2PO7A

Crystal structure of human ferrochelatase mutant with his 341 replaced by cys
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
359
structure length
359
Chain Sequence
RKPKTGILMLNMGGPETLGDVHDFLLRLFLDQDLMTLPIQNKLAPFIAKRLTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDCIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Altered orientation of active site residues in variants of human ferrochelatase. Evidence for a hydrogen bond network involved in catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Ferrochelatase, mitochondrial
total genus 137
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2007-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2po7A02
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2po7A01
2XWSA 1C9EA 1DOZA 1AK1A 4KLAA 2QD3A 2QD1A 2PNJA 2QD2A 1QGOA 4KMMA 2JH3A 2XVZA 2QD5A 2AC4A 1C1HA 2PO7A 3W1WA 1LBQA 2XVXA 3AQIA 2HRCA 3HCRA 1TJNA 3HCPA 4CCSA 2Q2NA 2H1VA 3M4ZA 4F4DA 2PO5A 3LYHA 3HCOA 4MK4A 2Q3JA 2XVYA 1N0IA 2Q2OA 4KLCA 2XWPA 3GOQA 1LD3A 2XWQA 2C8JA 4KLRA 1HRKA 3HCNA 1L8XA 2AC2A 2DJ5A 2H1WA 2HREA 2QD4A 2HK6A
chains in the Genus database with same CATH superfamily
1TLLA 3JALA 2YWXA 2Y0PA 1Q2XA 2C2HA 2R25B 2VJBA 1R6XA 2AD5A 1AC5A 1G5FA 1D7OA 4MYHA 1P9LA 3OE7A 1ETUA 2Z83A 1PL8A 5HKKA 3VGPA 3DKPA 2ZUSA 3HR7A 2M1XA 3DWIA 2OHOA 3LT5A 2VCHA 2VEDA 2VDVE 3HVIA 2R44A 2FRDA 2XA1A 5ADVA 4EQZA 1RXUA 2BEKA 3JQ7B 3K9NA 1GG9A 3B7WA 2BMEA 3LRTA 1MPTA 4UAVA 3VM6A 1JI3A 2VAWA 2YTZA 3L8HA 4RJTA 5KB3A 1C7FA 3MTBA 1TEZA 3RS3A 3DKIA 2JKZA 5B1HA 4XWAA 2GMWA 3V34A 4DV7B 4EA8A 2VJDA 4M1SA 3IAEA 3KV1A 3LCVB 2J6CA 3MIIA 2X8BA 2VNKA 4B4VA 2YL2A 2CK3A 2FMXA 3AFIA 3CX8A 4ZMBA 2PFGA 4GR4A 3BK2A 3HCBA 5KYNA 2QIOA 2H63A 1YS1X 3HBAA 1MB2A 2VNIA 3IOBA 2QE7A 4Q3AA 4EG0A 4KKVA 3AR6A 4IF4A 3G3EA 2C5AA 2OM2A 3G0IA 5CM8B 5BUQA 2C5SA 2GN6A 1H1LA 4F8EA 1PDWA 1TM4E 4AK9A 1UMDA 3K09C 3IUQA 4B4DA 1H69A 5FQNA 1BSVA 3P2EA 4C1BA 1KEUA 2RE8A 3FY4A 4NCIA 4TL9A 3GT3A 2GBPA 2MYTA 2PRKA 3DJFA 3GB9A 4PM4A 3ENQA 4Q82A 2QTZA 4QO8A 3VC1A 4B09A 4UVDA 3DXZA 3L7JA 3W5VA 1DMRA 2GHTA 1JLRA 2X9LA 2RHOA 3TZLA 3HADA 2H1SA 4EY4A 3I9JA 3WGLA 2I65A 3N70A 2K5UA 2G82A 1R74A 1CJCA 3DAGA 3G8BA 3Q7RA 5DM4A 3TW8A 1SKMA 3GWGA 1BXGA 3MXTA 4W8OA 1HSOA 2FGKA 2D2FA 3TNDA 1JA0A 1E1CB 2HYDA 2Y93A 2GJSA 3PUWA 1I14A 3UTDA 2XNSA 1BMDA 3OEHD 5B4VA 3PXAA 4NBUA 1XMQB 4DS3A 3QENA 2P40A 1DEKA 4KAJA 2ZRMA 5FEUA 1IHYA 3KU1A 4NBNA 4R1MA 3H5LA 5J4KA 5JS6A 5KX5F 5F33A 2PLRA 4R68A 2FLVA 4ZO7A 4MPJA 1U2GC 3GL9A 3IL2A 3FIJA 3SVLA 3I9KA 4YJHB 3UWDA 1X0VA 3QKSA 5EQTA 1P4GA 2PGXA 2W6JA 3EZ7A 4MA4A 2QL7A 3TK1A 4BFWA 1XN4A 3O1IC 1NJFA 3QMWA 3ROFA 5HKOA 3ND9A 3FD8A 3NBAA 5T3YA 4NLLA 3JATB 3W3ZB 3ANXA 4CM9A 4XASA 4Y1EA 4XIGS 4DHEA 5GADl 1PGJA 1NQWA 8ATCA 4BO5A 2Z4TA 1SCIA 5HCUA 5H9VA 5K7SA 2ISQA 4DR2B 1ODTC 1Y6RA 4YUZA 4TTPA 3GX1A 2YN2A 3TVTA 2B1JA 4O2BA 3AXTA 3LSTA 1KOLA 5C1OA 2PRIA 3GEIA 4O25A 3S3TA 4BJHB 2IEGA 2ZP1A 3U7HB 3VNVA 3E3NA 3UPUA 2Q99A 5J63A 3L4JA 1EFAA 1DJOA 3PXBA 4JIGA 2C5LA 4FHDA 2HLDD 3E4CA 1AKYA 2XHEA 1T9GR 4B71A 5GVSA 1SN7A 2HPHA 3K2BA 4J0DA 2QD1A 3I9MA 2PUWA 4UM5A 1QMGA 5G40A 5EIWA 2IXAA 1U2DC 1OLSB 3KKOA 3MRTA 4HNHA 5ED4A 5D6NA 1HR0B 3H04A 2AOVA 4UQOA 5HX7A 2FQQA 2DPGA 2PE5A 2XCUA 4OI4A 5EFZA 2NUPA 3FFAA 5LP6A 2Z30A 1JLLB 1ZEMA 2F2TA 1PK8A 4G2TA 4RACA 4JI1B 3UICA 2B34A 4EZIA 3EFOA 5K01A 5CPBA 2OQIA 1SQSA 4JXZA 2B1GA 1B8NA 4H18A 3U9SA 3GP5A 2E82A 1P19A 1I94B 4OIFA 2CL6X 1ML3A 2VNAA 3I42A 2P9FA 4TLBA 5JCXA 2BZ0A 1H8EA 2ACKA 3AETB 2J45A 2IEYA 1G3IA 4LZPA 4G0MA 4JGIA 3A9UA 1P2GA 4EJFA 2PNFA 4UM9B 1PGQA 3BMCB 4BIIA 3B3JA 2NZUG 3T61A 2Q6LA 5FO0A 5E6SA 4URVR 4YYZA 3IODA 2OBNA 5B4TA 5A9SA 4N5HX 3HKDB 7REQB 4JDPA 3T3MB 1UDRA 4D02A 2JFHA 2R9VA 2V97A 2CC2A 1TJNA 5FJIA 4M9RA 5I9LA 2HYIC 2OAP1 4GIBA 2PO5A 1ZRSA 2DPYA 3K6JA 3RK4A 3GGPA 3EXHA 3KD3A 4HQLA 4OYLA 2HK8A 1UKVY 1MRZA 1PFQA 3OZSA 2FWPA 3OQIB 3L1KA 4IF6A 4RFSB 4XIJA 1G8PA 1KY5A 2OLKA 2QJTA 5TVGA 4EAAA 3ZVMA 3DPUA 3S1AB 3AF6A 3U60B 4XX0B 3C6XA 1L5NA 4P7BA 1SOWA 3FWKA 1GT6A 3TLMA 2ETVA 5KAPA 5KNBD 5CB6A 2D1RA 1E58A 3W5AA 2VXBA 4I4TB 1ZIDA 2CJWB 3FBGA 4JH0A 5LU8A 5C4GB 3AVVA 1RM5A 1PLKA 5TXGA 2GCNA 2QQGA 1FSGA 1SCJA 5IJ0A 3TI9A 5IW8A 4L28A 4XYMA 1N1DA 3ZE7A 3LNCA 1IK4A 4L8GA 2ZZMA 2HPVA 3WNDA 1GKUB 5AK3A 1RACA 2XZPA 3WGKA 2OO7A 3D4NA 4AO8A 1UK9A 4DLBA 4PHFA 2WINI 1VE1A 2OFXA 3DHEA 3DAPA 4FTWA 4PIPA 2W5UA 4WFQA 5KQLA 4PR0A 2EKQA 1R8YA 1QAMA 1TLTA 2O7VA 3GGDA 4JJ4A 4L22A 4QD3A 4JZYA 5D8DA 1YB5A 5DK4A 4C0LA 2HQRA 2WR8A 1L7OA 4LJ5A 3O38A 3G2MA 5KYGA 3Q8KA 1LLCA 4RZXA 4HYEA 4QLAA 3WFZA 1U3UA 5C8YA 2VXOA 4B2PA 1Y48E 1SCBA 2VIIA 3BA6A 3Q9UA 2OBMA 1KI9A 5IMSA 3THXA 1XAHA 4TOIA 4B43A 1YIDA 2VR1A 4GEKA 2OYRA 3CEMA 4EUSA 1ISFA 4Y18A 3KUKA 1CHNA 4KUGA 3WGGA 1A4XA 4OBXA 5DTJA 5A6SA 3CVWA 2ZYSA 3DAYA 3PL1A 2H1CA 3PLRA 3WHPA 3MSCA 4C3OB 3PE6A 4HD8A 1KRWA 3DEIA 1PHRA 5DHFA 3UWSA 4I4NA 1Q7CA 5EE9A 4E5DA 2HQ1A 1G66A 2HK6A 4BAGA 1EFDN 3KQVA 3WB0A 3PQFA 4L0CA 3D31A 3A9SA 2NVUA 1RHUA 4D9HA 1KWGA 4FW9A 3DZJA 3OP1A 5FWXB 1M7HA 1QP8A 2ZDQA 3NRBA 4X0EA 2RGXA 1N3BA 