2PNFA

Structure of aquifex aeolicus fabg 3-oxoacyl-(acyl-carrier protein) reductase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
248
structure length
248
Chain Sequence
MEIKLQGKVSLVTGSTRGIGRAIAEKLASAGSTVIITGTSGERAKAVAEEIANKYGVKAHGVEMNLLSEESINKAFEEIYNLVDGIDILVNNAGITRDKLFLRMSLLDWEEVLKVNLTGTFLVTQNSLRKMIKQRWGRIVNISSVVGFTGNVGQVNYSTTKAGLIGFTKSLAKELAPRNVLVNAVAPGFIETDMTAVLSEEIKQKYKEQIPLGRFGSPEEVANVVLFLCSELASYITGEVIHVNGGMF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Aquifex Aeolicus FabG 3-oxoacyl-(acyl-carrier protein) reductase
rcsb
source organism Aquifex aeolicus
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-[acyl-carrier-protein] reductase
total genus 92
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2007-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2pnfA00
4CQMD 1T25A 2CMDA 4IPTA 5TX7A 3D1LA 3ABIA 1YBVA 1P1JA 4LSMA 4BNYA 1OI7A 3QWIA 2XOXA 2Q1SA 4E5YA 5B12A 3PVZA 2PKQO 4L8VA 4PLHA 3JV7A 4E5NA 1H93A 4WK6A 2X6TA 2CZCA 4YPOA 2V7PA 5BSHA 1KIFA 1YRLA 3L4BA 4OIMA 4RV9A 5L4NA 2JHFA 3FCOA 1O89A 3PYMA 3IC5A 1XHLA 1DC3A 4DPLA 4R16A 1YL7A 4L0QA 3H8VA 3QIVA 4PLGA 1H5QA 3OECA 3QWHA 4XEHA 1DFGA 3LT1A 1B8UA 5FFFA 1AHIA 3KTDA 1T2EA 4E5MA 3ZWAA 2X0NA 3KZVA 5JLAA 2EGGA 4YA6A 2Z5LA 2AE2A 4BKRA 1OFGA 3AUSA 4R01A 2J5RA 4CR7A 3H5NA 2FSSA 1VKNA 4RL6A 1PX0A 3V2UA 4OHUA 1C1XA 1U7TA 3TZCA 3FN4A 4RPGA 1KS9A 2WYVA 4PLFA 1P0CA 2VZ8A 4M1QA 1V3UA 4XQEA 1MX3A 1GU7A 1AN9A 3UCXA 2B4RO 3CSDA 1E1KA 4CR8A 1XA0A 5DZSA 4RCVA 3QSGA 1MXHA 1DC5A 2H63A 1NR1A 1U3TA 3GMSA 1P1RA 1PS0A 4KDEA 5BR7A 3RUHA 3H5AA 3UAGA 2RIRA 1Z7BA 4OXKA 1T2FA 3DONA 4HXYA 1LU9A 4I08A 2RHCA 1W0CA 2GRAA 4BV8A 2QRKA 2C2XA 3LDHA 1ZO8A 1MFPA 2JJYA 3JQFA 4W4TA 3S2GA 3PYLA 1BXZA 3GDOA 2JKVA 3GQVA 3QP9A 5JDIC 4YR9A 2C29D 4PLYA 5JS6A 3K96A 3OBBA 4BB6A 2D0IA 3WYCA 3GR6A 1UR5A 1FDUA 4LMPA 1BVUA 4P22A 1A4IA 3NAQA 3RWBA 2AHRA 1PGNA 4CUZA 5DOVA 2EWMA 1YH3A 2VUUA 4YWJA 1FDVA 1JKFA 1ZEMA 4PG5A 5J23A 3UFXA 1W8DA 4BNWA 3F9IA 1HE4A 2P5YA 2HMUA 1SOVA 3JQ7B 3WYEA 4LVCA 3KXDA 3X2EA 4DIOA 4DBZA 2J3IA 4Q9NA 3IKVA 3C1TA 2X9GA 1BTOA 5KJ6A 3D4PA 3EZLA 1CEQA 4Z9XA 1HLPA 3DZGA 2EG9A 3Q11A 3QJ5A 3QWFA 1DPGA 5JAQA 1HDCA 3H65A 1K6IA 4U5QA 5I7SA 3DZIA 2X5JO 1SZJG 1EVIA 3ZW8A 1LSOA 4NBVA 3IL2A 4AJ1A 1WMBA 4FPXA 2WTBA 3H3JA 4J91A 5CDTA 1HKUA 1IY8A 4L4SA 3SC6A 3QWBA 2I66A 1MLDA 4GKBA 4LCEA 4YRAA 3U49A 4GQAA 5COAA 1V3TA 2CF5A 2CDCA 3QVWA 4LRSB 2DAPA 2PV7A 4TVBA 3CH6A 2DT5A 3E9MA 4R5MA 4J9UE 3ZWXA 4YJGA 1MGOA 4KUGA 2GLXA 1OBFO 3JQ8A 3ZV4A 4FDAA 1Y5RA 2WE8A 1N1EA 4E33A 4AFNA 1EBFA 4W7HA 3M2TA 1WW8A 2EF1A 2GZ2A 4S1VA 4J7UA 2Q2QA 1XQ1A 4Y67A 1F8FA 4WUVA 2R00A 5GZ6A 2PTGA 3S8MA 4DLLA 1EFKA 2ZQYA 2D59A 1RM0A 1ONOA 2FRDA 3BTUA 5IDWA 2HJSA 1QXSA 1LRJA 3EDMA 3QHAA 1R6DA 1JWAB 2NU8A 2GASA 2LDBA 1DLJA 2CY0A 3G17A 4IDDA 4WCFB 1JWBB 2PKQP 3TF5A 4JK3A 1ZK2A 3PRJA 2HU2A 5CPFA 3JD4A 3NTRA 3ROQA 1T4DA 3DBRB 4CODB 1X7HA 4RF5A 5TLSA 4PLTA 3C7CB 3HB4X 3KYDA 1Z7EA 1EMDA 3QVSA 1KETA 1YVEI 4N5MA 3MJCA 4OMUA 4NNJA 4CQLA 5IZ4A 4B4OA 4OKNA 4CL8A 1C14A 4E2YA 4I9UA 2HK9A 3QLJA 4WCFA 2YHUA 4HNHA 1YJ8A 4FC6A 2PA3A 5DCYA 3K73O 2F00A 1JKIA 2CDAA 2POQX 4WEQA 4YXFA 3PWKA 1IHYA 1KVTA 2YZ7A 1C0KA 5KJCA 3HHPA 5FI5A 2DBQA 4A5OA 1X7DA 5JCJD 4TRRA 3OSUA 4XD2A 3E8XA 1XG5A 3VC7A 4XB1A 2O7SA 3ZHBA 3ETEA 2DVMA 3RSHA 4DYVA 1C1DB 1NQ5A 1X1TA 4QQRA 4B7UA 2PH3A 4EEXA 3AI2A 1P1FA 4WE3A 1P77A 2A92A 2RH4A 1I10A 4GMGA 4XYMA 4E2ZA 4ND4A 4DPKA 4FIZA 1KVSA 2RH8A 3I83A 4YJHA 4RORA 1NWHA 1C1DA 3HDJA 4KQXA 1VSUA 3OFSA 4G2NA 1E3IA 3FSRA 5ILOA 4WNIA 1GR0A 1AHHA 1PEDA 2VZ9A 2HSDA 4CM9D 3NGXA 2OZPA 1UJMA 2YDXA 2XF8A 3DZBA 1PJLA 2VWPA 1P0FA 2DTDA 4IDFA 4J1NA 4A0SA 4BS9A 2BELA 4D3FA 3GN2A 4CLRA 1U2DA 2IDZA 2X0RA 4LCJA 1DRWA 5IAAA 3ONDA 1Q2XA 2VHVA 4ID9A 4F46A 3A06A 2ZCVA 4XYGA 5IJZA 5GZ3A 1WLYA 1TB4A 1ZXBA 1B26A 2JCVA 2O50A 4GBJA 2QW8A 1M2WA 1LNQA 1PJCA 3D64A 1ADGA 5MDHA 3R3SA 5G4KB 4EUEA 4Y8VA 2B5WA 2VN8A 3WG9A 1IULA 1WVGA 3ZV5A 4DGSA 3WGZA 4E31A 4ZQHA 3BIOA 2E48A 1GUYA 1PQUA 1Y8RA 2GD1O 4W99A 3GRKA 1F0YA 5I9NA 2NVBA 1LBEA 3GNTA 4YJDA 2DBRA 4GL4A 5EPOA 1P1KA 3ICPA 3VOSA 3ZV6A 1MP0A 4EW6A 4A7PA 2AQHA 3HG7A 3PQDA 4N5NA 3W4IA 1LDEA 1ZEJA 3QWAA 2B4QA 2CD9A 1ZXLA 3WTBA 4YAEA 3DZHA 4IDAA 1X0XA 1Y6JA 2AQIA 1R16A 1ISGA 3BMQB 3OICA 5IN4A 3JQAD 3WYBA 2A35A 5C7LO 3C3XA 5BSGA 2VHXA 3AK4A 1DXYA 2X5OA 5G0SA 1H0KA 1JVSA 1LJ8A 5AOVA 1WDKA 1U3WA 2HCTA 1D7OA 1K5HA 4J90A 4Z6KA 5JCXA 5L45A 1K2WA 2PZMA 2V6GA 5G0TA 3RC1A 1PL6A 3LU1A 4FS3A 2Q4BA 5F3RA 4BKUA 4Z3KA 2WWRA 1PU2A 1NPYA 3PPIA 3WICA 4XCVA 5A02A 3I9LA 3BHIA 2HRBA 3LZ6A 1QP8A 4LMRA 1KVUA 4OL9A 1QYVA 4E30A 5TNXA 1DAPA 2O23A 2EKPA 2V6BA 4NBUA 1WWKA 3RFTA 4EJ6A 2B37A 5G2OA 1F06A 2GZ1A 3PP8A 4NHEA 4RVHA 1WXDA 4CPDA 2VT2A 3ZNNA 4S3MA 3I23A 3AY7A 4MOWA 1LRLA 4R3WA 1UZLA 3I6QA 3H4VA 3KRTA 4J0EA 3ETDA 3W8EA 2VHWA 2RBEA 2UAGA 1GQ2A 1PJ4A 5FYDA 3GZNA 1Q7GA 3IJPA 3GHYA 4PN3A 1AUPA 2DTEA 3VH4A 4F6CA 4GX5A 3JYQA 3KETA 1HLDA 4GWGA 1PS8A 4Z0TA 4F6LA 2P9CA 3LC1O 1CYDA 1HDOA 4CLDA 3GY0A 1ONNA 1P31A 1B16A 1WAMA 2Y99A 4YYZA 3G79A 3K2BA 3Q2KA 1CWUA 4D3SA 1EUZA 4DL9A 3CMCO 5IG2A 