2PNFA

Structure of aquifex aeolicus fabg 3-oxoacyl-(acyl-carrier protein) reductase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
248
structure length
248
Chain Sequence
MEIKLQGKVSLVTGSTRGIGRAIAEKLASAGSTVIITGTSGERAKAVAEEIANKYGVKAHGVEMNLLSEESINKAFEEIYNLVDGIDILVNNAGITRDKLFLRMSLLDWEEVLKVNLTGTFLVTQNSLRKMIKQRWGRIVNISSVVGFTGNVGQVNYSTTKAGLIGFTKSLAKELAPRNVLVNAVAPGFIETDMTAVLSEEIKQKYKEQIPLGRFGSPEEVANVVLFLCSELASYITGEVIHVNGGMF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Aquifex Aeolicus FabG 3-oxoacyl-(acyl-carrier protein) reductase
rcsb
source organism Aquifex aeolicus
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-[acyl-carrier-protein] reductase
total genus 92
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2007-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2pnfA00
5EESA 1A9YA 4RZIA 1I01A 1BXGB 1DC4A 1YDWA 4RLHA 4KUEA 2I99A 4PZCA 3IUPA 4DPKA 1GR0A 3IMFA 3OJEA 2DAPA 1E1KA 3JD4A 5COQA 3TZ6A 1T1SA 2VNSA 2J3IA 2Y68A 1ZK0A 3HADA 4AJEA 4BKRA 1P1IA 3AU8A 1HDCA 3ZWNA 3DBHB 5JW6A 3RKUA 1V9LA 2VYVD 4BIIA 4GX5A 1ZXLA 2FPGA 2P9EA 2Q2QA 1Y6JA 2OBYA 3KLMX 5CEFA 5MGBA 3H2SA 3SX2A 2IEDA 1JKFA 1H94A 4UVEA 1ONPA 1NQ5A 2CZCA 5A1TA 1ZK2A 4BNNA 1LC3A 4WLUA 3NDJA 4GKVA 3JQAB 1YS4A 4CLOB 2JAHA 2BD0A 3OHSX 4E30A 3DMTA 1P77A 1A72A 2QW8A 4QFDA 4R9RA 5CDYA 3ROPA 1P1HA 3PEFA 1QXSA 2GR9A 4B3IA 2ZIZA 4JNKA 3GGGA 4Q3EA 1HXHA 2BHLA 3ZU5A 4DIBA 3L4BA 4UEKA 3TOZA 1KY5A 3R1IA 1HSOA 1XKQA 4UEOA 1GQYA 5H83A 1H9BA 2ZTVA 3SBOA 3BMQA 3CTMA 3U0BA 2O4UX 3ZHYA 1P45A 2PKQP 5AXDA 5AXAA 5IDQA 4PFJA 1PWXA 3HZZA 3WLEA 4DLAA 4DBVO 3QY9A 1I32A 2PR2A 1MG5A 4NI5A 3KYCA 2DUUA 3V2HA 3ETGA 4FQ8A 3RBXA 1W6UA 3BTUA 4L4SA 2D2IA 5JO9A 1U3VA 1PJ2A 3GVHA 4NBVA 2I67A 3UW3A 2FZWA 3GHYA 4MVJH 1YOVB 2DT5A 1EUCA 1G1AA 1PZHA 2W2LA 3HHPA 3D0OA 2DUWA 4BO9A 3ZHXA 5HWSA 1ZSNA 1WW8A 2WE8A 4FFMA 4PVDA 1LC0A 2CF6A 2H9IA 1WMBA 4WLOA 1X1TA 4HFRA 1H2BA 1DSSG 4RV9A 4XGIA 4JROA 3ZNOA 1PSDA 4BGVA 3LVFO 4N5NA 1R4NA 3GT0A 3RC2A 5HTOA 2B5WA 1PZEA 2VWHA 3EUWA 3H9EO 1XU9A 4FD3A 5KWEA 4CM9A 1O8CA 4XKJA 4CM8A 3I9MA 3EYWA 5K6AC 4I9UA 1EBUA 4K1LA 3WYCA 3RKRA 4TMFA 3H5AA 3FWNA 3V1YA 1KC1A 3PHHA 3JCZA 4M86A 4NU5A 4B8WA 1DHRA 1KEPA 3LC7O 1RM5A 4BO7A 3AI2A 1UDBA 2V7PA 1IL0A 1P31A 3PGJA 1P1JA 2VYND 5A06A 3I4CA 3PIDA 1TA4A 5EIOA 3WGTA 3JSAA 4FB5A 1ULUA 1ZCJA 1ZNQO 2V6FA 4N5LA 4Z3KA 5G0VA 2X8LA 3QWAA 1I2BA 4K6FA 5G0WA 2V6GA 4PLYA 4BNUA 3MOGA 5DULA 4A7PA 4WECA 3I9OA 5F21A 5L7YA 4CUKA 1XYGA 1ARZA 3QIVA 6ADHA 2FY8A 3C85A 3WJAA 4P4GA 1YBMA 3ZWCA 3WGHA 3PHLA 1DXYA 4MKRA 2C5EA 2VOEA 1UP4A 3WR5A 4WLNA 4LW8A 1BSVA 1HETA 1X13A 4ND2A 5ENDA 1YONA 4BO0A 1IYZA 3I1JA 5F3RA 5I8ZA 2X22A 4QECA 4S3MA 3O8QB 1NBOA 3CPSA 4BO8A 5TIIA 3GMDA 1E6UA 2B37A 3ANMA 4IQ8A 5A9SA 5IAAA 5BQFA 2NWQA 3PLRA 1J5PA 1P33A 4NJMB 5CPFA 5BNFA 5KJ6A 1KEVA 1C3VA 1J0XO 2HQ1A 3MWEB 5T67A 3ROMA 5JDIA 4RPKA 2VRCD 2QYSA 4PLGA 1VKOA 1YGYA 3NT2A 3HDYA 2QIOA 4D3SA 5JNLA 4XD2A 3N7UA 3TWOA 3DBRB 1OC2A 1R66A 3DAFA 2WEKA 4M8SA 4CM9D 3TNLA 4XIYA 4JP2A 1LI4A 2VYVA 3GEDA 1I3MA 3LQFA 3NV9A 3W1VA 1H5QA 2PH3A 4XYMA 4IDDA 1N8KA 2VTDA 3U4IA 4NDNE 3WOHA 2OBNA 4A03A 2EEZA 3IP3A 1EE9A 1O9BA 1BW9B 5A5FA 2IZ1A 3F4LA 4OKNA 4RZHA 2B36A 2IRWA 3WTBA 3WQSB 1YO6A 1PJSA 3JQAD 5DOZA 4AICA 2NVUA 1FDSA 1UP6A 4UUMA 4OQYA 2VHVA 3AK4A 2BGLA 1VL0A 2VNAA 4BKUA 5LDGA 4MVJP 4XDYA 1ZMTA 3HWRA 1NAHA 2O3JA 1UXKA 3D3WA 3K96A 4FGSA 3OF2A 4L4XA 1PJLA 3Q9UA 3AY7A 3K8ZA 4TRNA 2HMSA 3RVDA 5DZSA 1WP4A 4JXKA 1B16A 5JBIA 4J49A 3QHAA 2YQ5A 2BLLA 4M89A 3SJUA 2YZ7A 3RSHA 5CDGA 2BELA 2OMEA 2C59A 3DFZA 5IXSA 1ISIA 1R4MB 4P38A 2X5KO 3JYOA 1EE2A 1FDVA 3GPIA 5DP1A 1ONOA 5L53A 4LVUA 1LDBA 3NJ4A 3ZWAA 1NQAO 2NV6A 4I1IA 1XA0A 1TT5B 5F1OA 4D7AA 3RASA 3LT0A 5F5NA 1Z45A 4BO4A 4CMJA 1RYDA 4J0FA 2NTVA 3F3SA 2BRUA 5CPBA 3ICCA 4QSMA 4CL8A 3WBFA 1LXCA 4AJLA 2D5CA 4TROA 1CWUA 1PR9A 1GYPA 2X86A 1M66A 4PIVA 4U7WA 3VH3A 4KMSA 3WNVA 4PN3A 2PNFA 2EF1A 4KTVE 4NK5A 3S2IA 4DQUA 1DIHA 1NQOA 3GFBA 1B8UA 1UH5A 3DONA 4OSOA 4XB1A 3V1UA 2EGGA 2GZ1A 4WCFB 4AJNA 1BHSA 1Q0QA 3ENNA 4CMKA 3WTCA 4F6CA 2C7GA 2YYYA 4IZHA 4RF3A 2P4HX 1PJCA 4LVCA 7MDHA 5EN4A 4F45A 1DRUA 1NR1A 4FFPA 2X5JO 4D44A 3STHA 5I9LA 3FR7A 4OKIA 3AM4A 1T26A 2GERA 4PZEA 5JPIA 4AJIA 4E5YA 2RH8A 3IIEA 1P3DA 2JFHA 1XLTA 2H63A 4ZICA 4PLHA 3U62A 1A4UA 2XOXA 5BSGA 3ITDA 4GLLA 2DVMA 4IM7A 3QWFA 3GLQA 5KVCA 4J1SA 5TC4A 3JQCA 1P9LA 2ZCVA 5G0UA 1I2ZA 1LRKA 4Z9FA 1HDXA 2PWZA 3TOXA 5CG2A 4KZPA 5DBFA 5T5QA 4QO7A 2EWMA 2DPGA 2UAGA 2GCGA 1Q7CA 3HJAA 4BB5A 3JQDA 3ZU4A 4EYEA 3QVOA 3VAZA 1ADBA 4K28A 2AQ8A 4DLLA 1VSVA 3E5MA 4JGBA 5G4KA 3B1KA 3PHIA 4ZQFA 4ZVVA 4OO3A 4XQEA 4KWIA 2AQIA 2FSSA 5L9AA 3QJ5A 8LDHA 3BTSA 3CINA 3JD3A 5A9SB 4L8VA 1HE2A 2RHRA 1N2SA 2WJPA 3D7LA 4IGEA 3RFTA 1R4MA 1D4FA 1X15A 5IJZA 2BF7A 3LT2A 5LC1A 2HO5A 3RJ9A 3Q2IA 5C5IA 4DRYA 1OZAA 3ASUA 3S55A 1NVMB 3SXPA 3NTRA 1VM6A 4MIOA 3DAPA 4NQZA 4DBZA 3GOHA 3HDJA 3PWZA 1EVZA 5JDCA 4BNLA 4XYLA 2ZB7A 4NBRA 5CDSA 1D8AA 1DBVO 1ENYA 3I3OA 4FSHA 1SPXA 2Y1CA 3QV1A 1C0LA 3TZCA 3HDQA 3KYDA 1C0KA 4MDHA 3WXBA 3F5SA 2YV3A 1UUFA 3NT5A 3MJTA 3PJFA 4IIVA 1X7DA 2AQHA 2Y0EA 