4YONB 1OFTA 4P22A 5M3BA 1GD1O 3HLTA 3MUEA 4KIGA 4RK5A 4ZJZA 4GMXA 1N8TA 4REQB 4W1QA 2ZUVA 3GLKA 1DAPA 4HB0A 2NP7A 1XXHB 5TMDA 3OQNA 4HDNA 2ZE5A 1WD7A 1MO3A 2DWUA 1ECJA 4Z49A 5JISA 5LVAA 3IP1A 2WTNA 1G4UR 1NM5A 5DLPA 8LDHA 1GGJA 5B30A 3GZNA 1R7RA 4GX5A 3M49A 4MP6A 5G4KA 3N6XA 4TUYB 2OHHA 4W5WA 2X5KO 5K5EA 1OFGA 2V96A 3LGXA 4YRRA 2BYTA 2ZS9A 3MRXA 1XELA 1M2JA 2I3DA 4ITRC 1SCUB 4JT2A 4L76A 4NCJA 3RK0A 4DF3A 4I81A 1T9DA 3IV7A 5A2GA 2Z98A 1HM5A 1PGPA 3FROA 4FOPA 4RZIA 4QTYA 1EVLA 4QBFA 1KO1A 1WABA 4ZQIA 4YCMA 5MN4A 4E07A 1B8PA 2Y3IA 4Q7EA 2I91A 4A82A 2V6MA 2NUAA 3I3SR 3T3OA 3THYB 1WXEA 2CFRA 1KOFA 3A6LA 3ZS9A 4RV5A 4F5EA 4EHIA 3BMOB 3IHWA 4TSFD 4P34A 1CZOA 4YAOA 1QIJA 1U81A 1A9ZA 2Q29A 3VA7A 1RJ9B 3BEDA 4KK3A 4TMZA 2XF8A 4URXR 2O23A 1E3DA 3R23A 1HORA 3LC1O 3O8DA 5IWAB 4L6AA 4NF2A 5A0VA 4I4TA 1Z5ZA 2BFAA 4H0NA 1VP3A 4QG7A 2R00A 5C34B 4NR0A 1H2AS 1MDBA 4Q4DA 4LMRA 2Q8NA 1QF9A 3HB9A 3O2NA 3H8JA 2NUAB 3S1AA 3W2HA 3SLGA 1TD1A 2HOQA 3GV0A 1KU6A 3HACA 1VLJA 3UJHA 4B9EA 821PA 2GAOA 2PXCA 3DLTA 3IJ5A 3HZOA 1Y82A 4M9SA 4I3HA 2Q6OA 3HDGA 4XVCA 1M2GA 4JI4B 3JARA 3P9ZA 1PR5A 3A2NA 4ACAA 1GNQA 1WWKA 2A5FA 3HN6A 1ZR4A 2XTMA 2ZI7A 4WQMA 3TLJA 5A9SB 7REQA 4KJXA 4L72A 4ZT6A 4KFSA 3G9QA 1JSCA 1OYWA 1U31A 4GMDA 4O2LA 3QZUA 4UHBA 2A1UA 2VHYA 4Z86A 4XWOA 5L9AA 4RJKA 4MJ3A 3ENNA 2UYGA 3NFRA 4FDMA 1G9XA 2R7NA 4IOKA 4WINA 1QGDA 5YASA 2A7XA 2O2YA 3U4CA 1N2ZA 1XXHA 3RG8A 4C0SA 4KC0A 2YVQA 3KAKA 1JG4A 1CR2A 1LNSA 4NK5A 3VPGA 1KETA 3BGVA 4DLXA 4NBVA 2JPDA 3HB4X 3RD5A 1MC5A 1KY3A 4PTYA 3QEBZ 1RCFA 3LIIA 5JH7B 2XE7A 3MJRA 2H5LA 1E8NA 3DUFB 5FBQB 1ZW6A 4AN1A 5KNDH 2BBOA 4D25A 3FDJA 3PVCA 1SXIA 5BNWA 4KPFC 3C8MA 2NVUB 1JLLA 3TIGA 4ZCTA 2WM3A 2WMNB 3STUA 1D4AA 2NUPB 2VPQA 4KXWA 2G5GX 1CUDA 4ZOLB 3WB9A 1I10A 1LPSA 2WAOA 1E6LA 1PJ3A 5HZKA 5FBWB 3C7TA 1W5BA 2IY9A 3ZU4A 2HA5A 2VNHA 4Y2XA 1JDSA 1W8DA 1RJFA 1YRBA 1NN0A 2D1YA 4H3VA 3QIAA 2QYHA 3AM3A 1MX1A 1NRWA 2HDNB 3RYHA 1BWPA 1XRRA 1KJZA 1UZAA 3LZCA 1O03A 3MRVA 3VR1A 1KK3A 1ZN9A 3A11A 5FUYA 4CDRA 2HV9A 1QYDA 4G0YA 3SE0A 5G0WA 3CNLA 2YHIB 1P17A 4YDSA 4KOEC 1E5VA 4P31A 1ABEA 1K97A 5JBQA 2DB3A 1ZMTA 2ADOA 2ES4A 2TYSB 4YRSA 4GOMD 4OB7A 2ZYVX 1UC5B 2OVBA 2ZR8A 3BJMA 1JDBB 1EXMA 2FSHA 1DUIA 1HRKA 2FRVA 1NY5A 2GS9A 2PIAA 1A69A 2IOYA 3GWZA 3H2ZA 4FFBA 4XWWA 4QWWA 1YVPA 4QOSA 2VPYA 5LJIA 3CE9A 1LRKA 1X7DA 2LR0A 1E89A 1PL6A 2DR2A 3WQBA 2M2IA 3Q2IA 3HJFA 2C2KA 3UT5B 3RS8A 4WDQA 3ZY6A 3ZWMA 3NPAA 2UZ1B 4OJNA 4ZAYA 2HUNA 4EW6A 3ZDDA 1KI6A 1V8OA 1E2QA 1OX6A 4FXPA 3KZNA 4PHHA 2QGNA 2YVLA 4DCSA 3F5QA 4YAJA 4IZIA 4X1KA 4YQEA 4ARVA 1R9NA 1SA0A 4D5EA 3NLLA 3NALA 1KDZA 3EG9B 3CRMA 3TTSA 2ILVA 4NDAA 2G0TA 4WVLA 4D9FA 3ABSB 5JARA 4OHCA 4LF6B 1R4NB 1HEYA 1Q0HA 4NPAA 5F9MA 4BLQA 1GSAA 2OD2A 1ZRMA 3AXSA 4GBED 3CISA 1VL2A 2POQX 1G3UA 5BO5A 3KWJA 2YNMC 1I5RA 2NU6B 1SWVA 3WMGA 1GCGA 3EUFA 1G7SA 3IPRA 2JHAA 3OQIA 1JS1X 3NT4A 1DKRA 4RFSA 3P9RA 1J42A 6AT1A 4CEJA 3VR6H 4LNHA 3B2EA 1Z6XA 4TTJA 3M7IA 1GZSA 2CUKA 1FSSA 1GHTA 2AHOA 2WKRA 3OEED 2XB9A 5KJCA 1HDEA 2XQVA 4X84A 3SKVA 3PFGA 1XF1A 3TE7A 1D5CA 2XE6A 4L07A 4U7WA 3NDIA 1O6FA 3OUUA 4JVMA 5DHRA 1Z88A 3NHFA 1JHYA 1QNLA 2NXCA 3UK7A 1P80A 3QGMA 2XODA 3DEJA 2VTBB 1BHQ1 2EG5A 4BN0A 2YS7A 2C82A 3BRSA 1KH3A 2KLHA 4WOKA 3HRHA 2ZT6A 3HA2A 4BAZA 3OEHA 2VT3A 3K5IA 2WQ6A 2PLAA 1TLFA 4IBOA 1BCSB 5ABPA 1SC6A 2I0FA 3T5PA 4CV1A 3K9HA 3BXOA 1M5UA 2VHVA 2XVZA 4KLZA 4WIAA 4DLLA 3UUFA 5DI3B 4N39A 5GWXA 1KFCB 4J16C 4P3YA 4MULA 2ORVA 2O50A 1AQIA 2AYYA 3LK7A 1I8TA 2ZJFA 3C3WA 5AFSA 1AGPA 2F9FA 3OLWA 1H93A 1P2BA 1QTNA 5FNZA 4TT3A 4ZN6A 2O6HA 1AM4D 1W35A 2QPOA 2RGNA 2GF0A 3GPDG 4MZXA 5I7HA 5L45A 3M6AA 4EG3A 5EPEA 2A58A 2EKBA 4XIIA 3VOAA 1YJAA 4MWOA 3BXPA 4DMUB 6CHYA 4D4MA 5IAEA 3IBTA 2PKEA 1ISIA 1OREA 4P53A 4BNMA 1J0CA 2PNJA 1QF6A 1R00A 5F9FA 2P7HA 4EMUA 4WJLA 4ZZ3A 3A2MA 4KW7A 4FXOA 2EU8A 3GRKA 5F23A 1KXZA 1XJCA 2EW8A 2KI5A 3EE6A 4KYIB 3DMYA 3FAKA 3O4IA 1TFUA 4V0RA 2Q5FA 3BXFA 3OFSA 4OQ4A 3P7MA 5CX1A 1UP6A 3B6IA 1VPEA 4JB2A 1M8PA 4PYQA 4Q4HA 5IKMA 2B4YA 3PICA 5REQA 1GDDA 2JJ1A 4NV1A 4OYHA 5B7QA 4X7PA 1NVUQ 2WSIA 3H2JA 3TUIC 4EO9A 3EMDA 1TM1E 5K3EA 4UUOA 1V9LA 4FT2A 1DINA 4RMGA 2FPIA 1ACMA 1NY6A 5CT9A 2E55A 1IM2A 1EDEA 4CKBB 4BVAA 4H6PA 3BWXA 3M82A 3S6JA 4DWVA 4DB2A 1JEEA 2QD3A 3L92A 2Q27A 4JHXA 2UYHA 5EMNA 2G9NA 1KRXA 1QKIA 2VJYA 4BU0A 3ZNQA 1SQ5A 4FINA 2PGNA 1QB8A 4EG5A 1G6KA 4KQWA 1ZNWA 1NYRA 3PUHA 4OQPA 5EA2A 2G6TA 4HEA6 2JBWA 1U8AA 2V55B 2AL7A 3BSWA 3T7EA 3TKAA 5AM2A 3E5NA 4X8MA 2WYWA 5CAEA 1Z35A 1Y7HA 2D7CA 1VB3A 2H57A 3D7SA 4M8SA 3IA7A 2O8NA 3A4NA 1CULC 3GLTA 1CJBA 5EL0A 1BS1A 3HXTA 1VLLA 3F96A 2YC4C 3ZKWB 5AVVA 5EP2A 4EO7A 2IBTA 2F64A 4GDMA 1YUBA 4DSZA 4QQFA 2J5QA 2I6QA 2PAFA 1MHPA 1V3VA 1L4BA 1M74A 2I76A 2AFIE 4OK5A 5FUQA 2BGNA 4KQMA 2BFFA 4G67A 5KJ1A 2ENWA 3VAAA 4TKLA 3OZUA 3MT7A 2QP3A 4JLAA 5FUMA 2V4UA 3IPLA 2EWWA 3L9WA 4H3KB 1NA5A 1V1JA 4PFJA 5CA1B 5K3AA 3FKSA 5CRIA 2QW8A 3ILSA 5DMXA 4M4SA 5E1OA 4RVGA 3WWYA 4YIHA 3WYNA 5KSZA 5BW6B 5T6MA 4AKEA 4EI7A 3HR4A 2JI4A 4L8WB 4Y9RA 5K0GA 2GUGA 4MWEA 1NLMA 1E3JA 3TQOA 4WY5A 1XVUA 1PTJA 2C2GA 