4AJHA 1PWZA 1EZ4A 3TL3A 1QRRA 3FWNA 3GC6A 1NVMB 1V35A 3MOIA 4CMHA 3AI3A 4ZD6A 5T57A 3UCFA 3D5QA 1EDOA 4F45A 1NNUA 1RM5A 1SPXA 5GMOA 1B2LA 3COSA 2VYNA 3JYLA 2UYYA 4RZIA 2EJVA 1XGKA 4RLSA 3DXFA 4RJTA 3RUAA 2H5LA 1HDZA 3GGGA 4P4NA 4IQ0A 3KEOA 3H9UA 3KSUA 5DCUA 3WDSA 3Q2IA 1UP4A 4NG5A 5JAIA 3VH3A 4YT8A 4M87A 5CG1A 1BXGB 4FJ2A 2W8ZA 4HFRA 5DNAA 4QT0A 4BB5A 5EL0A 3KVOA 4LISA 2J5KA 2CFCA 4R54A 4MVJM 5ER9A 1FK8A 1GAEO 1LQTA 1JKJA 2C5EA 3VTFA 5BQFA 5CDUA 4NR0A 4TKMA 4E13A 1LEHA 3K31A 3B6ZA 1EVZA 3JCZA 3K2EA 4IXTA 5A3JA 3AW9A 3H9GA 3H3FA 4BO1A 1I2ZA 3P19A 4E12A 3MJVA 2OP0A 3AWDA 2HDHA 4L4RA 2Y67A 4TWRA 2QX7A 4G65A 4DLAA 4DTIA 1F14A 1ZNQO 4RO0A 4J43A 3GHHA 2GR9A 3OJ0A 4CV3A 1DC4A 1L7DA 4ZVVA 3F4LA 3BMCB 2NNLD 1VJTA 4J1QA 1Y7TA 3FPLA 4KTVE 2J5QA 4URFA 1LDGA 2WSBA 3CZMA 4Y6SA 4L73A 2ILTA 1NFFA 5DP1A 2J6IA 4WLUA 1KOLA 3FR7A 3F3SA 2ZB4A 4MIOA 4MP3A 2VUSA 1KEUA 1N7HA 1EBUA 1O6ZA 4XR4A 3IAHA 5JCJA 1R15A 2IYPA 4WCDA 1P3DA 2SCUA 1U8FO 2A9FA 4GI2A 2OOSA 1KEWA 3R1IA 4HFJA 1IUKA 3GNQA 4DMLA 4WOJA 1TEHA 2GUGA 3PHIA 3UICA 4NBRA 3M1LA 1SMKA 2IZZA 4B4WA 2G82A 3A14A 4WASA 1SNYA 5I9MA 2C0CA 3D7LA 2C5AA 4IMRA 4BNXA 1BHSA 3LLVA 3DOOA 5TC4A 5U1PA 3OIDA 4J6FA 1BVRA 1N7GA 4Y6PA 3RASA 2X9NA 4ZQGA 2GPTA 1ZJZA 2IE0A 5A9TA 1IYZA 3PI7A 3VPFA 2JD2A 2EW8A 4UVDA 2W2KB 4GVLA 4IGFA 1ADCA 1E3WA 1PZEA 2E37A 3DBHB 3VVCA 1N92A 1PGPA 4ND1A 2BGKA 1IPEA 4IDCA 2BFOA 3BTVA 2BH9A 4JP3A 5ITWA 3DL2A 3FF4A 3K8ZA 3FNGA 3RKUA 2EERA 4OOFA 2AEMA 4CLOB 1RYDA 1C0LA 4PLZA 1J4AA 2IZ1A 2O48X 4J2OA 1GFSA 3WQQA 4XJTA 1A27A 4FJ1A 4XGIA 3ONFA 2B69A 3WOHA 1A4UA 4IJKA 3TOXA 2PK3A 1B14A 1Q0QA 1B0AA 3T7EA 4Q39A 1DRVA 5COQA 3U4DA 4K6FA 4H16A 2HKIA 2UV8A 2ET6A 1HSOA 5HBRA 5CEEA 1TA4A 3KSZO 3U4HA 1ADFA 4R69A 5CPBA 5THKA 1XELA 4FW8A 3ADOA 3HSKA 3G49A 1ZUD1 3H7AA 4GLOA 1G1AA 2WEKA 3RU9A 4IDEA 4JQCA 1Q0HA 3JD2A 1QYCA 3JQ6A 3WWZA 4D79A 3GAZA 3SVTA 4D0RA 3JQGB 3CINA 3OJEA 3W1VA 2ZYDA 1H6AA 3FWZA 3I1JA 2BFAA 1HT0A 1RJWA 4JCOA 3F6YA 3PLNA 3GRPA 5L7YA 3GG2A 4GWKA 4BNJA 4YRBA 2C7GA 3SXPA 1EVYA 2Y1CA 3MTJA 5C37A 4AJ2A 1EK5A 2UDPA 2NTNA 1A71A 2OO5A 3HDHA 4MKXA 3WGOA 2A94A 4JNKA 5A5EA 1HWYA 5A9SA 4R1NA 1ENZA 1KBZA 4K1LA 5H81A 3TDKA 4CQMA 3C8MA 3W6ZA 1F8GA 2BFPA 3O8QA 2NTVA 2Z1MA 3WTCA 1ISIA 1UXJA 2HLPA 3TNLA 4CMIA 3HB5X 1DOHA 2NQTA 4KMSA 5IZCA 1SO8A 2O2SA 3HADA 3PGJA 3SC4A 3D4NA 2VTEA 2C54A 1G0NA 4BGIA 5JAZA 3W4KA 3PWZA 3WQSB 1ZBQA 3ANMA 1Y81A 1RYEA 4O0LA 5FF9A 1I30A 3DAFA 4BKPA 4UEOA 2C2YA 4JBIA 5THQA 3GH3A 4BMNA 2I5PO 4GGOA 1KVQA 5JMPA 4AJ4A 1HYHA 2BD0A 2RHRA 4YQYA 4IGEA 1Q0LA 2DPHA 4CV1A 4PZCA 1UDAA 3A4VA 1PGOA 2YQ5A 1H2HA 3GA0A 5A03A 2B0JA 3U62A 4RDIA 5KVSA 5KIAA 1CRWG 3K6JA 5A05A 1EVJA 1M76A 1WZEA 1KERA 3PDJA 3GGPA 3DDNA 3CMMA 5KJ1A 3WIDA 5KKCA 1HDRA 3AFMA 5KJEA 2EV9A 4O1MA 1G6KA 4D7AA 2Q49A 4TRMA 2CVOA 5ADHA 1XU9A 2Y68A 1GADO 2DKNA 4PCVA 4ALLA 1GY8A 5LDHA 1KVRA 4LK3A 2FPPA 4CQLB 3ZN2A 5EJ2A 4D0SA 2DBVO 2ZIZA 4EUFA 4J3FA 3SLGA 2NU6A 4WLVA 4CMAA 4RVUA 1LDBA 1YKFA 1D3AA 2PZJA 1M6HA 2HMSA 3WGTA 1JAYA 3ZWCA 3U09A 4UEKA 3H6KA 1PJBA 5C7OO 4FGWA 5FEUA 1YQXA 3R0IA 2ZB7A 3ZH2A 1DIGA 5F5LA 4FBGA 1GZ3A 1QLHA 5COBA 3AY6A 3VDQA 1I33A 4AJOA 1DSSG 4HUJA 4IQ8A 3VHRA 3GZNB 3INRA 1KY4A 4WOKA 4JJIA 4L75A 4U6QA 1NQAO 3P7MA 2D4AA 3NT2A 2YV3A 4GKVA 3ZU3A 2AXQA 4XZ3A 4UVGA 2ZTLA 3UH1A 4O5OA 2W98A 4ALIA 5JFOA 4Z9YA 4ALNA 4KOAA 4QXMA 4CM6A 2D5CA 4D43A 2H9IA 4TSKA 1EK6A 1VM6A 5GZ1A 4DRYA 5KNLA 4OM8A 2WD7B 1OC2A 4GSKA 4CLRB 3GFGA 3ASUA 3TN7A 1EUCA 5IXYA 3QVOA 4E6PA 3QVTA 4HP8A 4ESOA 2FHSA 3DMTC 2W2LD 1VL8A 4BNKA 2FMUA 1NX6A 1YL5A 2P4HX 3P2YA 4PG6A 2RAFA 5I7EA 2NQ8A 4K26A 4E0BA 1SBYA 1R66A 5KCZA 4JIGA 3RC7A 3QRWA 3ICCA 1EE9A 1OMOA 2I3AA 1VC2A 3IUPA 3GVCA 2NSDA 3JQFC 5DULA 5FWNA 1QYXA 2NTJA 3ENKA 5L4SA 3L6EA 4NFSA 1QYDA 4DC1A 1VJ1A 3FTPA 1O8CA 3QW2A 2AQ8A 4TZKA 4IZHA 2QHXA 5TIIA 3LSYA 3AM5A 5KVVA 1KC3A 4BQRA 4Q3EA 4E32A 3UW3A 5CDGA 3NDRA 5ICMA 3QE3A 4OO3A 3AUUA 3RJ5A 1DJNA 3GN1A 1GDHA 1ENPA 2AG5A 1IHXA 4YBZA 3U3XA 4K28A 3UGKA 3NV9A 3ZU2A 4AJPA 3D5TA 3TWOA 4YAKA 2CDBA 5JDCC 3INGA 4L4XA 2Y1FA 1ENYA 4ND3A 4AJNA 1ZJYA 3JQCA 3OJFA 2BFMA 1LLUA 3AFNA 1RM3A 2JCYA 3RQSA 4IBOA 3N74A 3EK2A 3ZZNA 2F1KA 4KUEA 5T6BA 1R4NA 5BNTA 3NJ4A 2TMDA 3E6AA 3EC7A 4E4YA 4DMMA 3EZYA 1GEEA 3DQPA 4J7XA 4NIMA 2Y93A 4A27A 2X7HA 3RUCA 5IFLA 4HY3A 5G0VA 1CETA 4BNUA 3H9QA 3OQBA 3UVEA 3ON5A 4NBTA 5EQFA 3L07A 2ZYAA 3JTMA 1E3EA 4UAGA 3E1KA 2FR0A 4E3ZA 4I9HA 3Q1LA 4BO3A 5L7TA 1AE1A 1MFZA 1HDYA 4C7JA 4J7CA 4MIEA 2R6JA 4NK5A 2VOJA 3NTQA 1XSEA 1XQ6A 3KM0A 2NWQA 2YV1A 3ZNOA 4BUCA 4ALJA 2VHYA 1O94A 2DQ4A 4ROSA 1GYQA 4JGBA 3PJFA 1QV7A 4NJOA 4CMBA 1LC3A 2XXBA 3TFQA 1PS9A 1VL6A 3G1UA 2D5AA 3GMDA 4YT2A 2X22A 4GX2A 1UUFA 4RPJA 3AY3A 2G0TA 2WD8A 4IZIA 2OORA 3DR3A 1JLLA 1R4MB 1N8KA 1YOVB 5BT9A 4PGFA 4GGPA 3U4CA 3S2EA 3IJRA 3L77A 1QYWA 1E7QA 3FTNA 3FNHA 1ZMTA 4QTZA 2J3JA 5HWSA 3LLSA 3FBTA 1CIVA 4EBFA 3GLQA 1I24A 3JQ9C 3KEQA 1P33A 4OYRA 3BMOB 4CQMB 1E7MA 2P68A 1UP6A 3AOEC 5F1PA 4CUKA 4ZHSA 3BHJA 1U3VA 3V2HA 3EAGA 1AXEA 4LGVA 1ZCJA 5JO9A 5JY1A 2Q46A 3CKYA 1DHTA 5L3ZA 1GUFA 3TOZA 3VDRA 4FFOA 1B3RA 3KHUA 3H2SA 5IDXA 2FWMX 