2PNQA

Crystal structure of pyruvate dehydrogenase phosphatase 1 (pdp1)
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
459
structure length
382
Chain Sequence
b'LTPPQVNSILKANEYSFKVPEFDGKNVSSILGFDSNRLPANAPIEDRRSATTCLQTRGMLLGVFDGHAGCACSQAVSERLFYYIAVSLLPHETLLEIENAVELLPILQWHKHPNDYFSKEASKLYFNGLRTYWQELIDLDIDVKEALINAFKRLDNDISLEAQVGDPNSFLNYLVLRVAFSGATACVAHVDGVDLHVANTGDSRAMLGVQEEDGSWSAVTLSNDHNAQNERELQRLKLEHPKNEAKSVVKQDRLLGLLMPFRAFGDVKFKWSIDLQKRVIESGPDPPNYHTPPYLTAEPEVTYHRLRPQDKFLVLATDGLWETMHRQDVVRIVGEYLTGMHHQQQNAATHLIRHAVGYRDDITIIVVQFNSHVVGAYQNQEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords [Pyruvate dehydrogenase [lipoamide]]-phosphatase 1
publication title Crystal structure of pyruvate dehydrogenase phosphatase 1 and its functional implications.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 124
structure length 382
sequence length 459
chains with identical sequence B
ec nomenclature ec 3.1.3.43: [Pyruvate dehydrogenase (acetyl-transferring)]-phosphatase.
pdb deposition date 2007-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00481 PP2C Protein phosphatase 2C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.40.10 Alpha Beta 4-Layer Sandwich Phosphatase 2c; domain 1 PPM-type phosphatase domain 2pnqA00
3W42A 2IRMA 3RNRA 3FXJA 4YZGA 2I0OA 3ZVUB 5JO2B 4LG5B 3FXMA 4DS8B 2J86A 3UJGB 4N0GA 3NMNB 2V06A 3W45A 3EQ2A 3UJLB 2JFRA 3PU9A 4RAFA 4WVOB 3FXLA 5D2UA 2XZVA 4DA1A 3KDJB 5F1MA 4JNDA 3D8KA 3F79A 2J4OA 2PNQA 4LA7B 3ZT9A 2JFTA 2J82A 4LGAB 2POMA 4OICB 4RAGA 3W41A 1TXOA 3N3CA 3NMVB 3T91A 3UJKA 2Y09A 2CM1A 3T9QA 2ISNA 3W44A 2PK0A 3NMTB 1A6QA 4RA2A 2P8EA 3RT0A 3W43A 2POPA 3FXKA 3FXOA 3ES2A 2IQ1A 3W40A 3KB3B 4YZHA 2I44A 3JRQA 5JO1B 2JFSA 3QN1B 4LGBB 3MQ3A 3KE6A 5ITIA
chains in the Genus database with same CATH superfamily
3W42A 2IRMA 3RNRA 3FXJA 4YZGA 2I0OA 3ZVUB 5JO2B 4LG5B 3FXMA 4DS8B 2J86A 3UJGB 4N0GA 3NMNB 2V06A 3W45A 3EQ2A 3UJLB 2JFRA 3PU9A 4RAFA 4WVOB 3FXLA 5D2UA 2XZVA 4DA1A 3KDJB 5F1MA 4JNDA 3D8KA 3F79A 4IIPA 2J4OA 2PNQA 4LA7B 3ZT9A 2JFTA 2J82A 4LGAB 2POMA 4OICB 4RAGA 3W41A 1TXOA 3N3CA 3NMVB 3T91A 3UJKA 2Y09A 2CM1A 3T9QA 2ISNA 3W44A 2PK0A 3NMTB 1A6QA 4RA2A 2P8EA 4IIKA 3RT0A 3W43A 2POPA 3FXKA 3FXOA 3ES2A 2IQ1A 3W40A 3KB3B 4YZHA 2I44A 3JRQA 5JO1B 2JFSA 3QN1B 4LGBB 3MQ3A 3KE6A 5ITIA
chains in the Genus database with same CATH topology