4XX1A 1YMUA 4X8OA 3GELA 5HHTA 2YHSA 2X3UA 4BUJA 1XV5A 4JJ6A 3KOOA 2J5BA 1KVSA 4GWGA 2A9PA 1DDOA 2C8LA 2CJYA 2V9PA 4QPJC 1SUSA 3R7BA 1YRWA 3SQOA 2ANCA 2XNKA 4FBGA 4RW0A 5IDWA 1VRWA 2OMKA 3RUFA 1G38A 1QCYA 1T8TA 2PD3A 2E49A 2HSGA 2ZIZA 3E81A 3KYDA 3VJLA 5K3SA 2JZOA 4IVNA 4ZOEA 1MAHA 1N2GA 2P78A 2BT4A 4RA9A 1E0DA 1YVEI 4S24A 4IDPA 4J3NA 4W5OA 2O4UX 1AV6A 3LHFA 2HO5A 2ZJBA 4Y3UA 5A4KA 3ZJTA 2W2PA 1GTVA 4RIHA 1L4KA 4BP9A 1Z4OA 4O8CA 4MQ5A 4PG4A 4Z2AA 3C1UA 3FCXA 3QFSA 1MABA 3SSNA 5JR3A 3QEAZ 5I51A 4JP5A 3UBTA 5GZ1A 1OA0A 5BRJA 2X5XA 3JVUA 4J2HA 3E5MA 2GCPA 1H5UA 2ZKLA 3IURA 4M21A 2PSEA 4MICA 1L6IA 2EBUA 2F1JA 3C24A 4LWOA 3P1JA 4PRLA 3KS9A 4BEVA 4MDEA 1QIHA 1K7YA 1Q57A 3HN2A 5EJ6A 1YA4A 2OG2A 1OMOA 1YH3A 2B36A 2FWRA 3QHAA 4LJSA 4PBTA 4U9HS 4AUMA 4BNYA 1U0LA 5JD5A 3MB8A 1YCHA 1M8KA 2ZB3A 3DLCA 3FLMA 4B0PA 2ZXUA 4KPYA 3A04A 4WD3A 3A28A 2FDRA 3CT6A 5A3JA 4KB5A 3KJEA 4RKQA 4OLAA 4BQEA 4R1UA 3MD0A 1NSTA 5HPYB 3B6KA 1YBAA 4S05A 3LBIA 3OPVA 4RXTA 2NG1A 1I4TD 4DCPA 1QX3A 1UBHS 2FUG1 4IQGA 2D1FA 2QU8A 4M54A 4LJ7A 3V1MA 3NHJA 4G5GA 2W71A 2QZ9A 1YR1A 4BP8A 3IESA 5JQGA 1O7JA 1JALA 2BM0A 2HBQA 3OF5A 3UGKA 3RB8A 2N0SA 2P2CA 5FWDA 2VSOA 3KALA 2HRBA 3DVRX 5DGXA 3ZE9A 3WG9A 2H3HA 3FUTA 2OCIA 3GAAA 2ZSEA 2V7VA 1V1RA 1OXVA 3QYFA 4D9CA 5KYWA 1MRNA 3LGSA 1USVA 2Q3CA 2QROA 4IEEA 5LUBA 5FDFA 4A27A 4BKRA 4QICA 1XNRB 5CA0A 2C77A 2YHUA 3U44B 1E96A 1II0A 2QMZA 3IIEA 1J00A 1EWYA 2OECA 3WGIA 1CUYA 3VR5A 3ZLTA 3KQNA 2PS9A 4ZHQF 3L8DA 1EAMA 1YB4A 1QM5A 2Q3FA 2X3FA 2P9YA 3C6QA 3GQBB 5E38A 3RE1A 1NI4B 4P35A 3A4VA 4MNTA 3MT0A 4X7MA 1XLVA 2YMQA 1T0JB 2CFIA 2B8JA 2AOUB 2YVKA 3D0KA 3MS2A 1O95C 4FEEA 4B2YA 3WRVA 2I2FA 1OKKD 3BPSA 1CETA 3D8BA 1MZPA 4LXGA 2BGKA 2R47A 5EZSA 4RPHA 2PLFA 2DULA 1BCSA 4HH3C 1R4MA 1VE3A 4UBJA 5GOZA 4JI3B 4UBMA 4I1UA 3X2EA 3CB2A 3X2FA 1XU7A 3U3OA 3I62A 2BGUA 1NASA 3TTWA 5CCXA 4RJJA 2A14A 3T7IA 2H1OA 2RIPA 4FSXA 5F7XA 1TKBA 3N0WA 1H1TA 1NVXQ 3MWGA 3OHSX 3IIMA 1CUAA 3ZE6A 2J31A 1B74A 2OBFA 1KY4A 1ZCZA 1XOIA 3EF3A 3QI2A 1YCFA 2IT1A 1TZJA 2IUTA 1RLUA 3WOVA 3U7IA 2P6PA 4IIUA 3G2HA 3KBBA 1S96A 4GKBA 1PSDA 1S4MA 6YASA 1M72A 2WAYA 3DQQA 1PJ8A 2BY4A 2G9QA 1A8PA 3GFBA 3VPXA 3AKCA 2AC7A 3OM1A 4AMBA 2FLWA 1GUDA 4HLUA 4PVCA 3NHAA 2NZYA 4NCHA 1Z18A 3CQ9A 4YTEA 1COZA 2XCIA 3BAFA 4I46A 1QBGA 3IKTA 1KEVA 1C0LA 3TM4A 5C37A 2R2GA 2VP0A 1OTXA 2N1MA 2D3WA 4AMGA 4B4KA 1Z8HA 4CUKA 3OOSA 1E7SA 3G0DA 1IY8A 5NLLA 3FTPA 4ERXA 4ZGBA 1TCBA 3BHJA 3RT1A 4MCAA 1VBMA 1WIWA 2VT2A 3KE9A 3S99A 4F12A 4JB3A 2CLFB 4PSUA 2MSNA 4A8HA 3EB9A 3FHOA 3ZBTA 2QY9A 2UVPB 4Y1FA 1Z63A 2P6MA 1JMKC 3BULA 1VYVA 1JMYA 4R7ZA 4ZXFA 4C6TA 4LNUA 2I4MA 1QIKA 3SBDA 5M2QA 1U1DA 3A9WA 1KS9A 3HY4A 3I4LA 2IXFA 1KEEB 4XJVA 2VHZA 3M4YA 1LV7A 1NUPA 4KACA 2FZCA 5A6VA 2GK4A 5ED0A 1P3DA 4KOAA 4KPGA 4S2EA 1ZFNA 4Q93A 1OFHA 4BLOA 2WU0A 2ZIXA 3UMGA 2R11A 2WIFA 1PWEA 5DE3A 2ZAYA 3ND5A 4ID9A 5DKFA 1IN1A 1KDTA 1K27A 1VZ2A 4PZLA 4JXXA 4MRNA 3B82A 4P5EA 2GN2A 4LJ4A 1ZD3A 2NU9A 4IJ6A 4TS3A 3OZRA 1S1MA 3U17A 2OWEA 4O3MA 4BRZA 4JEUA 5B37A 3HKCA 4GP7A 4Q9KA 4EA7A 5CT5A 3S4YA 5IASA 3K0FA 3KL4A 4LXHA 3SN6A 4BO9A 2H2WA 1R6BX 5HA5A 4MKZA 2HIHA 5BUZA 3S29A 3LDUA 3U13A 4Y8VA 3ZGVA 1E4VA 1KC1A 4Q39A 2O2EA 2IODA 1TPYA 2Q2NA 5B58C 4JUBA 1YDFA 3DHVA 1HE2A 2IS2A 5LBUA 1A4IA 4R54A 3TTTA 1F48A 4LYGA 1X70A 2HT6A 2TMGA 3DE0X 3E3MA 2ZJ0A 2XIJA 2RC6A 2FUG6 2NSYA 4FPXA 4RH0A 2R7KA 1LDBA 3WWDA 4CT5A 1I4DD 1T10A 3OTGA 5AVKA 3NKVA 1B2LA 4XJTA 5JH7A 2O19A 1BVRA 2O8VA 5MGBA 2AG5A 1OXBB 5EHNA 1ZP6A 3SEZA 4PAMA 3NKLA 3SZRA 5L51A 4KDCA 3RIYA 2FPSA 1AA6A 1PX2A 2G5PA 4A92A 1DRUA 4BV2A 4G81A 4C7KA 1ESZA 2FJ0A 2FH5B 3KZCA 2FWBA 2FUCA 2IRWA 4WZAB 1VXRA 4ZEMA 2ZUFA 1EX9A 1KI1A 1GL3A 4LPSA 4RHUA 1MO5A 5EJEA 3EPLA 1I0ZA 4J4TA 2IOHA 4AQYB 3SZ3A 3N5CA 1N3LA 1KI3A 3NTVA 1QUEA 2DR3A 1ZM3A 1J0BA 1LBHA 1N2CB 3QKUA 4D7AA 1KMCA 5T6BA 2JVIA 4X61A 5C3MA 4PANA 2J0SA 1QGZA 1EHCA 3AHCA 2GEDA 2PBFA 4MB6A 5DDIP 1A88A 3ZY2A 2VUIB 1LPAB 5I3ZA 1Y8RB 1FUIA 1T5SA 4FNMA 2IS4A 4LAFA 1B93A 3EISA 1UL1X 2C2ZA 4NBRA 4O4JA 3DMTC 4H17A 4R2MA 2QDXA 3U40A 5HZGA 3H99A 3AHJA 2FE1A 3IC5A 2XUGA 4O63O 3JSAA 1XZPA 2GPAA 3X1ZA 4BKQA 3GLIA 5B3AA 2IYOA 1YR6A 2WWTA 2I4OA 3G89A 4JC5A 3ZEAA 4GH5A 5DWVA 3O4HA 2H52A 1E2GA 1RAEA 3WDKA 2JLUA 1PZXA 1WDMA 3BB1A 1EFVA 3RV4A 3QX7A 5CCBA 1TM3E 2DAPA 3BMOA 4NAUA 2NYRA 4XUGB 1B0UA 1ISMA 3R5JA 4NX2A 5IUKC 1M7GA 1GZ7A 1QIEA 1WY7A 3GAFA 4ZVKA 4F3NA 1WMAA 1BE6A 1J2EA 5CJJA 3G6WA 4RTNA 5I4BA 1TGVA 5KTRA 2F7SA 1CE8B 4GZ3A 2DUNA 1IN4A 3LKBA 5EXEA 4B32A 5JECA 2Y0CA 4DPKA 1M34A 1HDIA 4AN0A 5H1YA 1RQXA 2G71A 1PNRA 2YJNA 3FX2A 3HJTA 1NF8A 4UOZA 3GZNB 4IWYA 4U7FA 3U31A 1ZG3A 1EGHA 1Q0LA 1T5OA 3UAVA 1PEYA 5IUJC 3NHLA 2I34A 4Q7MB 4WNYA 5G1NA 1MW8X 3GA7A 2XYPA 1Q92A 4ND2A 4Z3OA 2FUKA 2Y1DA 3ABOB 3N87A 3R6LA 3U3JA 1T1GA 1T8PA 2REOA 3NV9A 4IJWA 5I9MA 1Z4PX 4TYWA 1YZYA 1Z7EA 2YJ6A 4I1RA 4X94A 1NVFA 4Q1AA 5F1PA 1AY0A 3ONEA 4NOJA 4BO4A 2C4VA 1DQNA 1Q12A 1EVJA 2XHZA 2A4KA 5K8LA 1NI5A 4AKIA 1A72A 2VT7A 1D6MA 2WE7A 4X6LA 2XUOA 4ND6A 4XPIA 4MLDA 3RIXA 1A50B 1RZVA 5JWRA 5I4CA 3GMDA 3BHIA 1V8PA 1Z2NX 2MSWA 4GRDA 