1YL6A 4PZDA 4BL5A 4AL4A 4ALKA 4AICA 4UVIA 5JYDA 4TROA 1YONA 3PIIA 1LRKA 3V5NA 1C0IA 1WZIA 3PYXA 1LTHR 2O3SA 3SX2A 3RFVA 1VPDA 1ENOA 5CP8A 1EEHA 2GZ3A 5CHEA 2EEZA 3UXYA 4C7KA 3QVXA 3VKUA 1HDXA 2O3QA 2I76A 4C4OA 4EUHA 4D3DA 4WEOA 3S2IA 5A5FA 3RKRA 4AJKA 4YACA 3NEPX 4BNFA 4E5KA 3WR5A 2EKQA 3C7AA 2GNAA 1BGVA 1E3LA 4NBWA 1DJQA 3PXXA 3A9WA 3HE3A 3E9NA 4FR5A 4AJEA 3DAGA 3R6DA 4NDNE 3NDJA 4WLNA 3G1TA 2V6MA 4AJLA 3OM9A 2PZKA 2WM3A 3ZHYA 4EJMA 1Y1PA 1CERA 1ZH8A 1O0SA 5CAEA 3M1AA 2PD6A 3PIDA 3MZ0A 3K30A 3UN1A 3WLEA 2YHIA 3JQAA 1EDZA 4RLHA 2AE1A 3S55A 2YY7A 2O4UX 5HRUA 1U4OA 1Z6ZA 1ZIDA 4UEJA 3WMXA 3E48A 1ZK4A 1S7CA 1HTBA 5AYVA 1HSZA 2DC1A 4FJ0A 4BKOA 5K9ZA 4A2CA 2C7VA 4XJSA 1JQBA 3PZRA 1ZMOA 3IS3A 3S2FA 4Z3DA 2Q1TA 3NT4A 1NXQA 2YV2A 4NFYA 4D46A 1IE3A 1PJ2A 1UDCA 3DC2A 3DBHA 3QY9A 3FBGA 2UUPA 4XRGA 4ITUA 1PQPA 2VRCA 1PGQA 1Z75A 1CJCA 3TL2A 3PTZA 4EDFA 1GPJA 3PGXA 4TRJA 2VYVA 4ZICA 4QFCA 2JD0A 2O4CA 3ZU4A 4M86A 3WIEA 4CMEC 3B1JA 3TZHA 1PZFA 2G76A 3JQDA 2W2LA 5EMHA 2FPIA 3BMNB 1O5IA 2XXJA 3CTMA 4PLPA 1E6UA 3SEFA 4MJLA 4DVJA 5JC8A 4LW8A 3DAPA 1X0VA 1H9BA 1EQUA 4NPCA 4PFJA 3WMWA 4EYEA 3WS7A 4GPD1 1PR3A 2JFGA 5AXDA 4BO5A 2VNSA 2HMTA 4RQUA 5F1OA 5B4TA 2HMWA 2GERA 4DPMA 4NU6A 3FD8A 4XDYA 1KEVA 1IZ0A 4QUKA 3JQGA 1HYEA 1Z82A 4JROA 1FDWA 3LYLA 3GDGA 4GLLA 1M75A 5HA5A 4YJFB 1E7SA 2WMDA 3DEYX 3OIGA 6LDHA 3RUFA 4BO8A 3G0OA 3LT4A 4XR9A 3GNSA 3UF0A 5L95A 3LF2A 3ZNQA 4E2WA 2FOIA 3D3EA 2EXXA 1VSVA 4AJIA 5K6AC 3FPCA 3QQPA 4BNTA 2Q99A 3PEFA 1GL3A 4HBGA 4BNHA 5TS3A 4L74A 3GVPA 4IM7A 1PGJA 4RF4A 3PJEA 2VWGA 3PQEA 4YAGA 4XB2A 2Z1NA 3TZKA 3HFGA 4A10A 3KYCA 3K9QO 4GH5A 2DBZA 5I7VA 1KEPA 1PSDA 2D3TA 4RVFA 4JBGA 1I5RA 3U0BA 2X58A 4YJGB 1GUZA 1JU9A 2FPGA 3H2ZA 4U7WA 1LSSA 2I6TA 3GVHA 2BGLA 1DFHA 5L9AA 2JFFA 5DN9A 2QRJA 5I8WA 2O3JA 4TVOA 1ZZEA 4MVJF 3VPSA 2NU9A 2YYYA 4IJWA 4QSMA 3ZGYA 1DC6A 2AEJA 4BNIA 1HL3A 4YVFA 3FRJA 3LT0A 3L9WA 3PWSA 1ORRA 4JN6B 5JC1A 3NJ8A 4MP8A 3RC9A 5I7FA 5ENVA 5MGBA 4J2HA 1NAIA 2DLDA 2ZJ1A 3Q9NA 3SJ7A 2VWQA 3VZQA 3I9KA 4B8ZA 3B20A 4MVJE 3FHLA 5TJHA 3D4OA 3IOYA 1EUDA 3I9JA 4G5HA 1VL0A 1ULUA 2BGMA 4KP7A 3TSCA 4IINA 4NK4A 5U9CA 1J5PA 1Q7BA 3ONEA 1TVEA 4MDHA 2V65A 5U4QA 2DFDA 3JYPA 5B4UA 2VYVD 3MJTA 1K3TA 2H6EA 2Q2WA 2Q1UA 4J4TA 4KUHA 1VI2A 1XYGA 1M6WA 4XYEA 1YO6A 3I5MA 4YQZA 1SEPA 4WKGA 4RPLA 5HS6A 4PZEA 3CXRA 2W2KA 2WDZA 4I8XA 5IDYA 2TMGA 1U5AA 2NVUA 3W8DA 2O3UA 1ARZA 4L9RA 1T2DA 2ZK7A 4JX8A 1ISMA 4J4BA 5EESA 4OQZA 4CV2A 3HZZA 4N7RA 4NH4A 1A9ZA 1PTJA 4ILKA 3VZSA 3DOJA 3DZJA 3CZRA 4O63O 4XQGA 1X1EA 1ZSVA 1MG0A 1O9BA 1R0SA 4W82A 3UUWA 5A9RA 2NM0A 4ZQBA 1ZFNA 1Z73A 2NVUB 2EKLA 4PVCA 1C0PA 3BZUA 3DBLA 1YDEA 3C24A 4E5PA 5JW6A 5L4LA 5TT0A 1FF9A 4J1SA 5JBIA 4B7XA 1NFQA 4UREA 4DQVA 3ASVA 2JL1A 3IP1A 1Z45A 3HDQA 1T26A 4U6SA 3EY4A 4IDBA 4IS3A 4WNCA 1A7KA 1NQOA 1Q1NA 3OMLA 5DBIA 1H6BA 2WYWA 1NWCA 4P4LA 3ZWYA 3AM3A 4CMKA 4EJ0A 4FSHA 1YDWA 2Y66A 9LDBA 3WWYA 1YB1A 3BXXA 3I9OA 3LT2A 2IYOA 2QYSA 1T2AA 5JDCA 5A04A 1T2CA 4U0KA 1PL8A 4D41A 1LSJA 2GN4A 1FJHA 3GFBA 3RJ9A 4ALMA 1H9AA 3LF1A 3W8FA 4IXWA 4I1IA 1XEAA 3T4XA 4NZ9A 3WNQA 3Q6IA 4JBHA 2EW2A 5BNFA 4OXYA 3TZ6A 2H1SA 2VQ3A 1OC4A 2EJWA 2BF7A 4BNGA 4MIYA 4ND2A 1VLLA 4QX6A 5F5NA 5LCXA 3RUEA 1X14A 4BV9A 4YCAA 1XCBA 1YS4A 3JYOA 4JP2A 5TSDA 5AQ1A 2ZB3A 5IXSA 1BW9A 2PGDA 3EVNA 3GUYA 5IZCC 5K0ZA 1XLTA 5K6AA 3I9MA 4IDGA 3D0OA 2HMVA 4NFHA 2E4AA 2ZYGA 1CDOA 1YXMA 3BMCA 3GEMA 4CMIB 3EVTA 3T4EA 4KZPA 1NP3A 4PLWA 1I8TA 2P9GA 3I9NA 2Q1WA 4UVHA 3VZPA 4DIBA 3JD3A 4UUNA 3OP4A 4CM4A 3WFIA 1LUAA 2CF6A 3DMTA 3F4BA 3OH8A 3E5MA 4P4GA 3KUXA 2GF2A 3WGYA 4OGWA 1XR3A 4J16A 1YBMA 4WGGA 2AA3A 4W9NA 1CQIA 4LN1A 4M49A 4MVJG 3ZDFA 4CM8B 1BWSA 1E92A 3VPHA 1LDYA 4Y98A 1NHGA 2ZB8A 1M66A 3TQHA 3V1YA 1DEHA 1WNTA 1YB4A 5HS4A 3E82A 5ENDA 5A06A 3BTSA 1UXIA 3GAFA 2O2YA 4WJZA 3V8BA 2BI8A 4DA9A 3Q0EA 1DLIA 1SC6A 4K9DA 3ZWWA 3BAZA 5TJ9A 1LDNA 2DUUA 1BMDA 1V8BA 2R2GA 3H9JA 3KSDO 1ZSYA 4Y9DA 1TXGA 3T7CA 3PJDA 4P38A 3UOGA 5JMWA 4INAA 4K6CA 4MVJA 1WDLA 3ADPA 1LLDA 1YE3A 4I9NA 3HJAA 3EW7A 2B5VA 4J0FA 3WX0A 2QZZA 3CUKA 3HUDA 3VVBA 4GVXA 2O3TA 1FDSA 2Y1OA 4U0JA 4FFLA 3PLRA 1ZK0A 2ZTVA 4NQZA 1C3VA 4PRKA 2XAAA 4Q3NA 1H94A 1UP7A 4R1UA 1P9LA 1JTVA 4XQ9A 1G0OA 5KOIA 1ISHA 1E7RA 2JFHA 2GCGA 4HX5A 2EP7A 5B37A 1FDTA 5IN5A 4G81A 5JY6A 3O4RA 1GQYA 4WLOA 3ULKA 3TFOA 3I4FA 1X15A 2FR1A 2FN7A 1NM5A 1F17A 3PK0A 5IDQA 3NTOA 2QYTA 1S6YA 1I3NA 1LXCA 2OMEA 2HRZA 4HKTA 4R9RA 4I5DA 4IUYA 2CNBA 3KLMX 2PNFA 1NASA 1V0JA 5DP2A 4IIUA 1K89A 4I5EA 3S1LA 4FFPA 2WJPA 3DFZA 4GX0A 2RCYA 1E6WA 1VJ0A 3JQEA 4PLCA 4R41A 1H6CA 3PJGA 4TQGA 3X2FA 3U5TA 2JAPA 3EYWA 1T4BA 4MVJP 4M55A 1PZGA 3L6DA 1E1NA 4OOEA 4UUMA 3QA9A 1B7GO 2Y0DA 1RPNA 2WD7A 2C59A 1HF3A 4CM9A 3RIHA 1PIWA 4CLHA 3JD0A 3IQDB 3U4IA 2I67A 1ONPA 3Q3CA 2QRLA 3DWFA 1MC4A 1T1SA 2BMAA 9LDTA 4Q3DA 4BO6A 3MEQA 4M54A 2VT3A 2ZJ0A 1Y8RB 4YJFA 1P45A 2IXAA 3VAZA 3E5RA 1GYPA 4CMCA 3ZWNA 3STHA 1PZHA 3ZHZA 2W90A 4P8RA 4NI5A 1CF2O 4CL3A 4BVAA 2YUTA 2CVQA 4Q3BA 3PHJA 2VWHA 3GVIA 1X7GA 2FP4A 4CM5A 2XPCA 3ST7A 1A7AA 4R1SA 4CM1A 5CEJA 1MUUA 2CVZA 3L6OO 1GCOA 3GOHA 3KBOA 3KYCB 2JHGA 1AXGA 