4BNKA 4KQWA 1MLDA 4Z0PA 2NQTA 3R0IA 3OETA 1L7EA 3CZRA 4LISA 4Q3DA 1P0CA 2AE1A 2W90A 3DTTA 4EGFA 4BB6A 4BNIA 4E5PA 5I7SA 4IJWA 1P44A 4E5MA 3OQBA 4C7KA 4IS2A 2BFAA 1GYQA 3C24A 3TZKA 3GEMA 3PTZA 4D3DA 1HSZA 3K9QO 3QWIA 1DRWA 1QYDA 2EW8A 5G4LA 2I66A 5GMOA 1PL6A 5U1PA 4LSWA 4CODB 5KVVA 2O2SA 2QYTA 4NJOA 1C0IA 4RPJA 4BQPA 3AOGA 3FNEA 3ZWBA 4B4VA 4IJVA 2A4KA 3DBHA 4UUOA 1B3BA 4YEDA 5KVSA 4J0EA 2WMDA 4CV0A 2PFGA 4DVJA 2O3UA 2CNBA 2GO1A 1T24A 1NPDA 5ENVA 3MOIA 2DFVA 3RUCA 3TRIA 4B7UA 2J8ZA 4BKPA 4NG5A 4Y67A 4PRLA 2DLDA 4M87A 4RDIA 4XCVA 3RFVA 5I8WA 1EDZA 4Y98A 4ND5A 1GQ2A 1YL5A 1VJ0A 1YOVA 8ADHA 4L75A 1J4AA 4ONEA 5BT9A 3BMNA 5A3JA 3WIEA 1P74A 3VDRA 2FOIA 1YB4A 3QQPA 4HKTA 1UXGA 2QHXA 3F1LA 5KCZA 5ILOA 3T4EA 2GUGA 3GGPA 1T2CA 4QQRA 4TKMA 1GZ3A 4FR5A 3KSZO 1IZ9A 1DOHA 3EK2A 3GC6A 1GL3A 1Q7BA 4ILKA 1RWBA 1XQ1A 3EHEA 1DFHA 4PG7A 4Q3CA 4CV1A 5ICMA 1HZJA 5I7VA 3BHMA 3HFGA 3DOJA 2AG5A 3E1KA 4MP6A 1SC6A 3RC7A 4QT0A 4NR0A 2DC1A 4AL4A 5ITWA 2ZYDA 1KY4A 1YKFA 1X1EA 3JQ8B 4WNCA 4HXYA 4FFRA 5EJ2A 4KDFA 2HKIA 2PGDA 3GEGA 4UULA 3JQ7B 1G0NA 1F12A 1U5AA 3GFGA 4UREA 3GDOA 5COBA 1UXIA 1N1EA 4GSLA 4XR9A 1IHYA 3JV7A 3PYLA 4Y8VA 4DLBA 1SMKA 2X1HA 3GY0A 4GH5A 2GN6A 1U4OA 1V6AA 2QZZA 4YCAA 4YAIA 1ZVMA 3ZH2A 4AFNA 4R1NA 3U5TA 2YV2A 3QE3A 1CJCA 1S7CA 5AXCA 1HDRA 4TZTA 1GUYA 2ZJ0A 3VH4A 1T25A 2V6BA 4ROSA 4R5HA 2JD0A 4BNXA 3W4IA 3GK3A 2Y0DA 1BXKA 1MFPA 3AY6A 2ZYAA 5FFFA 2B0JA 4XQGA 4LGVA 1I30A 4RDHA 4BGUA 3JQ6A 3PZBA 4R1TA 5F1PA 3KSDO 4R69A 4XRRA 5G4KB 1E92A 2EP7A 4KUGA 3GF4A 2VYNA 5A05A 3JD1A 3PQEA 4J43A 4RPLA 3QW2A 1RJWA 3IL2A 1RM3A 4OHUA 2DBVO 4J16A 1BMDA 1CDOA 3K30A 4BHTA 2OUIA 4U6QA 2C20A 4J4BA 1TT7A 3D4OA 4HWKA 4WASA 1VRWA 1CRWG 3NDRA 4AJJA 1DJQA 1R6DA 1UZLA 4D79A 1B15A 1KVSA 5LDHA 2E82A 1TI7A 5TT1A 1MB4A 4I9HA 3W8DA 3NTOA 1NHGA 1NNUA 4K6CA 3DBRA 4RVHA 2D59A 2UV8A 3Q1LA 1Y8RB 2DQ4A 2BI7A 3EAGA 4A0SA 1U2GA 3U3XA 3VVBA 1BDBA 4IGFA 3VDQA 2O4CA 1U3UA 5JCJA 2PZKA 1WZIA 3HE3A 1YVEI 3KHUA 3IQDB 1VKNA 1R0LA 1LDNA 4UVDA 3DZJA 4E2WA 1YDEA 1PJTA 3GG2A 3V1TC 4WEQA 3P5SA 1SNYA 2VOJA 3L6DA 1EUDA 1VSUA 5DCYA 1ML3A 1HLPA 4M49A 4P4NA 1PGPA 4H7PA 5JAQA 4E5KA 5FWNA 4RPHA 4P8RA 4OQZA 4MO2A 1K89A 1ZFNA 1NPTO 3KO8A 5FF9A 4CR6A 4E31A 5EQFA 6LDHA 2VN8A 1EVIA 1H6CA 5EQDA 3UXYA 1K6XA 2PD3A 2P9GA 3M2TA 3GUCA 3OH8A 3KOUA 3ZW9A 1H0KA 2CDCA 3BTOA 1OBFO 4FOOA 4BO2A 2IZ0A 3RC9A 4B79A 1BW9A 1SAYA 2C07A 1EDOA 3UOGA 3DOCA 1LA2A 4L9RA 1K5HA 2GZ3A 2QG4A 3NT4A 4GWGA 4YJFB 1FDWA 3EZYA 4IDGA 4W9NA 4BV9A 1LSJA 3C1TA 2NVUB 4D0SA 3PQDA 4YXFA 4DIFA 4BNJA 4HX5A 1HTBA 3H4VA 4CM6A 3V5NA 5JAMA 1CERA 3GUYA 2FSVA 3AI3A 4JBIA 3W4KA 5IDXA 3KSUA 1DC5A 4IDCA 1T1RA 2B35A 1AN9A 1UP7A 4IPTA 4B4WA 4FJ0A 1CEQA 3QVXA 2A94A 3MZ0A 1FJHA 2YHIB 2VRBA 4DC0A 1IE3A 3OECA 1IULA 4FC7A 4YAGA 5B4UA 1Y81A 3HNPA 5CEJA 3WWZA 3V2GA 1YQGA 3BMNB 4L73A 5IG2A 1M2WA 5KKAA 3DHYA 2EP5A 2AMFA 3ZNPA 3OMLA 3FI9A 5JFOA 5FYDA 5A04A 3E9QA 5C7OO 3H3FA 4ZGWA 4B4OA 5G0TA 2Y0CA 3A9WA 4ZN6A 4NK4A 4TVBA 3WNQA 3ZWXA 2JD1A 1PZFA 4CQMD 4AJPA 4HFMA 4YT8A 1UXJA 1PS8A 3WICA 1CETA 3C8MA 2E48A 2PGJA 4W7HA 4EUHA 1K2WA 3JD0A 1Z74A 1HYEA 1PR3A 3NEPX 3S2FA 2RH4A 3QVSA 1A5ZA 4ZHSA 1ENOA 4RVFA 4UEJA 1EK6A 4PRKA 1N7HA 2RIRA 4DUPA 3ZZNA 2BFPA 2QQ5A 3E5RA 5DDIP 1E1MA 4A27A 3M1AA 2GSDA 1Q2XA 4LK3A 1TLTA 1ZSVA 4NBTA 3HSKA 5EINA 5THKA 4EBFA 2FP4A 5JSFA 3IS3A 3SC6A 3FWZA 2VCYA 1WDLA 3UKOA 4CR8A 2Q2VA 3OP4A 4YJFA 5KJEA 4E33A 1JQBA 4MVJM 1GCUA 1DAOA 3F4BA 1ZK1A 1H2HA 1MXHA 3LU1A 4GSKA 4NFSA 3KBOA 1YBVA 3L9XA 4YJHA 1DFIA 2WWRA 3COSA 3I9LA 3SLKA 3IC5A 4RVDA 1R12A 4OXKA 3ZWMA 5IDWA 1ENZA 4GMGA 1CYDA 3RFXA 5GZ6A 3UGKA 3RUFA 3V2UA 2FR8A 3ROKA 5C37A 3N74A 2NLOA 3OIFA 4J90A 1VLLA 1U3WA 2B4QA 1NAIA 2DBQA 4BO6A 5JC1A 1DRVA 4QO8A 4YACA 1QLHA 5G2OA 1M6HA 2X9NA 4G65A 1EBFA 1ZO8A 5J23A 2ZK7A 2E37A 3WGIA 3E48A 2F1KA 4Y6PA 1A27A 5F1KA 1GD1O 4CR7A 4IZIA 5KJFA 2ZKLA 5DBGA 2EJWA 2RHCA 3CH6A 3LZ6A 1E3LA 3OEYA 1J49A 2W98A 4J3FA 1UZNA 4Y9DA 2O50A 4GMFA 5L7TA 3BXXA 3JQBA 5MDHA 1ZK3A 3GG9A 4CMHA 1LDEA 1CQIA 2A92A 2Y67A 1XSEA 2I9PA 1EZ4A 1PJBA 1KEWA 1YL6A 2EGHA 3DO5A 4WKGA 1BVRA 3PVZA 4EJMA 4PLVA 1YE3A 2VZ8A 1Z7EA 5IF3A 4XDZA 4FFOA 4M1QA 4UAGA 3OQ1A 3BTVA 4AVYA 2P5YA 3IJPA 3INTA 3JYNA 2CSUA 1KYQA 3E6AA 3OJ0A 3X2EA 4NNJA 5ER9A 2IODA 1AHIA 1E77A 3PWKA 1K3TA 2DU8A 1E7YA 1BTOA 3MCVA 2OZPA 3NAQA 5GZ1A 1X14A 2I3GA 4MP3A 1PGQA 5B37A 2FZEA 3C7AA 1AUPA 3OJLA 2VWQA 1VPDA 3D4PA 3U4CA 2O23A 1U1IA 3LF1A 2I65A 4YRAA 1ULSA 4BNHA 2VWPA 1XG5A 2CVQA 3O38A 3JYLA 1IUKA 2V65A 4GWKA 4H15A 3AOEA 4BNTA 4NFYA 4D45A 1NXQA 3VOSA 4YRBA 1P1KA 4W6ZA 5JLAA 3E8XA 1GZ4A 1LX6A 4O5OA 1AGNA 2HJRA 2XAAA 2HRZA 2GLXA 5U4QA 1WNTA 2G82A 1BVUA 1F0YA 3PGXA 5HS6A 3RWBA 4E2YA 3LYLA 4N18A 3AU9A 2WE7A 1E3SA 4PLFA 3OICA 4XEHA 4EITA 1UXHA 1P1FA 4JN6B 4CMEA 4CV2A 3CIFA 1BXZA 4DL9A 5B1YA 1E7SA 2GN4A 3I23A 4CMBA 1HDOA 3F6YA 1DIGA 1WZEA 2ZB3A 5KJ1A 1HE3A 1PQPA 2E49A 4ESOA 4NJMA 1B14A 2HMVA 2B4RO 5KNLA 1ADGA 5EL0A 1HL3A 4ALLA 3W8EA 5EERA 4OIMA 1JU9A 3EZLA 3GRKA 4PLPA 1JDJA 4DGSA 2B69A 1M67A 2X7HA 4JJIA 3JYPA 1XGKA 4XWYA 2W8ZA 2O3QA 1W0CA 2HAEA 1GUZA 2LDXA 1KVQA 2IDZA 4CPDA 3BMOA 