5KBYA 1NVTA 4HKTA 4TVKA 4X1YA 1CUWA 2CF6A 4DCGA 2C7PA 3QBEA 3QKIA 1OU0A 3LWNA 4EARA 1Q16A 4A0SA 1TJPB 4M1YA 3H42B 3QBJA 3HO8A 4AY6A 4P33A 1UJMA 1BEZA 1CRLA 2CLDX 1U0OC 4OMDA 2AH5A 3C3CA 3R4VA 3S70A 3WI7A 1ADYA 4ZI3A 1UK6A 1W96A 2ZQZA 2ZBEA 4G4IA 4LJ8A 3FTFA 5EZYB 4EG8A 2LUOA 5F2OA 2NO0A 2R00C 2PYZA 2XTZA 2OO3A 5DIFA 4IHKA 2VF4X 2W11A 4CDGA 2ZRKA 1OYOA 2HX1A 3LLVA 2NU7B 1EQ2A 1QG2A 2GJ9A 2R8PA 1NPDA 1RKVA 2X6RA 2H0RA 4JUCA 4UZSA 1F2UB 1BH6A 1UBCA 4TV8F 4KXNA 4B3CA 3GUCA 3HTXA 4UM8B 2FA9A 4E94A 1QIIA 3P45A 4HZGA 2R1VB 1Y3IA 2JNWA 2F43A 1X86B 3AQIA 4G23A 3UA4A 4Z4IA 3A9TA 4V02A 4D46A 1HDOA 1EM8A 4QNMA 1E4EB 2Q5EA 4O59O 5IVPA 1USWA 5TDHA 1HBJA 2O7SA 4FYVA 5H02A 4I6JA 3REOA 2VAXA 3VV3A 3ZHTA 3PBKA 5JNWA 5LKAA 2ZYUX 4EIWA 3SIXA 1YDEA 1G5QA 3L1VA 3WLFA 1E3IA 4KX3A 3S2FA 1U0JA 3LCJA 4CQJA 1CTQA 2Q1SA 3F3KA 3UV6A 1ZGBA 3CC8A 5BSVA 3JS5A 4DG8A 1VSTA 2XMBA 1LLUA 1SVLA 5JU6A 5JG7A 1NE2A 4LY3A 4KITB 2WV7A 2G77B 1B6RA 1CDOA 3VUFA 4M76B 2WHRA 4BX8A 1ZVQA 2VQEB 1IVSA 1XQ6A 3RBAA 1I4OA 4YJ3A 4E09A 3DLAA 5BQ5A 2YWFA 2W4MA 4XWYA 5JSQA 3LF1A 4X5OA 5AW3A 4QFMA 2WJIA 4IKOA 2OV3A 3IOMA 4G85A 4LYHA 1LQ2A 5J4VA 2QZ4A 2HY7A 5AW2A 3AEYA 3PHBE 1HDYA 4MWZA 4UU8A 2BFFB 2BR5A 1XZKA 1HT3A 3L1UA 3R41A 5TNXA 4CI0B 3HPRA 1YJQA 4UTOA 1YGYA 4JBHA 3UHJA 4FWIB 2O3TA 1T1SA 1JYSA 5C5DA 3KLPX 3FOEC 3HKDA 5CM9C 1DOHA 1EBBA 2QUZA 1LZKA 2VHEA 4HWTA 4JP1A 1R27A 1TYZA 1P0FA 2Y67A 3A6ZA 3D59A 2X0KA 1TRKA 1Z62A 3HLYA 1GZ4A 1U9ZA 3GPBA 3Q2KA 3I53A 2YIMA 4FS3A 1LLDA 4MIOA 1RLMA 3DHNA 2FXIA 4RABA 4DSTA 3EAFA 4ZTZB 4QDXA 5DH9A 3AETA 3G13A 1TZ2A 5JHGB 1U02A 3MNFA 5CLLA 3TDNA 3TQQA 5FV7A 2PKCA 5D3MB 1JEDA 3I1YA 3N2NA 4WZBB 5FBVB 3VFDA 4HAVA 1NC1A 5AHXA 1W36B 1K3FA 4Q48A 3I04M 1VHDA 1JSZA 2XA9A 3C4QA 1X8KA 4RMJA 1Y81A 5LB4A 2A9RA 2JFQA 1ZJ6A 3BXZA 1U7WA 4XJXA 3V1UA 3ZIAA 1UQTA 2A84A 1CHDA 2NQ8A 3UW3A 2AFIB 4IFIA 5CDYA 3NWPA 1IZ9A 1UC8A 1XMOB 4CR8A 3IIIA 3ICVA 1BFKA 1WVGA 3GO4A 2OHIA 4MR8A 4P5PA 3T3NA 1BJTA 3TRHA 1V6AA 3A8TA 3KYJB 1I1HA 5D5QA 2BP7A 3SFVA 2VF5X 3ONFA 4KLNA 3F7OA 3LVFO 4PIVA 3URKA 1KZ1A 1K75A 5EXTA 2B4RO 3CA8A 2IYZA 1SXQA 3UMJA 2OO5A 5EERA 1L7PA 4TLDA 5K8JB 3I09A 3QEKA 1RC1A 1ZXXA 4CFZA 1D6NA 4JC4A 2DU8A 3R7FA 2JZCA 1FYDA 1JX6A 5TARA 4X24A 4LYFA 3IMCA 1SRQA 4AKGA 3OOYA 4XLZA 1UKYA 3BKXA 4YHBA 5DBGA 3EFBA 7ADHA 3EXFB 1MJNA 1JIXA 3ADKA 1WUHS 5A1JA 4W5HA 4QTUB 5HEKA 1WMSA 1QH1A 1IEWA 2QRUA 5B6IA 2J85A 3WBFA 1MFZA 5H4HA 4DJAA 2PO7A 1AGXA 1TVKB 2VQSA 4J0JA 1T8WA 4Q47A 3I2JA 2LDXA 2XX3A 3B5JA 3RS5A 2EQBA 3U7EB 5CHYA 1XDWA 1IHDA 1RKUA 3RKRA 4MR8B 1IRIA 5DTEA 4IIBA 4OBWA 4LQDA 3F6RA 4RZ3A 3ZNOA 4AYTA 1O6ZA 1W4LA 2EF1A 2AFIA 3EEQA 1OFUX 1QH9A 1RYFA 4F2WA 3LZDA 1J0XO 2IHTA 3IBGA 1QHIA 2I6TA 5FKJA 5BNIA 1ENOA 3DMGA 2WWVD 2Y1GA 3WXBA 1R0YA 3WJ7A 1XRSB 2PTGA 2K2QB 2QUHA 2DWPA 2EATA 3ENWA 3WP0A 1EU1A 3SWWA 5ENDA 2V4ZA 1L7MA 4QELA 3HA7A 2VEOA 5ITWA 4RUKA 4YX9A 2PS0A 2NIPA 2V3VA 1N0HA 4HH1A 5DLQC 3O91A 4G4SO 5I7SA 4YFYA 5ALSA 3KKPA 2X2EA 2PR7A 5DYTA 3PEEA 4Y9UA 3IE1A 5KSPA 1RS0A 2KW5A 4J2TA 5JV5A 1G41A 1E3WB 2UYOA 3CVJA 3U19A 1U0BB 2H65A 1FMTA 5AVYA 5LXTA 2QNBA 4B31A 4MPPA 2DECA 1N1MA 3L79A 5I7UA 1L8AA 1P2FA 1PW7A 1P0QA 3IQEA 3BZBA 1UMDB 1BN6A 2QIPA 2V74B 1JZQA 1SB9A 2C4TA 5E8JA 1Z0FA 1IB6A 1DT5A 2E0IA 3BE4A 4BMXA 4LYEA 2E4WA 3R0JA 4INAA 4Q1EA 3M6XA 1QVVA 4QUEA 2Y99A 3TR6A 3JRWA 3O93A 1GLVA 3DWGA 4AZ0B 1GSIA 4BNDA 4J7AA 3HXLA 4MINA 4CL0A 1E3EA 3D3EA 4X9XA 1ISHA 2CHFA 3DGFC 4K3UA 4N5IX 4RLSA 3V80A 5IXYA 2RGYA 3F4KA 4MPDA 2OPBA 3VO9A 3IEKA 3V3TA 3AVYA 1CJSA 1XQWA 1JQ5A 4MW2A 3FUXA 3SEQA 1E7QA 3UWKA 4E5MA 2MSCB 4K9RA 2FETA 2VA8A 3NDJA 3T3HA 1L7VC 4YEDA 4FD3A 1NE7A 1GGFA 1P31A 3GJ4A 3HC7A 3LHDA 1NZDA 3C3AA 1QYIA 2DPLA 3SSOA 2AJLI 3NBQA 5KTMA 1QR2A 4ERNA 1HNWB 4HSGA 1BXRB 2A94A 5CITA 4L4RA 2OVFA 2CUZA 3GAZA 1RI3A 2GFIA 2P2LA 4MYSA 3DHYA 3MAJA 1QG0A 3B1XA 2A35A 4JQYA 2VPTA 4RU1A 1FRQA 1J33A 4D45A 2BF7A 2CXRA 1QRUA 1XZGA 1RMQA 2G1JA 4ZVSA 4EY6A 2X0IA 3U4HA 1HPLA 4JI0B 2ESRA 1JLMA 3L2OB 3FWZA 1CUXA 1K5HA 4GMKA 3O4GA 2WWXA 2RK3A 4MUKA 4ZYVA 1GKYA 1DC6A 2P67A 5COBA 5I3CA 2XITA 2ZVJA 1ISSA 5HKLA 3AVWA 2DKFA 1THTA 1QPBA 4OP3A 3DLBA 1L4EA 5EEGA 1RNLA 1YDWA 4HPXB 3DFKA 4XGQA 3AIOA 1OY1A 2AS0A 5CGZA 3VZQA 5KC9A 4EF6A 4L0DA 1JIUA 4QPCA 3ZLVA 1U9IA 5F21A 3FYDA 4H1UA 4PRYA 3GUHA 2CXHA 4XXHA 1EI9A 3ZEIA 1GG5A 3CS3A 1QAOA 4KN5A 3ANSA 4G89A 3UJCA 3FCEA 2OHJA 4HNAB 4RIEA 3D8TA 2COEA 2P79A 3TTXA 2P62A 3IEVA 2UUOA 4MYCA 5HKBA 2H2AA 1NQUA 4XPIB 5F76A 1COWD 4ZEOA 5LZ9A 2Z1DA 1CUIA 1P6UA 1PK7A 2V65A 3FUUA 4HAOA 4WPGA 4GR5A 2HMYB 4IUYA 1SQGA 4CLOB 5H4GA 2DJ5A 3SBOA 1N2HA 3Q40A 4QOJA 4RKWA 3SG0A 5JAIA 1I4EB 3SYTA 3CF0A 1U4SA 4I50A 4BYMA 1QFMA 3R8XA 4EX6A 3WSVA 3ZCQA 1XC7A 3IR7A 2IH4A 2VDMB 1RYDA 5TGDA 4HPJB 3P2KA 2YINC 3OCWA 5JCOC 4UJ5A 4N7BA 4B3SB 3D2AA 2O9JA 5L7YA 2P9BA 2BEUB 2PX6A 4OI2A 3SX4A 1G8YA 1SG6A 1UKCA 2GZ2A 4YXFA 3RRYA 4YRLA 1CEEA 3MJTA 2IHBA 1N57A 2H4JA 1N0IA 4XB2A 4BRSA 4U6NA 4B3JA 1CE8A 1YE5A 4P7KA 5FOTA 5JAZA 2Q2WA 3IDSA 3IKMB 3M3HA 4G56A 4C4PA 4C2TA 4TM8A 4BEJA 5F77A 4BTLA 3PD7A 4FN4A 4XD7A 4NPHA 3WLKX 2DP4E 3M34A 4KQ6A 