4EZBA 2PZLA 5ES3A 3DBVO 3GVXA 5DBGA 4II2A 1OAAA 4Y6RA 4BNNA 4RPHA 1N5DA 4BO0A 1GZ6A 2JD1A 4JXKA 4M8SA 1E7WA 4ZU3A 4FB5A 5G0WA 5C3MA 1VKOA 1FXSA 1T1RA 1YJQA 1YWGO 1TT5A 2FZEA 1C1XB 2GN8A 3MOGA 4B8WA 2EGHA 2FSVA 2DU8A 4FGSA 4KWIA 4AG3A 5KVCA 2ZKLA 3RUDA 4R68A 4Z9FA 3DBRA 4BO9A 4BMVA 1GQQA 4RZHA 3MTGA 1KC1A 4D42A 3I4CA 5ILGA 3DFUA 1W4ZA 1D1SA 2VRBA 4JLWA 2GDZA 3C1OA 4MP6A 1UXKA 1TT5B 4IY1A 3MJEA 3O03A 4WLEA 3ZW9A 1ZK3A 8LDHA 3V1TC 1PJSA 4DUPA 1N1GA 2GO1A 5CG2A 3UKOA 1MC5A 1E3SA 5KJFA 1BG6A 3HFSA 1LI4A 4B79A 1PWXA 5T64A 3RAJA 4J9VA 3TZQA 1YQDA 1NBOA 3AU9A 4BGVA 1U5CA 5I9LA 3KB6A 2PGLA 3NT5A 2YJZA 5GY7A 3RFXA 2PH5A 3B1KA 1XIVA 2QQ5A 2BHLA 4WLFA 3ZWPA 4D45A 3VH1A 2CUKA 2Z95A 2EIHA 3NUGA 4FC7A 5TGDA 4QFDA 2VNAA 3WB9A 4NU5A 2D1YA 4FD3A 1UAGA 1ISFA 5JPIA 2G17A 3VH2A 5A1TA 3HNPA 4YB8A 3HN2A 3OEYA 5F1KA 3ANLA 2EP5A 1UXHA 1NVGA 1IZ9A 4W7IA 1JDJA 4BO2A 1BDBA 1NFRA 4R4JA 3WBBA 1OZAA 3P5SA 3MCVA 4ND5A 4ZA2A 2X4GA 5AXAA 4IS2A 1I01A 2NV6A 4EITA 2VRCD 4FOOA 3WSVA 1ZW1A 1K6XA 3ZHXA 2YFHA 4CMJA 2PD4A 4MPDA 1ML3A 1I3MA 1YBAA 4O59O 3U9LA 1R0KA 1W73A 1SOWA 1RKXA 2VYND 1TT7A 3OA2A 4PVDA 4AJJA 4YT4A 3E18A 3GZ4A 3OF2A 5JNLA 4PG4A 4D44A 1BW9B 3V1UA 1UZMA 3K92A 4BKQA 3C85A 1H2BA 1KY5A 2NACA 1N9GB 3ANNA 4RQTA 4WECA 3GUCA 1U4SA 3ROKA 2O7QA 3WQRA 2NVWA 2UVDA 4U8GA 1ISJA 4YRDA 3FI9A 4JJFA 5F21A 3OHSX 4ZGWA 1I3LA 2DPGA 1L1FA 3I6IA 4GMFA 2OFPA 1DAOA 2WE7A 3JQ8B 1P1IA 4BNZA 3WXBA 4XKJA 4J1TA 4H7PA 1HE3A 1HE2A 2HO5A 1KYQA 1N9GA 2Y0CA 5TRTA 5LDGA 4CM8A 2VUTA 3B1FA 5A3VA 3UCEA 2BI7A 3CE6A 4BNVA 1JA9A 1DIHA 1LLCA 3DTTA 3RVDA 5IF3A 5KKAA 4MVJI 3DZFA 5C5IA 1NPTO 2B35A 2GYYA 3FNFA 1NYTA 4CLXA 1PQWA 3CEAA 4Z0HO 3WGIA 3NRCA 3WBFA 2D8AA 2FR8A 2IZ0A 4OH1A 3JD1A 1Z74A 4KTTE 1EE2A 4XIYA 2X23A 4A03A 1RWBA 1VRWA 4W9NC 2GN9A 1Y9EA 5JE8A 1UDBA 3DO5A 3DMYA 3WJAA 1CQJA 5HTOA 5JYEA 4N18A 1V6AA 1PL7A 1A5ZA 3ORFA 4EEZA 3GEDA 2HK7A 2I65A 1GTMA 2B83A 3KO8A 4ZRMA 2J3HA 3HQ4O 4CUJA 3INTA 5DT9A 5CDYA 1U8XX 1JW9B 2D2IA 1R37A 4BO7A 2GN6A 4XGKA 1V9LA 4BGUA 2VOEA 2IEDA 1I3KA 1WP4A 3H5RA 3W6UA 4DWVA 1MA0A 1JAXA 3MJSA 2PY6A 3PFWO 2Y1GA 3KV3O 5DCWA 3HDYA 4QEDA 2OGUA 4NJMB 3LK7A 1OOEA 4TZTA 4CMGA 4MVJD 4CJXA 2G1UA 3M2PA 2B4TO 5BNIA 5DBFA 1GD1O 4FN4A 4CLOA 1O95A 3MWDB 4EI2A 1J6UA 5BSFA 2QIOA 2HK8A 1U1IA 5C7IO 3ITKA 1U3UA 4RVGA 1U2GA 3PHGA 3RC2A 3GG9A 2DM6A 3AM4A 4WCFC 1DBVO 4L76A 1IB6A 2Q2VA 5ICSA 3OJLA 4DXHA 3ZWVA 3RBXA 4PG8A 3BMNA 4RVSA 3OETA 2YW9A 3ZCXA 4XX0A 4XIJA 1PJ3A 3LC2O 4O6VA 1UZNA 3IKTA 3E03A 2X0IA 4M89A 4A26A 3ZWBA 1HEUA 3OQ6A 4DIFA 4YAJA 5G4KA 1B15A 3RBZA 2JCXA 2X1HA 4PRLA 2P5UA 1SB8A 3IIEA 4XWYA 1IPFA 2O3RA 2GSDA 5BSEA 1B3BA 2PWZA 2WYUA 1QG6A 4BIIA 4HV4A 2PR2A 1E7YA 3PHLA 2R00C 4HADA 3I3OA 5G0UA 1E1MA 2P4QA 3MJ4A 4FOSA 2Q50A 2GGSA 1LDMA 1DIAA 1PJQA 1L7EA 1ZK1A 2AMFA 3D3WB 2NLOA 2VCYA 2G5CA 2EHDA 2OHXA 3F46A 4MINA 5I8ZA 5TQVA 3RU7A 1A72A 5KWEA 2OP1A 1QKIA 1MV8A 1P1HA 3ZI0A 3DOCA 2BRUA 3VZRA 4XQCA 4QO7A 4BHTA 1GPDG 2IRWA 3RD5A 4I5FA 4OQYA 4YDRA 3WJ7A 3D3WA 5T5QA 3EHEA 1VE9A 4LSWA 3NKLA 5EN4A 3VPGA 1HETA 3PZBA 3DHNA 4KWHA 1BXKA 1J49A 3LVFO 1I2CA 3W4JA 3V2GA 1ID1A 3ETGA 4XRRA 5TF4A 3VTZA 2QZ9A 2ZCUA 3OJOA 3KYBA 3F1KA 4EGFA 3VKVA 2OUIA 4ZQFA 1D1TA 3C7DB 1ADBA 3ZU5A 1QSGA 3OQ1A 2Q3EA 4PLVA 4QECA 1GEGA 5ER6A 4HFMA 2P91A 3AOGA 3F47A 4DC0A 3JYNA 3DHEA 3NYWA 4F3YA 3BYZA 2ZTMA 3PQFA 1XKQA 4ZRNA 4RPKA 4AVYA 4E21A 2J8ZA 1HYGA 5H83A 4UULA 3WFJA 1HZZA 2FY8A 4YAIA 4GAEA 2Y1DA 1UAYA 3K5PA 1DFIA 1IL0A 4TRNA 1R4NB 4R9SA 1DIRA 3RUIA 3G3EA 4RVDA 2YHIB 2I99A 1UXGA 3JQAB 5EINA 4OKIA 5T8KC 2HUNA 4B4UA 4BQPA 2C07A 5CFZA 4LVUA 4H3VA 1I36A 4R51A 2PGJA 1ZSNA 4BMSA 4E2XA 3RI3A 1HRDA 1E5LA 2HJRA 3GPDG 3TJRA 3ZWOA 4DLBA 3C1AA 1EFLA 4GX1A 3GDFA 2PKRA 3A1NA 5JXWA 2PFGA 3F5QA 3ZNPA 4CM7A 3P2OA 3DHYA 3O9ZA 1SEVA 4BNLA 2Q4EA 1NQTA 2YFQA 3TPCA 3AU8A 4OAQA 1E3WB 4B3JA 1DRUA 2Y0EA 3NX4A 3VPXA 3NGLA 2YDYA 1Y9AA 4IJUA 2E49A 2UUOA 1DO8A 2DTXA 3SLKA 2VZ0A 3ROPA 3AUTA 2I9PA 1NVTA 4NMHA 5ITVA 3GK3A 1QLJA 3GEGA 2NADA 3F5SA 3WGHA 5L53A 4FFMA 1YB5A 1K6JA 2JAHA 3WLFA 4FFNA 3EMKA 1BRMA 4R5HA 2P2SA 5L40A 4BO4A 3GT0A 4ONEA 2OBYA 3PHHA 4YT5A 1SB9A 4RDHA 1DDOA 4Z0PA 5T8KA 1P74A 5EQDA 4MO2A 4RGBA 3AOEA 4X54A 4CLEA 8ADHA 4Q3CA 4I5GA 1QV6A 4KQWA 5T67A 4ZQEA 3BMOA 3AUAA 4TMFA 4CV0A 3ITDA 1LA2A 1WMAA 2A4KA 3F1LA 4R1TA 1LSUA 4UUOA 2W4QA 4II3A 1QORA 3CIFA 3DZKA 4ZN6A 1GV0A 4Q3AA 4YEDA 5DDIP 3KOUA 1W6UA 2BLLA 3JQ7A 1WDMA 5HM8A 2Y1EA 5B1YA 3E9QA 4N5LA 4BOYA 4CMEA 5A9SB 2NU7A 3JSAA 2E82A 1LX6A 3HN7A 2VHZA 1JVBA 2Y05A 4MKZA 5JAMA 1XU7A 1K0UA 1ULSA 2AG8A 2OXIA 3EUWA 2B36A 1HXHA 2X86A 2ZQZA 4OJNA 3WGQA 1JN0A 1Q7CA 1E6EA 2V6FA 3L4SO 5KTKA 3SBOA 5JO0A 3JQBC 3WSWA 3ENNA 4N54A 4DQUA 5EERA 4YTEA 3PDUA 4MKRA 2CSUA 3FNEA 1Y8QA 3GF4A 3KLPX 5AVOA 1MB4A 1PJTA 1F12A 4FCCA 4CR6A 4OSOA 1I2BA 3N7UA 4RF3A 5A4DA 3BTOA 2Q45A 3BMQA 3OIFA 3RBVA 1PR9A 1HDGO 3A28A 2X0JA 1Y8QB 1H6DA 3WGGA 3OA0A 2C82A 4UUPA 5CEFA 4BGEA 4UVEA 5AXCA 1LQUA 4JJGA 4FFRA 1E3JA 3IUSA 1BSVA 2QG4A 1BDMA 3KYDB 3GGOA 3ZV3A 1YGYA 3M6IA 2ZTUA 1N2SA 4WPGA 4IMPA 5G4LA 1T24A 5DOZA 4CM4B 2DUWA 1E5QA 1Y5MA 2HQ1A 2DFVA 4B3HA 4IJVA 5H82A 4FQ8A 