ A;  4US9 A;  1DK3 A;  3MC1 A;  9ICE A;  3AMZ A;  3BQT A;  2KJ9 A;  1H38 A;  4M9J A;  5B66 U;  4J9R A;  2R8J A;  4UQG A;  4C8N A;  4Q44 A;  5KFC A;  2WF7 A;  5J2F A;  3G6V A;  4ED1 A;  2HBK A;  4P0P B;  4M04 A;  5DBC A;  1B22 A;  3WKB A;  1S0V A;  2BQU A;  1K5O A;  4XA5 A;  5KT4 A;  4Q8F A;  1LVH A;  4CDG A;  3NUQ A;  4CF4 A;  5C5J A;  2UVU A;  3NVY A;  2WF8 A;  4KLM A;  1LKY B;  1B43 A;  3N7S C;  4EEL A;  2KSO A;  1SL0 A;  3H8M A;  4LZG A;  3PW0 A;  3AQF A;  4O3S A;  5JUM A;  5CA7 A;  3GIJ A;  1SV0 C;  2QAR B;  4FZL A;  2HHX A;  2ZUC A;  1XS9 D;  1L3S A;  1JUD A;  1Z19 A;  1ZQV A;  1A6S A;  1NJX A;  2C2E A;  1DGS A;  1RYU A;  4EEK A;  3T3F A;  2XGP A;  2CXY A;  1A0P A;  4DLG A;  1TAU A;  3QUT A;  2IHN A;  4RT2 A;  4GC7 A;  1L3T A;  8ICA A;  2KVC A;  1YZ7 A;  1ZQB A;  2AGP A;  1TK0 A;  1ZQT A;  2QKQ A;  2YY6 A;  2ISP A;  3HJE A;  4BXO B;  3BDP A;  1S0M A;  3C5G A;  3KKA A;  9ICG A;  2YMP A;  5KT5 A;  7ICE A;  5ALR A;  2JGA A;  4BGD A;  2HOQ A;  3C1Y A;  4BX9 C;  4ZH4 A;  2E1F A;  5CEH A;  2JEI A;  1N48 A;  2A1J A;  3JPP A;  3BS7 A;  5IIK A;  3V6H A;  5ALV A;  2NYV A;  5TZV A;  5F9N A;  5EE3 A;  2DQN B;  1U45 A;  1Q3U A;  3HIL A;  3Q8Q B;  4R64 A;  4Z6E A;  4QZI A;  3WKA A;  4ECX A;  3G6X A;  4C8K A;  4UB1 A;  2GH1 A;  4ECV A;  2H3Z A;  3F2D A;  7ICS A;  2HVH A;  3HRD D;  5DGB A;  5J0P A;  3OTQ A;  2R8K A;  4PH5 A;  3NGD A;  2MSN A;  1JX4 A;  2KSO B;  3QU4 A;  4Y2V A;  2IMW P;  3RB3 A;  3IG5 A;  4P4M A;  4AYB C;  2RDJ A;  3TFR A;  2JEG A;  5ALZ A;  2F2A B;  2KK0 A;  1PK3 A;  3BS5 A;  4IR9 A;  2W9B B;  2BCR A;  4KN4 A;  1UQV A;  5AI0 A;  4FBU A;  1RYR A;  4RNM A;  2AXT U;  2VJ4 A;  2NRT A;  3TAR A;  3ED5 A;  2BZF A;  1MSW D;  5DG9 A;  4Y2T A;  5AK3 A;  1T8E A;  3ISB A;  1ZQC A;  2KZ3 A;  3GV5 B;  3UMC A;  3QEB Z;  2FMQ A;  7ICR A;  5IIN A;  1T3N A;  1ZQZ A;  4C7Z A;  2D8C A;  3PO4 A;  1F0M A;  1IM4 A;  3E0F A;  1X6J A;  1N61 A;  5ALH A;  4USA A;  5KFV A;  2HDO A;  5KFL A;  3RFA A;  3FM9 A;  3GIK A;  5J0O A;  2C28 A;  8ICK A;  3HKZ F;  2PFO A;  8ICT A;  2KMD A;  2M0N A;  3C1Z A;  8ICN A;  1V38 A;  3V6K A;  4C4R A;  4TUP A;  3BS5 B;  3Q8M A;  1S0N A;  3LWL A;  