1W48A 4GKJB 2ADFA 1WXIA 3PQCA 3AV3A 4GGMX 5GJVC 3QXJA 3O90A 4WKCA 4B44A 2NQTA 1VZ3A 3PFIA 1CQJA 2C9BA 3QVOA 4FEAA 2BJHA 1V95A 4P4GA 1FTWA 4WCVA 3VMFA 1UBNA 2RCYA 4PS1A 4ZI7F 2C94A 2XRYA 4IQFA 3AQ4A 4RZSA 1EYZA 2FZLA 3U49A 4BFYA 4ZYLA 1U04A 3NYQA 2W42A 2JFZA 2AMVA 3OCJA 2I2BA 4OQMA 1G9TA 1OX5A 4L74A 2V7WA 1IBMB 4DA0A 3PIDA 4IW3B 5EIFA 2QSYA 4QVKA 3VDNB 2RCNA 1L8XA 1SVMA 1FFXA 4BP1A 1JJBA 4D0NA 4LIPD 2W8BB 1PR0A 5CR9A 4DGQA 3DTVD 4DLRA 4JJFA 2CD9A 4M1WA 4LJYA 4OK6A 1POXA 1E1RD 1FRNA 5I7AA 3WYCA 2WABA 4CMEC 3EVAA 1A8HA 4IKEA 4DLWA 4FLEA 1V16B 2XYGA 2H2IA 3RTDA 2R8OA 4QA9A 3EG5A 5FWXA 1MUUA 5K2MA 2GZMA 5UKDA 1Z5VA 3BQ9A 3DT6A 4WZAA 2B78A 2D5BA 2HMAA 3BD8A 4WXEA 5KYVA 5AW0A 2SICE 1RQGA 1FVFA 1Z2OX 1HTWA 1H23A 4NU6A 4J9VA 5DHQA 1J1IA 2Q3HA 3K35A 4D5GA 1JEYA 2VTDA 3QJ5A 1CK4A 1HXHA 4PZCA 3T95A 4MUJA 1YR9A 4IM7A 4GI3A 3T4PA 5FRDA 1ZNYA 1NWCA 2C1XA 1YUMA 1N2CE 2OC9A 4EP1A 4F9FA 5K8CA 1XRMA 2REQA 3TQRA 3RWMB 4NOMA 3VPCA 2O8CB 3X1XA 2Y2VA 1IAQA 2C9CA 2XXJA 1DBIA 3N58A 1L4HA 4Q66C 1OWOA 3SS8A 4ND3A 2HJRA 4H2DA 3WICA 3SYKA 5BSKA 3U3XA 3RS9A 4N47A 3ID6C 2XNHA 2V6JA 4DL9A 1X9HA 2IFTA 1OXTA 2XCOA 4LYYA 2EFEB 3NTUA 1N6PA 3BQNB 3G2LA 1ZGHA 2A33A 1PWYE 4L78A 4ENRA 3LO8A 4N3NA 1ONPA 1QORA 4O6VA 2FX3A 2C42A 1M6VA 3IB6A 4KRYA 3IV9A 2ZUWA 4JI5B 4ZCRA 4CKWB 4OGLA 3VR2A 5JQGF 3X43A 2PSJA 3QQ5A 3VTKA 3PHGA 1MJFA 3MTAA 5F5LA 2H1WA 2HU8A 1H6DA 4F0JA 4OU4A 4KHZA 3S2EA 5T4HA 3I2KA 3PQ6A 4I4CA 4FDUA 4UOQA 2Q6KA 2JIBA 5TIIA 3B38A 3BDIA 3QVUA 2WFLB 4DNQA 2O8CA 1EVKA 3W6PA 3OIYA 5E3IA 2A5DA 2GD1O 3VHQA 2OHFA 2BFPA 2V6FA 4L15A 5JSUA 1TF5A 1DV1A 1QHNA 3AONB 4G0VA 5CK4A 4A8TA 4II7A 4EYSA 3R8CA 1PR3A 3DL0A 5CJPA 5CB8A 4RDXA 1WCIB 4W63A 2NXEA 5TEVA 1RXCA 5JTUA 5J4HA 1T2NA 3O6VA 1U8EA 1UPBA 4XZ3A 1SBNE 2UVPA 1MN6A 1VPTA 2PQMA 1VKOA 2QQEA 3CIFA 3AB3A 3COPA 3EXHB 5GIPE 1OWLA 4QU5A 1C1DB 1SUDA 2FSSA 3O2JA 3PQ8A 5EINA 4AQ7A 3DVAB 4Y1RA 5CFNA 1AZLA 3P71T 5EYPA 1XI2A 4EJ6A 2R8EA 2O1SA 5KNBH 3GJZA 5AVJA 3LQ1A 1E5LA 3P0EA 1FFHA 3GLFA 1B73A 3IAM6 4HGZA 1K5PA 2O5CA 1OLUA 3TQCA 2BFDB 1S1CA 1Y8CA 5D7NA 4BVJA 2V7BA 4DMHA 3MCTA 4XGNA 1X9IA 1QZTA 1E92A 3GUUA 1QUFA 4R0NA 2PFSA 3DFZA 1XMJA 1JQBA 2B3TA 3HGQA 4QUAA 2OCAA 2EKZA 4RK1A 2B0JA 2GF2A 3GIWA 4OYRA 1E18A 3RYIB 5K0CA 3WLJA 5KVQA 2HDHA 3FTCA 2Z5GA 3FZQA 1NXXA 5CB4F 5EIEA 1FQJA 3EXAA 4TLMB 1RXWA 2IF0A 1FFAA 2I7TA 4RO0A 4WY8A 3ZJUA 1K4YA 4NRDA 3RC7A 5LWHA 4Z7NB 2D13A 4GLJA 1C1HA 5GY7A 3ICEA 3PWSA 1MXHA 3ADPA 3PHHA 4PCVA 2GZHA 3WMFA 4JU8A 3IOCA 3KB6A 3VNBA 2J3IA 4DM3A 4ER6A 1U7PA 1CJMA 5NULA 3T9DA 1MVOA 2NXJA 3BIJA 4I9UA 4AP6A 3S27A 1QGUA 1VCNA 2VDNB 4QHTA 4Q3BA 3TKLA 2AK2A 3M9LA 4ZTBA 5AQ1A 3C7AA 1BHO1 5GJCA 1IOZA 1Z0SA 3IT1A 4O2BB 2RGAA 3AJRA 4IUCS 5E3JA 5CVJA 4B8YA 3DYIA 4KSYA 1CUVA 1XKTA 2P3QA 3QWFA 4L02A 5HCIA 1T9ZA 2ZRCA 2O57A 5AKIA 1O8BA 5IJ9A 3CZ9A 4KXXA 5TC4A 1P45A 3PD0A 5TX7A 4MR9B 4UVHA 5AK6A 4KWTA 2JFYA 1IQ0A 4V0OA 1F1BA 4L4XA 3AOGA 2BHNA 2IHZA 5HOQA 3W6NA 4EF4A 4GI7A 1IK6A 1WNTA 4MQEB 2YJGA 2N3ZA 4NCNA 4D8VA 1PKEA 4AZWA 3OQ1A 1CDEA 1RM0A 3Q7PA 1H9BA 5H68A 3JD0A 3USZA 4YJHA 4NNPA 3GFPA 2HMSA 1XRJA 1IXKA 2A9KA 3F2IA 3HEAA 2W6CX 3RVMA 3TDMA 3U3MA 2XOXA 5CDUA 1NJ1A 4TSFA 3T5GA 1GTG1 1G16A 1OC4A 2GEUA 2J48A 2QN6A 2PMKA 4HB2A 2ZK7A 3IH5A 2W43A 4AL4A 1H0RA 3LQQA 4CGZA 2VYND 1FEZA 3R0VA 3QK7A 2G8NA 1H4QA 1CUEA 2FKNA 4BQRA 1YHNA 4K9PA 1JXQA 4OHBA 2V6BA 1IMJA 2QW0X 3SE7A 3SM9A 4HL6A 3LYHA 1FYFA 1V25A 4Q9DA 5JW6A 1QIMA 2AE2A 2VK4A 2PAAA 1L5VA 1YR7A 2NV6A 2VNSA 2VP9A 1SZDA 1CJKC 4KYUA 3BD6A 4HVAA 4HR7A 3C8ZA 4FHEA 4MS3A 3E5HA 3IQHX 2PX0A 4OOEA 1XQ1A 3AINA 5D84A 4B7ZA 2JJ2A 2PEYA 4Y2GA 4D4IA 4U1RA 3LPNA 5C7YA 3LQ2A 3DMHA 5FPKA 3L0DA 2ILTA 4MJ7A 3UUEA 3MBIA 2F3SA 2NSDA 1E2IA 4IJMA 5MN5A 3TRFA 5AJUA 3E9EA 3HKBA 4W6ZA 1T3SA 4KQCA 4BQQA 4I5EA 2PL5A 1RYBA 3ICOA 4MEAA 4G5FA 1RXYA 3TD9A 4WAUA 1UFRA 4QEDA 4TXJA 1KKLA 2BGTA 1OBOA 2JFPA 1Q7BA 1P73A 3B20A 2CXUA 3G88A 3O47A 4WKBA 4DV2B 4FGZA 1I7SB 1J23A 1EFPB 3T1TA 3RTCA 1FA9A 1YBHA 1HDCA 5KWEA 5JJLA 1N2OA 2WTXA 1EE2A 2ZAGA 1GVHA 3N0VA 3RFUA 4YMTA 3VPFA 1FY2A 1FSZA 2RHMA 3WIVA 2VDKB 3BF8A 1ZD9A 2DPMA 2HBYA 3K8YA 1TU4A 5JPDA 3JQ7A 1QXSA 5CB4B 1EESA 2PMEA 5D85A 3EFHA 3BAZA 1SK8A 3OP4A 4FCWA 4JVOA 4PLZA 4LRQA 3H0KA 2ZSIA 4M1ZA 4C5AA 3IAHA 2CLKB 4NG5A 1OASA 3OJLA 1TECE 2WIBA 1DG3A 3JQCA 3KIPA 5EWJB 3WLAA 4BO7A 1BHJA 2HSDA 3HJCA 1QAQA 4NCBA 3GLHB 1NU6A 1W9MA 3FRHA 2H1HA 3R5KA 1G8MA 5PNTA 2VBGA 2AR7A 2FW0A 3ZUGA 2GLUA 5IYZA 3ZWAA 3G0OA 3GFVA 2P69A 4X90A 1IATA 3B7PA 1XJWA 3B3QA 3SIWA 3T7TA 4QUIA 3ZHZA 3KZXA 2VH2A 4RSMA 2P1DA 1PWXA 2P35A 4PEVA 4RK6A 5CDTA 4IILA 4UTZA 4G1EB 1GPMA 1YI0A 1T1RA 4LQ4A 4I1PA 4AX4A 3QNWA 2QD4A 4A0QA 1VJ5A 2QXTA 2VYFA 1E2EA 3DVSX 3ZKWA 5I8PA 2Q6IA 1CEYA 2C9MA 2BFMA 1XJQA 1GL7A 5GONF 3JXEA 2VJKA 1XVVA 4JBNA 4XYGA 4E3WA 4F1KA 1KP9A 3RR2A 3PT5A 4YYEA 3GNQA 4PWZA 3RADC 4W7IA 3ZOKA 3I61A 5DW3A 2O0LA 4AECA 3PU6A 3QEOA 4D9JA 1Z4JA 1AUOA 3HNRA 2GQ0A 1M73E 4RM3A 4YQYA 1M2NA 1STOA 4W7SA 3VO8A 1MIHA 1UC9A 2XLCA 1C41A 1MEEA 5IM5A 4BE9A 5K3FA 3FTDA 1ZXBA 3KYCA 4ENVA 1ZH0A 2POCA 2OC4A 2QRHA 4KKXB 2GEKA 4Q4AA 