2PNFA

Structure of aquifex aeolicus fabg 3-oxoacyl-(acyl-carrier protein) reductase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
248
structure length
248
Chain Sequence
MEIKLQGKVSLVTGSTRGIGRAIAEKLASAGSTVIITGTSGERAKAVAEEIANKYGVKAHGVEMNLLSEESINKAFEEIYNLVDGIDILVNNAGITRDKLFLRMSLLDWEEVLKVNLTGTFLVTQNSLRKMIKQRWGRIVNISSVVGFTGNVGQVNYSTTKAGLIGFTKSLAKELAPRNVLVNAVAPGFIETDMTAVLSEEIKQKYKEQIPLGRFGSPEEVANVVLFLCSELASYITGEVIHVNGGMF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Aquifex Aeolicus FabG 3-oxoacyl-(acyl-carrier protein) reductase
rcsb
source organism Aquifex aeolicus
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-[acyl-carrier-protein] reductase
total genus 92
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2007-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2pnfA00
4PG8A 5F21A 4JJIA 3KSUA 4D46A 1K5HA 3OHSX 4K28A 4Q3BA 2P4HX 3GVPA 3ZW8A 3LC7O 4IINA 4BNXA 3T7CA 1R4NB 2J5KA 4D0SA 3NGLA 5ENVA 1GD1O 3WNVA 4B3HA 4PZCA 2YHUA 3VHRA 4FIZA 4E32A 3K73O 3GY0A 2BMAA 3WS7A 1XSEA 1T2DA 4P38A 3K5PA 4BQRA 2EXXA 4OXKA 4F3YA 4IS2A 1KS9A 5DZSA 3UOGA 5DP1A 1H2HA 3ZU2A 3AU9A 4BNKA 3JQAA 1VKOA 4BNIA 1DEHA 3ONEA 1N1EA 2FPIA 4EDFA 1LLCA 4HXYA 3RC7A 1GEGA 1JWAB 3JQ7B 4YJGB 1DIGA 1NAIA 3DBVO 4BMSA 3HN7A 4PG6A 4BNYA 4F6LA 2I76A 1GR0A 3FBGA 1JWBB 4HY3A 3RVDA 1HEUA 4EJMA 3E03A 4J1QA 1L7EA 4IJWA 4BGIA 4WLNA 3ADPA 3U3XA 4WK6A 3TWOA 4YT4A 5B4UA 3PLRA 1HDRA 3RBVA 3GGGA 2J5RA 3GZNB 2VYND 3B1JA 1RM5A 1ISIA 1XWFA 1E92A 2YY7A 2YV1A 2IODA 1F12A 3TZCA 2VHVA 1KC3A 1EK6A 1RM0A 3D3WA 2XF8A 1RM4A 1U4OA 3DMYA 4YJDA 1DC5A 1YDWA 3KEQA 4FFMA 2CDCA 3TNLA 3E9MA 4RPKA 1AXEA 3SEFA 1Y8QA 3AUUA 5CHEA 4E13A 4JLWA 3I6QA 1R0KA 2V65A 3TFOA 2ZYAA 1BMDA 3AM4A 3EC7A 2RBEA 1W6UA 2C2YA 1BSVA 3FR8A 2DU8A 2C7GA 3GFGA 3W8FA 4CM4A 4DLBA 1NXQA 3TF5A 1YWGO 3ZV6A 1NYTA 5JC8A 1X7DA 1T1RA 1R0LA 1H2BA 4PLZA 2CFCA 4FSHA 3EZYA 4WLVA 4ZQBA 2IXBA 3T4XA 4EITA 4PG5A 3UGKA 2GYYA 2X5KO 3KYBA 1JKFA 4E3ZA 4CM9D 1ZEJA 1QRRA 1R37A 5CPFA 3RC9A 1TT5B 1WMBA 1CERA 5A9RA 4UVGA 4KMSA 4J90A 2BFMA 2HCTA 3KYCA 5JY1A 2YV3A 3D4OA 1KOLA 1X1EA 4TRJA 3UVEA 1VJ1A 3UUWA 2WM3A 2Y1EA 3HNPA 4OOFA 5BSFA 3LT1A 2B5VA 4F46A 2WEKA 2AEJA 2EERA 3A1NA 2Y05A 1B3RA 5I8ZA 2PY6A 3AI3A 3SBOA 3N74A 2R00C 4ALMA 3ROMA 2X4GA 2E6UX 3S2IA 4NBRA 1J0XO 1HE3A 3KZVA 3OP4A 1HETA 4Z3KA 3ASVA 3QLJA 1LUAA 1MB4A 3JYLA 4AJJA 5CDUA 1P1IA 3BTVA 1J4AA 4KUHA 4M55A 1MFZA 3PJGA 3P2YA 4AJHA 1CWUA 3TRIA 2GZ1A 2PZJA 3RFXA 5H82A 2WDZA 2CF5A 1QYCA 4E5MA 3UN1A 4IDGA 2PKRA 4KDEA 4OHUA 5A4DA 3GZNA 1KVUA 4DQVA 3NDIA 4UEKA 4ZD6A 3ETEA 3AWDA 3WYBA 5IF3A 4N5NA 2IEDA 2H1SA 2UAGA 4ZN6A 2HLPA 2EW2A 3DAPA 2ZATA 1NVMB 5A3VA 2IYOA 2PZLA 2PD4A 1NVGA 4MVJD 3WWYA 5IN4A 5KJ6A 3EDMA 4CV2A 2GERA 3JQ6A 2E4AA 2VT3A 5EN4A 4Y67A 4TKLA 3H9EO 3V8BA 2O3QA 1EE9A 3BHJA 4M87A 3PXXA 4FD3A 1H9BA 2VYVA 4B4UA 4BOYA 3M1LA 3TZHA 4DIOA 2HMWA 3SXPA 3GR6A 2Q1TA 1CQIA 3M1AA 2Q50A 4UAGA 4B8ZA 1Y5RA 1W4ZA 4XRRA 3G49A 5IXYA 1Z45A 3QIVA 1VM6A 1D1SA 2DTXA 4AFNA 2AW5A 1HDYA 2B4TO 4XQ9A 2DBVO 3L07A 3PHHA 4YDRA 3ZWPA 4AJIA 4GWGA 4XYMA 2IRWA 1L1FA 3ON5A 4F45A 1Y9EA 3HWRA 3WGTA 3KSZO 5DBGA 4QUKA 4BNHA 4BVAA 4XJSA 2D5AA 5B12A 1N9GB 1XQ6A 1SOWA 3L0DA 3O26A 4J16A 5EPOA 5JDIC 5HA5A 4CQMD 2WYUA 4XIYA 2EGGA 5G2OA 1PQWA 5KJ1A 1YXMA 1HLPA 1NR7A 1S6YA 2VYNA 4GLLA 4NBWA 2QW8A 4WCFB 3FHLA 1E1KA 5A9SB 4ZQEA 3V2HA 3PJDA 2I6TA 3COSA 4IDDA 4KQWA 3QQPA 3IL2A 1BXGA 3KO8A 3ONDA 4N7RA 4GLOA 1SPXA 2D0IA 2WD7B 3KYDA 3LT4A 2NM0A 3JQFA 3TPCA 1V3UA 1AN9A 4FC7A 2GN8A 5DP2A 1PWZA 3GN1A 4LN1A 4XIJA 1ZUD1 4YRBA 1ULUA 4D43A 5G0WA 4CMIB 5IDYA 1SCUA 3AFMA 1JA9A 1U3VA 3G3EA 3ETDA 1A4IA 2PK3A 4O0LA 4CLRA 2GCGA 3Q9UA 4NI5A 1KY5A 4LW8A 4DREA 4HBGA 3STHA 4LVUA 2Y1CA 1VC2A 2VNAA 4IQGA 4B4VA 1QORA 1GY8A 2PLAA 3ZNOA 2JJYA 1BGVA 3ZV5A 5DNAA 1A71A 3U4IA 1K89A 1XU9A 1U2DA 1IUKA 3PYMA 2NQTA 1IB6A 3WBBA 3K30A 1N92A 3H7AA 4FOSA 4GSLA 1YBAA 3UCEA 4CQMB 1UZNA 4PFJA 1CIVA 3QE3A 3HHPA 4RPHA 1B8VA 1P1HA 5KOIA 1HE2A 3F3SA 4R9SA 4LRSB 5CDSA 3DC2A 3KXDA 2Q99A 4ZVVA 4HNHA 5K6AC 4TRRA 4YJFA 2F00A 1GYPA 3GH3A 4NG5A 3MWEB 1DPGA 4D3DA 3OJOA 4OH1A 4YA6A 5DBFA 3ZU4A 5CPBA 2X6TA 5KJCA 2O3SA 5C37A 3DZHA 1YJ8A 4FCCA 4YEDA 3JQ9A 5JBIA 1KVSA 2PD6A 3H3FA 3ZN2A 2X0JA 4U6SA 1F8FA 5K6AA 2YZ7A 4BNNA 3HG7A 4J1SA 3WQQA 3GVIA 4LISA 4OQZA 1I3NA 1U7HA 1JLLA 1XQ1A 2PGJA 4CL8A 1H6CA 1CF2O 1JKJA 4NH4A 2YFQA 5DCWA 3OJFA 2FMUA 3S55A 3GEMA 3U4HA 1DO8A 3MWDB 5I9MA 1B0AA 4E5KA 2GN4A 1LDEA 1KBZA 1OC2A 3C8MA 3I9LA 3ZNPA 1BVUA 2O3JA 4Y9DA 1MP0A 4LMRA 3BMNA 3F4LA 3EVNA 4O1MA 3H6KA 4RQTA 4J43A 1QYVA 3NTOA 1DC6A 1YGYA 4IXTA 4HFMA 5IAAA 1YB4A 3GN2A 4UVIA 2CDAA 2DFDA 2Q4EA 2UUPA 3RIHA 2GN9A 2C82A 4LSMA 4HP8A 3VOSA 2IEBA 1R6DA 1PJ4A 4RF4A 2HUNA 1C0KA 1UP7A 1Q7BA 1ZZEA 2I66A 2OBNA 5IJZA 1X13A 1I3MA 3PZRA 1DFGA 3C3XA 3UF0A 4YXFA 5C7OO 4Q3CA 1A7KA 3NRCA 2Y68A 4IJKA 1WNTA 3FRJA 2WJPA 5JLAA 4PGFA 3B1KA 3ZH2A 1Q0QA 1WDKA 2FOIA 1ML3A 2GSDA 3FN4A 1PQUA 3ZHYA 1O94A 4H16A 4XDYA 4CR8A 3VZPA 4JBIA 2RCYA 4J4TA 4XWYA 4ND2A 5ILOA 3K9QO 3G1UA 1YQXA 4I5EA 4JCOA 3E6AA 4BNMA 1YS4A 3NX4A 5KVCA 7MDHA 4PLFA 5DOVA 3OA0A 3OM9A 5H81A 2X0RA 