1COK A;  1ZQN A;  5IIJ A;  1XSP A;  4F8R A;  1KDH A;  1M6Y A;  3KZI U;  4ED8 A;  5KFX A;  1Z00 A;  4YQW A;  4C8L A;  1BPD A;  4DSK A;  1KW4 A;  2C2D A;  3OJU A;  2P6U A;  1N62 A;  2W54 A;  1SB3 C;  4P0Q B;  3H4D A;  3CP8 A;  1ZQJ A;  2KHQ A;  4OJO A;  4R8U A;  5CWR A;  4O3R A;  2YB4 A;  4QZD A;  5J2E A;  4QZE A;  3RH4 A;  2PKE A;  5AIA A;  4QIW C;  4ICA A;  4ED3 A;  2H3I A;  4QW9 A;  1D8L A;  4NLC A;  2P35 A;  4ELT A;  1QLN A;  3RB0 A;  4ECU A;  2W3S A;  3B9J A;  2ZTE A;  1F5S A;  4I2I A;  5J29 A;  3UQ0 A;  1JAL A;  3WK9 A;  4F93 B;  3SV3 A;  3MR5 A;  3BZK A;  3KBB A;  4M47 A;  4JUZ A;  2DPI A;  2G09 A;  1WWU A;  1ZQH A;  2R8H A;  3EWA A;  3PW4 A;  2RRD A;  2BDP A;  2XCP A;  1U48 A;  9ICX A;  5ALY A;  3KD3 A;  1S76 D;  3M9O B;  3MR6 A;  1XNS A;  1RQN A;  4J9Q A;  5L9X A;  2G5I B;  5KFH A;  4M9H A;  3TAN A;  4CCH A;  3KFU F;  3SEN A;  3I28 A;  2KIW A;  4QWE A;  2BHN A;  4FE3 A;  4WJ3 B;  7ICG A;  4U6P A;  4DQS A;  2PFQ A;  2BCQ A;  2HHW A;  3GU3 A;  4C0Z A;  3PW2 A;  3UXP A;  5KNI A;  5E79 U;  3KZX A;  1N5W A;  5KFM A;  5J2H A;  4QW8 A;  1T94 A;  5J2B A;  4AYB F;  1WUD A;  4I2E A;  3I1Y A;  1KTQ A;  3JPN A;  5HHI A;  1ZQY A;  4GLX A;  3GDX A;  4TUQ A;  1JXE A;  4J9S A;  4M9N A;  2WF5 A;  2ZXH A;  1NZB A;  1ZQD A;  4QWA A;  1QSL A;  2DFL A;  3PR5 B;  2FJ6 A;  2K8B B;  3M1Y A;  5ALT A;  5HNK A;  3WK6 A;  1ZYQ A;  4ZOH C;  2VKQ A;  2V4R A;  1SWW A;  1X40 A;  3H8J A;  3NVV A;  1MQ3 A;  2W11 A;  1B0X A;  3RBE A;  1HUO A;  4TUR A;  4QZ8 A;  3B0X A;  5J8Y C;  4JB3 A;  3QYP A;  4RQ5 A;  5AK4 A;  4PGQ A;  1IXR A;  1L5U A;  2XID A;  7ICM A;  4UAS A;  8ICG A;  1SKW A;  5J2D A;  5J2J A;  4KLD A;  5DKW A;  1OUQ A;  5B5E U;  3IRU A;  4DOC A;  3RR7 A;  5L1L A;  2HOF A;  4MEY A;  4ECR A;  5ALF A;  3V7J A;  1WCL A;  4I27 A;  5CJ7 A;  3PML A;  2ZTC A;  1J2M A;  2I1Q A;  8ICJ A;  4AP9 A;  1HEK A;  2BPG A;  1GO3 F;  2W04 A;  5EWE A;  4GXJ A;  4F2S A;  4C7Y A;  2VA3 A;  2MUT A;  1KL9 A;  1Z1V A;  1RDF A;  3CNH A;  3PW7 A;  3CW2 C;  5J2K A;  4E0D A;  2HBL A;  4YR3 A;  2XY5 A;  4I2H A;  3RR8 A;  3NS1 A;  2R18 A;  4UAW A;  3F2B A;  5IIM A;  4DWI A;  2BDU A;  2KKP A;  4DL7 A;  2WB1 