4C4TA 4U9UA 1JVNA 1UJCA 1XK7A 3B1ZA 3NH6A 1U8XX 4KXUA 5CD1A 4ZOQI 3HR8A 4FGLA 3HPQA 4MARA 3FSJX 4MQEA 4UC0A 3HZZA 5KOYA 1QH1B 3C7CB 5B1SA 5ALHA 3I6IA 3N7UA 1MH9A 2I66A 4U00A 2DY0A 4B75A 1RWPA 2EGUA 3EXFA 3EZNA 3HKEB 3I9FA 5JPIA 4FDAA 4ZV4A 3U4GA 4BV8A 1A5ZA 4WCFA 2VI5A 4URZR 2RHRA 3IBSA 4GYYA 2D7DA 2Q8PA 2XCTB 5JCPA 3WLLA 1NZJA 1T0HB 2JVJA 4HX2A 4JQZA 3WHLA 4E1BA 3KETA 2UXBB 2X2FA 1XZ8A 2X40A 4MPTA 3IO3A 4WA8A 4PLFA 1QKJA 2H4WA 2ZJ1A 4N5MA 1GPAA 3CN7A 2PUDA 4DM4A 2ODTX 1KPIA 4D98A 3WP1B 2NPOA 2XLBA 3Q0EA 1MW9X 4MGIR 5CH3A 1GGHA 2JI7A 5E7IA 5C3UA 2DLNA 2JLZA 1A9SA 5FFMA 3TYXA 1Z68A 3RSOA 5BWOA 4BLVA 1T6XA 1Q2UA 3VU9A 3W8NA 5HGJA 1XUOA 2X76A 4LGCA 4LRTB 2WKWA 2HK7A 2Q5OA 1EVEA 1ZNQO 4ZA2A 5BMOA 3HHPA 1KJ9A 3SS9X 1EUYA 3K3PA 5H83A 1G5HA 1DXYA 3FNRA 1QRTA 1RRGA 4RSHA 2WHXA 3GJ3A 4AN4A 4BNIA 4JLWA 5LQKA 3D4IA 2OFWA 4OAQA 4LRXA 3LE8A 5K6RA 2QQFA 3V8EA 2QR5A 2XAUA 3F3SA 2XZOA 4PSAA 4DZTA 1PFYA 3D3NA 4YCBA 2GTHA 2IHYA 2PCLA 3RVRA 5KYUB 3RRZA 3LPLA 1OFUA 3MLEA 3PR3A 2FB9A 2Y71A 3IDQA 1DE0A 1E6WA 2B83A 2HK9A 4E2ZA 4MUEA 1P4AA 2NZVG 1CX9B 4YQZA 4UM7A 3I6MA 1BNCA 1LI7A 2JRLA 1VCOA 1VLQA 3QOXA 5KYXA 3OLZA 1POWA 2HWXA 3LPDA 5CX4A 5LMUB 2AKEA 3BL5A 3FGZA 3KG2A 4GICA 4MV6A 1AXGA 1OH5A 3BK7A 5CFZA 1P5RA 3Q85A 4WK2B 3PX3A 5IK2A 4DQKA 1RHMA 1G8KA 3ZWCA 3NPMA 2JBAB 2IE8A 4JLBA 2HF2A 4L2IB 4ZVQA 2O2CA 4XOUA 2QZPA 1I2AA 3L6CA 2YHBA 3PNQA 3WDLA 2IYTA 4ARAA 2UYYA 1WMBA 3JASB 3AERB 2Q9BA 2IP4A 3TQHA 4BMVA 2VTKA 5IT9A 4AS1A 1HLPA 3G1TA 1SXJA 4G36A 4PZDA 2FMKA 2P6NA 5LZ4A 4X1IB 2WJZB 1M3SA 3OMLA 5KMGB 1ZVVA 3ZZUA 2FFAA 2YZ2A 1Q11A 3CUUA 5BQXA 1JZSA 1LS1A 4Q1VA 2H0AA 1EFRD 3QU4A 4WUTA 2CBGA 3RK1A 4NJEB 1W581 3ZIUA 4G5SA 4B3RB 4E11A 3RM3A 1F8YA 2V58A 3H4VA 2XMGA 3G8CA 4IJQA 5CYFA 5DN6A 1JJIA 2TMDA 2JKYA 5KOJA 1RWKA 1NULA 1PFUA 2GD0A 1E4EA 1ISGA 3H2IA 1TF7A 3MQ2A 1LPMA 4LF9B 4BEBA 3ED5A 4WW0A 3QOFA 5KKCA 4K26A 1U1CA 4J3JA 1AKMA 4R2XA 4FNOA 2B1IA 1R15A 1JDVA 2LE0A 3PUYA 3GVPA 3GW8A 5EGNA 4C4AA 3CRVA 1ULAA 4YLYA 2CSXA 4FR2A 1WPQA 3TOSA 2F8LA 1GP2A 2H2HA 2IZOA 2K6GA 2X9VA 4JR0A 4UPEA 2AC4A 3C1AA 2GA9A 2QA5A 3VUEA 1LDGA 3EF1A 3H83A 4LHZA 2IZ0A 2NVOA 4R6XA 5H7XA 5A7GA 4C7XA 5KSWB 2CDNA 2SCUA 3TZHA 1WCWA 4UNNA 1E9SA 4F60A 1KWKA 1NNLA 2V7XA 4ZAXA 1HLDA 5FBLB 5IXSA 4DR6B 4I5IA 2BHRA 4RTJA 1QHSA 2EHDA 3PUXA 2YWDA 1J8YF 2IHVA 5CNIA 2WUEA 4Q6BA 4BFTA 3RLFA 2A7QA 2ZWIA 1A9QA 5ALUA 5EZQA 2YYZA 3E61A 2WU8A 1IBKB 1BEUB 3LVBA 1QVZA 5LDDC 1R9GA 4LFAB 1P9OA 1RWXA 4JHLA 3SY8A 1FX0A 3CLTD 1ESEA 3GJRA 4BZWA 3NI2A 3OZDA 2PJUA 4AJOA 5BSWA 3FGOA 3RUHA 1MV5A 3C7DB 2DZDA 4GI1A 4KVGA 4C0QC 4DIFA 3IDAA 4GPIB 3IUPA 3JZFA 4YR9A 1JHZA 1MQ9A 1KVRA 3CF2A 1ECCA 1HC7A 3NDRA 4U02A 5A71A 3AU8A 4JV5B 2OENG 5ELLA 2YJZA 4LXTA 1UPCA 4H1HA 3AX6A 2I29A 2GM4A 3IBCA 1E2DA 3SQWA 1AZWA 1JFTA 3G85A 4CE6A 1VE6A 1DJQA 1U0EA 3V7NA 4HFJA 4UDNA 2ZBPA 3L0ZA 3HNPA 2V45A 4YRGA 5C53B 4LHWA 4RY9A 1B14A 4WFIA 3D4LA 4KLAA 1ECPA 1NW6A 2C2OA 2VDQB 3CRQA 5IT5A 3A4YA 3GAMA 4AD8A 3AOEA 2W98A 4ZZIA 3NATA 3WLTA 4TKUA 2I1QA 2AMFA 1X1QA 2QN9A 4MDFA 5HW0A 1IN6A 3NM4A 2X1MA 4FR0A 4G0XA 4BNHA 1Y1TA 1M1UA 3NXSA 3PZBA 4HP8A 5SZIA 3SR4A 2WJ6A 4QWMA 4H77A 4Y2YA 1OD6A 3UT0A 2OR3A 4ZAWA 4E5KA 3OFJA 1N0WA 2E9SA 2R66A 2VUSA 1DAMA 4W7HA 3WRYA 3C6YA 1IBCA 1KK1A 2H51A 2W58A 2Y0BA 1JHUA 1HGXA 4GLFA 3NGXA 4GSKA 1MTZA 5EIAA 4L3WA 3PX2A 4QPDA 3ZH2A 1FVXA 1M6EX 2BZGA 4IH4A 1XEWX 2VSXA 1R4AA 3BRWA 2EARA 3NT5A 4LI3X 4AS3A 4YV0A 4BNVA 3SHVA 3SFTA 4V0MA 3HDVA 1C1XA 1YCDA 2PSDA 2RKBA 2AYZA 3RAPR 2C9DA 3KFLA 3R6GA 4GXNA 4YV7A 4D0LB 4EFDA 4O2RA 4GF5A 3TJZA 3DO5A 1QIDA 1YULA 1JILA 4DC0A 1XXHE 3TIVA 1QU3A 2WU4A 4OX9Y 4OQDA 3BA1A 2EX4A 5IN5A 3E7FA 3TZEA 4BP3A 2FSFA 4D0GA 4DQUA 2V1UA 4U7JA 3FJYA 1OPRA 4FZRA 3FHCB 3VSEA 4X62B 3PGKA 1I13A 1AS2A 1A1SA 1FDRA 1N5KA 3GRYA 5EZ5A 3DTNA 1MVLA 4IHJF 1HDZA 2IP2A 2Z2YA 3KK0A 1FOEB 1UMCB 4MITA 2KWIA 2ERCA 4GBJA 2PMDA 2ZSBA 2F9MA 2YXLA 3SF8B 1JEAA 1PFVA 5C8VA 5AVWA 2QTRA 3OOWA 4LJLA 1JIVA 1F6DA 4Q3EA 4R69A 1NUAA 1OI3A 3RO7A 4YRIA 3GOHA 2Q3MA 5ER9A 4ZO4A 5JRDS 1Z12A 1WSDA 1RZRD 2G8LA 2P0AA 2ZULA 4H0FA 1C5KA 3ZZTA 1I1OA 4C0HA 3AG5A 1FL9A 2CCJA 2ZUDA 4DYDA 3ZWNA 1PV2A 3INNA 4BXOA 3CNEA 3STWA 2GUWA 4IRXA 1J5PA 3T3EA 3B6EA 2NNWB 4D9GA 3F9CA 1V5FA 4XR4A 1YK1A 1A98A 3ZCPA 1U99A 2IPNA 5KQGA 3A3NA 3RU3A 1ZMRA 3H9GA 2D7JA 2O2JA 2W2OA 4TMTA 4ZO6A 4HY3A 3D3JA 3K15A 4E32A 1Y8QA 3EBOA 4QDTA 4BHTA 1Y4AE 1ZW1A 3T52A 2FP4B 5E6UA 4GC9A 4NHOA 3T7SA 3HYLA 4G26A 4EUEA 3K0CC 5ALZA 3FLEA 3L40A 2CL7X 4D3XA 3ESBA 3O3OB 3EEIA 5CBPA 4XDYA 2O05A 2DVMA 3BDVA 4YAWA 1P5JA 3Q7QA 4R2WA 1W6RA 2QG6A 4RAOA 3W8RA 4BFXA 1J4AA 3EX7C 3BERA 3D3WB 4ZC1A 4WUVA 5HKAA 5HKKD 2A92A 1YS6A 1XTRA 4Q9JA 1DKMA 3GGSA 2XNCA 4O1MA 1JHMA 3G82C 2Y0EA 3E35A 3I6ZA 4MUBA 1A8QA 4OUDA 4R81A 3KLMX 2FR0A 4CMBA 4RE6A 1B0ZA 2O2HA 2X0JA 1W59A 3P9SA 3AEQB 4A5SA 4RFVA 3T9EA 2I71A 3QQPA 1BFUA 4I5DA 3V32A 5C51B 3DBIA 3K9FC 4C14A 1PZGA 3O9ZA 4MB2A 1ZZGA 1WCYA 4IICA 1YU9A 2ZJ5A 4KMMA 5FUVA 2JH3A 1SC3A 3RFXA 4CGYA 2FE4A 1NZFA 2JB9A 2FDXA 1KDVA 3T94A 1UQRA 3N0RA 2X14A 2C3PA 4BMNA 3LRXA 2BDEA 5TQVA 2HGZA 3PNKA 4MGZR 