3JQCA 2Y1OA 1V8BA 1R4MB 5IZCC 3W4KA 2EKLA 3BMQA 2Y1FA 3LC2O 4L0QA 1VJ0A 3WLEA 4DRYA 2NU9A 4WUVA 2CF6A 1A27A 2C54A 3E48A 3V5NA 3EMKA 2EW8A 2R2GA 1SB8A 4J7XA 3H8VA 1E0DA 3X2EA 3O8QB 1QXSA 5TJ9A 1NASA 1U7TA 3EK2A 3PTZA 3Q1LA 4IMRA 4OIMA 4Z9FA 2CDBA 5T67A 2J3KA 1P1FA 1QMGA 2AQKA 4YT2A 2W4QA 1NQ5A 4WGGA 4XQCA 4L73A 4YYZA 4DQUA 3PWSA 5G4KA 1ONOA 3N58A 2EJVA 3I1JA 4E5PA 4ITUA 4OAQA 4K9DA 4AG3A 1BDBA 1XEAA 5DCYA 1EBFA 3DOOA 2CZCA 3IDSA 4XGKA 1H0KA 1MGOA 1XHLA 2FPPA 1PGJA 3CINA 3BHIA 2AE2A 3IUSA 1MXHA 2BFOA 3AOGA 2AQIA 4IM7A 3TN7A 4YAJA 4W82A 4ALIA 3W1VA 2DBRA 1IZ0A 1SBYA 1C1DA 2J5QA 3SC4A 1Q0LA 4Q3AA 2AA3A 2NTVA 1NFRA 5L7TA 5J23A 2C0CA 4IDEA 1PJCA 3U4DA 1E7WA 3HSKA 4R5HA 5GY7A 4PLPA 2JCVA 2ZB3A 1VKNA 1XU7A 3Q6IA 5JDCC 4I5FA 4PN3A 2DUUA 4JJFA 3M2TA 5C3MA 1E3JA 4CR6A 5KWEA 3ZI0A 2P5UA 1BRMA 4D3SA 5MDHA 3RBXA 3UAGA 3CEAA 3H9GA 3HADA 4FR5A 1YL6A 1IL0A 3WIEA 3C1TA 2ZCVA 2H9IA 2VZ8A 3B6ZA 3LT2A 3C7AA 4DIFA 2OGUA 4J9UE 2X22A 2DTEA 4I1IA 3PQEA 2PH3A 3RU9A 4F6CA 4BO5A 4NBTA 2HMUA 1R15A 3HDHA 4H7PA 1DDOA 1B26A 3WX0A 1E7MA 1DIRA 3PFWO 3R6DA 5JY6A 3RASA 2WD8A 3DDNA 2HJSA 3PRJA 4HUJA 4WLEA 3AK4A 2ZQZA 1SC6A 3FF4A 3ZWMA 3OIFA 1UR5A 1EBUA 3WGOA 5L45A 3AM5A 1WMAA 3FD8A 3VDQA 1CDOA 1DLJA 5L4NA 1ZMTA 4OYRA 1EDZA 3DBLA 1V6AA 5COBA 4BO3A 1VJTA 3F5SA 1P3DA 2IE0A 3GUCA 1G1AA 1PU2A 4J49A 3X2FA 4NIMA 3PHJA 1OOEA 4A5OA 2DVMA 4UUNA 1PJLA 1A5ZA 3WYEA 4IZIA 1PZFA 1LTHR 4XCVA 1MX3A 1YQGA 1H6BA 1DRWA 1BW9B 2GZ2A 3H2ZA 3ADOA 1B2LA 3JD4A 5G4KB 4B3JA 1GAEO 1OFGA 4WCFA 4RDHA 3ANNA 3KOUA 1JKIA 3PFFA 5JAZA 1CRWG 1R16A 3KLMX 4ND1A 4Z0TA 2VQ3A 3F1KA 3QVXA 4BO0A 1O5IA 1KVRA 1NPYA 1HE5A 3MOGA 4J7CA 4DLAA 3RJ5A 2EEZA 1WPQA 5KJEA 1DHTA 3JQFC 4WCFC 3EGOA 4EGFA 1GFSA 1LEHA 1PJSA 1NX6A 1ZO8A 4MKRA 1IYZA 3RC2A 3WMWA 4M8SA 3DMTC 3FPCA 1AE1A 5DCUA 4EJ0A 4ALNA 1G0NA 1V3VA 1VE9A 1ZW1A 4R51A 1WWKA 3PQDA 1NP3A 4WNCA 3QWIA 5F5NA 2WSBA 1OI7A 2C59A 4R1SA 4ZQGA 2ZTLA 1J6UA 3AY6A 3D64A 1Q2XA 5TSDA 2C5AA 4ZHSA 1L7DA 3JQ8A 3WGQA 2GLXA 5GMOA 4ALJA 4BO8A 5EINA 5L40A 4CMBA 1ZBQA 2DPHA 3G17A 1HYHA 4NR0A 3VDRA 4OM8A 4BNJA 1N9GA 1EVZA 1FDWA 1I8TA 2QRLA 2VZ9A 3GRPA 4MP6A 4CM1A 5A5FA 4EI2A 5KKCA 1O89A 1PWXA 1OMOA 1H6AA 4MVJF 4U0JA 4PIVA 4WEQA 3ST7A 4WOJA 4X54A 5ER6A 3JYPA 3PI7A 4MVJE 2BLLA 5CFZA 5DT9A 2D4AA 3IMFA 4J9VA 1E6EA 1Z74A 4DC1A 5ADHA 4GKVA 1DXYA 3R3SA 2O48X 3ZWNA 1HSOA 3OICA 4H3VA 2ET6A 3D3WB 2O3TA 2Q1SA 4B4WA 2Y0DA 1MG5A 2X1HA 3JQ9C 4YWJA 4YJHA 4BV8A 1I32A 2EKQA 3L9WA 4WE3A 1ISHA 9LDTA 4UEJA 4R4JA 1G6KA 4WLOA 1Q7GA 2JAHA 4CMEC 3K2EA 1H93A 1W0CA 4IUYA 4ZRMA 3QA9A 2CVOA 3RU7A 8ADHA 2DLDA 4UUOA 4WEOA 3UFXA 2DC1A 4EJ6A 3KYDB 3P19A 4J91A 3A28A 2CSUA 1D1TA 2JKVA 3HB4X 3K92A 4XYEA 4YT5A 2Q2VA 4NJMB 4KWIA 5ER9A 5JAQA 4I9NA 4CMKA 1GCOA 2NVUB 4YAEA 3SX2A 2E49A 1RYDA 3IOYA 6ADHA 4PLTA 4R41A 1EUZA 5GZ6A 1E5LA 2WMDA 4RPGA 4AVYA 4RO0A 3S2FA 1GUYA 4PRKA 4BO9A 4CLXA 4AJ1A 3RI3A 3IKVA 3QVOA 2NU6A 1ZK4A 4NNJA 4JBGA 4PZEA 4CLRB 1SZJG 4YAGA 4Z6KA 3H3JA 4II2A 1SB9A 2GPTA 4BKQA 1V0JA 3NKLA 2EP5A 4CMGA 3KB6A 5I7EA 1B14A 1C0LA 3T7EA 3FNFA 3PVZA 1MG0A 1K6JA 4FDAA 3FPLA 1EUDA 1FMCA 1F06A 4FN4A 3PGJA 4B7UA 3AJRA 5A5EA 2X0IA 3U49A 5IFLA 2RHRA 1K6XA 5CEFA 2BFPA 3L6EA 2OL4A 5IDXA 4M49A 4A03A 3AY7A 4M89A 2O50A 5ICSA 4NDNE 1ISMA 1JDJA 4P8RA 4QSMA 2X5OA 4TZTA 1Z82A 2ZB8A 4GAEA 1ONPA 2QRKA 2D5CA 5LCXA 1UDCA 1ADBA 1LRKA 4FC6A 1I24A 4XKJA 2OZPA 1Y6JA 4CM8B 1GTMA 1KEUA 2ZB7A 4S3MA 2CNBA 3GZ4A 1C3VA 3KHUA 4GMGA 4LCEA 1ZFNA 3FWNA 5ES3A 1LNQA 5A03A 1BTOA 3GHYA 1CYDA 1ULSA 4W7IA 3GC6A 3T4EA 3WICA 1DIAA 3BMCB 1TLTA 3KRTA 3RKRA 4NJOA 1QV6A 1M76A 1I3KA 4XZ3A 2H5LA 2P2SA 3MJCA 4GX5A 4BNGA 1BWSA 4ALKA 4RQUA 1O9BA 2VRCD 3P5SA 4W6ZA 1VLLA 1WAMA 4N54A 4U8GA 4K1LA 3KBOA 3PHIA 1ZH8A 1SEVA 4R1TA 3VTFA 3WQRA 2D2IA 2FSSA 2ZTMA 3AUTA 4CM6A 2BELA 5EESA 4AJKA 4OSPA 4CM3A 2NQ8A 3O03A 4RVDA 3VC7A 2FHSA 3K96A 3V1UA 3DB2A 3GVXA 2YHIA 4J4BA 3G0OA 2Q49A 4DUPA 4C4OA 4IQ0A 2Q2WA 1X1TA 2AG8A 4GH5A 1MC5A 3HQ4O 1UXHA 2Y99A 3CPSA 3IAHA 1E7QA 3VKUA 3TSCA 5BNIA 5G0SA 4PLYA 5HRUA 2PD3A 2J3JA 2O3UA 2I3GA 4L4XA 2GASA 3VH1A 5GZ1A 3OJLA 2GNAA 4TQGA 3GDGA 5JFOA 1ZSYA 3LSYA 5KTKA 1X7HA 3D4NA 4CMAA 1WXDA 5JO9A 4OXYA 1JAXA 1P0CA 4BGUA 2A35A 3DL2A 2GO1A 4GL4A 2XAAA 1N7GA 2PKQP 2Y0EA 2Y93A 8LDHA 4K26A 1E7SA 1VSVA 2C20A 3WB9A 1P44A 1A7AA 1X7GA 3ZHZA 4A7PA 4J6FA 3PHLA 3SLGA 2LDBA 1YH3A 1U1IA 4ZQHA 3GEDA 1ZXBA 4YPOA 1TB4A 4RVGA 5THQA 1QP8A 2YW9A 5T5QA 4GPD1 3ZWAA 4ZRNA 4LK3A 2GRAA 3PZBA 3LDHA 4G65A 2B83A 4QEDA 1Y8RB 4CLHA 3LU1A 5A02A 2ILTA 2IYPA 3ITKA 4BMNA 1F0YA 2PKQO 2WWRA 3WTCA 4CUKA 1ISJA 4CV1A 2JD0A 3WXBA 1WVGA 3D0OA 4JN6B 1H9AA 2EJWA 3ITDA 4IPTA 3F47A 3ZWXA 1I33A 2G1UA 1NQTA 3RC1A 2W98A 3A4VA 4J0EA 2A94A 4BL5A 5CG2A 3VKVA 3JQEA 4XGIA 1QV7A 2OORA 4RVUA 4FFNA 4CM8A 2BGLA 2GDZA 4J2HA 4XR9A 5I9NA 3Q11A 3AI2A 1QLHA 4MINA 2HJRA 4K6FA 4XR4A 5I7VA 1A9ZA 2BD0A 2IZ0A 3IC5A 5HWSA 3DBHA 4M54A 5JCJA 4BB5A 3ZWYA 4GVLA 2Z1NA 4E31A 3SC6A 4NBUA 1PR3A 1Z73A 5A9TA 2BFAA 3FR7A 4PLWA 3ZV3A 3PYXA 2BH9A 5IN5A 1BDMA 5THKA 1R66A 4GGPA 5JDIA 2X9VA 3HFGA 1V35A 3WYCA 3RCBA 1MV8A 4DBZA 1PGNA 2PWZA 4NQZA 3KV3O 2VTDA 2YV2A 2JFGA 