1E77A 1NTOA 3WNVA 1GYRA 4PIVA 3LQFA 7MDHA 3GPIA 2X5KO 3H9EO 2PD3A 3B70A 1D8AA 4B3IA 4HNGA 1DIBA 1U9JA 4LRTB 2OL4A 1XDWA 3ROMA 4NJMA 2X8LA 4PG7A 1SCUA 5TT1A 3MWEB 5JDIA 1LC0A 2IEBA 3DTYA 1U28A 1RM4A 2E6UX 4HWKA 1DHRA 1HE5A 1XWFA 2VTDA 1TI7A 3L0DA 4QO8A 1LLQA 3O38A 3TRIA 4DQXA 4B4VA 5AXBA 4DYDA 2YQ4A 3ZWMA 3PFFA 1E0DA 3R3JA 4XYLA 4J4HA 3OEWA 1R12A 2IODA 1P44A 2AEFA 4B7CA 3AI1A 3LC7O 3UHAA 1V3VA 1QR6A 1NHWA 1E1LA 2PLAA 1B8VA 3IMFA 1ZKMA 2AW5A 3DBLB 4XDZA 3SJUA 3O26A 2OBNA 1U7HA 4RF2A 2ZATA 5FI3A 5CDSA 1IOLA 1R4MA 1YOVA 4DBVO 1MG5A 2FZWA 1D4FA 2HAEA 4MVJH 5L51A 4IQGA 2P9EA 3DB2A 3JQ9A 3NDIA 5DF1A 5B4VA 1GZ4A 1M67A 1NR7A 2NUAA 4YJHB 4ZJUA 1X13A 3AJRA 1GV1A 4DREA 1MXFA 1AGNA 1I32A 4IIVA 1QMGA 4XGNA 2C20A 4CM3A 4H15A 2IXBA 3BA1A 1BXGA 1I0ZA 3L4BC 3IP3A 2LDXA 1WPQA 1UH5A 4XYBA 1NPDA 5KVQA 3HWRA 1EQ2A 4KDFA 3Q9UA 3RROA 4OXNA 1B8PA 3I52A 1HZJA 4GSLA 2J3KA 2AQKA 4OSPA 1J0XO 4BNMA 1NAHA 2X9VA 1DB3A 1GCUA 3FR8A 3O8QB 3RCBA 4TKLA 4J49A 2BKAA 3EGOA 4HFNA 5JSFA 3N58A 5L7WA 3BHMA 4W6ZA 3IDSA 5LC1A 3L9XA 5EIOA 1SAYA 1FMCA 1TLTA 1R0LA 1A9YA 4R3NA 3CPSA 4XA8A 2I3GA 6ADHA 7ADHA 4A73A 3JQBA 1YQGA 3QV1A 1ZVMA
chains in the Genus database with same CATH superfamily
1DP4A 1KH2A 3U3JA 1QOPB 2JZNA 1S0UA 1T25A 3DV2A 1CRPA 3O95A 2DGDA 1Q19A 2PWBA 4MQ6A 1IWOA 1SUDA 1P1JA 4LSMA 4BNYA 4QA9A 3QWIA 5CITA 3OFNA 3E0XA 2RHMA 2VVTA 4JS0A 3TM5A 2WM9B 4JYZA 3PVZA 3IV9A 1QFYA 3OURA 4PLHA 4NOJA 4EJ2A 3PR1A 4I1RA 2NT3A 1LWNA 2XE4A 2CXOA 2NUTA 4B3DA 1KIFA 1T8UA 2ZI5A 4OIMA 4Z53A 1EG2A 3PYMA 4E5DA 3I8SA 5LZ8A 1QIKA 1I1NA 1MO6A 1V2HE 1XHLA 1YR8A 3FGNA 4FFBB 4LC1A 4XOUA 3X3HA 1E2JA 4DPLA 5KREA 3RS4A 4R16A 3BUSA 3A6LA 3GCZA 3FNIA 2WAYA 1II0A 4C07A 2R7KA 1PW5A 3CLTC 1J09A 3C8ZA 3OECA 3QIVA 4ML3A 4C4SA 3HYLA 3WDKA 1EP3B 2GYVA 2VPTA 1ECPA 3ZWAA 2X0NA 1M8PA 5DNYB 5DVZA 4XLZA 5JLAA 3IRUA 5BSMA 2AE2A 4YK7A 2ZVPX 4G1FA 4R01A 3RE1A 1WDWB 1PWHA 2WP8J 4FYJA 4RTJA 5AFSA 1CY0A 4RK1A 3PQ7A 1PX0A 3BFPA 1DTEA 2VK4A 2Z4RA 1CUVA 2G7MC 5EE3A 1KS9A 4I50A 5I4KA 4YLGA 3HCDA 4PLFA 2CXPA 1P0CA 1N5KA 3GI1A 1NP6A 1PT8A 2VZ8A 4PX3A 4WVFA 1HR0B 1AN9A 4KQGA 5AOAA 1OXVA 1RBMA 1SKUA 2FTKE 2I4LA 3VO1A 2OD2A 3P9KA 4KMMA 1QFSA 1U3TA 3GMSA 3QVMA 4FCWA 1UBMS 4OQLA 1PS0A 2E9SA 3P2KA 4P7FA 5EE1A 3H8SA 4F8JA 1UBEA 4MQMA 5LYJA 3H5AA 3UAGA 3VJKA 4L8WB 1Z7BA 2GZDA 5BWBA 1GG2A 1KJYA 1JEQB 4I08A 2GZSA 4ZU6X 3BREA 1BVHA 4D5EA 1YDHA 4B4KA 2FXVA 2AXPA 1XQVA 1ZO8A 2JGMA 4ND6A 3JQFA 4N5DA 4W4TA 1BXZA 1PQYA 1YU6A 3GDOA 3B7GA 4YR9A 4HXGA 4GS5A 4LRUA 2PUEA 1BE8A 2D7DA 1AK2A 2DF8A 1XC7A 4ZZ1A 3F78A 4M7RA 3GR6A 3WYCA 4TKZA 1R3UA 4FDLA 4R2IA 1IY2A 1A9OA 1L7BA 1FDUA 3AHHA 4RA9A 4F85A 1BVUA 4P22A 5JROA 3NAQA 4HPXB 1LPOA 5DX8A 1UDRA 1NVAA 2QQ0A 4P80A 4F5DA 3NI2A 4L4UA 4PYLA 4OBXA 1ODTC 5IJAA 3PEYA 1VJDA 2DLNA 2ZI3A 1YH3A 1YIOA 3AZQA 4XIIA 3V4FA 1K6EA 2C3UA 4OFWA 3AVTA 5J23A 4PXAA 1W8DA 2HBYA 3G2KA 4BNWA 1M2VA 2M6SA 2ZUEA 2Z6QA 2P5YA 4ZAWA 4DIOA 3G0DA 4X1YA 3RODA 4K6MA 4DSNA 3WWOA 2X9GA 2H18A 3IFSA 3THYB 4HNUA 1DBPA 3EZLA 4U4AA 4Z9XA 5BY2A 4UHJA 4JWKA 4RMHA 3BKXA 4QBGB 5CU7A 2I3DA 1FNSA 1SZJG 3ZW8A 3EXEB 2RKWA 2I87A 4H7DA 4Y7DA 4AJ1A 4UCQA 1WMBA 4NAVA 5B7GA 3HU1A 1GKUB 3NIGB 1U1CA 5CLGA 1OH8A 4UU8A 4W8OA 3VZBA 3IAS6 3TSZA 2XGJA 3AIKA 3SC6A 5IJ9A 1CHNA 2B9VA 1X1BA 2G9NA 1OKKD 3H2BA 4GQAA 1VDMA 4R8LA 1X9HA 2DAPA 1FRZA 4AWXA 3ER9A 1MMFB 4N41A 4K0RA 2GTIA 1EYZA 1FQWA 1WLSA 1XTJA 3BORA 4LECA 4B43A 2RGRA 4AZVA 1WXFA 3OZUA 1OIWA 1G20B 1XROA 4N03A 5AD1A 3VKGA 4B9AA 4BMOB 1MGOA 3IE1A 1REQA 4KG7A 3R76A 2G9QA 3GQBA 2GLXA 4FI3F 1OBFO 4MLZA 4NCBA 4YH1A 1V1RB 1Y5RA 2OR3A 1N1EA 3K8OE 3BULA 4QLBA 2Q0XA 3AEUA 5CFLA 5B57C 4YJKA 3CQ9A 5IPFA 5FXMA 5B5SA 4J7UA 2Q2QA 2C5GA 3K15A 4LZLA 4YJ2B 3MN1A 1Z2AA 1K86A 2NOAA 1TZCA 4I0WB 4ENVA 3IX7A 2VEOA 2D59A 3FPSA 3GIWA 3DNMA 4OG2A 4BYGA 3STXA 5IDWA 3EG9A 1L4KA 5H68A 3OOJA 1ZNWA 4I8DA 4JI6B 2J67A 2ANCA 4RK4A 2NU8A 1R5JA 2GASA 4JLKA 2LDBA 3KE9A 5FX2A 4FONA 2CY0A 1P62B 3G17A 4G37A 3SC3A 1ECGA 5IP5A 2DEUA 4C03A 3ZVKA 1XAHA 3TF5A 1E4OA 2I1LA 2WA1A 4JK3A 4PTYA 1ZK2A 5AK0A 4GOOD 1L5WA 3NTRA 2O7VA 3C1UA 4UBOA 4B6GA 2QI9C 3KYDA 3DE3X 3QVSA 2O5VA 1KETA 4NNJA 4FP9A 1N2XA 1M8JA 2Q6OA 4E1VA 2FW0A 5IZ4A 3DZ8A 4OKNA 1IRXA 3NHMA 6ABPA 1C14A 2CXHA 3SMVA 1L3CA 3DC7A 5A6SB 2HK9A 1SXJB 3QLJA 1ZJ6A 2YHUA 3VKFA 4HNHA 4DCSA 1YJ8A 2PA3A 5DCYA 3K73O 4MCHA 3E3AA 2KI5A 2P90A 4ZEVA 4KXVA 4B80A 2VPWA 1RQ7A 4Y2VA 1UKEA 5G1NA 4B2IA 4X90A 2YZ7A 3D8TA 3DSRA 1P4GA 5JHHB 4ZMRA 1H3FA 2DBQA 3LX4A 1K7XB 1W0KD 5JCJD 2ZYTX 1Y7LA 3FUCA 1JAHA 2ZWAA 1U7ZA 4EX7A 5AM2A 1K92A 3ZK8A 5E4YA 3LPDA 2J33A 2O7SA 5IS2A 1OGJA 4KNVA 2DVMA 3A1TA 2WFLB 3QXSA 3RSHA 2GFHA 1EINA 4B6QA 4DYVA 2OV4A 1X7WB 3RPEA 3ZCRA 2BMJA 3LQ4A 2XUZA 2PH3A 3P9XA 1THGA 3CKMA 3E35A 1P1FA 4NKRA 3JW8A 1CE8A 1OXMA 2ZRHA 4PBRA 4WUTA 3TLCA 4XYMA 1H2EA 3NTUA 4E2ZA 4C6TA 4DPKA 1KVSA 3K71B 3I83A 3DEJA 4EZIA 1DTSA 3LXMA 3WKDA 3IAAA 2XYHA 3PFNA 2AOUA 2ZBGA 3ESYA 4N6NA 1B6TA 2AF4C 2FW8A 1XEXA 5ILOA 2D06A 4WNIA 1L7PA 3V1KA 2WBLC 2VZ9A 2CL7X 3PD1A 3FCYA 3HZHA 4U2GA 1DX6A 2XF8A 4AX8A 4H1HA 2DTDA 2O05A 2ZUCA 1ESZA 2HF2A 2CFSA 1YR2A 4OYHA 