3W42A 2IRMA 3RNRA 3FXJA 4YZGA 2I0OA 3ZVUB 5JO2B 4LG5B 3FXMA 4DS8B 2J86A 3UJGB 4N0GA 3NMNB 2V06A 3W45A 3EQ2A 3UJLB 2JFRA 3PU9A 4RAFA 4WVOB 3FXLA 5D2UA 2XZVA 4DA1A 3KDJB 5F1MA 4JNDA 3D8KA 3F79A 2J4OA 2PNQA 4LA7B 3ZT9A 2JFTA 2J82A 4LGAB 2POMA 4OICB 4RAGA 3W41A 1TXOA 3N3CA 3NMVB 3T91A 3UJKA 2Y09A 2CM1A 3T9QA 2ISNA 3W44A 2PK0A 3NMTB 1A6QA 4RA2A 2P8EA 3RT0A 3W43A 2POPA 3FXKA 3FXOA 3ES2A 2IQ1A 3W40A 3KB3B 4YZHA 2I44A 3JRQA 5JO1B 2JFSA 3QN1B 4LGBB 3MQ3A 3KE6A 5ITIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W42 A;  2IRM A;  3RNR A;  3FXJ A;  4YZG A;  2I0O A;  3ZVU B;  5JO2 B;  4LG5 B;  3FXM A;  4DS8 B;  2J86 A;  3UJG B;  4N0G A;  3NMN B;  2V06 A;  3W45 A;  3EQ2 A;  3UJL B;  2JFR A;  3PU9 A;  4RAF A;  4WVO B;  3FXL A;  5D2U A;  2XZV A;  4DA1 A;  3KDJ B;  5F1M A;  4JND A;  3D8K A;  3F79 A;  2J4O A;  2PNQ A;  4LA7 B;  3ZT9 A;  2JFT A;  2J82 A;  4LGA B;  2POM A;  4OIC B;  4RAG A;  3W41 A;  1TXO A;  3N3C A;  3NMV B;  3T91 A;  3UJK A;  2Y09 A;  2CM1 A;  3T9Q A;  2ISN A;  3W44 A;  2PK0 A;  3NMT B;  1A6Q A;  4RA2 A;  2P8E A;  3RT0 A;  3W43 A;  2POP A;  3FXK A;  3FXO A;  3ES2 A;  2IQ1 A;  3W40 A;  3KB3 B;  4YZH A;  2I44 A;  3JRQ A;  5JO1 B;  2JFS A;  3QN1 B;  4LGB B;  3MQ3 A;  3KE6 A;  5ITI A; 
#chains in the Genus database with same CATH topology
 3W42 A;  2IRM A;  3RNR A;  3FXJ A;  4YZG A;  2I0O A;  3ZVU B;  5JO2 B;  4LG5 B;  3FXM A;  4DS8 B;  2J86 A;  3UJG B;  4N0G A;  3NMN B;  2V06 A;  3W45 A;  3EQ2 A;  3UJL B;  2JFR A;  3PU9 A;  4RAF A;  4WVO B;  3FXL A;  5D2U A;  2XZV A;  4DA1 A;  3KDJ B;  5F1M A;  4JND A;  3D8K A;  3F79 A;  4IIP A;  2J4O A;  2PNQ A;  4LA7 B;  3ZT9 A;  2JFT A;  2J82 A;  4LGA B;  2POM A;  4OIC B;  4RAG A;  3W41 A;  1TXO A;  3N3C A;  3NMV B;  3T91 A;  3UJK A;  2Y09 A;  2CM1 A;  3T9Q A;  2ISN A;  3W44 A;  2PK0 A;  3NMT B;  1A6Q A;  4RA2 A;  2P8E A;  4IIK A;  3RT0 A;  3W43 A;  2POP A;  3FXK A;  3FXO A;  3ES2 A;  2IQ1 A;  3W40 A;  3KB3 B;  4YZH A;  2I44 A;  3JRQ A;  5JO1 B;  2JFS A;  3QN1 B;  4LGB B;  3MQ3 A;  3KE6 A;  5ITI A; 
#chains in the Genus database with same CATH homology
 3W42 A;  2IRM A;  3RNR A;  3FXJ A;  4YZG A;  2I0O A;  3ZVU B;  5JO2 B;  4LG5 B;  3FXM A;  4DS8 B;  2J86 A;  3UJG B;  4N0G A;  3NMN B;  2V06 A;  3W45 A;  3EQ2 A;  3UJL B;  2JFR A;  3PU9 A;  4RAF A;  4WVO B;  3FXL A;  5D2U A;  2XZV A;  4DA1 A;  3KDJ B;  5F1M A;  4JND A;  3D8K A;  3F79 A;  2J4O A;  2PNQ A;  4LA7 B;  3ZT9 A;  2JFT A;  2J82 A;  4LGA B;  2POM A;  4OIC B;  4RAG A;  3W41 A;  1TXO A;  3N3C A;  3NMV B;  3T91 A;  3UJK A;  2Y09 A;  2CM1 A;  3T9Q A;  2ISN A;  3W44 A;  2PK0 A;  3NMT B;  1A6Q A;  4RA2 A;  2P8E A;  3RT0 A;  3W43 A;  2POP A;  3FXK A;  3FXO A;  3ES2 A;  2IQ1 A;  3W40 A;  3KB3 B;  4YZH A;  2I44 A;  3JRQ A;  5JO1 B;  2JFS A;  3QN1 B;  4LGB B;  3MQ3 A;  3KE6 A;  5ITI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...