5LC1A 3ZDXB 3AL0C 4X92A 3I45A 1HE5A 4PY2A 4KLCA 4HJXA 1Y0BA 2C1EA 2DSTA 2QVGA 4N0QA 3DEHA 4RZ2A 1PL0A 2EFHB 4UQPA 4ZGGA 2J9GA 1QVWA 1NHWA 2D00A 3VJMA 1MAUA 4HVTA 2WD7A 4R0VA 3V9PA 1K7SN 2ATCA 3BKWA 2WI8A 2OZKA 5DNUA 5JFOA 3QBTA 4KBGA 2UZ4A 1WLYA 1H0SA 4YAUA 2ANBA 3ER6A 2VJCA 1WTCA 1KZ4A 2QX6A 1PV1A 4L2IA 4R8VA 4TL7A 2PU5A 4UXIA 4YJ2B 1CFJA 2FRDC 2G5CA 4QSHA 1NHGA 3N2LA 1IZZA 4GL4A 3RAGA 1VRCA 1ZIYA 2ZS7A 3MHTA 2ZRQA 3UOWA 5C1BA 3KQSA 2IYPA 3M8KA 1T4DA 4JZKA 1WBDA 1T36A 3VHXA 2H9AA 3CMMA 1KEZA 2FN7A 2H9IA 4RKRA 1GAEO 3MWLA 1IHUA 3P94A 1VKHA 4IDAA 2XWBF 2PL3A 4LWQA 3X0DA 4N5NA 5FWYA 4YAFA 4QARA 4CTJA 4H35A 4TLCA 2BEVA 2CJPA 2ZFUA 4H7DA 3DYBA 3HGMA 4MIYA 4GVLA 2BEWB 2O5RA 4X63A 1X7GA 2JCBA 3GJXC 5DX8A 2ZG6A 4E1VA 4WZZA 5BWNA 4KE9A 4L4SA 1CERA 3U81A 2ISCA 4DJJA 1VGRA 5JAQA 2RHCA 3PXCX 2WJPA 3Q9SA 5JRZA 3NHUA 4CF6A 2D06A 2WFAA 4LDNA 5LP6B 1KGDA 4IH9A 5I9SA 1Z6QA 4BGEA 2QAIA 4F93B 3JQEA 4BCDA 1GU0A 1XVLA 4MV1A 1WM1A 3DFFA 5EJFA 1A9OA 1Y7PA 2I6FA 4R8MA 3U80A 4A8JA 4F8JA 4EHDA 4Q0MA 1O97D 2IYSA 1Z74A 2IYFA 5J2TB 2EX1A 1QK4A 4J0HA 1RWBA 4UMFA 2R7MA 3R0IA 3QSYA 3FRIA 2YN4A 3GPIA 3IULA 3OG9A 1OT5A 1VLMA 3E58A 4QUHA 3A1FA 1A7JA 3OT1A 1Q0RA 3BJIC 3H5NA 3JZMA 4XQ0A 3RANA 1U3WA 2ONZA 3W04A 3MJFA 4CT4B 10MHA 4PC1A 4CM3A 2I55A 2AKYA 4JAVC 3Q8LA 2ZE7A 3F73A 4BNFA 5M34A 1Z7WA 5JCJD 3RNLA 2V7QA 2G0AA 4F71A 4CCSA 3PRKE 2QL9A 3WIBA 2VDOB 3JATA 4FI3F 3BIWA 4JC8A 2O6LA 2W2XA 4GHWA 3R75A 2ZZNA 3PR2B 1KA9H 4EX7A 2ORIA 3I34X 4PICA 1LLQA 5CIYA 4RTPA 1SMKA 1J2YA 3OOEA 3S8YA 5AK4A 1HURA 1X39A 1S2LA 1RDFA 3PIRA 2ZBRA 4WT7A 3E05A 2VZ9A 5H16A 2IPXA 4EH1A 1WXDA 1R18A 1Z39A 1RXVA 2BEWA 2C5BA 4N8EA 2IHKA 4ZVLA 3N76A 4FSDA 4KI0A 1Z6PA 1MQAA 1X1TA 2DFPA 1D0SA 2QL5A 3OQJA 5HILA 3QUBA 3PCTA 3ISVA 2CEKA 2CHQA 1XMIA 2ZZKA 3KBOA 5IVDA 4MK4A 2RK6A 4DNOA 2H5IA 1JF8A 1ZD1A 2QWXA 2QMEA 2QRLA 2VFAA 1AT1A 3FVWA 3I1FA 4UBIA 1D2RA 2ENUA 2XCQA 3GEBA 3KT3A 1MABB 3VYUB 1BW9B 1TM5E 4MGKR 2BZSA 1ZJZA 4FWBA 4I4TF 2Y4OA 1PAUA 2WD9A 3D0RA 1M7BA 2C3YA 4ENTA 2E89A 4KVZA 3TCXB 1BWQA 1G21A 1DO8A 1V3QE 1EK0A 4HXFB 1FK8A 3RSFA 2VF2A 2WPDA 4HWRA 3FF1A 5J47A 2FOIA 4CU2A 3LP6A 3OKPA 3VDXA 4QUGA 1N1GA 4GPZA 3S2IA 1UWKA 4DKXA 4GSLA 4OY3A 3VR4D 2HBZA 2OAQ1 4MSUA 4Z8YA 2AOXA 4QQNA 3WHKA 1CR6A 1RBQA 4DA9A 5G41A 1ESMA 1ISRA 3KHSA 4EHHA 1D04A 5FYQA 1VECA 4M8NE 4RY0A 2EEPA 1LRLA 1AUQA 5J3JA 5BW8A 1WU8A 4HLDA 2VYCA 2QU7A 3LKVA 1IUNA 1H2HA 2FWMX 1U3DA 3SVZA 5C5IA 2ID7A 2EL7A 3NASA 5DBOA 4ZMRA 5DU2A 1EM8B 1OW3B 3SZLA 2CVHA 3KVRA 3ZD9A 1KYIA 3DBLB 3KKZA 3PXDA 5LZ8A 2PUBA 1BA2A 5JVDB 1YBFA 2X13A 1YFKA 3L6OO 1J39A 1CUUA 1FRFS 1TK3A 3PQEA 3ZXYA 4EM6A 3C48A 1FTSA 2YR0A 1PIWA 3GUVA 4BRWA 1EAYA 2CV2A 2GBIA 1Z34A 1XDGA 2H4YA 1IM8A 2NU7A 1CD5A 1MC4A 2B8EA 2WA2A 2IYRA 3HKBB 3OPYB 3KQLA 3CH6A 2DQKA 3AUKA 2GM3A 4K6OA 2AT1A 3KO8A 4XCXA 3DQPA 5CBPB 1SCAA 3KR1A 2AJ8A 4N0DA 4O3FA 2WIAA 4NCKA 5ALDA 4UBNA 1GU1A 5ESRA 3EA5A 3WYFA 2VAPA 4TTAA 4ZXPA 4K9LA 3BXHA 3C4VA 5BUSA 3VR6D 5FNVA 4UD6A 1E20A 2PTHA 4AYXA 1NR7A 4OQEA 1A9PA 1BQ4A 3S55A 1PNQA 4ZU6X 2VZLA 3QELB 2DFDA 1UBOS 5KWVA 4BGIA 1UP7A 3A6GA 1KP3A 1T91A 4U7PB 3KPYA 2EKDA 5BYKA 1QJCA 5A3SA 5EHQA 3FTEA 3C1OA 5ERYA 5H0IA 3PFBA 1BDHA 2OCKA 4RSRA 4WBSA 3T7KA 4WOPA 1DXQA 2UUAB 1M2FA 1WDTA 4XDGA 3K73O 1ORTA 3MGKA 1KZ7B 1BDBA 4EMBA 3ACBA 1WF6A 1KMHA 3TBHA 3TNLA 1XTKA 3DC2A 1PS0A 2O8DA 3OU2A 3JR3A 5EJGA 2FPWA 3R7AA 1X8JA 1KZ9A 3CINA 1TQ6A 4FR5A 3AR4A 4LZJA 3VJKA 2V0GA 1Y3CE 3HE3A 1A27A 3EN0A 2FSVC 2R96A 3IHLA 4JJGA 3RVQA 3RU7A 4Z0HO 1Q15A 5EJ7A 2PX4A 3WWPA 2X5JO 1X1CA 1Z0DA 3UH1A 3TQFA 3CSUA 2HIAA 5DNEA 2YY6A 4M87A 5DSXA 1EDBA 3H1TA 3IB3A 3AHHA 1XZHA 2AWOA 3R3UA 5H81A 3SOPA 1S2IA 1FLAA 3JYOA 4LKRA 2LCIA 4LE0A 5JJCA 4NJOA 4EQ6A 4BZQA 2WEKA 3QE3A 4PAGA 2H5EA 5LYJB 2PX2A 3KU4A 3RYCB 5E4YA 4KSCA 4RPJA 4D80A 2A6PA 1Z2AA 2OSBA 1YS4A 2ZVQX 2HWWA 4BDSA 5JNVA 2ZRPA 1LX6A 4FJ2A 1H4SA 2XB4A 2VHTA 3AR9A 5K4HA 2HDOA 2JFUA 4CQMD 8ADHA 4IAOA 3AB8A 2IYVA 3EGDB 4GP9A 5EQDA 3GLIB 1DEAA 3RRXA 1HWYA 2E85A 1DQYA 3V4PB 2WJAA 6NULA 1QHHA 2HW8A 1GGVA 1N77A 1RQ2A 1W5FA 3FYHA 4NMMA 2BF4A 2P4QA 4FYKA 2VP4A 5ESDA 3KDAA 4C08A 2ZRAA 2J5RA 4O4JB 5P8WA 1FLVA 2ZB2A 1KRHA 2NADA 3HBJA 4PLCA 4PLVA 4EVSA 2VTBA 4BS9A 2H1FA 4WBNB 4UHCA 3TNYA 1D8AA 1G20A 2RAVA 1U0GA 4FFPA 2VCYA 3UENA 3VZPA 4JASB 2ID8A 4Q6WA 2CLCX 2CUTA 4EW1A 4K03A 1XVTA 5ARBA 1TF2A 3GCDA 2CXXA 4Z9YA 5MDHA 3RAJA 3OM8A 5ALRA 1USIA 3RHTA 1CU1A 2CBZA 4HMPA 2BFDA 1XMVA 1OLUB 2R6CA 2V6IA 4O5OA 3L7MA 1B6TA 3LUKA 2NU6A 3PSHA 2BUCA 2C99A 3PEUA 3W2EA 3W2TA 3E1SA 4R2HA 4RPLA 1QH8B 2GJ4A 4FKBA 4M89A 3TSOA 1GUZA 5LM3A 1RTTA 4Q9NA 2P65A 4LDRA 2V7UA 1EFCA 2AFHA 3EAGA 3WK9A 2C07A 4AG6A 2HT1A 1LBTA 2ZITA 2OFPA 4XOIA 4BQIA 5BOSA 1QV6A 3N8NA 3QFRA 2QJOA 2BIFA 2I7XA 3WL7A 1I32A 1OGIA 1VIMA 1PBTA 3GFGA 1C14A 2HIMA 2PV0A 4G5OA 4Y2QA 3RRJA 4HNRA 4B5LA 1VI5A 3M6WA 4YGYA 4K88A 4KTVE 4YCSA 1GFIA 1HL7A 4JUAA 3ZX4A 4CF4A 5HFAA 3ZW9A 5AIBA 4W99A 1OILA 3LYLA 1NFRA 1PGNA 1N6KA 2WSSA 4CM4A 2FXVA 3BT7A 4E4TA 4GE3A 4HDMA 5AKKA 3GJ5A 2B3DA 5HE9A 2FEPA 5D3ZA 5BV8A 5KVSA 1Z0IA 3L7BA 2VHJA 4LN1A 3ZDZB 3G9UA 