F;  4I2D A;  4KLS A;  2HHT A;  4TUS A;  5ALJ A;  1KKX A;  4YXJ A;  3RF9 A;  1NK4 A;  4PPX A;  4Y2Q A;  4PHE A;  1U49 A;  4NLB A;  3RJI A;  3QU9 A;  4DLE A;  1Q8K A;  5CB1 A;  3WK4 A;  2P6R A;  4ED7 A;  2NRX A;  5DDY A;  4ED0 A;  3BQ0 A;  5D49 A;  2P66 A;  3SI8 A;  2IA6 A;  2OEH A;  2OWO A;  4C8M A;  4DQQ A;  8ICX A;  3TAP A;  2KHV A;  4Q43 A;  4EZ9 A;  5G5H A;  1BNP A;  1BPZ A;  5KT2 A;  4FZM A;  8ICB A;  2ZIV B;  3RRH A;  1LV5 A;  4ELU A;  2ZIU B;  1A76 A;  4KMO B;  4P4O A;  5EWG A;  4B9L A;  1DOQ A;  2QB1 A;  1ZD5 A;  1X9M A;  3DV9 A;  2MUT B;  4ECZ A;  4PHA A;  4PL1 A;  7ICF A;  7ICT A;  4O3O A;  3SR6 A;  4EBE A;  3WK7 A;  3H8S A;  4DFM A;  5EE9 A;  1XO1 A;  2J6U A;  2LKY A;  3CYM A;  2K4E A;  1CEZ A;  3QUQ A;  1D9D A;  2XIC A;  5AKJ A;  3LK9 A;  2W03 A;  4DL4 A;  4XQ8 A;  3JPO A;  2XI9 A;  5KFZ A;  2DGZ A;  3ZDB A;  2J6S A;  1ZD2 P;  2K4I A;  4US8 A;  3TFS A;  4R65 A;  1ZQA A;  1IV8 A;  3L3F X;  5ALE A;  5KL8 B;  4PGX A;  2ATL A;  4F92 B;  3GV7 B;  2KVS A;  3Q8R B;  1PK1 A;  3C2M A;  7ICK A;  4QZA A;  4M9G A;  1B4F A;  3LVW A;  2RQ5 A;  3FDS A;  4OJP A;  4UW9 A;  4KLF A;  3IP4 B;  2ZTD A;  5HHH A;  5III A;  1NK9 A;  4BDP A;  4UAR A;  1X42 A;  1V9P A;  4RUA A;  3BQ2 A;  3E58 A;  3IDW A;  4QZF A;  1UA1 A;  4NLZ A;  3M9N B;  5L1J A;  2HHS A;  4Z6C A;  3K4G A;  5H2F U;  2DBY A;  4I2C A;  3HWT A;  3PR4 A;  3BJY A;  2ISO A;  4IS7 A;  1IIP A;  3SMV A;  2FPK A;  1N60 A;  8ICC A;  1UT8 A;  4DSI A;  2L5Y A;  3ISD A;  1OXJ A;  1ZQP A;  3N4M B;  3WKE A;  5D46 A;  4O5E A;  4K4G A;  5KFA A;  2W55 A;  4NLK A;  3ICX A;  5AKE A;  4I2G A;  2HHV A;  2HBJ A;  3PSI A;  2ZXI A;  2ZIX A;  4J9L A;  3D6J A;  4UAT A;  5J0T A;  2K4P A;  4JWM A;  2AH5 A;  5EWF A;  2KV2 A;  9ICH A;  4KN7 A;  4JV1 A;  1ZD4 A;  5JRT A;  4DSJ A;  1L8L A;  2KFN A;  2HHQ A;  2LM1 A;  8ICO A;  5AKL A;  1PK1 B;  1ZQU A;  5KG3 A;  2JMG A;  8ICQ A;  1NZP A;  3PSP A;  1RPL A;  2Y1I A;  1SZP A;  1NK6 A;  4RQ4 A;  2F1I A;  2RLT A;  2FLL A;  1KLN A;  1J97 A;  1T7P A;  1NKC A;  5DB7 A;  3UPQ A;  3FC4 A;  5EE0 A;  1QH9 A;  4FFD A;  3FAH A;  2F76 X;  3PX0 A;  5BOM A;  1SXE A;  2KN7 A;  5AI4 A;  2Y0S F;  4KX3 A;  1UT5 