2GEUA 1E2MA 2IDKA 3QE9Y 4CLRA 2YXDA 2X0RA 5BXQC 4LCJA 5HPYB 5A1JA 3ONDA 2J4CA 4BTLA 2HA6A 5AW5A 3O6VA 3MMXA 1MC1A 2AK2A 2C7BA 4ID9A 3A06A 2NZXA 3KT0A 2P9BA 4JJ8A 1YACA 1V47A 3DEKA 5EIBC 5FNVF 4JLOA 3IMEA 5G1OA 5IJZA 3GJ0A 1W88A 2O50A 1VE6A 2Q4DA 3HSSA 1XYYA 3ITEA 4GR9A 2BUBA 1Y9ZA 3NZEA 1M2WA 1LNQA 2REQA 1RZRA 1ADGA 2FLWA 2IP4A 2GPYA 2G4VA 2XIJA 3P94A 2QM0A 4FYIA 2VP6A 4DGSA 3K9HA 4YRCA 3F73A 3WGZA 3UV3A 3HBNA 4E31A 1D9ZA 1UMCA 5F9FA 1Y8CA 1B73A 4W99A 3UMRA 1AQYA 3K0FB 4HD8A 4YMIA 1G2IA 2Q0SA 2W48A 3GNTA 5E6SA 4YJDA 2DBRA 3C0KA 4ZVUA 5DRTA 5EJAA 1G9XA 2L2QA 3VOSA 4JB2A 3T9EA 1R0CA 1SVKA 1J0BA 3EULA 5LWHA 4NEHB 3W4IA 5KTKA 3QWAA 3TEMA 5C4IA 1JQDA 1ZXLA 4YAEA 2ZIUB 3V9AA 2ZSBA 3NHLA 3C14C 4I99A 5JMOA 3KJQA 3IXLA 5DW0A 2R68A 2EU8A 3F9CA 4AKGA 5KNDD 5IN4A 1JDUA 1Q5PA 3EXIB 3PPVA 4P9NA 1UBGA 3PF9A 4UCWA 4Y1RB 3SYKA 3TVTA 5C7LO 1AB5A 1SXJE 3PNOA 2JCBA 4BJ6A 2QLFA 3HA5A 3KQKA 3QMWA 1H0KA 2IS1A 2V74B 1BA3A 2C9OA 1K5HA 4J90A 4DNOA 4K1XA 4GUDA 2O0LA 3BIFA 4MLCA 3ZVLA 4W9RA 1N5MA 4CIAA 1O4VA 3NOVA 4XVQA 2VSQA 1PL6A 4FS3A 5G0TA 1RYFA 2Q4BA 3F49S 3KJXA 4UM9D 1AO0A 2ORWA 3P9YA 2A7QA 2IZOA 3KZ1E 4MV7A 5JASA 4G5YA 5D1HA 4XCVA 3RAEC 4A36A 3I9LA 4RNDB 3T7AA 4EIWA 3LZ6A 1Y89A 3G23A 1I51A 3H9BA 1DAPA 4NBUA 4FFDA 4RA6A 5DGHA 2B37A 5G2OA 1DJOA 2AOVA 2HIHA 3JX9A 1KSGA 5JSZA 5HFAA 5LN1A 1WXDA 2ZUUA 2I6XA 1U0SY 5EEHA 5J2UB 2ZSUA 1BU8A 1WR8A 1XALA 4JJ6A 3U3DA 1G41A 3QPUA 3I23A 2QJWA 1FZQA 1FFHA 2JGDB 1UZLA 1K7YA 5HIMA 5KKNB 2E89A 3DZCA 4O4HA 2C4WA 4NOLA 4FU0A 4CKZA 2VHWA 3FOZA 2RBEA 2GEVA 3EY9A 1DUSA 2J48A 3OOSA 4GP9A 5FBWB 4J76A 4A16A 4N3BA 5FYDA 2RHGB 4CFSA 4IIGA 4X1IB 3T3NA 3ND6A 4R98A 3PDWA 5SY6A 3ONNA 1S8FA 3GHYA 5CYGA 3FE2A 5IM4A 3L1HA 1KZ9A 2CDNA 2ODBA 1E18A 1GPH1 2VXCA 3RABA 5JR3A 3JXEA 3WK4A 4R1OA 3ADKA 3KETA 3ER8A 5JOQA 1EGVB 1Q57A 4Z0TA 4Y0NA 2X4DA 5D3QA 2R1TA 2RGDA 4WFIA 4GBED 5CVVA 3ICEA 3GY0A 1HMYA 1ONNA 4YYZA 3G79A 3Q2KA 4ZCTA 4IDNA 1EUZA 1H2ZA 2LKCA 2XMSA 3HUEA 4PO9A 5K4AA 5IG2A 3I2IA 3CBQA 4X1YB 3TL3A 2MJLA 1QRRA 4JLMA 4WBXC 1K5PA 3KQHA 1UBSB 2GB4A 1DQRA 2HBZA 3R0VA 4QASA 3AMVA 1YZHA 2ZJ5A 5CLHA 4U63A 5KWVA 1T9GR 2Q3CA 3AY0A 1L7NA 2BL4A 3LP5A 3NHYA 5CB4A 2UYYA 1NYRA 1N2CB 3ND7A 3ID6C 1KARA 1UPAA 4IH4A 2IF2A 2W6PA 1C2TA 1HDZA 1RD4A 3GGGA 4H7EA 3TB4A 3IALA 3CNEA 4E03A 1E1DA 2JATA 5DCUA 3QLEA 3AEXA 4M9CA 2MR6A 3Q2IA 5E3HA 3KALA 2HV8A 4B34A 3L7KA 1DQNA 4JOSA 4M87A 3VH3A 4DLRA 4KXXA 1AKQA 1O58A 1WOMA 5A71A 3VA7A 4S24A 1N8TA 3V8VA 4BB5A 1E9AA 1CNEA 4KYTA 4EVRA 2PMEA 4J3NA 1W19A 1ZINA 2HA7A 1OTYA 2YRFA 3HY4A 3P0FA 4M1SA 2PR7A 2DFNA 5K0CA 1JXOA 5LZ2A 1FK8A 2HK6A 1LQTA 1G20E 5DI9A 4IRXA 3VTFA 3ZZMA 1BE1A 3LWZA 5K3CA 4OGKA 5CDUA 3D6AA 1OFUA 3EXFB 4CE6A 3AZPA 3JCZA 3K2EA 3X1YA 3FSGD 3H9GA 3NMUF 1IDN1 5FPTA 3H3FA 1U7PA 3G59A 4BO1A 4EHAA 5DLPA 4EELA 3NRJA 3P19A 4Q9HA 3MJVA 1TM7E 2H9AA 4Y9UA 2XRYA 2FFAA 2L18A 4H6PA 1HE8B 4TWRA 3L0YA 4G65A 3WJ1A 2HB6A 4BVLA 2RGCA 4IP0A 1AUVA 3HI4A 4G0VA 1TM2A 1DKMA 1C7RA 1ZGAA 2RFLA 3FKQA 4JV5B 4IIJF 4ZVVA 3BMCB 2HRDA 4DS3A 1GL6A 1X9IA 1H4VB 4CT0A 1Y7TA 2ZJZA 3DAYA 3FPLA 3KKLA 3C3KA 4P98A 1OI4A 1NQWA 3WLMA 3O8LA 4F06A 2O2CA 1ICIA 4WK4B 1M2FA 3SSOA 1EH5A 3URMA 2O54A 3MWYW 2JAQA 4BNDB 3IUMA 5DP1A 3DQZA 1QPZA 4RACA 2Q41A 1TDJA 3UHFA 4IFIA 5FUQA 2MT9A 3LHIA 3F3SA 3ZS8A 3KSAC 1ZU4A 2ECFA 4GKAA 2VUSA 1Z3IX 4RENA 1EBUA 2WHPB 4XR4A 1DQYA 3H17A 4O08A 1YMVA 2I34A 4BFVA 2RI6A 3NEAA 1AURA 5AHXA 4UMFA 2DB3A 1J25A 1KEWA 3R1IA 3QXJA 1IUKA 4ZK2A 2IXFA 4MA0A 3EISA 4QFMA 5BQ3A 4WOJA 1TNDA 2BT4A 4OREX 3PHIA 4TMKA 4QBIA 5T3YA 1SMKA 3STUA 1ESCA 1JDBB 4D9IA 3JY6A 2G82A 4DOMA 1QIDA 3H1AA 1SNYA 1JFRA 2Z1DA 1KI4A 1MTZA 3ZI4A 4EPRA 4JBNA 1BHSA 3LLVA 3D43A 4ES6A 2E55A 3DTVA 2H08A 2VJQA 1JFFB 2II6A 1R00A 2WFLA 3GFTA 3RASA 4LCBA 4ZQGA 4JDPA 5JARA 1ZJZA 1JHDA 2IE0A 4O29A 2VNJA 2FZ4A 3R7BA 3P9PA 3WVNA 1J2EA 2JD2A 3R44A 4BU1A 4G5FA 3R7AA 1GPAA 1QGUA 4GMXA 2CLMB 1CVRA 1PZEA 2E37A 3CCBA 3VR3A 1OXUA 1XN4A 3C8HA 3MOSA 5SZHB 2YS7A 4MVYA 4YHHB 3A9RA 2BHSA 1GOTA 3D8NA 3IEUA 4UBIA 1G5HA 2GILA 4ESEA 1M7GA 4PZAA 4KN9S 1TECE 3LX5A 4UBLA 1KWGA 2X7JA 1RYDA 3ZZUA 3AO0B 3M4ZA 3IA7A 1SQ0A 2ZIGA 2C4KA 2IZ1A 1HC7A 1DMRA 1UMBA 4HJRA 3WQQA 1XRQA 2J1LA 2HQOA 2ODQA 1TYEB 5I9SA 3AI7A 2EYQA 2J6HA 1A4UA 4Y6QA 1IB0A 1N8NA 1X7WA 3ML1A 2QJTA 4C08A 3WYNA 1U98A 2G25A 3Q7TA 4TV8B 1JGTA 1FY2A 2A59A 3O75A 3W8NA 4AY4A 3ZDAA 4EFDA 4MQFA 1DRVA 2ZBPA 1HTTA 2ACVA 5ICGA 5LLDA 1TA4A 2W6MA 2BMDA 3T1TA 5ED0A 3U9SA 4R69A 3DVLA 4AYTA 2GD6A 1XELA 4L6IA 4FW8A 4PC1A 1ZUD1 3I01M 2PU7A 1KKMA 3L8YA 4GM1A 4MO9A 4M0CA 4OU4A 4QL3A 4X7BA 2CL0X 2OCLA 1F8YA 3JQ6A 4DUGD 3WWZA 4D79A 1KJNA 1CY2A 4NICA 1JSCA 3EA4A 3NASA 2Q1XA 4GXRA 3TAXA 4YRGA 4I3FA 1LY1A 3KVYA 5G53C 4J16C 2IX3A 4KPEC 2CXQA 1H8HA 1SUEA 3SSNA 3GCXA 3BB1A 3AJDA 2IF0A 1JDSA 2JFNA 1E2KA 2JH8A 3GRPA 5ECWA 5L7YA 1N2GA 1WD5A 4BNJA 5TPZA 2VF2A 4FNOA 2W2VA 3V8RA 2B5OA 2GQ0A 2NO1A 1P9WA 3R5JA 4ON9A 3IOBA 4UDNA 2ATIA 5GJVC 3T7IA 3GT7A 3TDKA 5H81A 1WOYA 3W6ZA 1CQWA 3IB3A 1P6QA 2VIIA 3O8QA 4Z9BA 4C29A 3SEZA 2XSZD 1E1RA 4D57A 1DAIA 4MYRA 5KYXA 1GIAA 3MRVA 5IT4A 4CQNA 3ICQB 2FFRA 2Q5FA 