3WJ7A 2B69A 4AL4A 1EK5A 3GAFA 3GF4A 2UVDA 3S8MA 3IP1A 2X9NA 1C0PA 4YT8A 3RUFA 1C0IA 3DTTA 3NTQA 1RM3A 1PJQA 3GQVA 4MVJP 4L4SA 4JNKA 2BGMA 3VPFA 2VOJA 4RCVA 3D5TA 1K2WA 3A06A 3BHMA 3ZGYA 3WTBA 2X8LA 2P68A 1PX0A 5IDWA 1GADO 2D8AA 4D3FA 3W8EA 5L51A 3O4RA 1W8DA 3G79A 2W2LD 4MVJG 4EUHA 4GQAA 1GUFA 2HRBA 2IXAA 2BI8A 1HWYA 3ZNQA 4GWKA 2VHZA 3Q0EA 1WLYA 4QO7A 4B3IA 1ZVMA 1XR3A 3LQFA 4J1TA 5JDCA 3S2EA 2AHRA 1UZMA 4Y6RA 4W99A 2VNSA 5TGDA 5ITWA 3ZCXA 5COAA 3PHGA 4P4LA 1Z7EA 3MEQA 3FTPA 5BSEA 5DOZA 3DZJA 3JV7A 4E33A 5ILGA 4U6QA 3WQSB 1M67A 1YO6A 3DTYA 1XELA 5CEEA 4HKTA 4XJTA 1CETA 1U9JA 2FR0A 3EVTA 1YBVA 3WG9A 3AI1A 2VWGA 3VH2A 3TQHA 4ALLA 2AG5A 3OFSA 5TX7A 4BO4A 7ADHA 3QWHA 2G76A 1QSGA 4PVDA 2DM6A 1LI4A 4LCJA 1P0FA 4FB5A 1W73A 3GDFA 4W7HA 1BHSA 4CMEA 4RVHA 5F1PA 2O2SA 5B37A 1LRJA 3L6OO 3C7CB 5A1TA 4JROA 2I65A 5JC1A 1Q7CA 3ZV4A 3JD0A 3O9ZA 3FWZA 1HF3A 1I0ZA 4RPJA 3JQGA 3JYOA 4WKGA 4R5MA 1T24A 4IS3A 4WPGA 2R6JA 1DRUA 2B0JA 3FTNA 4FS3A 4RLSA 4H15A 2JFHA 1DC4A 1F17A 2NSDA 5L7YA 3DOCA 2AEFA 1YRLA 2JHGA 3PJFA 2YDXA 1KVTA 3OQ1A 3PDUA 3UH1A 4FOOA 5A04A 1KC1A 1GEEA 4PCVA 4BS9A 2PZMA 4B7XA 5HM8A 2B35A 1WZIA 2BRUA 4BKOA 3QSGA 2JD2A 3E5RA 1FDSA 4RDIA 1UP6A 4CUZA 1NTOA 3GNSA 1A72A 5H83A 2X9GA 3RUCA 1EFLA 1GV0A 4KTVE 1QYDA 4GVXA 1HXHA 1KY4A 4PG7A 3KETA 2FY8A 1LBEA 2AMFA 3LK7A 3VPGA 1EE2A 5IXSA 2Z5LA 5KNLA 3D1LA 1HYEA 3QJ5A 4GGOA 2FRDA 5KVSA 3GUYA 2DPGA 3V1YA 1M66A 2CMDA 2PR2A 3I9JA 2DTDA 3QY9A 4D7AA 3ABIA 3QVSA 5FYDA 3WGZA 3I9KA 1Y7TA 4UVHA 2EF1A 3QW2A 4AJPA 1EFKA 2XOXA 4IZHA 2VWQA 3PQFA 4KUGA 1AUPA 1I30A 3DZIA 1E3EA 3PPIA 1YB5A 1CJCA 2AQHA 2VWHA 5DF1A 2HAEA 4BHTA 1EQ2A 3F9IA 4A27A 5TT0A 1MA0A 4ND3A 2ZJ1A 4WJZA 4Q3NA 4DXHA 1DAPA 4OMUA 5TRTA 4CLDA 4L4RA 4PG4A 4FFOA 2D59A 5IZCA 2OHXA 1LJ8A 4E0BA 1U5CA 2UYYA 4YACA 2FR1A 3JCZA 4JK3A 1MFPA 4OOEA 4RLHA 5A06A 3M2PA 5K0ZA 5HTOA 1KEPA 2FWMX 3DAFA 3GK3A 4UREA 1S7CA 4NJMA 4BO2A 3Q2KA 3GVHA 4NFHA 4MP3A 4DWVA 1T1SA 1Z75A 4YBZA 3TOXA 3VVBA 2QHXA 1P33A 2B4QA 4MDHA 1KEVA 1E7RA 2C7VA 4Q39A 3BIOA 1U4SA 2Z95A 1YB1A 4FJ0A 4TROA 2P9EA 1SEPA 4XD2A 5EIOA 5JMPA 1I10A 4BUCA 1PQPA 4DPKA 1TXGA 5DN9A 4C7KA 1ADGA 4B7CA 5JCXA 4DYDA 4BV9A 1GYRA 4DBVO 5I8WA 1BW9A 1EMDA 1KEWA 2HSDA 2YDYA 3P2OA 4DA9A 3ASUA 3JQAD 4I9HA 3GA0A 1E3LA 1E3WA 5EQFA 2O23A 4R3WA 4BNTA 2EG9A 1VL6A 2JAPA 1H94A 4K6CA 5C7LO 3BA1A 5TS3A 3E9QA 1R4NA 3GMSA 4L74A 1IULA 3ZWWA 1ZCJA 4J7UA 5LDHA 3JYQA 1PR9A 4RGBA 2NTNA 5EERA 1SOVA 1NWHA 1VSUA 5L7WA 4R1UA 1I01A 3E9NA 1E6WA 4QO8A 3H65A 5IDQA 2EHDA 3DZBA 1LDGA 1RJWA 5KJFA 4BNVA 5JYEA 4ESOA 1NHWA 1ZK0A 3HN2A 4J4HA 4FW8A 1KYQA 3EZLA 3R0IA 4FFRA 3L4BA 2HMSA 3NJ8A 1LDNA 1T4DA 4INAA 1UXGA 1OAAA 3OEYA 1O6ZA 3JQBA 3BYZA 4A0SA 9LDBA 4NMHA 3I5MA 4NBVA 3UKOA 2FPGA 1LSSA 4EW6A 1IOLA 3W4IA 5L4SA 3ICCA 4WLFA 2C2XA 1LXCA 5A3JA 4GI2A 1YQDA 1J5PA 1LQUA 3WFJA 3ROQA 3I52A 3Q2IA 4CUJA 1HTBA 2B36A 3JQAB 5L9AA 1P31A 5U4QA 1LU9A 2O4UX 1U28A 3GAZA 4KTTE 4E4YA 5JW6A 1GV1A 3DBRA 4MJLA 4OO3A 4HWKA 1DFIA 1AGNA 2NACA 2NLOA 4RF5A 3S1LA 2F1KA 3LT0A 1ZK1A 2DUWA 1ZMOA 4TVOA 2NVUA 2W8ZA 5JAMA 2ZTVA 4HFRA 4DPLA 5FEUA 2NNLD 2UDPA 4NU5A 1ZK2A 2J3HA 2Q2QA 4O63O 3F46A 3PWZA 4LGVA 3WSVA 4D79A 4GMFA 1UXIA 2HQ1A 3DHNA 4U7WA 4YB8A 1J49A 4BGEA 4L8VA 1UXJA 2DBZA 5L53A 3VAZA 3MJEA 3UICA 1E1LA 4EUFA 2DBQA 4MKXA 4JGBA 2NUAA 1O95A 1Y5MA 3K31A 3NYWA 1N2SA 4BNUA 3W6ZA 4EUEA 1I2ZA 4BO7A 4QX6A 3GDOA 1P1JA 5HS6A 3G1TA 2O4CA 2TMDA 3C24A 1GZ4A 3Q3CA 1UXKA 1ENPA 3DMTA 4XA8A 4BNZA 1PGQA 3K8ZA 4G81A 2NU7A 3BTUA 1VL8A 1T4BA 4TMFA 4E12A 1C14A 1DRVA 2A92A 4R1NA 4YR9A 3OSUA 3OJEA 1LA2A 3GG9A 3IIEA 4ONEA 4U0KA 5T64A 4IDBA 5AXDA 1D4FA 3GPIA 4PZDA 4ZU3A 4DLLA 5CDYA 5JYDA 4AJLA 3JQ7A 3LVFO 3H9UA 3ICPA 5BT9A 3BTSA 3FNGA 1ENOA 1H5QA 2X86A 3OJ0A 3BAZA 1DJNA 4IDAA 5AOVA 3I4FA 3IJPA 1LLUA 1EQUA 5B1YA 3UCXA 3GHHA 5L3ZA 4WECA 4KQXA 4RF2A 1BXKA 1ISGA 5COQA 4BB6A 3BMCA 5KVQA 1U5AA 4B79A 4I08A 4CLOB 4DTIA 4P4NA 4QECA 1YBMA 2XXBA 3HB5X 4EYEA 1KETA 2GF2A 1FXSA 5CDGA 3TZKA 3B20A 4WOKA 4MIEA 3RUAA 3DHEA 1E7YA 4E30A 4NZ9A 3C85A 1A9YA 1OZAA 2DKNA 3CMCO 4II3A 3WOHA 1IPEA 4JP3A 3B70A 5LDGA 3ZW9A 4CQLB 1D8AA 3D7LA 1PS0A 1KIFA 1RWBA 1GU7A 2OMEA 4LRTB 4JBHA 4CMCA 4FQ8A 5HS4A 1XGKA 4XYGA 1ZJYA 1PJBA 3L6DA 3E8XA 2Y67A 1B8PA 1FJHA 5BSHA 5ENDA 5FFFA 2ZKLA 3KM0A 3BXXA 1VRWA 4JJGA 4LMPA 4D0RA 4W4TA 4I9UA 4URFA 4CODB 4CQLA 1EVIA 3E18A 5LC1A 1E6UA 1ADFA 3HE3A 5TNXA 1Y8RA 5BNTA 3A9WA 1BG6A 4TZKA 2YUTA 3W8DA 2ZJ0A 4OGWA 4R9RA 5FI3A 1YE3A 3PIDA 2RAFA 4UUMA 4GX0A 4BGVA 4D42A 2E82A 4BKPA 4E21A 2O7SA 1NVTA 3PIIA 1GQQA 4A10A 2IZZA 2CUKA 3CTMA 4O59O 3JQBC 3AU8A 4RF3A 5DBIA 3P7MA 2LDXA 3DONA 3FCOA 1KVQA 3VZSA 3WNQA 4CM4B 3FBTA 1U3WA 3D5QA 3VH3A 2VT2A 1ZK3A 4G2NA 1N1GA 2GR9A 2QZZA 2ZYGA 2ZYDA 3U0BA 1ZSNA 4XQEA 1SNYA 4QXMA 3WIDA 3H4VA 5I7SA 3MTGA 3INGA 4JXKA 3CMMA 4E2WA 1Z6ZA 1HDGO 3NAQA 3IUPA 1JAYA 1LSUA 4YRDA 4UUPA 3E5MA 4AICA 4NFYA 4P4GA 4A73A 5ITVA 3D3EA 1NFQA 3VPHA 1XIVA 3HDQA 2V6MA 1PJ2A 3MCVA 3CE6A 1HZZA 2BGKA 4WCDA 4Z0HO 3BMOB 4YAKA 1IPFA 2PZKA 1NWCA 1UH5A 2WYWA 2X58A 1BVRA 1ADCA 2YQ5A 4L76A 5F1KA 5C5IA 4EZBA 1FDTA 1EEHA 2EP7A 4Z3DA 4CLEA 1NFFA 3GGPA 