3F46A 4D42A 2YJZA 3I52A 3AWDA 1P0FA 1Q7GA 3FNGA 2QX7A 1DC6A 3CMCO 4WLEA 5TQVA 1SEPA 3RUHA 3OFSA 1O89A 4OM8A 5FI5A 4DQXA 1S6YA 3ZU3A 1EFKA 1X0VA 2EW2A 1V3UA 1KERA 4XB2A 3M1LA 4IDEA 4MVJD 4HP8A 4CLHA 5ICSA 1PGNA 1DDOA 3DFUA 1P1RA 7ADHA 3ETEA 3KEOA 1YQDA 1ZW1A 1PTJA 4ZRMA 1U8XX 3IP1A 1EVYA 4CJXA 1ISFA 3AM5A 3WYEA 2WSBA 3N58A 3DL2A 4WK6A 1OMOA 1Z82A 4R3NA 2OGUA 2DKNA 2EERA 3JQ7A 2WD7B 4EJ0A 3UAGA 3GDFA 3DBVO 1IY8A 1JLLA 3VKUA 1LSUA 1B2LA 1GTMA 1ZEMA 3BHIA 1Y9EA 4DMMA 5CEEA 4CLEA 3RQSA 5L7WA 3DQPA 5C7LO 4ZA2A 1JWAB 2R00A 2VUTA 2GPTA 5TGDA 4KQXA 2HMTA 2EV9A 1JWBB 1OI7A 2A35A 2D1YA 5F5LA 1SB8A 2C29D 3HUDA 3GPDG 1QG6A 4E2XA 5JYDA 1Y8RA 3RUEA 4JJFA 2VUUA 1WDKA 4BL5A 2TMDA 3ONEA 3M6IA 3O4RA 1C1XA 1A7AA 5JY6A 2Q46A 1N5DA 1LUAA 1BG6A 5FEUA 4CM4B 4CUZA 3NDIA 1XELA 4X54A 4FIZA 3HN7A 3KEQA 4ZU3A 4J2HA 1E0DA 1BDMA 1BGVA 1QYVA 1T4BA 1GUFA 1NX6A 2RBEA 2HK7A 1EK5A 2IZZA 1QYCA 2CMDA 2ZB8A 4RGBA 4LMPA 3U9LA 3VKVA 3W8FA 2X9VA 5DCUA 4FJ2A 3IKVA 3PRJA 3F1KA 4AJ2A 4BMSA 5AXBA 2J5KA 3DEYX 3M2PA 4D41A 2V6MA 2GF2A 4GPD1 4BO1A 1YQXA 3FHLA 1F14A 4Q3NA 2WYWA 4CM3A 3JQFA 2NNLD 1QR6A 2AQKA 4MIYA 1YL7A 3BHJA 4A26A 4IY1A 4ID9A 4DC1A 4UUNA 1QP8A 3KM0A 3DWFA 1CQJA 3F5QA 4XQ9A 4GX2A 4MVJG 1NPYA 4OXNA 4TSKA 2PKQO 1R0KA 4R9SA 3RU7A 2C5AA 3RU9A 3TFOA 4INAA 1NQTA 5HA5A 1H6AA 2BFMA 1XQ6A 1DIBA 3S1LA 5T64A 3FD8A 4E6PA 1QLJA 3AJRA 4WCDA 4R5MA 2QZ9A 2CY0A 1DB3A 3JQAA 4CLOA 1SO8A 2X4GA 2BH9A 5TJ9A 5A5EA 3MJEA 4BMNA 4XA8A 3TL3A 2G5CA 5G0SA 3OBBA 2XXBA 4D3FA 3FR8A 2NU6A 5B12A 3RD5A 4ZQBA 1GEGA 4BNYA 3EDMA 3KZVA 1HT0A 4IMPA 5B4TA 2X0NA 1A4IA 3E9MA 4OAQA 2P5UA 2Y1FA 1QV6A 1SOWA 1IPFA 1ZMOA 4Z9XA 1HDGO 2CD9A 4WE3A 1HEUA 4Z9YA 3WYBA 1UR5A 1B26A 3A1NA 3DDNA 4XRGA 2I5PO 4FPXA 1Y5RA 1PEDA 4OH1A 1IOLA 1OFGA 4MVJI 1QKIA 4N5MA 3INGA 1PL8A 3PYXA 4B3JA 3GHHA 2JJYA 4HFNA 4AJHA 4E21A 3EY4A 2AEMA 1NYTA 2J5QA 1PQUA 2Q4EA 2VQ3A 4IDAA 4BOYA 1F06A 4YJDA 5IXYA 4CUJA 4J4HA 1B8VA 3I9JA 1WVGA 3ITKA 4BNFA 1JW9B 3Q9NA 5BNTA 3ZWVA 1U7TA 3FBTA 3FNFA 2OXIA 1Y8QA 1B3RA 3TDKA 5JYEA 3GAZA 4TZKA 2G17A 2H6EA 3A06A 2A9FA 1E3WA 3I6QA 2WDZA 4L74A 1WLYA 3DHEA 2DBRA 4O0LA 3H5RA 5L4SA 4LMRA 3D64A 1M6WA 4BKOA 3BA1A 5JS6A 1C1DB 3P7MA 3ZWWA 4J2OA 2VHYA 1PIWA 5TX7A 1PS9A 2EG9A 1I10A 2ZTMA 1R37A 4MP8A 1X7HA 2BGMA 4DMLA 1JAYA 3C1OA 1N9GA 5EMHA 1VE9A 2EHDA 2X23A 4RORA 3DZIA 1I0ZA 2JKVA 2C82A 3AFNA 2XF8A 4FS3A 3GN1A 4CQLB 2P4QA 5JDCC 4I9NA 2EKPA 1ZIDA 3AFMA 4WUVA 2X9GA 4KDEA 4EUFA 4L76A 1V3VA 1JVSA 4J7UA 3G79A 1ZBQA 4U5QA 1U9JA 5HBRA 5K9ZA 3K6JA 3ZNNA 2GDZA 4D43A 4YWJA 4PZDA 1ZSYA 3L6OO 4I5EA 4FFNA 3PHJA 1TVEA 3L6EA 3FBGA 4HUJA 4B4UA 5HS4A 1U2DA 3KB6A 4Y6RA 1NFRA 3C7DB 3VPHA 3WX0A 2OL4A 1QYWA 1IPEA 4A5OA 2Z5LA 2O3SA 4OGWA 2OP1A 1N1GA 1PS0A 5ER6A 2E4AA 4OXYA 3TQHA 3ULKA 1XWFA 4W4TA 3DHNA 2HMWA 3DMTC 4Q39A 5TJHA 3WB9A 2Q45A 3H2ZA 4O63O 3DR3A 3QVTA 3S2EA 3GVXA 4BUCA 2ZB4A 3O8QA 1DAPA 3IUSA 3R3JA 3ZI0A 3K31A 4B7XA 1ADCA 5AQ1A 2W4QA 4IUYA 4XJSA 4YRDA 5TF4A 3BMCA 1I36A 4D46A 1JN0A 3U09A 5A03A 3UCFA 9LDTA 4H3VA 4NZ9A 3G1UA 3AUSA 3HFSA 2WTBA 3GAFA 3ST7A 5A4DA 2Q99A 2E6UX 1PX0A 4TQGA 5KOIA 4RF5A 3L77A 2JAPA 3GVIA 2BKAA 4CQMA 3OIDA 2ZYGA 3JQGA 2NU8A 1GCOA 2P2SA 4ZQGA 2BI8A 5CDUA 1E1LA 3JQ8A 3HG7A 3JQBC 5DCWA 1E6WA 4ITUA 4GAEA 4JJGA 4GBJA 1WPQA 5KIAA 1B0AA 1Z7BA 5CAEA 3KXDA 1Y8QB 2Q1TA 3UVEA 4WEOA 3I9NA 4N7RA 5JCXA 3A28A 1H93A 1GV0A 1LEHA 1YJQA 3WQRA 3PHGA 2IXBA 4IQ0A 4RVUA 2Y66A 3INRA 4R1UA 5I9MA 2X0IA 2AEFA 3K5PA 1I33A 4C4OA 1DIAA 4I8XA 5JAZA 4DXHA 4ZD6A 2YUTA 1R16A 4FDAA 1KEUA 3CUKA 1NFQA 4WPGA 1KC3A 3DC2A 4NFHA 4G5HA 3RIHA 1XU7A 4WOKA 2R2GA 2O7QA 4FN4A 3UH1A 4CMAA 4TKLA 3H5NA 3W4JA 1T2DA 4URFA 4RJTA 4O59O 5B4VA 2HLPA 3D3WB 3SVTA 4A2CA 5C7IO 1T2EA 3KVOA 3WLFA 4BKQA 3B6ZA 1M75A 3PQFA 4R01A 1LLCA 2PA3A 1DPGA 4U6SA 3SC4A 2IYPA 2Q49A 1Q1NA 1ZJYA 3AUAA 3C3XA 2EIHA 1LDGA 2NTNA 4XX0A 4LN1A 2JHFA 3EVTA 4IIUA 4TRMA 3WS7A 3AOEC 3SLGA 1MG0A 4LRSB 4CM5A 3TSCA 4JIGA 3LC2O 4OL9A 2J3KA 3H3JA 1AHHA 4OOEA 3TN7A 3RUAA 5TT0A 2JFGA 4IQGA 3WMWA 4Q9NA 5TLSA 3P2YA 3CSDA 4FGWA 4DQVA 1PL7A 1ID1A 1TT5A 3WGGA 1Y7TA 3QP9A 1H6BA 3VPXA 4MKXA 4KUHA 1RM4A 1R0SA 1XCBA 2O48X 2ZQYA 3BMOB 3GH3A 5JMPA 3ONFA 3I9KA 2NQ8A 1IB6A 2AA3A 2NTJA 5L45A 1LRJA 1GFSA 4UUPA 4GQAA 4E13A 2Q2WA 4IS3A 1GV1A 1PJ3A 3GZNB 4Y6SA 1EMDA 1K6JA 2D5AA 1SB9A 4NU6A 5JDIC 1A7KA 4FJ1A 5CP8A 3DZHA 5KKCA 1ZJZA 3DZKA 4WLVA 4WCFA 1E1NA 5DP2A 4BV8A 4I5DA 1ZK4A 1JKJA 2FR1A 3ZCXA 2W2KA 3DZBA 4G81A 3GZ4A 3GNSA 4XZ3A 2YY7A 1E6EA 1RKXA 1F8FA 1SOVA 3B20A 3JQGB 2Q50A 3P19A 4DWVA 4K26A 4XYGA 3D3EA 1D7OA 1RYEA 1KVRA 2CUKA 4MIEA 4EZBA 2WD7A 4UVIA 2QRJA 2X0RA 3AM3A 4R1SA 4WLFA 1WMAA 3OQ6A 1HWYA 4QUKA 4CM7A 1V8BA 4HV4A 5ITVA 3OM9A 4PVCA 4RCVA 1FDTA 2DM6A 4PGFA 3ZNQA 1YB5A 4I5FA 5JO0A 2PD4A 5H81A 2C2YA 1ISGA 1K6IA 4TRRA 3LK7A 2PY6A 1ADFA 1RM0A 3Q6IA 4YAKA 3QVWA 2D4AA 3Q11A 1UZMA 3SEFA 5IN4A 3U49A 2D8AA 1NP3A 4YQYA 2GRAA 3HB5X 2HK8A 3A14A 5K6AA 1LLUA 2Q4BA 3PJGA 1XHLA 3WGOA 4AJKA 2YHIA 1NM5A 3G1TA 2VZ9A 4YA6A 3WSWA 3GA0A 3KLPX 2AXQA 1QMGA 4Q3AA 3TFQA 4C7JA 4J7XA 2NADA 2GD1O 3RROA 3H65A 4Z6KA 3SJ7A 1GADO 4BGIA 2VHXA 2VUSA 3CKYA 4W9NC 3PI7A 1VL6A 