A;  2E5S A;  2HW3 A;  5AI8 A;  8ICU A;  2JEF A;  3MBY A;  4DSL A;  3KKA C;  5BPC A;  1L8O A;  2LBO A;  5IIO A;  3TQ1 A;  1ARO P;  1Q46 A;  8ICM A;  7ICP A;  5J2I A;  5AI9 A;  1ZQX A;  5AM0 A;  5AK5 A;  5KG2 A;  4C4S A;  3RBD A;  3JPT A;  4BJQ A;  4EYH B;  4ECT A;  4Y2S A;  4EX6 A;  1N2X A;  1ZQL A;  2E8O A;  3ISC A;  3HKZ C;  3F5A A;  2K8A A;  1WCN A;  1JXL A;  3JPQ A;  2KZZ A;  3GV8 B;  4RT3 A;  5J2G A;  4J9O A;  4RPZ A;  2V4Q A;  3EPI A;  4FO6 A;  4M9L A;  4K4H A;  3RAQ A;  5KG5 A;  4QWD A;  2W7P A;  4DF4 A;  2EZX A;  4GXK A;  5ALW A;  3U26 A;  2WB1 C;  9ICL A;  2KKV A;  1TE2 A;  5ALG A;  2I9G A;  9ICK A;  3ZDD A;  3B0Y A;  3ORY A;  4P0Q A;  3SAH A;  4DOB A;  5G5G A;  4MEX A;  2PI4 A;  9ICJ A;  3PSF A;  4I2F A;  4O5K A;  2WF6 A;  2KP7 A;  3NTU A;  2EQY A;  4RQ3 A;  5KFB A;  3OJS A;  7ICU A;  4RQ2 A;  3J81 j;  4DO9 A;  3F5E A;  2ZJ8 A;  3WU2 U;  9ICP A;  1RZT A;  4YP3 A;  2OM6 A;  1TAQ A;  4MFC A;  1IG6 A;  1SL1 A;  1ZQG A;  1SWV A;  5KFQ A;  4TQS A;  3BQ7 A;  4F50 A;  3M6Z A;  4KLT A;  2V9W A;  5KL1 B;  3KHR A;  2C2R A;  4NV0 A;  2EAP A;  9ICV A;  4IQV A;  2O6K A;  1NK5 A;  5J0U A;  3NAS A;  1K1Q A;  1L3U A;  1MC8 A;  2EZZ A;  5KFF A;  4F4Y A;  3GIL A;  2JEJ A;  4KLH A;  3RAX A;  5AK6 A;  4RPY A;  1U4B A;  4K4I A;  4IRC A;  4UAZ A;  2ALZ A;  1N5X A;  2G07 A;  3UM9 A;  4R8U B;  1ZQK A;  7ICL A;  1TVA A;  3TKA A;  3N7R C;  4MF2 A;  5AM5 A;  4FBT A;  2KD1 A;  2BCV A;  7ICH A;  4CF5 A;  1X9W A;  3ETL A;  5DB8 A;  2LMR A;  2KE7 A;  3RB4 A;  2EH9 A;  3T5H A;  3KTQ A;  5KFG A;  1DGJ A;  5ALI A;  5KFT A;  3H7I A;  4EBD A;  1TFR A;  2DKX A;  3RH6 A;  4UB3 A;  5DQH A;  4QZB A;  4M0A A;  4UBC A;  4BXO A;  3M6K A;  5J0Y A;  3THV A;  3D2Q A;  3QU7 A;  3RJK A;  2PMZ C;  4Q45 A;  2BCU A;  2A1A A;  3TAD A;  4RQ7 A;  4F2R A;  2QB0 A;  1QSS A;  4NLN A;  2BPC A;  2J6T A;  1DK2 A;  4UBB A;  5EE1 A;  1NJY A;  4BWJ A;  5CP2 A;  3SAG A;  9ICC A;  4Y2Y A;  2H5X A;  4C8O A;  4O3N A;  3KHH A;  2VA8 A;  2FI1 A;  3H0L B;  2W9C B;  3IG8 A;  1A77 A;  3RJE A;  2AQ0 A;  4MFF A;  4B9V A;  1PVP A;  3EW9 A;  2VJ5 A;  3N7P D;  1BNO A;  2DKZ A;  4EYI B;  4CGZ A;  4YCX A;  1ZRN A;  1EXN A;  