4EEZA 4C7JA 3GG2A 5TC4A 3ZU5A 1E1MA 3CUKA 2OOSA 4CLOA 3U5TA 1DHRA 4TWRA 3NT5A 1KERA 3KVOA 4MVJH 1GUZA 4DC0A 2W2KA 3ENNA 1TT5A 4J3FA 4LSWA 4WNIA 1B3BA 3I4CA 1TT7A 2D3TA 4Z9YA 3PGXA 4E5NA 1HDZA 3I9NA 2JL1A 1YL5A 5EJ2A 1LDBA 1LLQA 2P9GA 3LZ6A 3RQSA 1IY8A 3F1LA 2VRBA 1LC0A 1DJQA 3BMQB 3JD2A 3AFNA 5EQDA 4CV3A 1DLIA 1LDYA 3QVTA 2W90A 3TL2A 3E1KA 4BMVA 4A26A 1T26A 1QYWA 4RL6A 2AE1A 4MKZA 4R16A 4CV0A 2B5WA 3AY3A 1U8FO 2Z1MA 3UXYA 2VUTA 4KZPA 2QYSA 4IQ8A 3TFQA 1X0XA 1NPDA 5TQVA 3RUIA 4UVDA 4BO1A 6LDHA 2VTEA 4R3NA 4NPCA 4GBJA 3I83A 1TI7A 4Z9XA 1HE4A 4LVCA 4CMIA 2QIOA 2WYVA 4ZGWA 3CIFA 3VTZA 3CZMA 4DIBA 1PJ3A 1IHXA 4MP8A 2VHWA 3IJRA 4XX0A 2YYYA 3EYWA 4RZIA 4OSOA 3F5QA 3MTJA 4CJXA 3L9XA 1I36A 1TVEA 3OEWA 4JQCA 1JW9B 1T2CA 4MIOA 1DC3A 4BNWA 3E82A 1YL7A 1DIBA 5U9CA 2I99A 3QWBA 1GCUA 3INRA 1LC3A 1I2BA 2PV7A 2FP4A 4L75A 5JE8A 3D4PA 5T8KC 1ZNQO 2X0NA 4DL9A 2QX7A 3OECA 2V6FA 3I23A 1P1KA 3KTDA 4QT0A 1Z7BA 3WDSA 4AJ4A 1WP4A 5CEJA 4WLUA 3LC1O 1CEQA 3IS3A 1N7HA 2NU8A 4CM5A 1B8UA 1HSZA 4BKUA 4PRLA 3ZWOA 1PS9A 4ND4A 5TLSA 5A05A 4EBFA 1RYEA 1HZJA 2X23A 3EW7A 1T25A 4MO2A 4DGSA 3MJTA 3NUGA 3IQDB 1X15A 1QKIA 1K3TA 1U2GA 3NGXA 4Y6SA 3JD1A 3ROKA 4TVBA 3OIDA 1RKXA 4IIVA 1VL0A 4G5HA 4R01A 4ZQFA 4Y98A 1P1RA 5KVVA 3ZHBA 3KUXA 4DQXA 3TL3A 3KSDO 1MUUA 1GQYA 4RVFA 5AXCA 1WDLA 1XA0A 3OQBA 5CG1A 2TMGA 3EY4A 3PWKA 3OF2A 1QR6A 1VI2A 2HU2A 1UAGA 5FWNA 1PTJA 2DAPA 4IGFA 5I9LA 2DQ4A 3RJ9A 3IP3A 4YVFA 4D44A 1Y9AA 4R69A 4HFNA 4Z0PA 3CH6A 4J1NA 2C07A 4CQMA 3SJUA 3O8QA 1PIWA 3VPSA 2IDZA 1RPNA 3QHAA 3MJSA 4CL3A 1PGPA 1ENZA 3I6IA 3RD5A 1GYQA 5AQ1A 2NV6A 2Q1WA 3I9OA 3ROPA 2QG4A 1UP4A 2OP0A 2NADA 3RFVA 1UAYA 4ID9A 1JVBA 2BI7A 5KIAA 1YVEI 3JD3A 5U1PA 3W6UA 3PDJA 3WMXA 1WDMA 1WW8A 1XYGA 3DOJA 3WSWA 3ANMA 1ENYA 1I2CA 2YQ4A 5JAIA 3AOEA 5KCZA 2VYVD 3JYNA 3WGYA 3HFSA 1U3UA 1HT0A 2VCYA 3HZZA 4XB1A 2I5PO 4WASA 3ZHXA 3TZQA 1NBOA 1X0VA 1GQ2A 4MOWA 1DSSG 1Y1PA 1R0SA 3RROA 4GKBA 1AXGA 1YKFA 2AXQA 1VPDA 2HKIA 5JPIA 1DFHA 1ZKMA 3DBRB 4B4OA 3DR3A 1C1XB 3KYCB 1K6IA 5L4LA 4TRNA 3WGGA 2CD9A 2VWPA 1O8CA 2E48A 2NWQA 1EVYA 1XLTA 3H5AA 2ZTUA 3BTOA 3H9JA 5F3RA 4RORA 1R4MA 1PZEA 1EZ4A 3I9MA 5FI5A 3MJVA 1PL6A 2ZIZA 3DBHB 3JQ8B 4U5QA 2HK8A 5JXWA 1NPTO 5BSGA 1DAOA 3LF2A 2QZ9A 3NEPX 5JS6A 4FFLA 1M6WA 3WGHA 2CVZA 2ZQYA 1AHIA 4E2YA 5A9SA 4IGEA 2J8ZA 5K9ZA 4DMMA 4J0FA 5G4LA 2RH8A 3JTMA 4ILKA 1JN0A 4CMHA 4J2OA 2V7PA 1DOHA 3AUAA 3RKUA 1T2AA 1GZ6A 3S2GA 3TJRA 3LLVA 3C1AA 2PGLA 3QRWA 4GSKA 4Q3DA 4HFJA 4YQZA 4PLHA 2P91A 3I3OA 2OFPA 4EEXA 4YJGA 3PK0A 3R1IA 1YDEA 1GPJA 1LSJA 1PZGA 3H5RA 4KP7A 3UW3A 5TT1A 1EUCA 1R12A 2VHYA 4KOAA 4OKIA 4Y8VA 2BHLA 2VOEA 3GEGA 5T57A 2R00A 3CSDA 3ZWVA 4BNFA 3SJ7A 5G0TA 3GNQA 2G5CA 3HUDA 1MXFA 4NHEA 1EDOA 2FN7A 5TIIA 1I5RA 3DFZA 3O38A 4FJ1A 2BF7A 2I9PA 4CMJA 2YHIB 3PJEA 5JSFA 2P5YA 2VUUA 2DT5A 3KEOA 2GUGA 4PVCA 4BNLA 3PEFA 5TJHA 4XRGA 4RZHA 2ZB4A 4YQYA 2CVQA 3OH8A 4O5OA 5TF4A 3SLKA 1OC4A 2G0TA 3L77A 2EKPA 4OL9A 4UEOA 1UZLA 1E3SA 3RUHA 5BR7A 1PJTA 3SVTA 2HO5A 2VZ0A 2WE8A 4XGNA 4RPLA 4HV4A 3OMLA 3UHAA 5IG2A 3PP8A 4R68A 3VZRA 1HKUA 1OBFO 2J3IA 3DBLB 3GVCA 1M2WA 4N5MA 5JO0A 1IHYA 2H63A 5DDIP 2IZ1A 5AYVA 2FZEA 1ONNA 3U62A 3IKTA 2RHCA 3FI9A 5ICMA 3PLNA 4KUEA 1D7OA 4OXNA 4R54A 4JX8A 4QTZA 3V2GA 1NNUA 3B1FA 3BZUA 4FGWA 3JQDA 4RV9A 4BQPA 2H6EA 3ANLA 1HDCA 2G17A 3GGOA 2Y1GA 3QWAA 3OQ6A 3K2BA 1B15A 1B16A 2O3RA 4NFSA 4BO6A 1U8XX 3GRKA 4P22A 2EIHA 1V9LA 1UJMA 2J6IA 3CZRA 2Y66A 1UDBA 3CKYA 5C7IO 3C7DB 1V3TA 3AM3A 3NV9A 1X14A 4IDFA 1PL7A 3DZFA 3F6YA 4HNGA 3NT4A 1YOVA 2OBYA 2WD7A 3INTA 3MJ4A 4MVJM 2UUOA 2JFFA 1ZEMA 3DAGA 2QYTA 4DYVA 4MVJA 4I5GA 2PGDA 2B37A 2P9CA 4MPDA 4CPDA 3RWBA 4D45A 4YTEA 1JQBA 3WR5A 3QVWA 4CM9A 1GPDG 2BKAA 1U3TA 4JIGA 4D41A 4E6PA 3FSRA 5EMHA 1JU9A 2FR8A 1BXZA 1B7GO 2JHFA 3GLQA 3JQGB 4KWHA 2C29D 3AOEC 4N5LA 1N5DA 1P9LA 1TEHA 2VHXA 4HADA 4PLCA 3EHEA 3OA2A 4CM7A 4OJNA 2E37A 2RIRA 4W9NC 2XPCA 1UDAA 3QV1A 2HMVA 2PNFA 4XDZA 1QLJA 3V2UA 4NK4A 3VPXA 5AXAA 1PS8A 4HX5A 4IJVA 4MVJI 5G0VA 3RUEA 5IZ4A 1XG5A 1ZJZA 2A4KA 4PLVA 1Q0HA 5KKAA 1JTVA 3VH4A 1K0UA 1SMKA 5I7FA 3LYLA 2HRZA 5DULA 2O7QA 4GX1A 3NTRA 4TRMA 4W9NA 4Q9NA 3GT0A 1M75A 1CQJA 3JSAA 4L9RA 3GMDA 1NR1A 3WLFA 2VN8A 4DVJA 4ZJUA 2VUSA 1PEDA 2EWMA 3DHYA 4YRAA 1ZIDA 4BIIA 1LLDA 3HDJA 1JVSA 4M1QA 5FF9A 2EGHA 5B4VA 1HDXA 1NHGA 1PL8A 2AQ8A 2EV9A 1E5QA 2Y0CA 3N7UA 4UULA 3VVCA 2B4RO 3WWZA 4XYBA 2OP1A 2Y1DA 3FNHA 4XYLA 3DZKA 3WFIA 4S1VA 2OO5A 3F4BA 5T8KA 5JNLA 1ZXLA 3WBFA 1BXGB 1P77A 5BNFA 2SCUA 3NT2A 1FDUA 3W4JA 3ENKA 4YAIA 1E77A 4MIYA 4QQRA 4E5YA 2WE7A 1IE3A 4TKMA 3BMNB 2PTGA 3WJAA 1LDMA 1LQTA 3ORFA 1GDHA 4B8WA 1NQAO 1T2FA 1N8KA 5F5LA 3RUDA 4Q3EA 5GZ3A 4M86A 1C1XA 1PZHA 1MLDA 3ZNNA 1I3LA 2Q45A 2WTBA 3DWFA 4YJHB 2PFGA 3ULKA 1ORRA 1SO8A 5HBRA 2JCYA 2HMTA 3UCFA 1DIHA 5CAEA 3R3JA 4AJEA 4RJTA 1SAYA 4AJ2A 5JMWA 2RH4A 3PYLA 3H9QA 4TSKA 1M6HA 1XDWA 2JCXA 3ZDFA 3V1TC 2G82A 1ARZA 2W2KB 1TA4A 2OXIA 3DZGA 4AJOA 1P74A 2HDHA 4Y6PA 4RVSA 5JCJD 1UUFA 4I5DA 1NM5A 3TOZA 1C1DB 3GPDG 1F8GA 1HL3A 4FFPA 4FGSA 1QYXA 1YONA 4GX2A 3AUSA 2W2LA 4YJFB 1E1NA 2POQX 5CDTA 3L4SO 3OETA 4I8XA 3Q9NA 3EAGA 3ZZNA 1ISFA 