2GZ2A 3MWDB 2PKRA 3WSVA 1KIFA 4CLXA 4YT4A 4J4TA 4AJOA 1ISJA 3RAJA 5DNAA 1CF2O 3FPCA 3PDUA 3WG9A 3ON5A 2HUNA 2X5OA 3DBLA 2HK9A 3CXRA 2YDXA 1C1XB 3NX4A 2P9CA 3MEQA 1GPJA 4UVHA 4CMCA 4WJZA 1DFGA 2AW5A 5L4LA 3GZNA 3ZGYA 4W82A 5ILGA 5CHEA 5TNXA 1LBEA 4CM1A 2O2YA 4G2NA 5LCXA 3VZRA 1L1FA 1KVTA 1YJ8A 1ZXBA 3ROQA 1E3EA 1V35A 4GX1A 1LNQA 1Z73A 4L0QA 2UDPA 4YJHB 4A10A 5JAIA 4W99A 4GL4A 5AVOA 2HCTA 3H9GA 3V8BA 3VH1A 4E12A 4GVXA 1E5QA 4YT2A 1E3IA 4CM8B 3GVPA 4TRJA 4DIOA 5ES3A 1UAGA 1DEHA 1D1SA 4I08A 4YT5A 5THQA 4EI2A 3RC1A 2POQX 5GY7A 2GNAA 5IN5A 3H9QA 5JMWA 3ZWYA 2YW9A 3RUIA 1Z6ZA 3E82A 4RVSA 1FK8A 3FF4A 1Y9AA 3MJCA 3CEAA 3OJFA 1SZJG 4XGNA 1FXSA 4J1NA 3K2EA 3T7EA 4U8GA 3VZPA 1U8FO 4JCOA 2DTDA 3NKLA 4BNZA 1O95A 2YFHA 4J9VA 1DO8A 1MC4A 2AEJA 4KTTE 3NTQA 3OA2A 4PLCA 1U28A 3NYWA 1KETA 4EW6A 2EKLA 4KWHA 3PDJA 5CDTA 2AG8A 2O3RA 4CLRA 1LTHR 2OFPA 1SCUA 1MX3A 2FPPA 1YRLA 5A9RA 2J3HA 3LT4A 2CVOA 4P4LA 4WGGA 1VJ1A 4K9DA 3RBZA 4DPLA 5GZ3A 1M76A 5HRUA 1LLDA 3DAGA 4ZQHA 3ETDA 4HBGA 4MOWA 4ND1A 3UHAA 1GZ6A 3EC7A 1PZGA 4E0BA 1JVBA 3T7CA 4IXTA 4JLWA 4FOSA 1GEEA 2PK3A 3C7CB 3K2BA 1I3KA 3PJDA 4ZRNA 4DTIA 1X0XA 2CVZA 3KTDA 3FRJA 3MTGA 5KVQA 1QSGA 1DHTA 4LCJA 3JQEA 4R54A 3K92A 1V3TA 2HU2A 1FF9A 2CDAA 5BNIA 4EEXA 4PCVA 3FSRA 2UUPA 3PFFA 3UICA 1ISHA 2X0JA 4O6VA 4ALMA 2I3AA 1NWCA 3DBLB 5H82A 4R68A 2DPHA 1PU2A 2J6IA 1GYRA 2HSDA 5KJCA 2P68A 4YBZA 1HLDA 1E3WB 3G0OA 4BO3A 1NVGA 1X7GA 1W4ZA 4DYVA 4E5NA 1C1DA 3PIIA 3OIGA 4BMVA 4L4RA 3I83A 4GLOA 1DJNA 3OA0A 4HADA 5COAA 4FC6A 1N92A 2IXAA 3PYMA 3S2GA 1EFLA 2BMAA 3QWHA 3VPSA 1H9AA 1MXFA 2HJSA 3HB4X 4II2A 4OOFA 4CLRB 4EDFA 4YAJA 1HE5A 1U5CA 3PP8A 3EVNA 4PLWA 1KVUA 2AHRA 2PD6A 3G3EA 2OOSA 1QRRA 3WQQA 2GGSA 1XEAA 3VPGA 2VRCA 3B1FA 2X58A 4MVJA 1O5IA 2G1UA 3PWSA 4WOJA 3R3SA 4DPMA 4E32A 2UUOA 1RPNA 1I8TA 4R51A 3CE6A 2Z95A 4R41A 3ZV3A 2B4TO 4F46A 3PK0A 1A9ZA 3LDHA 3WDSA 1PGOA 2LDBA 4Q3BA 3AW9A 1XR3A 4JQCA 3IJRA 1WDMA 2BFOA 4CMIA 3GMSA 4PG4A 1G6KA 5KTKA 1HYHA 2YFQA 3LT1A 2RCYA 3ABIA 3K73O 4ALKA 4CQMB 4F6LA 3KYCB 2HRBA 3L4BC 1O6ZA 4AJ4A 2NUAA 1AXEA 4AG3A 3O9ZA 2FR0A 2C0CA 1TEHA 5L4NA 4CV3A 3CZMA 3BMCB 2PZJA 4BQRA 4LCEA 1YB1A 4MKZA 1QV7A 1YBAA 4JK3A 5A3VA 1KOLA 3QLJA 3Q0EA 1PJ4A 1DIRA 4YAEA 1JAXA 1TB4A 3ZWPA 3W6UA 3DTYA 4BNMA 3RBVA 1EQ2A 2NVWA 3ONDA 4W7IA 3L07A 1Q0HA 4RQTA 5K0ZA 3VHRA 1A71A 1GY8A 1N9GB 4BNWA 1UDAA 1W8DA 3FTPA 1I3NA 3VC7A 3GQVA 4ND3A 1ENPA 2QRKA 3FCOA 3A4VA 3E18A 3RI3A 1QORA 1I5RA 2PTGA 3G17A 2GASA 3ZDFA 3TF5A 2HMUA 3ZN2A 1F8GA 4E2ZA 3KV3O 4KP7A 3UF0A 4JP3A 3GNTA 1H6DA 3NGXA 5L51A 4E3ZA 5L95A 3TJRA 2NU7A 4PLZA 1W73A 2NACA 3BMQB 4YB8A 3NUGA 4B3HA 3B1JA 1HF3A 4M55A 5BSFA 2VZ0A 3HQ4O 1OAAA 2DTXA 4GX0A 1UJMA 2VWGA 2YV1A 2ZCUA 3FTNA 4IINA 4TVOA 3D1LA 3HN2A 1HDZA 1OOEA 5BSHA 5TSDA 3ADPA 1UAYA 5IDYA 5ADHA 2XPCA 1XDWA 1C14A 4PG6A 4UVGA 4ZJUA 3ADOA 5T8KA 4R16A 3MJ4A 3F9IA 4XQCA 2JCYA 2P91A 3LLSA 2UYYA 1FDUA 1N7GA 4YR9A 1NTOA 3DB2A 2B83A 2FRDA 3GN2A 1SBYA 3LLVA 4R3WA 2R00C 2Z1NA 3U4HA 4IJKA 4FCCA 2X6TA 1TXGA 3JQFC 1R4NB 4B8ZA 2Y99A 1LU9A 4CMIB 1EUZA 4YPOA 3WGYA 4RVGA 4GGPA 4BVAA 4TWRA 3ZWOA 1ZUD1 3WJ7A 4CLDA 2EJVA 1F17A 3B70A 3Q3CA 2XXJA 4MVJE 3EGOA 5JC8A 1ZEJA 4GKBA 3L4SO 1T4DA 4XYBA 4NBWA 3MTJA 5DF1A 4NIMA 3BIOA 3L0DA 4MINA 1BWSA 4U0KA 4FBGA 2D3TA 4QEDA 4YJGA 2Y05A 3ORFA 4NH4A 1G0OA 2ILTA 1PQWA 2Q3EA 3JTMA 3WBBA 2ZJ1A 1HKUA 3DOOA 3MJVA 4HNHA 5T57A 1ORRA 2OP0A 3JD2A 3W6ZA 5JCJD 1EEHA 4XYEA 1Y5MA 3I4FA 4KOAA 3QSGA 1HRDA 3ZHBA 4OYRA 5A9TA 1PJQA 1MGOA 2JL1A 2NU9A 3AUUA 1Z75A 4ND4A 4IDFA 5DN9A 4M54A 2H1SA 3TZQA 4MVJF 3O03A 4MJLA 3DZGA 3GR6A 5IZCA 1ZKMA 3E03A 5DT9A 1KS9A 2VHWA 1EVJA 2Y1OA 2B5VA 2WD8A 1BRMA 4XJTA 5AYVA 2EXXA 4QXMA 5TS3A 1YH3A 1JTVA 4MPDA 4LRTB 3T4XA 4H16A 4RF4A 2WYVA 1T2AA 5EPOA 4JX8A 4IJUA 2Y93A 4Z0TA 3ANNA 4S1VA 3R6DA 3UCEA 4DA9A 1MC5A 1Y1PA 1ZZEA 3ZU2A 1D3AA 5JE8A 3I6IA 3EMKA 3PJEA 1E7WA 1DC3A 4YDRA 3HDHA 3JQ9A 1PGJA 3KUXA 1JA9A 3PLNA 2UVDA 4J7CA 3VZQA 3PPIA 2Q1WA 1KBZA 3OSUA 3RCBA 3BYZA 3ZV4A 3H7AA 1HYGA 1DLJA 1VL8A 2Y1EA 2Q1UA 3QRWA 1LJ8A 1XIVA 1LQTA 3ICPA 1HDYA 2YQ4A 1AE1A 4RQUA 2VT3A 2W2LD 1EQUA 3MJSA 1U3TA 4R4JA 1R15A 3H9UA 5C3MA 3FPLA 4EEZA 2Y1GA 5CFZA 4Z0HO 3WFIA 3OEWA 4HFJA 5T6BA 3TL2A 5L40A 1PWZA 4OJNA 4EJ6A 3LC1O 2Q1SA 2IEBA 4PLTA 3VZSA 5I7EA 2SCUA 3DMYA 1NASA 2JHGA 3RJ5A 3RUDA 4E4YA 4WNIA 3CMMA 1LDYA 4J9UE 2NSDA 4YVFA 1NWHA 2YDYA 2GN9A 3BZUA 3E9NA 1U4SA 4RPGA 1AXGA 3ZV5A 1B8PA 4RO0A 2HDHA 1NR7A 3BAZA 5BR7A 1D1TA 1LDMA 3NGLA 4QTZA 3O26A 4QFCA 3ANLA 2ZTUA 2G0TA 1GU7A 3IOYA 2I6TA 4ZQEA 1ZH8A 1WAMA 2I76A 3C1AA 4IDBA 2D0IA 1V0JA 1NVTA 4DREA 3WIDA 4JBHA 3WWYA 3WGQA 2RAFA 3GGOA 3NJ8A 4NPCA 4QX6A 4J1TA 3VTZA 1MV8A 5A02A 1E7QA 5TRTA 3S8MA 5T8KC 2GYYA 4D0RA 4I5GA 3TZHA 2PZMA 3LF2A 3DZFA 3JYQA 2CF5A 3X2FA 1VI2A 2QRLA 1E3JA 1UDCA 4BNGA 3VVCA 4ALJA 4J6FA 2J3JA 1B7GO 2DBZA 4PG8A 3VTFA 5IZ4A 3VPFA 4P22A 4OMUA 4IXWA 4RL6A 2Z1MA 2FPIA 1FMCA 1MUUA 3H6KA 2O3TA 4J1QA 4ALNA 4PG5A 4B7CA 4CMGA 5CG1A 1YWGO 1IZ0A 1O94A 4RF2A 1SEVA 3PFWO 3ZV6A 2AE2A 4FW8A 4BGEA 2Y1DA 4NMHA 3I5MA 3U4DA 1GPDG 1LQUA 1DLIA 2C2XA 3AUTA 3FNHA 3UN1A 2WM3A 4O1MA 3PXXA 1I2CA 3UFXA 2G76A 