3OPX A;  1X9S A;  7ICN A;  3ZDA A;  2OHF A;  4B9N A;  2N1R A;  4F5O A;  5L1M A;  1KEJ A;  2F1J A;  2DF4 B;  5JU5 A;  2ESE A;  1X2I A;  1DRG A;  5F9L A;  1KFT A;  3V7K A;  2JZB B;  4DS4 A;  4B9T A;  3K1Z A;  2F3N A;  2D6F C;  4Y2J A;  5AKZ A;  1NOM A;  5ALQ A;  2Y9U A;  4NL9 A;  9ICR A;  4YR0 A;  4J03 A;  2H3F A;  2JHD A;  3R9K A;  2DL0 A;  2FPM A;  4Y2R A;  1CRX A;  1Z00 B;  1QTM A;  5KFW A;  3ZDC A;  2W43 A;  1MN8 A;  4C4T A;  4TQR A;  3AUO A;  3CRX A;  3EPG A;  2W9M A;  4P0P A;  3HP6 A;  1ECW A;  4X5V A;  1PVR A;  4RNO A;  3K75 D;  4NM1 A;  2LHT A;  4J9N A;  1AQ6 A;  1VJ5 A;  4O3Q A;  1YT3 A;  3RTV A;  9ICB A;  4U7C A;  3RJG A;  2B21 A;  4EEN A;  9ICO A;  5TIS U;  4C80 A;  1KFS A;  5EOZ A;  3T5K A;  4O3M A;  1WYG A;  1L7P A;  4DS5 A;  1RM6 C;  1S9F A;  5GTH U;  1TAM A;  4DQP A;  1TK8 A;  1UCV A;  4MHV A;  2ZIU A;  4DL3 A;  3MGI A;  2ES6 A;  1XSL A;  4UB4 A;  3HPO A;  1S97 A;  4YG2 A;  2YN4 A;  4A8E A;  5L1I A;  2ZJ5 A;  5KG4 A;  2MAX A;  1JN3 A;  2ASL A;  4PJ0 U;  5HR6 A;  5KG7 A;  5J0W A;  1KSP A;  2JV3 A;  8ICR A;  2AGQ A;  3QXG A;  1Y88 A;  5ALL A;  5DB9 A;  4RQ0 A;  3OGU A;  1QQ7 A;  4DOA A;  3HT3 A;  5KFN A;  3SYZ A;  3V7L A;  3QE9 Y;  1WWV A;  1T4G A;  4XRH A;  1PUZ A;  1S8O A;  3O0F A;  1FO4 A;  8ICF A;  1NJW A;  2OCE A;  9ICI A;  4IQT A;  2Z7J A;  1OW5 A;  3NVW A;  3QZ7 A;  2IOH A;  4BWM A;  2HBM A;  3N28 A;  2DUY A;  3SQI A;  4ED6 A;  4JK1 A;  4NXZ A;  4YD1 A;  3EUB 2;  4KLG A;  4KLO A;  4NLG A;  4YMN A;  1X9X A;  5DGA A;  5AIB A;  2KOB A;  3IHQ B;  3AM9 A;  4QWB A;  4CE6 A;  3F2C A;  2IOF K;  4NM2 A;  2AU0 A;  4B9M A;  3QEA Z;  1SKR A;  3ZD9 A;  2UVW A;  3AEV A;  4YXM A;  5KFS A;  2XVT A;  4I2B A;  2A1J B;  3H4B A;  5J2C A;  1BPE A;  3ZDE A;  3RB6 A;  5KFI A;  3HX0 A;  5AIC A;  1CUK A;  3PO5 A;  1ZJN A;  2K60 A;  4DCC A;  2AQ4 A;  4M6W A;  2JZB A;  2QLT A;  2UVV A;  2E8N A;  1XU4 A;  5J2A A;  4RU9 A;  8ICY A;  4JWN A;  2Y0S C;  1X6I A;  4UB5 A;  4M6W B;  4KIT B;  3DEE A;  5AKX A;  3AU2 A;  5J0Q A;  9ICA A;  5KFD A;  1D9F A;  3KOO A;  4DQR A;  4EZ6 A;  2K8C B;  2HOI A;  2E8M A;  5KG6 A;  2CN1 A;  2A3V A;  1RG6 A;  4OCZ A;  2OXO A;  3QNM A;  2KIV