3WB1A 4WN9A 5C8XA 1KVQA 1O6GA 2VDUE 4FUQA 3ZU3A 4JY7A 2WP0A 5FORA 4QXOA 3MAGA 5AHKA 1ZX1A 3RODA 1MV8A 5JEDA 4KHPB 4ZZ1A 1Z5GA 3D4OA 2NU9B 4AKHA 2FYTA 1SVIA 3I0ZA 2ORWA 4PYLA 4WN9B 5FR1A 3ESZA 3EA4A 1LDEA 4PG6A 4E6EA 4GOJA 3IRUA 2F1RA 5G4LA 3H5TA 3MHPA 1J8DA 1ZD5A 2VQ6A 2ZJ7A 4KNWA 1YZLA 3L1IA 4RXMA 2GSWA 4P32A 5ICFA 4Z2YA 1U80A 5K03A 9MHTA 5TGTA 4IHAA 3T4EA 5JADA 4L8YA 1JYFA 4ZOLA 3BTUA 1BE1A 1NM5C 2PVPA 1JHVA 3DZCA 3EYAA 3P0RA 5EP1A 2G72A 4GZ5A 4LNUB 4DV1B 4ILKA 1KO8A 1HL3A 3QX8A 3GMTA 4CM5A 4DCJA 1RHRA 1S3FA 1C8LA 4F4FA 2I6SA 5GINE 3TIIA 2W48A 3NTRA 4YXWA 1DHRA 1E1LA 2D1SA 3PGLA 3SI7A 1E2MA 4E5NA 2CXOA 1M1NB 2BCJQ 4X1IA 3AKYA 3GEGA 1JSXA 1MGOA 5A02A 1Z83A 2BDUA 2WJVA 4PHCA 2YWHA 4NYMQ 2HF7A 2R87A 3AERA 3K1YA 5T7BA 2B2CA 2H48A 4B84A 5CLJA 2DT8A 3V4VB 1VPWA 2DC1A 4TPKA 1PBNA 2L42A 5SYMA 4YUYA 3AHDA 3L02A 3UZUA 2FFQA 1HNNA 3THWA 3RTEA 4IYRA 3AEKB 2IEIA 5EKTA 3CLSD 1KTIA 1F2TB 3MINB 4C01A 4DFDA 5HOEA 2AMYA 2AWNA 3JAKB 3H86A 1FB5A 2J32A 2P2NA 2CXSA 1G20B 3T41A 4E46A 3E18A 3M1YA 2QXUA 3LT1A 1YAHA 1RW4A 2J3JA 1UQUA 1ZOSA 1D4ZA 2Z2IA 3JQBC 4WBNF 3O1HB 4WK6A 4B6PA 1CNMA 2MYUA 2OGZA 3HHEA 1CYEA 2MCFA 3FWPA 4AMUA 3ZOZA 1FUUA 2BH2A 4G01B 2B4AA 1D07A 1JLKA 1N2IA 1SUFA 4HCJA 3HV2A 1Y9JA 4IFEA 4R1PA 2YIJA 4CHGA 2DR0A 4IVRA 1MO4A 4H60A 3C8DA 2HLPA 3G7NA 3RVBA 4CMKA 1WV1A 1IN5A 2VN8A 2E5FA 4XSGA 4YUVA 3W3AH 2GD2A 1TTTA 4DA6A 4PC6A 4RHEA 5IBRA 2CHVA 2J6HA 2WVAA 1PX0A 3OICA 4J1TA 2EYUA 4PRKA 1QHFA 3KSDO 1VFPA 4XWKA 4NFSA 1WSWA 3ELDA 2G04A 1RHKA 2M1ZA 3IE0A 5JTTA 3TH5A 5IUNC 3T06B 4XR9A 3EPHA 4JT8A 5FLEX 1T2EA 3NCHA 2OHGA 1KJJA 1KK2A 4KQHA 1KC3A 5G4KB 2IPLA 4RA6A 1WUJS 5FULA 2JCGA 2JGLA 4IDHA 2P68A 2Q2VA 3DTYA 1SM4A 1W47A 2DHRA 2OAGA 1GEEA 1HE8B 2Q1WA 4JSTA 4P3XA 4WERA 4WOCA 3UXEA 2MYNA 5BMVF 1Z0UA 1K9VF 1BG6A 2BM1A 1TNDA 2P5UA 4OP2A 2AHRA 5LP6C 4AZVA 5CFOA 1ZN2A 4DV3B 2GJKA 4PYIA 4CLOA 3K1ZA 4AICA 1EB9A 1L5HB 1SXHA 5TVKA 3L8CA 3V5NA 1HLGA 1PQ4A 3A1WA 1OHHD 1TAHA 3WYGA 3Q7SA 5DNDA 5AMXA 2PJRA 3FYUA 1EK5A 2V0NA 1T3LA 4W1SA 5AKZA 3JQ9C 4I7EA 5LNK1 3GN1A 5IS2A 1MB0A 2F90A 4FC6A 1RLJA 2OB1A 3VSDA 1Y5RA 1GAJA 2ATEA 5DRTA 5AWFC 3TNJA 1YRQA 4ZALA 4QNRA 4H4DA 3UTCA 3W7AA 3ZTYA 1PNTA 1SZCA 2QORA 1R3DA 4B83A 5IEJA 4C6RA 4F97A 3AIKA 1QQTA 2C5GA 5D51S 4A6XA 1ZESA 3CEHA 3A05A 4NG4A 4MX8A 4OMFG 3ZVKA 1X9GA 4ICIA 2X4GA 1YQ9A 3ONVA 2XADA 3TEJA 3LU1A 4D8WA 3V33A 1E64A 4HX5A 3SXJA 2OO5C 5E7QA 4HUJA 1UKAA 3FYUC 4ZQHA 3UYLA 2Z2KA 3DM9B 4Y1GA 4NXMB 2WF5A 1N6RA 3L3BA 3NHWA 3CLKA 1HZZC 1GITA 3P9IA 4PXYA 2G25A 1OLOA 5IDYA 5JYDA 5LQDA 1MZVA 3HM2A 2FEKA 1R37A 1USUA 1GCUA 2OL4A 5J5VA 3HA5A 1Y1KE 4LDQA 1MA0A 5JS7A 3AIMA 1FVHA 4FFLA 3PITA 2CNWA 4WZ6A 2FF5A 3Q5GA 2BMVA 2YJ3A 3R7DA 4AYWA 4B7CA 3QMMA 5FYDA 4I4IA 3SICE 4CKEB 5HJ5A 1EUDA 5HBGA 3RKUA 4BE7B 3HBMA 5FOUA 1DBVO 4D1YA 2O8EB 1INLA 1O5OA 9LDBA 5JATA 4IHJA 3SEFA 4G65A 3AIIA 3KZOA 4DCMA 2XB2A 5B1EA 1GG2A 1IQRA 3L7AA 3QVGB 4U2BA 3W77A 2FJPA 3B78A 4K2HA 1IFXA 3HYNA 3DVQX 1P72A 1U4NA 2ZBUA 4D6PA 4WFKA 4UCFA 3V55A 4DLAA 2CJWA 3ZK9A 1A7KA 2OPHA 1H4VB 1E7WA 2I1WA 3DMFA 3HDJA 3MWEB 1E7MA 1OVGA 4B48A 4JROA 1JJAA 5D3KA 4YI5A 3Q11A 2ZRJA 3IR5A 1FNNA 2A9OA 3O31A 2ZKIA 3O4FA 1TO6A 3NGMA 4ZT7A 4ZD6A 1AF7A 1EWVA 5DB4A 3UQZA 4CUJA 3KVOA 3GDWA 3F6BX 3I64A 5AXCA 4C22A 1ZK3A 3T3DA 1ZGAA 3BSYA 3Q41A 1P0PA 3ZG6A 2RKOA 2MINB 1HTBA 1KKUA 1PZEA 3FPFA 3MMSA 3HABA 2CYCA 2IJGX 1Y37A 4UNSA 3DONA 4GLOA 1L1EA 1NN3A 3IT2A 5IKXA 3BQMB 1K6EA 1CUGA 3EWSA 3CSSA 4K6GA 2YZNA 1Y7TA 3OQHA 4DCTA 3AEXA 4R8KA 4WESA 4B3DA 1AIPA 4W82A 4RD2A 4Q3NA 4L4UA 1N6HA 1RQRA 2WTBA 4L6CA 1G7RA 4EKDA 1RJDA 5JZSA 1J70A 1E3WA 2QTMA 1S6YA 3RI3A 1E1QA 5KTYA 5GJBA 3DYVA 3FDZA 5IFKA 3W5DA 1EE9A 4MVCA 5JLAA 3BMNB 2IPAB 1EP9A 1EHYA 4M86A 1U2EA 1YL7A 4HDRA 3KLOA 4RK7A 4ZVMA 1AUVA 5E6RB 1L7XA 5ECWA 3FLAA 4DDVA 4POOA 3M6VA 2ZSAA 2VWPA 4AC9A 1ECFA 5ALXA 1DC7A 4J0IA 4BE4A 1U0FA 4ZO8A 2NT3A 4M7OA 4RHCA 1G8SA 4H1WA 1C9EA 1XNJA 1S3IA 1NBHA 4QIHA 2OILA 1FMCA 3K9QO 3P32A 4R05A 3S2GA 1R0KA 1YZKA 3ROMA 1RPTA 3K9GA 3DE4X 3DDCA 4E5UA 1KPHA 1R0BA 3NM6B 2EC5A 3PDUA 1NOIA 5FWAA 1TVKA 5E0OA 2WTEA 1E1MA 4ZHQB 4R41A 2I8AA 3UHAA 3RUCA 1HT0A 1ICEA 3I6QA 1YZUA 2QDKA 1EH5A 3CCFA 3ZCRA 4MVJP 3GD7A 4IV8A 2PMWB 4LVOA 2GPBA 5I7FA 1YMQA 4PX5A 3O8QA 5ITZA 4QXMA 1ZD4A 4H0CA 1OTHA 4C6SA 1JHPA 5SZJA 3Q3IA 1A7UA 1ES9A 2COKA 3MTQA 3OU7A 3FSRA 2NO4A 4IR7A 1CPYA 2O4CA 3I52A 3T7CA 3WL8A 4A0RA 5JROA 4BB0A 4LBYA 3SQMA 2Y27A 5ADWA 1Q7GA 1EE1A 3L0SA 2R4TA 4HQ0A 5FI5A 3U3KA 1ZA1A 3UATA 3HWX1 3JQAD 2VG8A 5K05A 3NG1A 2XOEA 4ISCA 2V98A 5ILOA 2CDBA 3IPAA 2BI4A 3H75A 4C05A 1BYUA 4C21A 1AE1A 5JBNA 4ANFA 1ST3A 1FPQA 4QPNA 3EQ9A 3SSAA 3NC1C 4Q1FA 3W2FA 3TLEA 3DDOA 2G9RA 5AD1A 2GI4A 5JPCA 2XIQA 3ZDYB 2C3MA 1E1CA 3ECAA 1K06A 2NTNA 3RSZA 3D4BA 2JGEA 3AUJB 4PG7A 3LIPA 2Q9AA 2R65A 3NONA 1YRLA 1K8YB 1UANA 2HI0A 4NL4H 4DJFC 3WKEA 2P8JA 5LCXA 3K9LA 1DAFA 3TXXA 4P3PA 4WKGA 4F45A 3FUCA 1IJFA 5D3MA 3PQDA 4AXBA 2ZYDA 5T5QA 3D7MA 4IVPA 2EZ9A 2XECA 3MWDA 4GBMA 2Q7OE 3AI1A 1XCOA 5JAOA 3A6JA 1GYPA 2Z58A 1OZAA 3AVPA 1S3SA 4YBRA 5BYJA 3T1YB 2NTEA 2PZGA 3OPMA 3L7IA 5TR9A 3PX7A