1J6UA 4N54A 3KYBA 5IFLA 2CFCA 2VT2A 2CDBA 3UCXA 1L7DA 1GQQA 4GGOA 2ZTLA 3ZW8A 1MP0A 3KYDB 4J91A 1I24A 4IBOA 4YJGB 5I9NA 4NHEA 1I3LA 1K0UA 3FN4A 3KETA 1VJTA 5DOVA 2FMUA 2IE0A 3IAHA 1JKIA 3KRTA 3GNQA 3TPCA 1LRLA 4YYZA 2C7VA 3Q2KA 3ASVA 4WCFC 1T2FA 4U0JA 2ZATA 3DXFA 4II3A 2F00A 3VH2A 3AI1A 3G49A 4RLSA 1Q0LA 2DFDA 2H5LA 3QWBA 3AY3A 4GI2A 5JY1A 5JXWA 3LSYA 2OHXA 3PZRA 4XGKA 3GRPA 1WXDA 1OC4A 2WYUA 1GAEO 3WGZA 1E7RA 4EUEA 5IZCC 2IYOA 3D5QA 4ALIA 1HE4A 1BXGA 4BS9A 2FWMX 5HM8A 3EW7A 2PLAA 1LLQA 3JQ9C 3GVCA 2O7SA 4CMEC 1VC2A 4GVLA 4YTEA 5BSEA 4Z3DA 2BGKA 2TMGA 1NFFA 1ISMA 2VHZA 3OJOA 3H8VA 1IHXA 2FN7A 3ZHZA 3WMXA 5I7FA 4F3YA 1E7MA 4NBUA 3D4NA 2ZQZA 5FI3A 5L3ZA 1CIVA 4A73A 4OSPA 2C54A 4BO5A 2OORA 2DTEA 4CL3A 1GDHA 4IMRA 5U9CA 3ENKA 2ET6A 3D5TA 3F47A 4YQZA 2FHSA 2PGLA 1MA0A 2PH5A 2PZLA 2JCVA 4XIJA 2JFFA 1C0PA 1O0SA 2EKQA 2NM0A 1U7HA 1WWKA 2NVBA 3H9JA 2J5RA 4CM4A 1LSOA 4FFLA 1HZZA 4JBGA 2YHUA 3NRCA 4HNGA 2OO5A 3L9WA 3WFJA 1MFZA 1NHWA 3IKTA 3IDSA 4CQLA 9LDBA 2JCXA 2VTEA 3QA9A 3UUWA 4AJ1A 4XR4A 1QYXA 4LSMA 4BNVA 1ONNA 3P2OA 2W2KB 1E5LA 2GN8A 4DYDA 1LSSA 2R6JA 1YXMA 3GDGA 5DBIA 4HY3A 5AOVA 2JD2A 2PV7A
chains in the Genus database with same CATH superfamily
5EESA 1KNXA 3RYCA 1U0BB 1BXGB 1RS0A 1L3BA 4UD2A 3RLIA 2I99A 4ZIRB 5B55A 2GNOA 2PX3A 4IF4A 3HBLA 4ZOEA 1I2MA 4FYYA 4PZCA 4BFTA 4DPKA 3KC2A 1GR0A 3K6SB 4PFQA 2H1OA 4MI6A 2HMYB 1E1KA 4GC9A 3IQZA 1X3SA 2J3IA 2Y68A 2GD2A 4PXSA 1KGSA 3RS0A 4CKCB 4AJEA 5IM4A 2LVBA 3ZQ6A 1PT8A 4RYLA 1L5VA 2Q0SA 2Q7DA 4WXMA 3ZWNA 1O95C 5DNYB 2G06A 3DBHB 2WQ7A 1V9LA 2V0CA 3QVJA 1W5TA 4HDKA 1CR4A 4OJTA 2AGVA 2P9EA 2R86A 5LDDC 2YL2A 4F5EA 1YCGA 2B6NA 3SX2A 3T9DA 2IEDA 4UVEA 1ONPA 4FNMA 2CZCA 4RQAA 1QV9A 3C5EA 3GLHE 3LFHA 3OIWA 2XCUA 4BNNA 4UFPA 4GKVA 3RSFA 3NP9A 3RDPA 4CLOB 5AUNB 1AK9A 1PG5A 3OHSX 5FTKA 3TK1A 2NTYC 1P77A 3HVKA 1FFHA 4PICA 3OTWA 4QFDA 4R9RA 1AT1A 4KE9A 5CDYA 1P1HA 2NP6A 1ZI9A 2XD9A 3JWEA 1QXSA 2GR9A 4IDQA 4RHTA 3HYLA 3ZBQA 2ZIZA 4UASA 3EQZA 4LZAA 4XI9A 2C4MA 1PUXA 3GGGA 4Q3EA 3UMBA 2XKKA 5JQGB 2VKQA 2BHLA 3QKIA 4LV5B 3BIFA 4EX7A 1D6JA 1OA1A 3I30X 3U17A 4XXHA 3GT7A 3TZBA 5I45A 2SKDA 4F2GA 4EHNA 5H83A 1GQYA 2ZTVA 2VDLB 1J99A 3BMQA 3R0JA 4WY5A 1YTLA 2R8BA 1E4OA 2O4UX 3ZHYA 2FN4A 2ZW9A 1AGXA 5IDQA 4PFJA 2CD7A 3DP9A 2QORA 3WLEA 4EAQA 1NMZA 3BWYA 4RWEA 2O8EA 4WFJA 2PR2A 1WCIA 5AJYA 4NI5A 4WBSA 5BYJA 4BAZA 3KYCA 1KMCA 2YY5A 2NYVA 3V2HA 4EENA 5CEFA 4FQ8A 3FFXA 2PEZA 1W6UA 2BMJA 4L4SA 4HDSA 3GVHA 2J46A 3KELA 4KQHA 5AUOB 2P3LA 1XPUA 3GHYA 1FXUA 4MVJH 1UBJS 3WHIA 1MNQA 3ZIAD 3KL2A 1ZIYA 3HNOA 1WW3A 5C4GB 4FHZA 3FB4A 3HHPA 4XFDA 1NVVR 3MTAA 4ZVQA 5B2ZA 1CP2A 1WW8A 2XQJA 2JEYA 1LC0A 1TM1E 2H9IA 3QEMA 1JIUA 4FFMA 3T3DA 1CUFA 2W2XA 4WLOA 4OREX 4BBJA 5CX1A 3OZTA 4DV3B 1H2BA 1YF3A 4RV9A 2A67A 1SC4A 1N2ZA 3DAHA 3O93A 4FFWA 4QRIA 3GH1A 3DH0A 4EHLA 4YMUA 1CFZA 1R4NA 1E1QA 3KSMA 3QFTA 1JILA 2EGUA 4TTSA 2VWHA 4L4ZA 4Q3KA 2PVCA 3ESYA 3RVJA 4XWWA 2GJKA 4CM9A 3RSLA 3ZE9A 4CM8A 1M10A 1NW3A 1EUYA 3EYWA 4H17A 2Z3VA 2VBCA 4IJ5A 4MMZB 5K6AC 1V2HE 5CVDA 4ZMBA 3ITEA 1OTXA 3HCFA 4RZ3A 4LHEA 2ZAYA 2XMGA 3EE6A 1TYCA 1ZC4A 1Z37A 4IO1A 5HXAA 3MXTA 2WUDA 4B8WA 2GM9A 3OPYA 1DHRA 2DSNA 4Q05A 2IS4A 3LC7O 4JT8A 3AI2A 2PJDA 1CY1A 1P1JA 4YC7A 3DO8A 2VYND 1NLZA 3LHKA 4D0LB 1GZUA 2XX3A 3AJDA 1N78A 5F2KA 5HIAA 1ULUA 1W1WA 1ZCJA 1ZNQO 3WGVA 2GJ9A 4N5LA 4Z3KA 3JRXA 3BGIA 4M9CA 5FOSA 4RSRA 5EVCA 3IDOA 4KV7A 3ENQA 3MOGA 2P2LA 3Q7SA 3H11B 4A7PA 4C6TB 4E88A 5IU6A 1RQRA 1LVUA 1X6VA 4KO4S 3ZHSA 1FFCA 5CTJA 3B3GA 3WJAA 5MN6A 5EGNA 4NE9A 4YRJA 3M4JA 4FFBA 2QPTA 3H19A 2DJ5A 3I32A 5D86A 3RVQA 3DKVA 2C5EA 2VOEA 4WLNA 4D8XA 4LW8A 1X13A 1HETA 4BO0A 4DN6A 3NBXX 3FWYA 4HPJB 5L3SB 5F3RA 5LQNA 4OLFA 2VDOB 1EUCB 2V8BA 1H4QA 3Q87B 1E4EA 3VKWA 4DANA 3CPSA 4BO8A 1Z83A 2M6SA 3LY5A 3N07A 5FUYA 1MAUA 4BCBA 5IK2D 5KTOA 4KO8A 1E6UA 3KOMA 4BE4A 3A3YA 4QRHA 3V32A 4BV3A 3S2ZA 4YMLA 5JNWA 2FI1A 3BHNA 3IP8A 1J0XO 2OD2A 3MWEB 3ES9A 1U9IC 1RQNA 1SURA 2WHQA 1K86A 3GFTA 3FPSA 5DMHA 4Z4GA 2P0EA 3P32A 1YGYA 3PA6A 3M0EA 4M0KA 4UU1A 2QIOA 4D3SA 5FUMA 1UKBA 3AXSA 4XD2A 4KNVA 4YP6A 1IUPA 1GPWB 3LKDA 3QLTA 3DBRB 3QZUA 3TWOA 5KYUB 2XXAB 1OC2A 1GN9A 3G0DA 3K2IA 1IG3A 3FJ1A 4PHFA 3RS5A 3TNLA 4CM9D 1RZVA 4XIYA 1I5OA 2R8OA 4DXAA 1ZNWA 3C3JA 4HAYA 5LYJF 5JZ9A 1SVIA 1EFAA 3BXGA 4H60A 1AUOA 3M1IA 3V97A 4ACAA 2BUAA 3NV9A 1H5QA 3E7PA 2BTEA 2Z4SA 3G2LA 3KOYA 1UKZA 3G82C 1N8KA 4IDDA 3U4IA 3D54D 4JSTA 4M9QA 4S04A 4Z4QA 2EEZA 3HC7A 4JI3B 3LCRA 1O9BA 3O3OB 3R5SA 1R4AA 4NWIA 3G5MA 4OKNA 2FPOA 4HR7A 3SSAA 2B36A 2ZYTX 2IRWA 2WSLA 3AUYA 1Q57A 2CV0A 4OEHA 1QH8B 3I42A 5DOZA 4AICA 1GZDA 2J3DA 2ZBDA 4PIPA 5TQ2A 1G5PA 2AC4A 1WS6A 4DQUA 4JYCA 3O47A 3VO8A 1A7JA 1UK7A 4GXTA 4UUMA 4X7RA 2II6A 4FR2A 4HDKB 5ED0A 1RDFA 3H5OA 3UY4A 2QN6A 4LK2A 1KSFX 3LNCA 3R3YA 1X94A 2AFIB 3B1VA 3D3WA 2FWBA 3P2KA 5I7UA 3HVHA 3OF2A 1S4MA 2YC4C 1KEEA 4DR4B 3Q9UA 2ZXFA 3BDIA 5J5VA 4NRDA 1WPGA 4YMWA 1NIJA 2PX2A 2XWQA 3B38A 1JECA 2HMSA 3BXHA 4B7AA 4ZOQI 4F3TA 4LY0A 2HPAA 2XTZA 2XODA 1AU9A 4LX8A 3QHAA 4DJJA 2BLLA 1QG4A 3LUJA 1N25A 4POOA 1BJTA 5TMBA 2RAPA 2BELA 4INPA 4JD5A 5SY6A 