2PA3A 5BQFA 3QWFA 1PSDA 2AEMA 2X7HA 3EUWA 4NK5A 1LRLA 3RBZA 1PGOA 2P4QA 1MC4A 4E2XA 4A2CA 3MZ0A 1XKQA 2Q4BA 2DFVA 3GFBA 1LX6A 3WGIA 1DB3A 1ZSVA 1H6DA 1T2EA 4CR7A 1NQOA 2Q3EA 4N18A 4XEHA 4DMLA 4IDCA 1D3AA 2OUIA 2GN6A 1NAHA 3ZWBA 2V6GA 4XQGA 1HDOA 4IJUA 5CP8A 4ZICA 4OKNA 4QFDA 3OBBA 2FZWA 1G0OA 2O2YA 3KLPX 2C5EA 2GD1O 1ID1A 1O0SA 3ZWCA 2Q46A 2XXJA 2X5JO 4IBOA 2NTJA 3K6JA 3OIGA 1E3IA 4OQYA 2HK7A 4KDFA 1A4UA 2Q1UA 2VRCA 2ZK7A 3ETGA 1Q1NA 2I67A 2NVWA 2QQ5A 3A14A 3C1OA 2PH5A 3ONFA 2HK9A 3NDJA 4YCAA 4E2ZA 2YFHA 1Y81A 4IXWA 4IIUA 3DQPA 3HDYA 3TZ6A 3H5NA 4FPXA 3U9LA 3RFTA 2D1YA 4O6VA 2FSVA 3H2SA 1FF9A 2JD1A 3VZQA 3DXFA 4ND5A 1QG6A 3NDRA 2QRJA 4FJ2A 1EVJA 3M6IA 1YJQA 1FDVA 4IY1A 3NJ4A 1DBVO 3HJAA 5B4TA 4DPMA 3U09A 2NVBA 1Y8QB 1HLDA 3QP9A 5T6BA 4BKRA 1LSOA 4QFCA 1E3WB 3FNEA 4ZA2A 2YJZA 1AHHA 4XB2A 4NU6A 3RAJA 2GZ3A 3DFUA 3ZU3A 1GL3A 2I3AA 1XCBA 1WZEA 1HYGA 1P45A 2V6BA 4JP2A 4AJNA 4FBGA 1GZ3A 1F14A 5F1OA 2A9FA 2CY0A 2UV8A 3AW9A 1HRDA 3DO5A 3LLSA 3GOHA 5MGBA 1IZ9A 1FK8A 5EL0A 5AVOA 3MOIA 3LF1A 3TDKA 2GGSA 4ROSA 5L95A 3DEYX 4IMPA 3GNTA 2ZCUA 4UVEA 4PLGA 5AXBA 1YOVB 3CXRA 3BMOA 3L4BC 5G0UA 3U4CA 3RSHA
chains in the Genus database with same CATH superfamily
3IA2A 5F21A 4EY6A 3IHWA 1HQDA 3SR4A 1ULBA 1J33A 4O4HB 1A7JA 4UU1A 3FTFA 4K28A 2P4HX 3GW8A 5L3RA 4IHKA 2PEYA 2GM4A 3DJFA 2A0UA 2J5KA 2OLEA 3H2JA 4Q9LA 3C3DA 4FIZA 4I7EA 3ITNA 2W58A 3K73O 1JQ3A 3NM4A 1YS1X 1YS9A 3GY0A 2J0UB 4LC0A 1XSEA 3Q41A 4LRXA 4K2AA 1T2DA 3MTDA 4TLMB 5CITA 2J41A 4EATA 1V5FA 2EXXA 1KU0A 3N7AA 4F3YA 1M6VB 2VF8A 2UXBB 1KS9A 4H3HB 2C3UA 3CPJB 4PPNA 4XIFA 4BVGA 3UJ6A 3BDAA 2UUCB 1N5RA 4ZAXA 4LV6A 3JQAA 2ZIWB 4BNIA 1DG1G 5DXAA 1GQSA 3PUIA 4XWGA 1FLVA 1LLCA 4HXYA 4MR9B 1SVWA 3RC7A 3LVRE 4GNKA 4O4JA 1SJ9A 4DMUB 2F9FA 2GD6A 3JQ7B 1DIGA 3DBVO 3L8ZA 4IX1A 4L2IA 1YMQA 4P32A 3TE6A 4PG6A 2WQ7A 3BX1A 3K0SA 2BONA 4L15A 1GOTA 3OEHA 2IUYA 3R20A 3UXHA 4DT1B 2OHJA 2IIVA 2W2MA 4JUFA 3WRWA 4F6LA 1JWBB 3OOYA 1HEUA 5FD8A 1E8NA 5F35A 3E0QA 2JEOA 4BGIA 1L7EA 4TKZA 3ADPA 3U3XA 4WK6A 2VRNA 2A67A 1M1YA 2CL0X 3GGGA 4ODIA 4RGQA 4YLYA 3X1KA 4YCMA 3B1JA 1ZMXA 2JFWA 1ISIA 3WB1A 2YY7A 2FEOA 2ID9A 2IODA 3HYSA 3K6KA 1L5YA 4PQFA 1S8FA 2ZBUA 4AWAA 5KYGA 1GZUA 4RD6A 7ABPA 1HL7A 4DCUA 1OPXA 3SM9A 4Q6BA 3OTQA 5DYNA 5SY6A 1SKBA 3D02A 3R7FA 1J8DA 1RM4A 4ZAZA 3U1VA 2A7QA 3IAAA 3KEQA 3KPJA 3S7TA 1MPXA 4MS4A 3RHTA 4FFMA 4N76A 4E6EA 1ZGGA 3TNLA 4TSRA 4RPKA 1KJ8A 3P9SA 5AW1A 3SEFA 2QROA 3AUUA 3RYCA 1CS0A 1QZZA 1CJMA 1VSQA 3OESA 4LJ7A 5DIZA 3VMMA 1BRTA 5JOQA 3AVXA 1CF4A 1BEUB 3AM4A 4JFAA 4GGMX 4UTOA 1RQRA 1ICEA 4JP5A 2IHKA 4HNSA 3FR8A 2A5FA 4R31A 5FOWA 2C7GA 1EM6A 1PFKA 3KOMA 1ZAKA 4G89A 4FSXA 3TF5A 2XZOA 4LOAA 4MV1A 4RYDA 3UGQA 4Y9RA 4BJHB 1K9VF 3A04A 3WLMA 5FLEX 1KMCA 4X92A 1J09A 2BFEB 4PLZA 3WV4A 4FSHA 3EZYA 4WLVA 1XJWA 2JZOA 4ZQBA 1KJYA 1LWNA 2JS7A 2PCLA 2GYYA 4Y2RA 3RW9A 4WBNB 3IH5A 1V26A 5JUWA 1IVSA 4PFSA 3RC8A 2GVDC 4LYFA 4CM9D 3FBWA 3HVJA 4B3BA 4YFYA 4DCVA 2HJGA 4F12A 2YY6A 3ZZ1A 2FUCA 1XZEA 2YQZA 3C3BA 1GUAA 2YWCA 3EVFA 3FPGA 4J90A 4XVRA 2HCTA 3KYCA 2XUGA 3R0ZA 3LUKA 3NYRA 4IH1A 4A2PA 2YJNA 1J00A 5T3UA 1KOLA 4BC0A 3EVCA 4CL2A 4WFQA 3QPDA 3RTEA 4TRJA 3SS8A 4BMOB 4FYMA 2BDUA 1ZN9A 4RK0A 2Y1EA 3E9DA 2IYSA 3HNPA 3MMNA 4KKXB 4OOFA 5BSFA 2WEKA 1YTUA 4KE7A 2AEJA 4LY6A 2QXUA 4I4IA 3V8VA 3A1NA 3EPJA 4W8GA 1B3RA 3UBTA 2PY6A 3E3LA 3PR3A 3N74A 4LVNA 4ALMA 2E6UX 2HN9A 1EI9A 4NBRA 1KFCB 3ROTA 5J5VA 2DEUA 2Q6OA 1J0XO 1QFSA 2D0OB 2YVAA 1L9XA 2JEZA 4MV8A 1YRYE 3BXFA 3ASVA 3QLJA 1UMDA 1LS6A 2REQA 3R41A 5IVKA 3AW8A 4AI6A 1P1IA 1RQLA 2JI8A 2Q5QA 1IBKB 3QBDA 1J4AA 2N3ZA 4KUHA 3A31A 4M55A 1QH8A 1EYZA 3OZ7A 1OJLA 4LJSA 3I1IA 1B74A 4F72A 3PJGA 5KB3A 1CYEA 5KNDA 4HNUA 4ER6A 3T9BA 3R9XB 3JATA 2PXHA 5AJTA 1N0WA 3R7DA 3GO4A 2JCSA 3O75A 3C6MA 1EFRD 4YDHB 1TA0A 1RBYA 2WDZA 2CF5A 1PEYA 3AF0A 1OIWA 1DU4A 3U4QA 1GJRA 3TRKA 3HO6A 1TVKA 3PFIA 2N1MA 2QMHA 1QRDA 1TJYA 3TW6A 3NDIA 4J0HA 4UEKA 1Q3KA 4BAGA 2BCJQ 1EGQA 3C3KA 3SWWA 2V3WA 2P4UA 1W46A 3R9XA 3K5IA 1NVMB 3DVSX 1MAHA 4RSGA 5H1YA 5A3VA 3T5MA 3G5LA 1B43A 2G28A 5IN4A 4FOTA 4MIKA 4EHHA 1Q2UA 2GERA 4OVKA 3T7KA 4ZCTA 1P2DA 2IPLA 3JQ6A 5DWVA 1J7KA 4FINA 2LBPA 4KQ2A 2AFHA 4C76A 3H9EO 5AJXA 2O3QA 4TQ9A 1YR7A 2JGKA 2KQUA 3M3PA 2BL4A 3ZY2A 2OSBA 4AMUA 1DMRA 3RRJA 5J2UB 1GCGA 4BOYA 3KKKA 5KSPA 4DIOA 3T3EA 1NMQA 1KXJA 2HMWA 4IYJA 3BWEA 3TXXA 2WMYA 3KR1A 4B8ZA 3VNBA 2Q50A 2IGBA 4M4SA 1W4ZA 3ZBQA 3G49A 3I72A 3SJCA 1ZL2A 3SYLA 1EXMA 1VM6A 4AFNA 3W2HA 1GLGA 4TV9F 2AK3A 2G8NA 2KHZA 3PHHA 2O54A 5K7SA 4UHDA 1L1FA 4BATA 1QOZA 3WGTA 3W79A 4MYRA 4QUKA 1WCV1 3JAKB 4WY2A 3HV2A 4H6XA 2PZEA 1XQ6A 3DXYA 2ADFA 3O26A 5D7NA 2C0PA 5AJHA 5C8DA 5EPOA 1OKKA 1R6VA 1Z18A 3AFOA 4IDPA 2GXQA 1PQWA 4YJ3A 5G2OA 3EXG1 1HLPA 4C0JA 1NR7A 3SXUA 4QPPA 4WERA 2VT6A 4NBWA 2BGNA 5I51A 2R9VA 1CUJA 1US8A 1XCGB 2CLHB 2QW8A 3GWGA 4NYMQ 3FHLA 2WHQA 4X90A 4X20A 4CTOA 1MD9A 4FWTA 2NUBA 2OYSA 2IY8A 4ZQEA 3PJDA 1AUXA 2OZLB 3COSA 3V2HA 2CNLA 4IDDA 4KQWA 4KVAA 4DV7B 3ONDA 2D0IA 4TL7A 1NSYA 3WKEA 3DMNA 4HAVA 2C7RA 2WD7B 3QH4A 1MDFA 2WJ4A 3IAUA 4KN5A 4NARA 1Y4UA 5ITSA 4ZTUB 1N77A 5BOVA 