A;  2FPL A;  4P4P A;  1ZQI A;  4F5Q A;  8ICE A;  3OSN A;  2AGO A;  4DF8 A;  2W8L A;  3I76 A;  3TI0 A;  1QSY A;  7ICI A;  1U47 A;  1SZH A;  3VC8 A;  4DSF A;  4Q8E A;  3JPR A;  3SAF A;  4R66 A;  4KLE A;  5ALX A;  1PVQ A;  2EAN A;  2AHO B;  5ALM A;  1L7M A;  5AKY A;  2VIX A;  4KLL A;  3PNC A;  4UB6 U;  5ALN A;  2G5H B;  4R63 A;  4UB8 U;  1S5L U;  3AN1 A;  1UA0 A;  4NJ8 A;  8ICW A;  2K4H A;  2KZM A;  2ZIX B;  3MR2 A;  3UQ2 A;  5AI6 A;  5AKH A;  1O08 A;  1PZN A;  5HML A;  4F4Z A;  2KIC A;  4KLQ A;  2LPE A;  3WK8 A;  4OO1 J;  4ECQ A;  1Z1B A;  4YVZ A;  2W7O A;  3BQ1 A;  2MA1 A;  4F71 A;  4HYK A;  4DQI A;  4EEY A;  3LDA A;  4MFA A;  1TK5 A;  7ICO A;  4YMM A;  5DQG A;  2GOL A;  3UMG A;  3A0B U;  1TKD A;  2ZIV A;  2LI6 A;  3AQE A;  4JMU A;  2A19 A;  3RH5 A;  2ASD A;  3QUB A;  3C2L A;  1ZXI A;  2JR5 A;  4J9M A;  1UHU A;  2UVR A;  1BVS A;  3UXO A;  2IBK A;  5HR7 A;  4JV0 A;  1O03 A;  2YTU A;  2RDI A;  3GQC A;  5CHG A;  3RJH A;  2KNJ A;  1RQL A;  2WAQ F;  1NKB A;  2GO7 A;  1Z4N A;  1SV0 A;  2NRV A;  4NL9 C;  1BPX A;  1ZQQ A;  5KTQ A;  1L3V A;  4EX7 A;  4B9U A;  1Z3E B;  3QX7 A;  4IQU A;  9ICU A;  1Q3V A;  8ICV A;  4YD2 A;  2PXI A;  5KT3 A;  1ZQR A;  4DL6 A;  8ICS A;  2R8I A;  3HW8 A;  2IOF A;  1ZD3 A;  4B9S A;  3M7D A;  9ICS A;  4O0I A;  2PI5 A;  3PVX A;  2PMZ F;  3OSP A;  5KFE A;  1URJ A;  4OJ6 A;  2KJ8 A;  4YR2 A;  2WHE A;  3NRW A;  4ECY A;  2W9C A;  1COO A;  1ZOL A;  4F4W A;  8ICI A;  5KAF U;  3LWM A;  9ICM A;  3V6J A;  5DDM A;  1MQ2 A;  2BQR A;  2JH7 A;  4B6J A;  4IRK A;  2D3D A;  1WG8 A;  5KAI U;  2NO4 A;  5KFP A;  1KN5 A;  3C21 A;  4KLI A;  3MFH A;  5ALK A;  4ELV A;  4FS1 A;  2EAO A;  2XCA A;  1L6N A;  4QJF B;  2FLP A;  3Q8L A;  4DFK A;  4P2H A;  2ASJ A;  4ED2 A;  3PX6 A;  1XSN A;  1FIQ A;  4J9P A;  3V72 A;  4RQM A;  3TAQ A;  4RZR A;  3Q8P B;  2VAN A;  2EZY A;  1RXW A;  1ZQS A;  4PHP A;  3WK5 A;  4ECW A;  4CNQ A;  1SGG A;  5HP4 A;  2M9N A;  3LVV A;  3ETR A;  1HUZ A;  2YMM A;  1P7D A;  2ZJA A;  4KTQ A;  1T3Q A;  4I2J A;  4FZN A;  4QZH A;  2H3Q A;  3RJF A;  5DLF A;  1ZQM A;  5AHX A;  2BGW A;  1ZQF A;  5KG0 A;  4FS2 A;  2QB0 B;  2KEY A;  3Q8S B;  4UAV A;  1DXS A;  1C7Y