3DFZA 3CM0A 3M5PA 4FYXA 1RRMA 4XM2A 3FMFA 5E9WA 1NI5A 1E2GA 5DHUA 2CYBA 2F55A 1FDVA 3NJ4A 2GBLA 1ZISA 3LBIA 4I1IA 1V5IA 5CB8A 5FHQA 1XKXA 1TT5B 4JZKA 5J43A 3EPKA 3A6PC 1GZ5A 1PE0A 5F1OA 4D7AA 2C1ZA 1RXYA 1N0VC 3R5HA 3CSSA 4Q24A 2PBLA 3B9PA 2LGJA 5FBHA 1SGWA 2VK4A 3RASA 4ANFA 1FZQA 3AP1A 3UFXB 8MHTA 4CMJA 3D8RA 5KYTA 5EUBA 4O3MA 2NTVA 2ASEA 3R0XA 2QM7A 4Q4HA 1MQAA 2VATA 2BRUA 1Y9DA 5C5CA 5LXTA 2X3UA 3L0ZA 3WBFA 2WD9A 2J0EA 2BM0A 1Z6TA 2GZMA 1UOPA 2AEEA 3GGCA 3DWGA 4TROA 1CWUA 3LDGA 3CRNA 3KALA 2QS9A 3VR5H 2AOXA 3CVJA 4PIVA 4P54A 4DGQA 1MRNA 5FAXA 5C46F 1JEOA 2X7XA 3O4VA 2GJSA 1G8JA 3ZZMA 3KT0A 4MYCA 3MPUA 3WFZA 4AF6A 4F4JA 3E8MA 1GPBA 1BOOA 1XWIA 3PPYA 4KWEA 2OXRA 1DIHA 1NQOA 2FU5C 1B8UA 1D07A 1C7JA 2I1WA 3DONA 3O91A 2GZ1A 4WSOA 5K3BA 3WYDA 3U7GA 5PGMA 4YMTA 4NZPA 4J0DA 4LJ7A 3WTCA 3FNIA 2H59A 3DOUA 2ZIFA 1QGOA 1T8RA 4IZHA 3SX0A 1ZQ9A 2KWIA 2G36A 5EN4A 5K0JA 4F45A 1DBSA 1NVAA 1VJGA 3LPMA 1J2EA 1TCUA 1X39A 2X5JO 4RL4A 5G53C 3DE0X 1NYLA 3T35A 4F8JA 2YJGA 1JJBA 5LA6F 2ZT5A 4E5YA 2WF7A 1P3DA 2JFHA 1XLTA 1PG2A 4IR7A 2ZS7A 1R64A 1JLRA 3DP7A 3LNTA 4KGXA 2EDCA 2W6IA 2N42A 1O9GA 1UBUS 1NVFA 4PLHA 5AIBA 3IEKA 1RT9A 1SELA 2JGMA 1UWCA 3L8FA 2FUNB 3G8BA 2CVFA 3CRMA 1N32B 3GLQA 3QBEA 1Z68A 4BLUA 2IU3A 4CIAA 4AQDA 1OFVA 4CF7A 2IUSA 1CRPA 2BFNA 4Q4JB 2E4VA 1P9LA 4KVZA 1GL7A 1I2ZA 1QJCA 5EFZA 3ITNA 4DCUA 4DV5B 1L7BA 1LRKA 1OXUA 4QPCA 2IV7A 4QPNA 4B6SA 4DDTA 1U1GA 5T5QA 3M3HA 4C0LA 2EWMA 2O6HA 3FPFA 4S05A 3MK31 4L27A 1WRBA 4EFDA 2HADA 1YRHA 2WFLA 5JASA 1RXVA 5J4KA 2ZE6A 5CD9A 4GI3A 2CNDA 1AUXA 2H65A 2GXUA 4K28A 1VSVA 3T7TA 1IXZA 1LPMA 3RWOA 3B1KA 3AG5A 4WZBA 3GOQA 2H85A 1F1BA 4FDTA 1YMVA 2AQIA 4WRRA 3IKJA 2CKMA 4U1RA 5AJZA 8LDHA 1UFRA 3M4NA 3JD3A 1WZCA 2PT6A 2FPIB 2G8LA 4UMDA 5AW0A 4KQJA 1TADA 2P9HA 1D4FA 3IP6A 3S29A 5IM5A 5IJZA 1VIMA 3UYKA 5CK5A 3VYVA 3U6KA 3Q2IA 2F9LA 4PZPA 1VOTA 5C5IA 4HC4A 3QOYA 2R87A 5EIWA 4B44A 1DKNA 2HHLA 2VPZA 5HNKA 4MJXA 4DBZA 3B51X 4C3ZA 1XTBA 5FLKA 1E2JA 3BCHA 3M4XA 3GOHA 1M5TA 2X0EA 3TAHA 1EVZA 1CVRA 3D3QA 1JMKC 2EZ4A 4AKIA 3C6XA 4BECA 2QJOA 3KZXA 3V4PB 4MNTA 4GZMA 3HJFA 1DBVO 5MN4A 1DPFA 2XKBA 3D6TB 3UC9A 3CT6A 1XTKA 2EYQA 2NN3C 1EG7A 3F5SA 2VTVA 5T4BA 4TTJA 4WKNA 2EJUA 1YV9A 4X24A 3FVVA 4IIVA 2AQHA 2JCSA 4BNKA 1YS1X 1O96A 4H7DA 4OCZA 2ZUBA 3ZQUA 2JKYA 1FSFA 3C6BA 3OETA 3TXAA 4R6XA 3M81A 3LPDA 4LISA 2RI6A 4U7DA 5LQJA 1P0CA 1AGRA 2ROQA 3QPUA 2W90A 3DTTA 5DLDA 4BB6A 2C3YA 4EI7A 3PXBA 4IJWA 2JEZA 3F9RA 3H2KA 4M1EA 3ABQB 3L82B 4MDFA 3N8KA 1GAWA 2BFAA 3HN6A 3IELA 2RHWA 1L7AA 2OXEA 4IS2A 3PX7A 3C24A 5BQ5A 3EXFB 3D8BA 3PTZA 4WBNB 2OXTA 1DNPA 1WHSB 5JD4A 2OCAA 5D00A 2YYSA 1AB5A 4DCGA 1UEXC 4EYKA 1LF5A 3K9QO 3M70A 4DIKA 1COWA 4L5BA 1Q5PA 3DTNA 2WYHA 3GCZA 4RM2A 3TLZA 4QLOA 4KITB 4OFXA 3B7WA 2WNSA 1FUEA 4PC3A 4TLLB 3PVCA 5GMOA 4LQCA 3VRHA 2JLWA 4Q9HA 4CODB 1XWWA 3QUAA 4GVPA 4R0NA 4AKTA 5HM6A 5CT5A 2OD9A 3EMBA 1VCIA 3TW6A 3FTDA 5FPYA 1SBZA 2ECPA 3ZWBA 2ZYSA 5BYBA 4IJVA 5D5HA 3DBHA 3KAKA 3MF4A 4GMHA 1R27A 3MC1A 2PFGA 4DVJA 1F9AA 1XD8A 1ZHHA 2CNBA 2O3UA 1T24A 4Q7MB 1NPDA 3HJCA 4ZT2A 1CUBA 2YZGA 2WOJA 4CIWA 3G5LA 3DE4X 3H7IA 2OCDA 5FUXA 2EBHX 4PRLA 4M87A 5DBEX 3KHKA 1XDZA 5LB4A 2DWCA 1BHO1 1EDZA 3C6QA 4G1MB 1Z6YA 1Z5VA 4INJA 2WQZA 4RLQA 1NLFA 1YOVA 3LBFA 4Z4FA 2XNDD 3NHFA 3N2LA 5HBGA 1GZ7A 1FYDA 1G2OA 2A88A 2P2DA 3W2IA 1FSPA 1GGJA 2HTEA 2XWJI 1W36D 3QQPA 3T1QA 5ERYA 4G1BA 5BVGA 2EIXA 2Q9CA 5FWXA 2GUGA 3GGPA 3N3AC 4MS1B 3TZLA 4TKMA 3WLAA 4GKKB 4M37A 1GZ3A 1RXIA 1ZNXA 4FR5A 1IZ9A 3EK2A 4CTJA 2EYUA 1GL3A 1RLUA 3RTCA 1X1BA 3N28A 1RWBA 3UK7A 1WSAA 5KOYA 4MCHA 2V6JA 3BXZA 4Q3CA 3C5WP 1BXRB 5ICMA 5IULC 4EUSA 1RI2A 3DOJA 2OCBA 4JL6A 1QTNA 2XA2A 4KH0A 4MP6A 5GP1A 3PE4A 4QT0A 2HIAA 4ZOBA 2BFEB 4IFTA 4ER7A 2HA0A 1KY4A 5ITWA 5A5VA 4U4AA 621PA 1TJNA 1EGVB 2J0UB 2JFXA 3OUTA 1IOVA 1QKKA 5EMJA 4LJLA 4B80A 3IVAA 4LRYA 4A8PA 3GEGA 4UULA 5C1PA 1NDUA 3U60B 3IV6A 4WHMA 4ARBA 3TQRA 2YHSA 3GFGA 4X3OA 5EE0A 5A4JA 1ZVVA 4N76A 4C2AA 5K09A 1YS9A 3LQQA 3PYLA 3JVDA 4Y8VA 4C08A 2XB8A 2CGEA 1RC0A 1SMKA 1YULA 2X1HA 5ICGA 2ZRJA 2LE0A 2ZBUA 3LUFA 1U4OA 5K8UA 2QZZA 4PWZA 1H8EA 1ZVMA 2JARA 3DGEC 3IUEA 3ZE6A 2DR2A 3KAQA 2AVNA 2R6HA 3L0YA 3VR3A 2QU8A 4U2CA 5BV1A 1HDRA 2ZJ0A 4EVQA 3VH4A 4ROSA 1U28C 2BISA 4JJ6A 2ILVA 1WY5A 4YI5A 3RABA 3DEFA 2Y0DA 1QB8A 2ZYAA 3FJOA 3QXHA 4LDQA 1QVRA 1CY2A 1EA7A 1TM2A 4RDHA 2F59A 4PEVA 3IV7A 3JQ6A 4BGUA 5ALVA 4R69A 1R0XA 4XRRA 1CEXA 1E92A 1S01A 4JC5A 3RLFA 3GF4A 2Q3FA 2VYNA 1C5KA 2A0YA 3JD1A 2OKGA 5ELLA 5A06A 1WSBA 3RG8A 1TZBA 1A95A 1BCSA 2C77A 1ZN8A 1W0KA 1E96A 3ED5A 1RM3A 4OHUA 4RPLA 4YRCA 1TKAA 1BKSB 5ERGB 2DBVO 4G23A 3D02A 2CZQA 3H0CA 1BMDA 2ZJ2A 3MAAC 3AR7A 1Y1LA 4CJXA 3PEVA 2C20A 1JQ3A 3LUKA 5MF6A 3DXZA 1NJ5A 1XVTA 3NDRA 4HDRB 1DJQA 1OE0A 4MKFA 2NPFA 2B2CA 1FTYA 2FX5A 1UZLA 2JIPA 3ASZA 3L8DA 4BEBA 5M04A 4RTNA 1M5RA 4TKVB 4JLPA 4DHWA 1E2FA 3PKJA 4QXPA 1QK3A 4RESA 3MRTA 4JLVA 3NBYC 3DKPA 2DZDA 3DBRA 2WFAA 3K9BA 5AT1A 2D59A 4V1CA 3QYFA 3A1SA 3LS2A 1SC1A 1NBEA 3ASYA 3ZKWA 1WXHA 1JZSA 1G8YA 1HQKA 1AM4D 2GZDA 1CQWA 1BDBA 4IGFA 1NUPA 2J30A 1RQLA 2YWGA 4PO8A 5JCJA 1YVEI 