2OK7A 4URYR 1JT9A 2J33A 4JASB 3GN1A 4XIJA 2OZLA 1ULUA 5BVHA 5G0WA 4CMIB 2NYAA 1MAVA 4XTCS 3RPEA 5IDYA 1APBA 4FFSA 3A6EA 1XROA 4Z2AA 1Q1BA 1SXJC 1W29A 4C4AA 1A4IA 1YA8A 2Q5IA 5DM2A 4MX8A 3AR4A 1CNFA 4NI5A 2XB2A 5B1SA 1YDFA 4LW8A 1Z4NA 4HEQA 5H3LA 3STHA 3Q3VA 2KPOA 1MF7A 3TVYA 2CE7A 4IQGA 1U0RA 3CUTA 3ZNOA 3OMXA 3LM8A 3GLGA 2BVNA 4Q66C 4L8YA 4A1OA 1SCBA 4ZOLF 2CHFA 4MVYA 2Y2VA 3D3JA 3MD9A 4AF6A 5DISB 2G71A 1XU9A 3AHHA 5FHRA 5CFRA 3PYMA 3STVA 4IAOA 2NQTA 5DTEA 1IB6A 3IT1A 3MJFA 1QG2A 1E2BA 3ZCVA 2OUKA 1IZ7A 4FOSA 5L6LB 1OWNA 4GSLA 3EDOA 1XQWA 1Z2NX 3TH5A 3IAM6 1XZHA 4TT3D 4PFJA 1FSZA 2OGTA 3ZKWB 1E1YA 3JVVA 3NOXA 2AZMA 5TMPA 2JLYA 2Y1XA 2P9YA 1NN3A 4MAMA 3F73A 4B3FX 4R9SA 4A15A 2O07A 3HXMA 3ZLBA 3KXDA 2Q99A 4ZVVA 1C8BA 1XQVA 2DSTA 3NI2A 4HNHA 3EA0A 3URKA 1KR2A 1HFKA 3JU3A 3OOSA 3NAGA 2I6FA 1YBHA 1TUBB 3F67A 3PRHA 4L57A 2AZXA 2BFCA 4CG0A 1N5IA 3D7KA 4OH1A 2WB4A 3UT5B 2PGAA 1RRFA 4DLZA 4QYMA 1ZL0A 2JLRA 2CEAA 5GOTA 5C37A 2FSPA 5DEOA 2WKPA 4RACA 2QV7A 3FLMA 1F6WA 3R7WA 4O3MA 1K63A 3H3FA 2BWJA 2GAIA 5DHRA 1DGQA 1U7XA 4UNIA 4Q7JB 3AONB 3ZZ0A 1XB2A 3U0VA 3WQQA 4E7PA 2XI4A 5JANA 3M70A 4M1WA 5CCDA 3A2KA 1H6CA 1FLAA 2G5TA 2PFKA 3CEHA 4YRSA 2YFQA 3DD1A 4KO3S 3RSCA 1Z4LA 3M9LA 4ZCLA 1G64A 1AK9A 4ZVRA 1XWWA 3S55A 3WA6A 1Y37A 1MJHA 2R6R1 1B0AA 1LFDB 1KI8A 3B48A 2GN4A 2XX3A 4GZ6A 1KBZA 1PHPA 4A0GA 4C0XA 4BP9A 3MLAA 3ZNPA 2Q9UA 4N8EA 1RXCA 4NV3A 1H23A 2II6A 1NUAA 2WAXA 3KR0A 3QLVC 4O1MA 2QJFA 3PQ8A 5EG5A 3LW8A 4J43A 1QK4A 2BGGA 5JI2E 3OT1B 2J9RA 3GCZA 1G8AA 3MCAA 5HJEA 1HFJA 1L5KA 5CT5A 1CY7A 3E81A 4LXUA 5E1MA 3G0HA 4P5DA 4CF7A 2UUPA 2VA8A 2YINC 3HYCA 3RYHA 1OU4A 4TXLA 4EA9A 3VYVA 4HP8A 3VOSA 3A70A 2IEBA 2Q5JA 4P4SA 3ONWA 1SXPA 4NYIQ 1Z4JA 1Q7BA 4UEWA 4DLRA 5ALUA 4J03A 1SA0A 1I4TD 5G1PA 4LQCA 5BV8A 1PWHA 1QVWA 1ZA1A 2CMKA 4KXQA 2I2WA 1MX5A 5J58A 2EBHX 2CJPA 2LWIA 3UF0A 3IR6A 3MTQA 3PX2A 1W88A 4QNNA 2CXSA 3NRCA 4IJKA 5JXGA 2VHUA 4EUNA 1AQLA 2VSXA 3R7BA 3WFZA 2FFAA 5FBRB 1Q0QA 4DMCA 2GHRA 4GO1A 4EGAA 2FOIA 2GT1A 2RSLA 2B20A 1Z34A 3FN4A 2VDJA 1GLVA 2CJWB 4HLDA 3REGA 1SKAA 4AKTA 4H16A 4XDYA 1QZTA 5ITZB 4JBIA 1M1UA 2RCYA 4J4TA 1U7PA 4ND2A 2ZAIA 4XWYA 2AF3C 2WIBA 3K9QO 5ILOA 1RPTA 2C4WA 4JCOA 2N42A 1S3FA 2FMHA 3E6AA 3LTEA 3N2NA 4PHHA 5BW8A 2QEQA 5CYGA 4DKJA 2HK6A 1E99A 1HMPA 4EW2A 3L6RA 4IUBS 3QXXA 2P62A 3OM9A 1JQLB 2CN1A 4FEGA 4BN0A 3JQCA 3R0VA 3QE0A 1GTL1 2H59A 2HR1A 4NCIA 4JC5A 3OTOB 1SUSA 4QUJA 3UJ8A 2EKLA 1AN0A 2DY0A 4L0QA 4G8BA 1UEXC 2YN4A 2CF6A 1XEXA 3DEIA 2W93A 1Y3HA 5IYZF 2EW8A 2ALJA 2R2GA 2QZJA 3H8VA 4XGQA 1JHUA 1N6HA 1YTLA 2F8LA 2WWGA 3GJZA 3PTZA 3TSZA 3PF8A 1U7ZA 4P93A 4TSFD 4DBLE 5AVJA 3AINA 3GLKA 3COZA 1DKQA 4AWBA 1NVFA 4BRZA 2ZIXB 1C2YA 3VJRA 2P3QA 1VE7A 4C06A 1P1FA 1NRXA 3HL0A 1C7IA 1QMGA 3I12A 4MO9A 3D0KA 4P35A 4JI5B 4WGGA 3T35A 2P30A 4FR2A 3W9SA 3KAJA 4AG6A 1E1RA 5G4KA 3N58A 1Z8FA 3I1JA 1AKMA 2R7NA 4QFBA 5FUYA 5DYTA 4F38A 4K9DA 1XTQA 2PQMA 4UPVA 1U8CB 2BZSA 3DOOA 3O9VA 1JWLA 2QVYX 3IDSA 2IPMA 4XGKA 1XHLA 5E1BA 1PGJA 4KGZA 3CF4A 4L9WA 2AE2A 2H1OA 4MYSA 3AOGA 3FFAA 2AQIA 4IM7A 3TN7A 2J59A 1EX6A 1I5EA 2RHLA 3AHIA 3FFXA 3E8SA 4LUCA 4YAJA 5EHXA 1IZ0A 1XZDA 1SBYA 1C1DA 2CB0A 2HQRA 3A8TA 3JAKA 5KYUA 1SHLA 3AJDA 1XDBA 3LUAA 3M6XA 4PPYA 1JLSA 3ZD9A 4B43A 4BAZA 2ZAMA 4CI9A 2IQIA 1JYFA 1PJCA 3LGXA 2OV4A 3GBSA 4ON9A 1US8B 5GY7A 2I22A 4PLPA 1ZQ9A 3HY3A 4RJJA 3Q6IA 5EUBA 1G21E 3I5UA 2R8RA 4KN8A 4DR5B 4PZ0A 3EIWA 1MQ9A 3P32A 2H4JA 4KPUB 1KI9A 1K5PA 2CFIA 1EDDA 4JMPA 2NO5A 1OX6A 3BZWA 1CZOA 1VFNA 4J0QA 3TUIC 2P5UA 3IP5A 2ZI5A 4PV7A 3WRYA 4DLPA 5FWXB 1E2MA 3RU3A 1TNDA 2B8EA 5DLYA 1H0RA 2ABWA 1KTIA 4ZOLA 3IBTA 3C6BA 3DFMA 3G0IA 3L8DA 5A4KA 5BVHB 2J3EA 2F64A 1N3IA 1ABEA 3B6ZA 4F1KA 5FPYA 2HWWA 2OGUA 5GJVC 3N2KB 2X22A 4FGLA 2NXEA 3F71A 3C15C 3EWAA 2VFAA 4UFNA 5TPWB 3RU9A 3KQQA 3VDMA 4DJTA 3C97A 3WRYC 5GP1A 4NBTA 2VVTA 5IT5A 2HMUA 2XE6A 3DOIA 3QBJA 4ZOLB 2H7YA 4B74A 4EG7A 1E7MA 3R6DA 2I8AA 1C3OB 4ZO9A 3RASA 1FNBA 3T9AA 1CDEA 5GADl 1V4VA 2A30A 2DE0X 2ZQZA 5JNVA 3HA7A 3AETB 3TG2A 1CX9B 1GAXA 1D1PA 4KMRA 5CBPA 5T7BA 1EBUA 4E08A 3VDQA 1Q83A 3K9LA 5HGJA 3CX8A 5CIQA 2ZYWX 5TQ2A 3ADCA 4YNBA 3A1CA 4P3XA 3PEWA 1QCCA 3VKWA 1J0AA 3FIJA 1KI6A 4RTNA 4O4IA 2QXYA 5AM1A 3EUEA 1C7JA 1QH9A 2GYVA 3AB7A 4J8PA 3SXJA 1DDIA 1G1AA 1WABA 1BCRA 5GAJA 4J49A 1U7DA 3WGOA 3PHJA 1OOEA 3O8RA 1RWMA 1F2TB 3K7EA 3NUQA 3IVAA 2Z4RA 4B34A 1PZFA 4G0OA 4EJSC 1MX3A 3OFVA 4YALA 3GT4A 4GIBA 4EABA 5JWHA 3H2ZA 3JD4A 2XIJA 4H1WA 2NMVA 4L5CA 2HREA 1O2DA 2PQ2A 2WD9A 4DIEA 3IUYA 4WCFA 4K7JA 4EHBA 2BI4A 2VBCA 1YOBA 1XZKA 1FX0B 3FGOA 5JAZA 2CUTA 1CRWG 1R16A 1I4EB 3DYIA 4UNNA 3NNDA 4Q3OA 2H1LA 4DABA 4PS1A 5LB2A 3AHFA 4FLFA 3KOWA 5KNCH 4W7SA 1UBRS 3ZHRA 1GRVA 1O5IA 1KVRA 1NPYA 3MOGA 4FCTA 4PC1A 4QAJA 2QU8A 3ZI7A 1AKRA 2DP4E 3B89A 4DLAA 5F98A 3B8EA 3UB4A 4OQMA 1DHTA 4RESA 4KYVA 4WCFC 4JZKA 3AIOA 4QBFA 5FTNA 1GFSA 4W5RA 3TIIA 4J6EA 5LQSA 3USCS 1GA1A 4MKRA 1IYZA 4NMMA 4UZSA 3RC2A 3Q8WA 5I7AA 3WMWA 5I7WA 3IMKA 3L4JA 1AE1A 4RVCA 4PFKA 1N7IA 5DCUA 3LAWA 4Z99A 3WLSA 1XK7A 3AH8A 1OIXA 3R0JA 3T7TA 2A0KA 1ZW1A 2OKGA 2GXAA 1X1RA 2CW5A 1WWKA 4YP1A 