A;  3BZC A;  4IC9 A;  5AM1 A;  5KFY A;  1NI3 A;  1S77 D;  2BR0 A;  3PST A;  1VDV A;  1NKE A;  1JI7 A;  3SEI A;  5AM2 A;  4YN4 A;  2G0A A;  1L7N A;  5DQI A;  3QU2 A;  4UAU A;  4UB2 A;  2BPF A;  1KRP A;  3Q8K A;  1XO0 A;  4EBC A;  2RP5 A;  4PHD A;  1ED1 A;  5L1K A;  3QU5 A;  3TAC B;  2BQ3 A;  2KFZ A;  2AJQ A;  2HMX A;  5AKI A;  2DWQ A;  3LYS A;  3L5K A;  5KT7 A;  1X66 A;  3GII A;  3GZF A;  4QZ9 A;  2YX8 A;  5KFR A;  2E8P A;  3JPS A;  2XO7 A;  8ICH A;  4GC6 A;  1QQ6 A;  8ICL A;  3EZ5 A;  1SXD A;  5J8Y A;  3PY8 A;  3K1R B;  2Y9T A;  3PZP A;  3SD7 A;  3QZ8 A;  3RJJ A;  2ODG A;  3MDC A;  3QUC A;  3VCB A;  2NO5 A;  4DL5 A;  2YMQ A;  3NVZ A;  2NRW A;  5T14 A;  2H3V A;  3ZI4 A;  3MFI A;  3C2K A;  2LYH A;  4IRD A;  1NNL A;  4QZG A;  4RQ6 A;  3M9M B;  2B6G A;  2FDR A;  2JH1 A;  1LKY A;  4OJ5 A;  1JMS A;  2R8G A;  4CF3 A;  2CPR A;  4DFD A;  9ICQ A;  5F3X B;  2CRX A;  1MA7 A;  2OH2 A;  3UMB A;  4PZN A;  4O9M A;  1ZRM A;  2ZG6 A;  5J0S A;  5AKG A;  2YB1 A;  4KLJ A;  4F5R A;  5J0X A;  3WKC A;  1C20 A;  3ZD8 A;  4LZD A;  2YML A;  2WFA A;  2F44 A;  2E1E A;  1S0O A;  3D2N A;  2KJ5 A;  2HVI A;  4O3P A;  1JIH A;  2YQE A;  4PGY A;  3OHA A;  9ICT A;  3ONN A;  4NWI A;  4RQ1 A;  1F44 A;  5A0L A;  1Z4O A;  5AI5 A;  2W3R A;  1XC9 A;  2LM4 A;  3E2E A;  3MR3 A;  1SIJ A;  4F4X A;  3H40 A;  2DPJ A;  4KMU A;  1YZ6 A;  4OD0 A;  1XWL A;  4IR1 A;  5J0R A;  4G9B A;  5DBA A;  4DFJ A;  3D2S A;  2EDU A;  5KG1 A;  4F91 B;  4G3I A;  5KFJ A;  4OJL A;  2EAM A;  3T5L A;  4IQW A;  2LYA A;  4RQN A;  7ICV A;  2XGQ A;  4DSE A;  9ICN A;  3SZ2 A;  4MF8 A;  3GFK B;  2XY7 A;  5CR0 A;  3C5F A;  1N63 A;  3IM1 A;  5HMM A;  1D8B A;  4HAI A; 
#chains in the Genus database with same CATH homology
 4JMU A;  2G5I B;  3L3F X;  3VCB A;  3M6Z A;  5KL8 B;  3IN5 A;  1HIW A;  2JGA A;  1PVP A;  3RFA A;  5KL1 B;  2HOQ A;  4NV0 A;  4BX9 C;  3KFU F;  5T14 A;  1TAM A;  1HEK A;  2E1F A;  2H3V A;  2VJ5 A;  3N7P D;  2KIW A;  1GO3 F;  2ZIU A;  3HKZ F;  2F76 X;  2Y0S C;  2M0N A;  2W04 A;  4CGZ A;  2OYY A;  3OPX A;  3LVW A;  2HBK A;  4FE3 A;  2JH1 A;  2Y0S F;  4KX3 A;  3DEE A;  4A8E A;  4U6P A;  3T79 A;  4P0P B;  4OJ5 A;  5CRX A;  