3ZK8A 4TYWA 2V9ZA 3C3KA 1L1RA 1LW7A 1Y9ZA 3ABRB 1R0LA 1V16B 3IVMA 3RVOA 1VG9B 3WK7A 3LH5A 5BRAA 1C9MA 3U1BA 4QIHA 2RJ3A 5DYYA 4MEBA 2VTBB 1ZS9A 1YDEA 2I2BA 4BGDA 1J70A 3V1TC 2GM5A 1OYOA 1SNYA 1VKRA 1OBOA 1NP7A 5DWDA 1FDRA 3VU0A 8ABPA 1JQLB 1TJPB 1WE2A 2IXFA 2SNIE 1JG1A 5SV2A 1W0JA 2CNWD 4YS6A 1A0OA 1E20A 1NPTO 1WV0A 3KO8A 3OKFA 4CR6A 2OENG 4E31A 3IQHX 3WK5A 2JCGA 1J2JA 2OT3B 2PMBA 5DN6D 3O74A 5EQFA 2XQVA 1H6CA 5HFJA 4IAOA 4GHWA 1KI9A 2RGAA 2P9GA 3OH8A 4TMVA 2GKOA 2OCGA 3PUXA 1H0KA 3QM1A 1F7VA 4BJ3A 1WX1A 1JTEA 1BH2A 4TYPA 4BO2A 2A6PA 2IZ0A 1M9NA 2YVKA 3RC9A 4DWWA 4NYIR 1EDOA 3LL4A 4QRDA 4DA6A 3UOGA 4XWOA 2RSLA 5BPHA 1JA1A 3CUVA 4MUEA 3WWOA 1TF7A 2AT1A 2G1AA 4RW0A 4YJFB 2YQZA 3ANSA 4OYYA 4XX1A 4IDGA 3TRDA 4NV3A 4BV9A 3VO9A 4NV1A 4C3UA 1DX9A 5EZYB 3A6HA 1HTBA 4BNJA 4BFCA 3H4VA 4DIFA 4ZJPA 3NTLA 4KYTA 2FSVA 4G1FA 4U02A 4EO4A 3ZK9A 4S1OA 2BKEA 4X1IA 5A3SA 5CA1B 3N5KA 4Y2PA 1QFZA 3KSUA 3CKKA 4P82A 2IOFA 2PXXA 4LRXA 1T1RA 4RVCA 1E9VA 4PQRA 3ND8A 3MNFA 4KC0A 4Q3OA 4RE6A 2B35A 2ZRHA 3ZHTA 1JXOA 1CLEA 4IPTA 4FJ0A 3WRXC 2A94A 3ZVNA 3LKZA 2BBWA 4X5OA 2YHIB 4PFKA 1DO2A 3K2QA 5JUWA 3I6BA 2WUGA 3TUZC 2GZRA 3SQXA 5B4UA 3HNPA 3FRIA 2DYKA 3QBVA 4OMFG 2UVPA 4RNDB 3QLUA 3NH9A 4LBWA 1M2WA 2WC1A 3DHYA 3EC2A 2J4DA 3F6EX 4C3VA 1SG6A 2G9UA 3BBPA 3LCMA 3H18A 4JYMA 3FI9A 3ZNPA 3ORRA 4FK8A 5FYDA 3H3FA 5IJ0B 4ZXPA 4UQPA 1T9GS 4QOGA 2VZLA 3T38A 5KX5F 4TVBA 4W1PA 4RELA 4KVFA 5FPSA 2Q5JA 3GFOA 4TLDA 1G2PA 2OCLA 2ZYVX 5LBIA 4P86A 5JYCA 1MB2A 3X1XA 5ENZA 1DT5A 4QBKA 4BPRA 1UXJA 4YT8A 4LQ4A 1KQNA 1CETA 3IOBA 2RGWA 4X95A 1OYVA 1YR6A 3EC1A 3H5WA 1RXCA 2PGJA 3GLHB 4IEFB 4BTLA 3I34X 5MN5A 1NSYA 1Z74A 4ZVKA 1U90A 1PR3A 4UM8B 5CXXA 2WWVD 4J0GA 4CG0A 4ZHSA 4LMAA 3ZJUA 3NEYA 4U9IS 3GUVA 2ETXA 3R5JA 5IRCD 1HTTA 4TXMA 4MJ3A 1JMYA 2NMVA 2QX4A 5EGSA 4FMBB 1THZA 4NARA 1VIDA 3AEUA 5J4HA 4A27A 1Q2XA 3NWJA 1TLTA 1H1LA 4LK3A 2BL4A 2RHDA 4WDQA 2ONJA 2FP4A 2JASA 1XMSA 2P77A 4CDRA 4EBFA 1JLKA 3C6ZA 4EYGA 2H1RA 2VCYA 3FWZA 4LHZA 4BMZA 2Q2VA 3MGKA 4CCYB 2WTXA 1DG3A 1SBNE 1AF7A 1IRIA 1F6WA 1OPXA 3FROA 1EFRA 1FEZA 5F4ZA 3HYCA 3F4BA 2LBPA 3AF4A 3L5KA 1S2GA 1RKQA 3K35A 4IKPA 4QDJA 4OH7A 5FKJA 1SKAA 3RVPA 3G6KA 3RVNA 3EJWA 2P1RA 1DFIA 2ORWA 1T6ZA 3I9LA 4I46A 1BC5A 4DBLE 4FCWA 1R12A 3ZWMA 4F4UA 1ENZA 2OPBA 5IDWA 2GI4A 2D7CA 2RBKA 2CCJA 1APBA 2WI8A 4X6UA 3KQSA 3RUFA 2WU8A 1S9HA 2OYRA 4EPTA 2C9YA 2FR8A 4MWZA 3ROKA 5C37A 3ADKA 3N74A 3OIFA 3PT9A 5B3JA 2I4LA 4KXFB 1STOA 1DV2A 2B4QA 2HT1A 4TS3A 4B9EA 2JLYA 3GBSA 3KQLA 3GBPA 3P71T 2YVLA 1G8SA 2JZOA 4D57A 3EZ2A 1OLSA 2YY6A 4YP5A 4QO8A 1JLSA 2LW7A 4ZTZB 1TM7E 3EBOA 2QTZA 3I28A 3TAXA 3CVYA 3QNWA 4DIMA 1M6HA 3L1UA 3QF7A 4NBKA 3DF7A 2ZYWX 4FHDA 4HN9A 5ESDA 1EBFA 2RARA 3R74A 1J39A 5JS2A 2IEGA 3ROXA 4QAJA 5SYMA 3E48A 3GUZA 3NR2A 3WDMA 1JEQA 3BICA 1ECPA 1WU7A 4Y6PA 4EG7A 5IUNC 3SKVA 5KJFA 1Q3KA 4RAOA 1YQ9A 5T3UA 4F7DA 2BEKA 3OEYA 3CH6A 3FY4A 3PR2B 3KLBA 2W98A 4J3FA 2HQOA 2O50A 2AFHE 3BXXA 3JQBA 5MDHA 2WKSA 1ZK3A 3CF4A 4Q82A 1YCFA 3UJ9A 1LDEA 4LF8B 2YWXA 5IBPA 3TEFA 3RODA 4G85A 1EZ4A 3ZTTA 1KEWA 2ID9A 3KEFA 1Z6AA 4A9AA 2PO5A 5LMCA 1VSBA 3IAUA 1KK2A 1BVRA 3B6EA 4X7PA 2PR7A 4PLVA 3OD1A 2VZ8A 3K1TA 2IUUA 1DMSA 3PD7A 4XSGA 3U4GA 3UF0A 1D04A 1JJFA 1GTVA 5IF3A 4H3HB 4OV6B 5TS2A 4UAGA 2IC5A 2G1PA 1M7BA 5I7RA 2JA2A 1WB4A 1U1EA 3OQ1A 1YFKA 3HCCA 4HX2A 4D0GA 1IU9A 4DUYB 3HL4A 3E6AA 1KYQA 2A9PA 3OJ0A 4BFWA 4IMJB 1H23A 1T8YA 2HSEA 1FJ2A 4R0VA 4FHGA 1A9QA 1U8EA 2KHZA 5DX0A 4EL5A 5JOQA 4BLSA 4H7HA 2R62A 3PUKA 2WA2A 2Z2KA 3AKDA 2FPUA 2IJGX 2YHBA 4LY9A 4X3CA 1E3TA 4Y2JA 4ZHQA 2OZPA 4F9EA 2NXWA 1JXAA 2DLNA 1FU7A 1X77A 3CISA 3NAQA 4X84A 3HGQA 4I1SA 4ZVRA 3ZCQA 4CIBA 3AILA 1QH0A 1QQ6A 2BAGA 4RBNA 1VA5A 4JDPA 4H0CA 3B6IA 2Z6QA 5AW8A 1VPDA 5BUCA 4UDOA 5BRJA 1B1AA 4OMCA 1OLUB 5ALOA 4DCSA 1VL1A 2DUJA 4PO3X 2BYTA 4XSHA 1K8YB 2IUEA 3GQBA 2PRYA 3JYLA 4HMQA 4TL9A 1EDBA 5IVPA 1UPTA 2GF0A 4Y6OA 4BNTA 3WAGA 2ZUFA 3VOSA 1VL2A 2P6PA 3O0TA 2A5LA 2PCJA 4G09A 4B0OA 5H3CA 4D8WA 4G0WA 3BH7A 1JV2B 3P2IA 4RD4A 5HS6A 1F0YA 4E2YA 3R8FA 1SCIA 2FW6A 3FLBA 5EKSA 3T0IA 2C1EA 4NDZA 4C1BA 3H83A 4PLFA 2OE2A 3LRTA 5CT9A 2I1QA 3V7FA 1WKBA 4EITA 5LP6A 2KS6A 2WWGA 4FINA 1UBSB 2G04A 3WMRA 1VGVA 4QATA 3R7BA 1XQVA 4JN6B 2KI5A 5I6DA 4CMEA 2CXOA 3COJA 3K1AA 4KE6A 1OREA 5B1YA 4YH1A 4CFZA 4CKEA 2WWIA 1DIGA 1PNQA 1E9FA 1G41A 4RTPA 2LKDA 2IF2A 1PQPA 2E49A 3GB9A 1AG9A 4AY2A 5JZBA 1TK9A 4ETIA 5EUQB 4LS3A 3FWHA 2HMVA 3IEXA 1EHYA 1VFNA 1C3EA 3WLRA 2Z2ZA 4ALLA 2INGX 4LJAA 3W8EA 3DEAA 3GRKA 1JT9A 4K03A 3DTVB 1JDJA 4PINA 2B69A 1DI0A 1W88B 4JQYA 4TTVA 2W8ZA 4IH4A 1W0CA 2HAEA 2HLDD 2LDXA 2IDZA 4PAMA 4PR0A 3BWDD 3C3AA 1LFAA 1I7LA 3G7NA 4ZODA 4ABTA 2YJZA 3I52A 1NF3A 3L04A 3QMVA 2TS1A 3O83A 5DVZA 3D3NA 5KX5B 4RH0A 4BVGA 4LYDA 2C96A 4FLFA 2IY9A 1O89A 5FI5A 3UMMA 4DR2B 4XIIA 3ZY4A 4XB2A 1E6CA 1FFXB 4Q01A 3LSTA 1XAGA 3L6BA 2J67A 3AFOA 1Y6ZA 2A0UA 2NXCA 2AUTA 5HIKA 3PENA 2O2JA 3SR3A 3DFUA 4BN5A 3OF5A 1JI3A 3QYPA 4GRIA 1YQDA 3SZ3A 1ZW1A 3CW2A 3TOVA 2ZJAA 2CB0A 2ZIXA 3IP1A 1CUYA 3NC4A 1KHHA 3RS4A 4MQBA 3ET5A 2X42A 1T3GA 3M6MD 4D9IA 1Y1SA 4G5SA 4PZYA 4OK3A 1Z82A 