4B48A 1DOHA 1RRKA 2WYHA 3AV3A 3PXBA 2O2SA 3PGJA 1WXXA 5K2MA 3SC4A 3W7BA 4XUEA 5TGTA 4TWZA 1RQNA 2H07A 1P72A 4IHQA 4QAQA 5ABPA 4PZPA 2GKGA 3PWZA 4QAJA 1JHRA 2EKDA 2R65A 3CJTA 3IURA 1JAIA 4QWMA 3ILVA 4WZZA 1GLGA 5FF9A 1F9AA 4UEOA 4U9IS 3GH3A 1OF1A 2VP9A 1FFBA 4LNUA 3M3PA 2OT3B 2I5PO 3CS3A 2J9ZB 3N0WA 5T4FA 4AJ4A 1SBIA 5JMPA 3V55A 4JSTA 2V59A 1HYHA 5J4VA 3GPLA 2PIAA 5EQJB 4QYXA 1CPYA 3LWDA 3UXEA 5DK4A 4CV1A 3RAPR 2IYVA 4KVGA 2HM7A 4KEAA 3TRJA 2IHVA 3GA0A 4PSKA 4ZHQA 4JUCA 1A7UA 1PAUA 3NG1A 5T41A 3WQHA 4AIIA 1G7RA 1JSZA 4MUFA 3S1SA 5IKXA 3GLFE 3ZE6A 5KOHA 1DIOB 3E9YA 2ID8A 2CXNA 2XDQB 1D5WA 1GFWA 4CDMA 1BHO1 3DMRA 2ZGVA 1DADA 4KI0A 3PDJA 5T4EA 3CVUA 1PK8A 1F20A 2XNJA 3WIDA 4G1CA 3NORA 4D9NA 1G6KA 2I6QA 4FHEA 4JVOA 4Y2PA 2JGDA 2Q49A 2CVOA 5EA2A 4KRFA 1E59A 2QRGA 4P54A 2DKNA 4HATA 4ALLA 3KSBC 4G1VA 2EAUA 3KQVA 5LP6F 4II7A 1YHNA 3AG6A 4GE3A 1RBZA 4G5QA 4MR9B 5EJ2A 2ZIZA 3OZSA 5TQ2B 1G9SA 2WKPA 3SLGA 2D3WA 4ISBA 5AW4A 1K8RA 4LXYA 4CMAA 5L3SA 1X1AA 2PM8A 3RVPA 1EVQA 4RVUA 2ZI9A 1LDBA 1Q44A 2WIGA 2R8EA 5JI3E 3U16A 1DL5A 1DOAA 3LO8A 1M6HA 3OY7A 3SJZA 1B76A 4KO1S 1JAYA 3L49A 2PLFA 1E2FA 4PZ9A 5DYGA 3ZTTA 5BUSA 3U09A 3BGWA 1PJBA 4H7JA 4FGWA 2A9JA 4ER6A 2APJA 2FZGA 4C4PA 4F3CA 5C7OO 1LWOA 4IFBA 1G5PA 1UBRS 1P4RA 4C0JA 1WQ1R 5F5LA 3GUHA 5CCEA 1OAKA 1GZ3A 3MIZA 4UOZA 5KINB 3SWWA 4HEHA 1W7AA 1QLHA 1XTSA 1YQWA 3AY6A 2XF2A 3G68A 4JYCA 4HUJA 4WBNA 5E9WA 2HRQA 1O0CA 4X1IA 1D2RA 1KY4A 4L75A 4EF5A 1P81A 2ZSAA 1T3TA 1SKYB 4DMFA 1CUGA 2JGFA 3CX8A 3HR4A 4G8BA 3JPYA 2ZWOA 1T10A 3I2YX 3ZU3A 4EK9A 4V0SA 4M99A 2ZTLA 2G8LA 1V95A 2C83A 3C5WP 4IF6A 2HXSA 4ALIA 1C29B 1Z34A 5JNSA 3EEYA 4ALNA 3ESBA 4QXMA 4PNZA 3TIGA 1F8XA 4CM6A 5IUJC 4WSOA 5TB5A 2H9IA 3N5CA 4Q1EA 5FV7A 1X39A 3EOZA 4DIMA 1IJBA 4DRYA 2WD7B 4R2WA 1OC2A 5FIUA 1M8GA 3FUUA 1CR6A 1UQUA 5DBOA 5FBLB 2X42A 5KCMA 4BV2A 5AW1A 2V0GA 1VLQA 2HHHB 4LJKA 3TN7A 5EJ5A 1EUCA 1V11B 1RACA 3B3AA 4XOIA 4LFAB 5ADWA 3QI2A 1W52X 3DMTC 3PUHA 4ESOA 1JR4A 3LVQE 2SICE 5BSWA 5MN5A 2I4TA 3ZY6A 4Q7MB 3RRYA 3D4IA 2P4HX 2PEYA 4PG6A 4F2HA 5I7EA 4IXDA 2JKZA 4E0BA 2IEAA 5KCZA 4KBFA 3RC7A 1IG3A 1ADYA 4PIMA 3ICCA 1BJRE 1N3LA 5A3QA 2ZRFA 1L4UA 4JSRA 2PBRA 3FCUB 2I9KA 1Z9BA 3S2UA 2GHIA 1IXRC 2NTJA 1QYDA 1LB1B 1VJ1A 2GEJA 5CH5A 1O8CA 4A92A 3A70A 4NZNA 4MMZB 1PR2A 2XJ4A 3RYCB 2D6FA 1UBUS 5B36A 5KVVA 1R0YA 2XTZA 3USCS 3QKRA 4YXWA 4QYSA 1PYOA 2YVKA 4F5WA 5CDGA 1AX9A 3NIBA 1VXOA 2P62A 5GV7A 2I3ZA 3ENQA 4KO2S 1O3YA 2JH3A 4YNBA 3BAFA 1CJBA 3GLSA 1Y6QA 1JDNA 3ZHRA 2ZBQA 3C70A 3GN1A 1FFEA 3A58B 3PNSA 1KYZA 3GGCA 1IHXA 2WNSA 4YBZA 2AJTA 2NZJA 16PKA 3RS8A 1NBHA 3CG4A 3DPIA 3ILSA 1Q1GA 1FYFA 3NHBA 3UGKA 3BMXA 2ZSKA 4HSEA 1GGMA 4QD3A 4DHWA 5FYQA 4A6PA 1L4GA 3PG5A 3ZYZA 3R40A 4KI7A 3RYTC 4B33A 3L7LA 3INGA 4OK5A 4PSVA 3KQMA 1P18A 2J3MA 1ENYA 2WHRA 2Y1FA 2YX1A 3AGPA 3OBIA 3OJFA 3EXAA 2BFMA 2XRMA 4DCGA 3U4QB 1NRIA 3NJRA 4EMBA 4C0HA 1QQBA 4ECEA 2JCYA 1VZ2A 4PQRA 3SHTA 1IK4A 3LI2A 1Q77A 1KJ8A 1QFJA 2OQIA 4IBOA 4QQ8A 3M82A 3G0BA 1MNAA 1JIQA 1UIMA 1JIKA 4RK7A 5FL7A 4KQEA 3OHMA 3H05A 5T6BA 5CB4F 1R4NA 1AS3A 1Z13A 2TMDA 3E6AA 3IYLW 4MGYR 3KWFA 4DMMA 3EF0A 4AIRA 3EPHA 3DQPA 5JWHA 1FFWA 5LBUA 2CLSA 4J7XA 3VYRB 1K98A 2W00A 4QNNA 1GPUA 3A31A 3PFKA 3TINA 5DK6A 5J2UA 4KX3A 5SZKB 4C7VA 5HK8A 1OTXA 4HMOA 4BNUA 3H9QA 3OQBA 4A0QA 4RM2A 2F6RA 4GXNA 1TL7C 2A2ZA 4K88A 4QSHA 5FO1A 3L82B 2PX0A 1OLUB 1XL1A 1E3EA 2QY9A 3FYUA 3GFFA 3SJBA 5J4LA 2J9FB 5TVGA 3ZLBA 2IOQA 1JLSA 4EF4A 1YRYE 1EBBA 3AERB 4BO3A 5L7TA 1NG9A 2W2XA 2OCXA 2X3YA 4G8DA 1MFZA 4URWR 121PA 4JLVA 4WOBA 1V3QE 4J7CA 3F6SA 4RHEA 1E2UA 5H70A 1WXQA 3S29A 2NWQA 2QAIA 2B8EA 1QAMA 4AUMA 5BWMA 4ROSA 1GYQA 3ISJA 4JGBA 1L5HB 4YR7A 4NZZA 3ZHTA 5FNZA 1KI9A 1NQVA 3TI7A 4CMBA 3RV3A 4ZT3A 4QUHA 3LE8A 3AEZA 4LHYA 4N39A 3T7KA 4EGSA 1ST2A 1E1RD 3SYNA 2PUWA 2F43B 1Z63A 1ZQ9A 4MIKA 1FUUA 3VYTB 3SDBA 1IZ7A 3LKBA 5A7GA 1FX0B 1Y9JA 4RUKA 5AVTA 5FTLA 1HYBA 3ROFA 4JC0A 1N8KA 3PQCA 4ADSG 4QDZA 1Z0AA 3W5IA 5KYUB 2PUFA 1OI2A 4BV3A 2G04A 3FTNA 3IEIA 2ZRQA 3L1UA 1IM5A 2XUGA 5BRNA 2CNLA 1SZCA 1NF2A 2PMDA 3O2SB 1KTIA 2FG7C 4IV0A 1SVNA 1D2EA 1RAAA 2O2XA 4LHZA 1CK4A 5INTA 2RHLA 3AOEC 4CUKA 2IKQA 3WL7A 1IJEA 1C4KA 1U3VA 4PANA 3QE2A 1W49A 4X3OA 1FSZA 3LQ2A 3EAGA 1NXPA 4NZPA 5HKBA 1QF6A 2KLHA 5CIYA 5JO9A 3N87A 4RTRA 2Q46A 2C7PA 3INNA 1OYOA 1S4QA 1F0KA 4PGGA 1T8PA 3OPNA 4QUIA 2ZSEA 3WSTA 3FIUA 4FFOA 1B3RA 4QYWA 2YMMA 1XYVA 1VPTA 1Z6AA 3G0IA 5DTQA 3RH0A 1AUQA 4BKMA 5IDXA 5HYVA 1Y1LA 1BFUA 2FWMX 1YL6A 3Q41A 3O92A 4NMXB 2P0AA 4BDTA 4Y9SA 3PA8A 5AVQA 4UVIA 4WZBE 5BYBA 5JNVA 1NUPA 1O03A 4KITB 3SZGA 1A8QA 1W4LA 1XZEA 3U60B 1TMKA 2GTHA 5AHRA 3PYXA 5EJ6A 3MQ4A 8AT1A 3EOAI 3SX2A 5JUWA 2ODWA 2XMDA 3W3AA 1U7DA 2WSLA 2YOGA 5KDOA 3T9AA 4B8YA 3TLGA 1QU2A 1HKHA 4RM3A 3B12A 4IWYA 4BZPA 1LV8A 4AY6A 4PICA 1HDXA 3DMNA 1J56A 1JJVA 1K2VN 1HQCA 5AW9A 3NNSA 1CUEA 3DULA 4IWXA 4C4OA 4LV6A 4EUHA 3K09C 4WEOA 4DG8A 2XYGA 4PNPA 4WOCA 2Y6UA 4JEUA 1QZXA 5A5FA 4FEAA 3X44A 4L50A 3TQOA 5EHXA 4W8GA 3JWJA 4C4AA 1UANA 4EQ6B 4BNDA 3A9UA 1DJQA 5DHSA 2YXLA 4HZUB 1Z8NA 5IDVA 4TTAA 3DAGA 3Q5EA 3D7RA 3BCRA 3NDJA 2PZAA 2V7XA 