1SKYE 1VKHA 2DULA 2QE6A 2Z5FA 1NP3A 4G63A 1LZLA 3QWIA 5IYZA 2MSKA 1ORTA 2P7HA 1XYYA 3KXLA 1NOKA 3OF5A 5E3HA 1PDVA 3D64A 1IM8A 3TECE 1XKLA 4ZHSA 3L4KA 1XNRB 4TM8A 3U17A 4BFUA 1JFFA 2JAUA 4RE5A 4CIDA 4A5SA 4CMBA 1EFDN 4A6DA 4EF4A 1HYHA 4BJ5A 2R68A 3H75A 3L8YA 4GSYA 2E1PA 1RMQA 3QLUA 1YF3A 1FP7A 4U02A 3U1TA 3WYCA 5JAPA 5A5FA 3BRSA 2C4HA 5ALPA 2HM7A 5DKFA 5F12A 4DUGD 3UJHA 4YHHB 4JLNA 1ECPA 5GJWC 1DX9A 5GOZA 3M6VA 1TEXA 2O2IA 5EIFA 3FUVA 3PI7A 2FPOA 2BLLA 2MYTA 4M99A 2ADOA 1V16A 3KD2A 4UMEA 3IMFA 5TEVA 3V4LA 4DC1A 3E4CA 2D4HA 3K70D 4C2TA 4JT2A 1XZFA 1NXXA 3R3SA 4LNHA 3ZWNA 2B99A 1YRAA 1ATIA 3OICA 4H3VA 3GAAA 4D9MA 2AN5A 4PC7A 2ZRDA 4LKRA 3QPUA 3JPWA 4XWKA 2X0FA 1MG5A 3KQLA 4YWJA 4BV8A 4NQRA 1HI9A 3IEMA 2FVXA 3L9WA 1T5SA 1KJNA 4HYEA 4MQLA 2PRYA 3R3UA 4A23A 5M7EA 3CH5A 4RUKA 3OQOA 2MCFA 4HH1A 3K2EA 3LPLA 4JCCA 1OY1A 1W0CA 2AOWA 4CCWA 5IJ9A 2W2OA 1T10A 1ACLA 1KO5A 2WHEA 2ZT5A 3QA9A 2CVOA 2GAAA 1TFUA 2IV3A 5KX5A 1KE1A 1AO3A 3EPLA 1QH8B 1ZJ6A 2H8GA 1T5IA 2V54A 1WD5A 1M72A 2PL1A 3A4TA 4UUOA 1FXUA 3KPVA 3P19A 2B9VA 1FP6A 2PBZA 4E5UA 1Z6TA 4FTWA 3HB4X 3K92A 4I9NA 2G0NA 1KJZA 4JSTA 4GKJB 4YAEA 4KQFA 3T9EA 4CKBA 1QK5A 1HYBA 1VHJA 3BF8A 1JDPA 1RYDA 1XZLA 2YIJA 3IOYA 3ZGXA 1Q19A 4CHTA 2VYQA 1FSPA 3BFJA 1ABBA 5C8XA 2Z57A 2P11A 1Y3IA 3Q9LA 4HDAA 2D2XA 3MGBA 3T61A 1Z38A 5LKAA 4RPGA 1T5OA 5KQRA 3GEBA 4RO0A 2AOTB 4ZI5A 5HQ3B 4QAQA 5HUJA 3O3NB 1TECE 2GPWA 4BO9A 5E6SB 2UZAA 4MCHA 3PDCA 3IKVA 4I8IA 3RFCA 4AJ1A 3NG1A 1NMZA 4JBGA 4PZEA 4CLRB 4Z6KA 4B6QA 4Z4IA 3EWIA 2VKQA 5F64A 5FYQA 5DN6D 4HVLA 2JRCA 3NKLA 2EP5A 4CMGA 3CR8A 4CKZA 1Z0DA 5G1NA 5AKZA 2L18A 5LQAA 7YASA 5FBZA 4FN4A 1FMCA 4OLHA 1K97A 3PGJA 1GPWB 4UUAA 5MHTA 2X0IA 1F38A 2B34A 1R0ZA 3SHVA 4ESEA 1I4DD 2CL6X 2BFPA 3VR6D 3I2JA 2G7ZA 1ZKDA 2YC4C 4O4JB 3B36A 3PXEA 1D07A 2PCJA 3JZAA 2ACKA 3ZBTA 3PKIA 1MAWA 3AIIA 3OHPA 1HT3A 5H7XA 3V32A 5ICSA 2ZM6B 4TZTA 2X7JA 4ZO7A 2ZSFA 4AN4A 1QIIA 3CQ9A 5KU7A 5DASA 3HR4A 2WY2D 5BORA 1T1IA 1Y1QA 3H2GA 3OEEA 1GPLA 2ZBFA 3GRAA 4L4UA 3DLCA 1I24A 2YMQA 2GETA 2OZPA 1BVHA 4M9RA 1GTMA 1NXOA 2XA9A 2CNBA 3KHUA 2NU9B 5DYIA 1JBKA 2QTFA 4KRXA 5ES3A 2R79A 1L3BA 5ALXA 3STWA 1BTOA 2Q8PA 3IIJA 1CYDA 2AUTA 2C58A 3I9V6 3Q5EA 2NUPB 3PIRA 4I0WB 4JL8A 1FJ2A 1U2RA 3WICA 2B8TA 1ORHA 3BMCB 5FDFA 3D2CA 4NE9A 1M0TA 5AM0A 2QGZA 1I3KA 2GZRA 4QUAA 4XPZA 4XZ3A 4ZMSA 5JT1A 4BNGA 1QIGA 1QHHB 2ZULA 1NRWA 5EE5B 4P4UA 4WY5A 1E20A 3KT6A 4W6ZA 1P91A 5AUQA 1WAMA 3UG6A 1D0SA 4U7GA 1YE5A 1T3TA 5IXJA 2OBFA 4LYJA 3BWBA 1J24A 1SEVA 1JAHA 3PB3A 4U2EA 3A3OA 2YXPX 4R1TA 2I6QA 3WQRA 1DJLA 1G5TA 4ER7A 2B1GA 2H5JA 2ZTMA 1NOIA 4CM6A 1C9YA 5EESA 6AT1A 1JQDA 2BUCA 4MHOA 4OSPA 4HLUC 1M5TA 3AZOA 3GGCA 4AJKA 4RVDA 3VC7A 5C1BA 3K96A 3REOA 2BEWB 4QM6A 1UFRA 4OB7A 3DB2A 3GVXA 1XAGA 1NY6A 3L2OB 5H4GA 3CLTC 2YHIA 3OJXA 1SVMA 1WETA 3DO8A 4DUPA 4C4OA 1YU9A 2Q2WA 4ZZ2A 4LWZA 2AG8A 1P7YA 3HQ4O 3HYRA 3CPSA 3E7FA 3LRTA 4OYYA 1E7QA 1JLKA 2DKFA 1QFYA 2QDXA 3OQMA 4MV3A 5ALDA 1II9A 4ZT5A 3EXHC 3I62A 3O8NA 4Q0MA 3AERB 2JLQA 2VQEB 1AK1A 2H9YA 3I6ZA 4HLUA 1M34E 5IKEA 1QRSA 2GASA 1YZYA 4LWPA 4JI1B 4H7FA 5GZ1A 3OJLA 2W48A 4JXJA 1M6NA 2B7BA 2GNAA 4FYPA 4N7BA 5IC5A 3EGVA 4D96A 1E1CB 3NBAA 4YROA 1ZRNA 5JFOA 1ZOOA 3LSYA 1YZ3A 2OHOA 3AP2A 3DWEX 1JFTA 4LAFA 3WISA 1WY7A 4U9HS 5JD5A 4FSDA 3SZOA 1Y3BE 2AJCA 2AKAB 3Q0IA 3DTNA 2ZOSA 2A2ZA 4G8CA 5JCOA 4BJ3A 4ZK2A 1BKSB 2GO1A 3DL2A 4AMYA 2XAAA 1N7GA 2R4UA 2Y0EA 4LGMA 5DVZA 3BS4A 4K26A 4WH0A 1E7SA 4G6ZA 1NA5A 4JJ8A 5EQJB 3QTLA 5A2GA 4L8FA 2CFSA 5BUCA 3GH1A 4EFDA 4YMHA 3PPWA 2RBGA 2XDYA 1AMOA 1U1IA 3F98A 5KC9A 1O6BA 3SDSA 1GNRA 2QI9C 3EGWA 2G8LA 2Z6VA 1LKZA 1LWOA 2PBRA 4FYXA 2NPOA 1QP8A 1L5OA 1IQPA 4O1IA 2IIBA 2YBEA 1Z9BA 4ZRNA 2AN4A 4IHJF 2GRAA 3ZIAA 1NN0A 3BK2A 2B83A 3DW3X 4QEDA 5FOVA 3ZDRA 1Y8RB 2CMFA 1Q0SA 3GB9A 3LU1A 2CUZA 2ILTA 1G2OA 2IYPA 3HC7A 4BMNA 1RC0A 4ZP1A 2PKQO 2WWRA 4PYLA 3X1WA 1Q3TA 3TQIA 1GGEA 3LDAA 1ZDMA 2JD0A 4H59A 3G2KA 1F3OA 4TTVA 1GL7A 1WVGA 3OCYA 1H9AA 2EJWA 2IVZA 4NJEA 4LHWA 2R86A 5AJYA 4BASA 1Q14A 2R62A 3LWNA 4CKXA 3A4VA 4BYMA 4H17A 5D01A 2KW5A 4K05A 3AZQA 4BL5A 1N5LA 4RBNA 2WHYA 1WXHA 3B6MA 4AYXA 4RVUA 4TGLA 5EZ6B 3M8KA 4CM8A 4EGQA 2BGLA 4XOIA 4J2HA 1L7RA 1Z5UA 4XR9A 3SEAA 4G0VA 2WDPA 4L6CA 4M3NA 5D6OA 3VNQA 1T4MA 3KQSA 5CA1B 2OXFA 3HRKA 4Y1RB 4R2IA 4X94A 1RYMA 5E8JA 1V6SA 5DT2A 5SV2A 5I7VA 2ZYIA 5BN4B 2C2WA 4PAMA 1A69A 1EDEA 2VZLA 3O1JC 5JCJA 2FPUA 1QCDA 5FX2A 3G8BA 1TZBA 4GVLA 3WAKA 2PMKA 3ELUA 1GGKA 2Z1NA 1JXAA 4A3SA 4JT8A 4LHEA 1KEZA 3TXYA 4CIWA 2V4UA 1F60A 3FR7A 4PLWA 5DGCA 3SJZA 5BQPA 3ZV3A 4C7BA 3OG9A 4UOQA 1BDMA 1Z6AA 5THKA 1R66A 1YI0A 5JU6A 4NMXB 4DBZA 4EM6A 4IMJB 5HDBB 4HDKB 2A1UA 5IS2A 1PJAA 4C0SA 2YV2A 4OCZA 3VPDA 4U63A 1PLLA 4AL4A 1F2UA 3QKRA 5HRCA 1SZDA 2Y4OA 4NOKA 4O4LB 1IOVA 3WRVA 3HVKA 1NBIA 3GF4A 3QQ5A 3QU7A 3S8MA 5CFOA 1RRPA 2HA2A 2PBLA 1GZVA 3P9XA 3BQNB 4DWWA 2C7PA 3BF7A 4IXDA 2HOQA 4D3YA 2PX6A 3QPBA 1DXOA 5DTIA 4JLDA 5EYPA 2WJ6A 5BMVA 2ZKIA 4R8SA 1T9GS 1PJQA 1D0VA 5AK5A 3R6TA 3F2IA 3FYUC 3SIPA 1O6FA 5E9QA 1IM2A 5KQGA 1TO1E 1KOJA 4TYQA 4JNKA 5CK4A 2C9OA 3CW2A 4J0DA 4Y6GB 3VPFA 2WSYB 1Y6FA 