4LJSA 1DBIA 4NU8X 4WY8A 3USES 3IDQA 2AR0A 1ZLXA 2K2WA 4P36A 5J63A 4E3WA 3FAKA 5FLXA 3AIIA 2MIIA 2WD7B 4MR8B 4EJ0A 3UAGA 3DBVO 4WCVA 1JLLA 2J3LA 3VKUA 3FVRA 2QVLA 1QCCA 3HUTA 3PL5A 1R2QA 1B2LA 1GTMA 1ZEMA 2Q27A 3AIOA 3BHIA 3QXCA 4G4JA 1VKHA 4DMMA 5I8PA 1B2RA 5CYOA 5L7WA 4V02A 1Y5NA 4GSYA 3DQPA 4F1WA 1IEWA 3C3EA 3AHFA 3FPJA 4ZA2A 4DDKA 3QFHA 2VNKA 2VUTA 2WSSA 3KQQA 4NAVA 2IEYA 4KQXA 1KEEB 2BM9A 1TA9A 2EV9A 1JWBB 4UBOA 3DLTA 3EGWA 1EP9A 1FYVA 2C9MA 1E9AA 4G0VA 1JEJA 1SB8A 5A7FA 2C29D 3VR2D 3T34A 4WD3A 3RIXA 2WSMA 2CLCX 4GD3Q 3R9XB 3OZCA 4B83A 5INTA 1QWOA 2C4KA 1MQ8B 2PVPA 5CNMA 5A2QA 1C1XA 3K3PA 1A7AA 2IYNA 4ZAFA 3TLKA 3YASA 1N5OX 1LUAA 1W4BA 1OCEA 1SOAA 1X8XA 1N6OA 4DT1A 1GXSA 1G6OA 3NDIA 2WFMA 5IVHA 4JQSA 3OFNA 1LVHA 3P20A 2WMNB 3M9WA 3ZHCA 1USVA 3BGSA 1EX6A 2BBSA 1T4BA 4LXUA 4QDXA 4UBNA 1VG8A 1Y3CE 2RBEA 2WINI 3AG6A 1EGMB 3DV0A 3EZFA 5A0FA 2IZZA 4HWGA 1XZJA 1NI4B 4NL4H 1HRKA 1A8SA 1YJ5A 3VC1A 4DLXA 1L4EA 3QLUC 4XUEA 4RGBA 3PICA 3TI9A 5BV2P 2D1FA 3VKVA 1UMBB 2I71A 1POWA 3C4VA 3EIXA 1ZM9A 3W8FA 3IKVA 3GRYA 5ADVA 4C6RA 4JU8A 3HGTA 5K3OA 1UQTA 2J5KA 4TQUS 3AHEA 2V6MA 4OI0A 1MIOA 3QFFA 1EGHA 4Q47A 1MAHA 3FHLA 2BGJA 2J3MA 1WA5A 2ZJ7A 5YASA 2WYWA 1Q7RA 4EX6A 5JSHA 4EFLA 2P41A 1GRVA 1PI3A 3R3WA 1MRSA 3SMVA 1IXYA 1RU3A 2DHRA 3BHJA 4MIYA 2VNIA 4CG1A 3GLGE 4FBLA 4LZPA 1X9IA 4ID9A 2H4JA 1P9WA 1QP8A 4TZ0A 3FB1A 2XIJA 4LDAA 3OLXA 1JB1A 1FE8A 2AMVA 1IBRA 1NBME 4OXNA 4C78A 3KSAC 4Q15A 1OU0A 3RU7A 3A3KA 3CO5A 3TFOA 3GJ8A 3PX2A 2REQA 1QO7A 1XQ6A 2FDXA 1DIBA 3IT1A 4QBIA 1LF0A 3S1LA 2E0IA 1U04A 2AK2A 1QLJA 2NO9A 3E2MA 3AJRA 1U6KA 4R5MA 1YZUA 3Q3VA 1SO8A 4F5ZA 2GPWA 3DEZA 5A5EA 4BMNA 5ANRB 1B0UA 2E2WA 2ZT8A 1CD5A 2JGLA 1JFFA 3H8JA 1DUVG 3DMRA 3IHWA 3OQIA 4WKCA 5G0SA 2FXVA 5BVHA 2IYRA 3KB8A 2QLTA 3PTAA 4X8LA 4FUTA 4IMPA 3K94A 1C3OA 1IOZA 3PPXA 3K20A 5KQMA 4MI1A 2EFYA 3E9MA 4F38A 1ACMA 2P5UA 2FHPA 2OBMA 1QONA 5HKKD 1XTUA 1G6HA 3E53A 4RFSA 1R9NA 1ZMOA 4Z9XA 4AUEA 2CD9A 4NX2A 3GJ7A 1HEUA 1AQUA 3B5IA 3NNDA 4IDPA 4LECA 4QHTA 4URHA 5EZYA 3RSGA 5KDDA 4OH1A 1SQ5A 1PEDA 4QKQA 4TLAA 5A1JA 3QHPA 4M60A 3U1TA 1QHSA 4YFYA 1O77A 1L4LA 1YZFA 4GNKA 3W5SA 4CKXA 2XZLA 1W5SA 1RABA 1ISSA 5JXIA 2AEMA 2OSVA 3M5CA 4OI4A 1J24A 1PJ8A 2VDWA 2PQ2A 1KDTA 2VF4X 2JAWA 2VHJA 4JB0A 1JSCA 1D2RA 1S1MA 3D3KA 3PUJA 4FOPA 4N40A 5IXYA 2PT7A 1G17A 1LJUA 3AT1A 2X76A 2FX2A 1VYHA 1JW9B 1D4ZA 2P2CA 5FL7A 5B6IA 1QYIA 3PEUA 4S1WA 2BHTA 2ATXA 4X8MA 3C87A 1K2VN 1RXUA 3N7TA 2Y6VA 4LJ8A 1B3RA 4QYSA 2XUFA 1WW2A 4TZKA 1L5SA 5GTDA 1YS6A 3A06A 3D8SA 1GR1A 1N8NA 2GTIA 5HJEA 1R8SA 3WYGA 1WLYA 3OJXA 5BMVF 4G89A 5JXGA 4O0LA 1C8KA 5ESXA 2ID8A 4LMRA 2O1SA 3DM5A 3E70C 4BKOA 2CT8A 5M7EA 3OBIA 2I4OA 4EABA 2C5SA 3SZRA 4E09A 1K92A 1CSEE 3IO5A 5TX7A 2EG9A 1R37A 1RADA 1URPA 1JP7A 1JAYA 1K68A 2EBFX 2QD1A 1J09A 2QQGA 1BEUB 3AERA 2X23A 2FFAA 4N5DA 4RORA 4B3BA 3DZIA 1I0ZA 2JZCA 2JKVA 2XF8A 2AJBA 1Z13A 4FKZA 4ZMSA 3BORA 4B3FX 3ZEAA 4I9NA 4TL8A 2ZRPA 1ZIDA 4LHXA 3AFMA 4OJKA 1T1IA 1TIKA 3B12A 3T95A 4FT2A 4Z7QB 3UMVA 1P2GA 4ZANA 2GHRA 3FGPA 3TLAA 3V8EA 4J7UA 4QBHA 5HBRA 1U9JA 2VPPA 2REOA 3K6JA 4PN7A 2EVWX 4XD7D 4EP1A 5DM60 4NMXB 1OAOC 5KUTA 1QHYA 3H5TA 2ZZKA 2AOUB 1JJAA 3QKRB 3DLBA 2I87A 3OJCA 3QXGA 2H2WA 1E2MA 2FE1A 2JI6A 1MEOA 3Q1KA 1FUKA 2WICA 2MINA 4J0HA 4O1HA 2GCNA 4U2BA 3REOA 5AJUA 3S1AB 3TX2A 3VPHA 1T4GA 2OL4A 2ZYUX 5DM0A 3PTLA 5CCDA 2QDXA 1Z7YA 2HA6A 2JK0A 2QR3A 4LGYA 3RRYA 3AR4A 1N1GA 4X63A 2B99A 2PZEA 2VDMB 2HHAA 4OXYA 1DRJA 4C9BA 5EHZA 3R9XA 1ADYA 4W4TA 3DHNA 2IITA 1N6LA 3G5AA 5D7BA 5B3JC 3DR3A 3GVXA 4BUCA 4KKXB 3D8UA 3I3SR 2EHJA 3R3JA 3CURA 5DU2A 4ZRDA 3ZI0A 1ADCA 3P97A 4XJSA 4YRDA 2OBBA 3KCNA 2AKAB 4DDVA 5TF4A 2PLRA 3QU7A 2GD0A 1XFDA 2QPAA 3TYXA 1T5BA 3BMCA 1FMLA 4JVMA 2R5NA 3KFVA 4MRAA 1P0QA 1EDEA 3VVLA 5DRTA 3HLYA 1KZ9A 4RA9A 4P80A 5AOCA 3VYUB 1N5MA 3MS2A 1O87A 5G02A 5HDBB 1XZGA 1FNSA 3LA6A 1REQB 5A4DA 2Q99A 2EARA 3RVBA 4BZWA 2WSYB 3R23A 3PXAA 1GGMA 1O5TA 3G2HA 5LXTF 4OATA 3R7AA 5BNWA 1P4HA 2ZYGA 2ODQA 4TV9F 1FX0B 2ODNA 4LF6B 3OUUA 2BI8A 4PE5B 2K7ZA 1E1LA 2DPXA 1ORWA 3JQBC 1GNVA 5CT6A 4Q66C 5DTMA 1M1NA 2FZCA 2VDJA 5I5GA 4DXDA 1MCZA 2XKJE 5KIAA 2Q4OA 1T1JA 3FIJA 4DCNA 1U0FA 3LKVA 5EKDA 3U7QB 2FW8A 3AR2A 4KNYA 4JWTA 3GEPA 4MYDA 3IE2A 4ZEWA 2QP4A 4W9RA 3GV0A 4KSBA 4EFMA 3A28A 3MD9A 1VB3A 1YJQA 4QA9A 5DHQA 4EFNA 4YASA 4RVUA 5J47A 1Y3IA 1E98A 1GUBA 1MKYA 1C30A 3C1UA 3K5PA 4L72A 1V5EA 1X70A 5DK4A 3ZCPA 3K8OE 4ZCTA 1XTIA 3N0VA 4DXHA 1M0TA 4YNBA 2RHGB 4ZD6A 5JH7F 4LF5B 3CUKA 2YVUA 1KC3A 4WPGA 5C31A 1V48A 2HNAA 2R2GA 3TSZA 3UH1A 2H0AA 2JCBA 1V8DA 3H5NA 2AFIA 4DSAA 1T2DA 5CB4F 4LXXA 3BK2A 4YQEA 3U4QA 1EWKA 5HGXA 1WXXA 1IAQA 1QO0A 1O95D 2YVQA 1T2EA 1D2EA 3WLFA 3KSRA 1KYWA 3ZX5A 5KTMA 3G5UA 3PXDA 1H0SA 1G7RA 1M75A 2GCPA 3PQFA 5CX4A 5K0TA 1N3LA 1V7QA 1MU0A 4U6SA 1V9SA 2YASA 1BX0A 1FXWA 1GAQA 2XWPA 3T5AA 1VCOA 1ZJYA 3TBHA 3NMUF 2OHVA 2LIPA 1LDGA 1PWYE 1OH5A 2IE8A 2PS3A 1DEOA 1KBQA 3EVTA 5F3WB 4DABA 2WHYA 1MG0A 1V5GA 4U39A 4UC0A 2XOEA 3TSCA 4YCJA 4CM5A 5C8DA 2ZRBA 3IMKA 3LC2O 4X93A 2QTAA 3H84A 2WHXA 4OL9A 1SC9A 1BEZA 1AHHA 3M33A 5AI5A 4FCTA 4OBWA 2JIBA 3TN7A