2E5S A;  4WJ3 B;  5HR7 A;  2CPR A;  4OJP A;  2CRX A;  5HR6 A;  2NV3 A;  1MA7 A;  3IP4 B;  2OH2 A;  2N1R A;  2ZIW A;  2DQN B;  3GU3 A;  3LVV A;  2HBL A;  4C0Z A;  1Q3U A;  2KNJ A;  2DF4 B;  2LBO A;  1P7D A;  2K8C B;  2HOI A;  2WAQ F;  2R18 A;  3F2B A;  2G07 A;  2K89 A;  2ZG6 A;  4BUG A;  4CDG A;  3KZX A;  3NUQ A;  2BDU A;  1ZQ1 C;  2CN1 A;  2KKP A;  2WB1 F;  2YB1 A;  4FZN A;  1F44 A;  2A3V A;  2H3Q A;  1DRG A;  1T94 A;  3AL0 B;  4P0Q B;  4PL2 A;  2OXO A;  3CP8 A;  4QIW F;  4AYB F;  2GH1 A;  4BJQ A;  1WUD A;  2G08 A;  2KHQ A;  3N7S C;  3N7R C;  3RF9 A;  2H3Z A;  4OJO A;  3F2D A;  4NLB A;  2E1E A;  2MRL A;  2F77 X;  2KD1 A;  2YB4 A;  3D2N A;  2KJ5 A;  1Q3V A;  2KEY A;  3HKZ C;  3F5A A;  2ZXH A;  3O0F A;  3ONN A;  3K1Z A;  2K8A A;  3IG5 A;  3AQF A;  4NWI A;  3H0M B;  3ALR A;  4AYB C;  5A0L A;  1IIP A;  3C29 A;  4QIW C;  2Z7J A;  1NZB A;  2D6F C;  4IC9 A;  3SMV A;  1KBU A;  4ICA A;  2Q4T A;  2H3I A;  3MGV A;  3PST A;  1SZH A;  3VC8 A;  2F2A B;  4NLC A;  2K8B B;  3H0R B;  3C28 A;  4KX5 A;  4CRX A;  2HBM A;  4FZL A;  3SAF A;  2W7P A;  2H3F A;  2JHD A;  2G0A A;  3ICX A;  3M7D A;  2ZIW B;  3SQI A;  1PVQ A;  2LYB A;  4QNL A;  2VKQ A;  2HBJ A;  2VJ4 A;  3PSI A;  1UPH A;  2KHV A;  2WB1 C;  1Z19 A;  1CRX A;  2PMZ F;  2ZXI A;  2VIX A;  3M6K A;  1URJ A;  2KKV A;  2KOB A;  2ZIX A;  3D2Q A;  1A6S A;  2F8L A;  4FZM A;  4OJ6 A;  2PMZ C;  2G5H B;  2KJ8 A;  2ZIV B;  1XO0 A;  2RP5 A;  3D2S A;  3NRW A;  3F2C A;  1ED1 A;  2ZIU B;  4KMO B;  4P0Q A;  3SAH A;  2KV2 A;  3CRX A;  3PSF A;  1A0P A;  4OJL A;  4ACO A;  2K4H A;  4P0P A;  2WAQ C;  3F53 A;  1ECW A;  4PL1 A;  2LYA A;  2ZIX B;  1PVR A;  5C0Y A;  2LHT A;  2JH7 A;  2HMX A;  2XID A;  2XVT A;  2G09 A;  1YT3 A;  3F5E A;  2KIC A;  2KVC A;  3LYS A;  3SAG A;  2JMG A;  2LKY A;  3CYM A;  3PSP A;  2RRD A;  2K4E A;  4U7C A;  1OUQ A;  4OO1 J;  1Z1B A;  2OM6 A;  3GZF A;  4GFJ A;  2W7O A;  2YX8 A;  2XIC A;  2G06 A;  2RHF A;  2W03 A;  2MA1 A;  2HOF A;  2XI9 A;  4O3M A;  2DGZ A;  1L6N A;  4QJF B;  2GOL A;  2K4I A;  3E0F A;  2KJ9 A;  3H0L B;  3IG8 A;  1D8B A;  2ZIV A;  1XNS A;  3PZP A;  3AQE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...