3H11B 1CY4A 3O8DA 4R71A 4UNRA 4B3GA 1QHXA 3LQ1A 1GZ7A 1XVAA 4PX5A 3JASB 1PX0A 5IDWA 3DOHA 5KWJA 1BHJA 4I1UA 5K3CA 1QKKA 1V4BA 2IH2A 1XFDA 4D3FA 4NMWA 3L41A 3G79A 4ME6A 3EGIA 4WW0A 4WY8A 5I9BA 3H1GA 2ZRNA 4HATA 2K7ZA 4MGHA 1CTQA 1JRLA 1PG2A 4JVMA 3BBPA 4ZYVA 1QM5A 5IDVA 1XR3A 2IP4A 1KDOA 4J1TA 4QODA 5FEMA 5ITWA 1JECA 2VNSA 4QPCA 2ZGVA 1W93A 2FU5C 4IIJA 2R48A 4BFSA 5BSEA 1YS6A 4U2BA 1X80B 1QGED 3ODPA 4Y1GA 1ZIPA 4ZXPA 5KAPA 4YXWA 4GPAA 1IJKA 2SECE 3CSSA 2A4MA 2WILA 3HBMA 1FS6A 3WBJA 4HKTA 4YCLA 1U9JA 4HRVA 4I3GA 3GLHB 2J08A 3AI1A 3NJRA 3JR3A 5B6PA 4ZEOA 1JZQA 2QL5A 3AUXA 5K4AA 4FFBB 5BSUA 5KUTA 3S2UA 2ZS7A 1L4GA 5BWBA 3H42B 2LTAA 4IFTA 1U3CA 5FPKA 3AP3A 3SD7A 2VL7A 2YZGA 5KPJA 4FB5A 4M8KA 4W9MC 2AV6A 5JNRA 4N5HX 3T7SA 3FUCA 2WAMA 3GDFA 2C92A 4KYUA 4RVHA 2A9KA 4Q34A 2O2SA 4LS3A 1N2XA 3DKVA 4UZFA 5TPZA 3VR3D 3ESDA 2I65A 1Q7CA 2C4MA 2CJFA 5BYBA 1JBQA 2MINA 2XYQA 1UJNA 4RW0A 1TU4A 3BBLA 4RAQA 4RPJA 3ZDEA 4G0WA 4ZZ1A 2IHJA 2QNBA 2WJZB 3EQ9A 2BFNA 1XXHB 2JIOA 5F4BA 1WA5A 3I37X 4UOEA 5DHPA 2W6MA 4YMGA 4NULA 4FS3A 1SKMA 3ORSA 3WVNA 1P7WA 2NSDA 3B53X 2XIQA 3O2SB 1W44A 5LYJA 2PQ6A 3D7SA 2EZUA 2AR7A 4OFBA 1BAPA 3OT4A 1O5OA 1NR5A 2JFQA 2XVXA 3AEQB 3NM5A 1GEEA 5J9FA 1IJEA 5DMHA 3V34A 5IBCA 4DQKA 4BS9A 1RAEA 3DEAA 3M6LA 5FL7A 1JR4A 4OI1A 2KS6A 4AX8A 5A4MS 3KWLA 5HM8A 2BRUA 4Z4EA 4BKOA 1RVDA 3QSGA 1T0IA 1W88B 4LDPA 4ZV4A 3E5RA 1M8JA 2BSXA 3KAPA 2PX4A 3KU1A 2O8BB 1ORVA 1E9AA 3QKIA 1OVGA 2C95A 4EY7A 3RADC 1PK9A 3DKRA 3QX8A 4M7OA 2FW8A 1EFLA 2BTOA 1GV0A 2CHQA 2GTIA 3MCZA 1ITZA 3SK0A 4BFVA 1M8KA 2C9BA 1KS2A 2E18A 2ZJ6A 1VSTA 3LK7A 1DDGA 2Y8EA 4F4UA 2QIPA 1LFAA 2BZGA 3KS9A 5D3MB 3TSYA 4A91A 3D2BA 5C8VA 1A50B 2G9ZA 1ELOA 1HYEA 1GUBA 3D1LA 3LVQE 3QJ5A 4BTLA 4MDEA 2RKBA 4DY6A 2DPGA 3G0CA 4XWAA 5KVSA 4K3UA 3FVQA 1PDWA 2PR2A 4D7AA 3IRUA 3KEFA 3KT3A 1Z37A 3U9TA 3ABIA 1FFDA 1ZICA 3L8FA 3W05A 1P6XA 2AOVA 1D2NA 5CLLA 3K09C 2EF1A 1XXHE 3QW2A 4B5LA 3BB3A 1P5ZB 4DDMA 1ZLYA 4HN2A 3LBYA 3ZCPA 2VWQA 2HCJB 3PQFA 4HWPA 4RFSA 4WWHA 1CRZA 1I30A 3NP7A 2LW7A 1E3EA 4LHYA 5DF1A 4BHTA 2VWHA 3KLOA 1DJPA 3HBFA 1EQ2A 1OBCA 2I1LA 4KSBA 4OAOA 3UUFA 3AYXB 2HBYA 5ALJA 2XGGA 4ACBA 2VQ6A 5EHIA 1JEQB 2MR5A 3DCYA 3DMRA 3QFSA 2AD1A 4MW1A 4ARAA 1LVHA 4DXHA 3TQSA 1KORA 2XB9A 4KHZA 1HR0B 2GD0A 4S05A 4R2WA 1AU9A 2J9XB 5JZBA 4CFYA 4ID3A 3A1WA 5CM2Z 3A27A 4FFOA 1ZUNB 3P9ZA 2D59A 5C4IA 5IZCA 1RW4A 2XBMA 4ITVA 1U5CA 2PIDA 3ESXA 3LRXA 2OV1A 4BZWA 2ZLBA 4YACA 4INOA 2FFQA 2Y0PA 2FR1A 2NAFA 5AHWA 4JK3A 2QWXA 1MFPA 2JCBA 2G63A 1JSRA 2C88A 1GG8A 3GK3A 2OY0A 2WIAA 5LN1A 2IOFA 3K0EA 4UREA 5EAIA 4NJMA 3H2BA 1AD2A 1G6Q1 4YHBA 1ONBA 3C98A 3GFPA 4MW5A 1TO6A 2Y77A 3NBQA 5ALOA 3C6XA 6CHYA 3S7ZA 4FYIA 5GM1A 4HGPA 3M89A 2ZBDA 4I14A 8ATCA 1BMFA 3ZVKA 1PR4A 1T1SA 3PQ6A 3PXCX 4Q16A 1T36B 2X13A 1E1QA 2OXRA 3TTVA 2B4QA 1DJMA 1TYCA 2C7VA 4UATA 2WAYA 4A92A 5EMKA 1S3SA 4UHHA 5EIOA 4Q4JB 5BY2A 4EMBA 1PQPA 3RIGA 1PYDA 4HZUA 1TXGA 1MRZA 3EBPA 4MUJA 1XP5A 3UWOA 2WF8A 4B7CA 4C7KA 1OBVA 1H9CA 1SWVA 3ZYZA 4BP1A 1UJ2A 2IE8A 3D2LA 4O3FA 4D4IA 5DI3A 5I8WA 1EMDA 1KEWA 2BISA 1M2VB 1ZC4A 1FRFS 5SYAA 3QVLA 2GESA 3EGXB 4CQNA 3VR2D 5EZYB 3T3MB 4I9HA 4J75A 3BWCA 2RHMA 1E3LA 1V8FA 3UGTA 2GAFA 2O2JA 4CTNA 9MHTA 3SJBA 1RWQA 1NN5A 2IP1A 2WPNA 4U3JA 1VL6A 3IAFA 5E7QA 3RRXA 4ARIA 1H4SA 2JAXA 3BA1A 1IQUA 1TIPA 4AY4A 3OTIA 1PYOA 4AKEA 3ILSA 2MYPA 4FDUA 2H7VA 3JYQA 5DX8A 3W9YA 1PR9A 4F5DA 5LDHA 1KQFA 2NTNA 4YJKA 3AF3A 3HY4A 1JXOA 1EFUA 4I5IA 1OF1A 1QWSA 2IHVA 2Q5EA 3LRPA 4FE3A 1NW7A 3FW1A 5EERA 1I4OA 2XCIA 4PNHA 3WYFA 1J1ZA 4RTJA 3OKAA 4ZJPA 9ABPA 1T6NA 3BCUA 5HJ7A 1PVDA 2EHDA 4LBWA 4NHOA 1RJWA 2J4DA 4M38A 5KJFA 3GXOA 1M0WA 2J30A 4AG5A 5LP6C 4A8JA 4MRVA 1L8XA 3ZZMA 4JR2A 5BWMA 1WQ3A 3EZLA 4CF4A 5LNK1 4PPFA 1IBLB 2R8BA 4X3CA 1U94A 3TI7A 1QQ6A 1RPJA 1Q1AA 1UPCA 3FVTA 4DIDA 3T7RA 2CXNA 3W3AD 1G8JA 2PUWA 2GKGA 1E2NA 1C7RA 2PV0A 3PUVA 1XCLA 1RZ3A 4KQKA 4UM9B 3FX2A 3SYRA 3TQRA 3VKFA 4NBVA 1I6LA 4UU8A 2CV2A 3H5VA 2FPGA 4JUAA 2CHGA 2H2WA 3E9EA 3UKOA 3GYGA 4EHFA 1OFUX 3I2FA 2F3SA 3JAWA 1N0HA 3ICCA 3PG5A 4WLFA 4JI3B 2C2XA 2RGYA 1LXCA 2RAUA 3SFVA 3TIFA 2ZBVA 2G70A 2FPSA 1J5PA 1HH4A 4BQQA 1X7WA 2J48A 3UC5A 4MDFA 3JQAB 1YU6A 2PYZA 2QAJA 4BDSA 3TPZA 2NO4A 3VNUA 3WHIA 5U4QA 4N0PA 4URUR 2DWQA 1I3CA 1PWEA 2FFJA 3GAZA 5IAOA 1BEZA 1G5PA 1M5UA 1WXGA 1GV1A 1WZNA 1WU7A 1W52X 3B6EA 4MJXA 5B3AA 3V7NA 3JS5A 5A7GA 2GBLC 3MK31 4HWKA 2NACA 5HE8A 5H9WA 1G66A 3EOAI 2FA9A 4ASUD 2F3PA 1KQGA 4IVNA 5CNJA 1LV7A 3ZVLA 4TVOA 1TEVA 2GZSA 1GFIA 3LHSA 3OPYA 1H05A 3E61A 2OR3A 1VPEA 2J3HA 1SWWA 2Q2QA 3OHMA 4HXEB 3V9PA 4KZKA 4ARBA 2O8CA 4HBZA 1P1CA 1JPVA 4KI7A 1EX1A 4RK1A 1FVHA 1QPBA 2QMOA 3K0AB 3UK0A 1J49A 4BGEA 3AEKA 1V25A 3EPRA 3O8BA 3WNBA 3R8FA 4L8VA 2NU6B 5DK6A 3OPYB 2DBZA 4FX2A 1T0BA 4Q9IA 3MTEA 3O2QB 3NFYA 1XHEA 4F3TA 5EP3A 4JGBA 2NUAA 1O95A 4IYRA 3NYWA 3FRIA 3P5BA 4AZWA 4BY9E 3W6ZA 4EUEA 3QBVA 3UW1A 3PSHA 1JU4A 1TGVA 2RFLA 1XMIA 2B82A 1P1JA 1YQWA 3FWYA 1INLA 3IPAA 5E6UB 4RK4A 2O4CA 3OPQA 3DC7A 1OCEA 3DMTA 3HACA 3PEVA 5HCUA 1XZJA 3EZGA 3K8ZA 4YV1A 4YLEA 5ALWA 4MH0R 1PR5A 4Y9TA 2NUAB 5HFAA 1BOOA 1T4BA 1NIJA 2GEUA