3RVKA 2CL5A 1KXJA 3FGOA 3ECCA 3MB5A 3L6BA 1F0NA 4AJLA 2ZYIA 4YFYA 3ZXUB 1NU6A 4UTZA 4DCPA 1LKZA 2XMCA 2J9XB 3DF9A 1Y1PA 1EHYA 1Y0BA 5BO5A 1ZH8A 1O0SA 2Q0HA 2QPOA 1ZMBA 2XVYA 3IAS1 4FCTA 3M1AA 4RIHA 1ESMA 2PD6A 4NU8X 5T4HA 2NNWB 3UT5B 4ECAA 1FW6A 1ZCBA 3K30A 1M5UA 2WPNA 3N75A 3WLEA 2QTTA 3NHUA 2YHIA 5LKAA 4ZCSA 2CJFA 1CUCA 4A91A 2GAIA 4AMUA 1OYYA 4EENA 3LWBA 1AOXA 5F7OA 3CUEF 2PAFA 3HV0A 4UEJA 5AT1A 3E48A 4W1PA 2DC1A 2X3FA 1V8PA 4BKOA 1HFWA 1HT2E 3ZQ4A 4FDTA 3VPAA 4EJSC 1C9JA 4MGZR 1XRSB 1Z12A 1GU1A 3FTQA 4Y30A 1NXQA 3INYA 3L0BA 5LL6P 4TVKA 2DERA 4LGMA 3FBGA 2UUPA 3GA7A 4GPTA 1G17A 1NN0A 2FF5A 2A5FA 4HUQB 1CVIA 3QLVC 3TL2A 3NV7A 2V5VA 3KUUA 3PGXA 4OK3A 1BXRB 3Q3IA 4PHHA 2QSZA 3LUHA 2O4CA 4M86A 4RH0A 3D6UA 1IWBB 1E32A 3DQQA 1PZFA 2QR2A 4O4JF 1FCJA 1HM5A 1U2TA 2K2WA 1DKLA 3CZ5A 1E6UA 3I9FA 4MJLA 1W1IA 4L78A 3SEFA 4FM9A 4PPYA 1CUYA 4B6RA 1H9BA 3FYDA 1U8UA 3GLTA 4RMNA 4EYEA 3OE1A 4GZ3A 2YJ4A 1RZ3A 5AXDA 1KFJB 3HLYA 4RD2A 4QDJA 3HXTA 4YS6A 4CG1A 3HBJA 2GK7A 4NU6A 1AA9A 3FD8A 1AK1A 2FUG6 4ITVA 1R6BX 1UKBA 1X92A 3OKPA 3T0IA 1NYQA 3CNOA 3ZHQA 1NULA 2IL1A 1WXGA 2FWPA 2EQAA 3JQGA 1SKAA 2QSJA 5BUZA 1FDWA 4OU5A 1WS6A 1UZUA 2IH2A 5HA5A 5HZGA 1RW4A 4X60A 1E7SA 2WMDA 3CVVA 1UM9A 1C0EA 5DYYA 4LQCA 2XZTA 6LDHA 3RSCA 1PLKA 3QKRB 2P0EA 3LT4A 4X71A 3GNSA 5GOZA 4IL5A 4BO8A 3LBAA 3LF2A 4E2WA 1D2CA 1VSVA 4WERA 5K6AC 1U2GC 3C3AA 3FPCA 1NN1A 2VUHB 5KX5F 2EKBA 1UL1X 3GB9A 1ESNA 3IQHX 3PEFA 4BNHA 3CUUA 4F3KA 4W5HA 2WWIA 1G8MA 4IM7A 4UFOA 4EUNA 1YDFA 4I4TA 2RARA 3PJEA 3LC0A 4KE6A 2OSVA 2OZLB 2VWGA 5IW8A 4HNQA 4BMYA 4U7DA 4YAGA 1I6LA 4H7IA 1YRHA 4M8LA 1YJAA 2R66A 4XB2A 4DR1B 3MXOA 4A10A 3NC1C 2RGXA 1KDPA 3EDCA 4B40A 2HTEA 4I4IA 1THTA 3NVAA 1QH8A 2H2HA 4N12A 5IARA 1ABEA 3C6MA 4O0MA 4RYDA 3O1IC 1RWOA 2X58A 1R0XA 1GUZA 1JU9A 2FPGA 2O2EA 3SYTA 2R87A 4Q16A 1DFHA 5HFNA 5D1NA 1Y6GA 2JFFA 3LX8A 3AF3A 1VHJA 3OO1A 4KACA 5LZ9A 2NU9A 4IJWA 1RXCA 3EGDB 3LQKA 4C21A 4PTLA 1KQ3A 4S2EA 2PJRA 4GIBA 1V5GA 1ORIA 3W5UA 1QIFA 3GLIB 2PVCA 3S40A 1HL3A 1G8KA 2BSXA 3TG2A 3Q5DA 4OHYA 1ORRA 4JN6B 3RC9A 4D4JA 3BH0A 5MGBA 2C31A 2XDQA 1P0QA 2XE8A 3IEKA 3EVCA 4HAZA 3H0EA 1ZJ5A 1YCDA 2C2KA 3SJ7A 3TDMA 5FLXA 1W2HA 4LDPA 3VZQA 4S05A 4YUZA 3B20A 1W5FA 2GM9A 1Y7IA 5JEEA 1X9GA 2I80A 2JGLA 4TS1A 3TOVA 3I9JA 3ZD6A 4W8HA 2G36A 4F6RA 2BGMA 2V9ZA 1KMHA 3KX2A 3ZEAA 1VPWA 4KZKA 2J3DA 3DCYA 5U9CA 1J5PA 1NXTA 1Q7BA 1JF8A 1FRVA 1T5BA 3OCWA 4YY3B 2VRNA 4DLYA 1PUIA 3JYPA 5FBQB 5B4UA 3MJTA 4EP1A 2H6EA 2YCLA 4QUBA 1L7OA 4MV9A 4YV0A 3RSLA 1QMPA 1SUIA 3KQYA 4XGQA 1UPUA 4YQZA 3I5YA 3NAMA 2IEGA 3KZXA 4URZR 5JMTA 4ARZB 3PVSA 4TV9F 2ZXFA 5FTWA 2P9ZA 2W7TA 4YRLA 5I3CA 3IQWA 3QI7A 2CFIA 4Q9IA 4I8XA 4DA7A 5IDYA 3L8CA 2D62A 3F74A 3IOEA 1PT6A 4JUDX 4L5YA 3TPFA 1JDVA 1A8PA 2CLKB 2YRXA 1WHSA 2EFDB 4JX8A 3BDVA 2GPAA 1Z18A 4E14A 1FLNA 2NYRA 1NBME 3PUXA 3MWDA 3DZJA 4JLSA 4XQGA 3VZSA 1BWRA 4BEWA 3VKHA 3FZQA 5CA1F 2XEXA 1LVHA 3FYTA 2IBMA 2QK4A 1R0SA 2N42A 2HIGA 1GKIA 2UZ1A 2ZIXB 4UM5A 1LFDB 2ABWA 4E5VA 3GEPA 4DSAA 2F8SA 5LQCA 3WL5A 8OHMA 2XTNA 1FPQA 2HSJA 1C0PA 2L69A 3E53A 1E5DA 2W2PA 5A4IS 1K08A 1WUJS 1Z28A 2OK8A 3MAJA 3GP3A 5ALIA 2GPBA 3K3PA 5F35A 1N4AA 1CG6A 1NFQA 3N2GB 1ZHFA 4Q4DA 2J9RA 2JL1A 4D9BA 4TV9A 3DE2X 4M0DA 1Z45A 2IYTA 3CLVA 1GL9B 1JUDA 1Y6RA 4U6SA 3S70A 1WA5A 1SH7A 1EA7A 4MWZA 3EY4A 4UPDA 4V0MA 4QOEA 1HORA 3DDCA 1I3CA 1NQOA 2GJKA 4LSZA 3OMLA 1FJXA 3H4TA 1JG6A 4CMKA 4X7MA 1BEUB 1ZVJA 2QPAA 3WWYA 5BUQA 4EECA 2CXSA 4DCCA 2IYOA 2QYSA 5JDCA 2HPZA 4LHVA 3NALA 5JAPA 5HZHA 1AKRA 4QPPA 2PLRA 2A5GA 3AHGA 3RS2A 4OQPA 1M83A 1G6OA 4B75A 5KQRA 2GN4A 4DN6A 1FJHA 4ALMA 3RJ9A 4XM2A 1H9AA 3RHTA 3DLTA 4I5IA 3ZHOA 4CKWB 4JLUA 4PNHA 1CC1S 4LOIA 4EHJA 2D54A 2OKGA 4NZ9A 1FLVA 3WNQA 1PX2A 2OE2A 4QHSA 4U2BA 2CCGA 3Q4GA 5IKMA 1M5TA 4DM4A 5CDSA 4A0HA 4OXYA 3TZ6A 2D1QA 2VQ3A 4L3WA 2IY8A 2F8MA 2X5NA 3QTBA 4QXRA 4ND8B 4BX2A 2P7HA 4GW3A 5KQPA 2BM9A 2IPLA 3NGMA 5C8VA 5IJ0B 3CLTD 1N8SA 4BV9A 1Z7GA 3QV2A 1QHXA 4GECA 5HUQA 4JP2A 4Q34A 5TSDA 2J4DA 2Q3BA 5A4KA 5IXSA 4DCNA 1UC4B 5IZCC 5K0ZA 4NONA 2ZRKA 4G5RA 1PNTA 3I9MA 3RJZA 2V5UA 3CGWA 4NFHA 2JARA 5K6AA 2ZYGA 4CEJB 2QTMA 1E1CB 2F9MA 2IYNA 2LZ0A 5A4FS 2CE2X 5JISA 2BHRA 1I8TA 4DIBA 2F1OA 1TTPB 3VZPA 4YDQA 1TW2A 1EJ2A 2YJGA 1IVSA 1TD9A 3IKLA 2HMAA 3JD3A 1Y98A 5NLLA 4MS3A 3AVVA 4CM4A 1J0EA 1H0HA 1LUAA 2CF6A 3D3NA 3F4BA 3IO3A 1OXBB 2N46A 2ZRIA 5BV7A 2GF2A 2BKUA 1XZKA 5AK3A 1N2JA 3FDFA 4FHZA 2H57A 1O4WA 2KHZA 2VYQA 1SXGA 1E92A 4LWQA 3VPHA 4MDFA 2YWXA 3AEQB 4LOHA 4CXMA 3HVKA 4CQJA 4Z4EA 3YASA 4O3MA 3TQHA 2VSFA 4S2UA 1A7JA 2EKZA 4P3XA 3W9SA 1I7DA 1IHPA 1U0JA 1DEHA 2LCIA 4C2TA 4CCYA 3HM2A 4YV2A 4YIHA 4PYNA 3QG5A 3CZAA 2WI8A 4UTXA 3SFTA 2OXEA 4DR4B 4FT4A 4JLAA 4QATA 3V8BA 5ENZA 4DA9A 1NW3A 1DLIA 3DO6A 3GEEA 1SC6A 5K3SA 1MORA 3BAZA 5TJ9A 4JX9A 1BMDA 5LMCA 3DEZA 3FW1A 2BMVA 4TTIA 5DLYA 4JVLA 1JEJA 1KYTA 3KSDO 4ARIA 1ZSYA 2OO3A 3ZZ0A 2WSSD 2J30A 5BR8B 4HUQA 4INAA 5I48A 2CYBA 4IEFB 3I04A 4I9NA 1G3UA 3UT5A 1RAIA 3EW7A 4LQ4A 2AI2A 3JTEA 5BQ5A 3VV3A 3WX0A 4TLMB 3HUDA 1TO2E 4FS8A 5DBHX 4MLPA 5H9WA 1BN6A 1SK8A 2O3TA 1C3EA 4LJ8A 5HCIA 4FFLA 1UKVY 2ZTHA