2PO7A

Crystal structure of human ferrochelatase mutant with his 341 replaced by cys
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
359
structure length
359
Chain Sequence
RKPKTGILMLNMGGPETLGDVHDFLLRLFLDQDLMTLPIQNKLAPFIAKRLTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDCIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Altered orientation of active site residues in variants of human ferrochelatase. Evidence for a hydrogen bond network involved in catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Ferrochelatase, mitochondrial
total genus 137
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2007-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2po7A02
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2po7A01
2HRCA 1LD3A 2Q3JA 2HK6A 2Q2NA 2PO7A 2HREA 2XWQA 3HCRA 2DJ5A 2H1WA 2XWPA 2C8JA 1QGOA 2XVXA 2QD2A 1HRKA 4MK4A 3HCPA 1C9EA 3GOQA 4KLRA 3W1WA 4CCSA 2XVZA 2XVYA 4KMMA 1LBQA 1TJNA 2QD4A 3HCNA 2JH3A 2PO5A 1L8XA 2QD1A 2AC2A 2Q2OA 2H1VA 1C1HA 3AQIA 3HCOA 3M4ZA 4F4DA 2XWSA 1DOZA 4KLCA 2QD5A 3LYHA 1N0IA 1AK1A 4KLAA 2PNJA 2AC4A 2QD3A
chains in the Genus database with same CATH superfamily
4PYLA 3M4YA 1G0NA 2QMUA 3F9CA 1T9ZA 2FRDC 2HUNA 3JQ9C 4AJNA 1UPBA 3I05A 5H82A 2CFRA 3TI9A 2E87A 3IAAA 3VVBA 2B3TA 2NTVA 1B23P 1D04A 3V7YA 3I1FA 5CJPA 2BVNA 3GFTA 4D44A 2CMKA 1NE2A 4PHTA 5IAEA 3E0XA 3QY0A 1RJFA 4RVGA 1U8YA 4OGGA 5BXYA 4ZU3A 3OJLA 2I7CA 4EY4A 4NYIR 2ZIZA 5KKNB 4G1BA 5DYTA 3P5BA 1ND6A 3DEAA 4X92A 4DWVA 1V1RB 4POAA 1YDHA 1JYSA 1Z83A 3OZGA 4JMLA 5D5PA 4C0QC 2A9OA 4QA9A 4D3ZA 1E5QA 2XQJA 3UIEA 1RYBA 1R4NB 3ECCA 2F1HA 4WN3A 2IWHA 1G3UA 5JS2A 1M54A 4OCZA 4QELA 3RTBA 3WK9A 2XUKA 2J3LA 4HDRA 2AB0A 1ACMA 1BHQ1 1QZXA 3SBXA 3WMWA 1F4LA 1RZUA 1ULSA 2WA1A 3DEYX 3LQ4A 1AN9A 3OM0A 4FMCF 1PUXA 1GAJA 3QEOA 4LK3A 1PSDA 4S0ZA 1YASA 2B6NA 4MYUA 3DMHA 5A4AA 1OR8A 1QCYA 3L7IA 5DNVA 4DDVA 3W5BA 3OO0A 4NYIQ 1E9VA 4C30A 2WUEA 1KYWA 3UWPA 1FRQA 3HFSA 4RDIA 1DX6A 4XGNA 4HPWA 5IZ4A 1F9AA 2AV6A 1KQPA 3CNHA 3GLQA 1WEHA 1FMCA 3N7TA 4TQUS 4X1YA 4AS3A 2R8ZA 2Q4TA 5JE8A 1XQWA 2I7TA 2SCUA 2IV2X 2DHCA 2ODAA 3DAOA 4UHJA 2AI2A 2C2YA 3STYA 2V5UA 1GCAA 3CV3A 2H2AA 2BHNA 2GD6A 1JR3A 1KQNA 2ZI5A 1AGXA 4GPTA 5EY5B 3BA1A 4WPGA 5I7RA 4GPEA 5AJXA 2PFKA 2X2OA 1ZXXA 3GGSA 4YPOA 1NDHA 4LQDA 1B76A 1U8ZA 2GPNA 3KEOA 4I4LA 2H4WA 4PONA 4I1IA 4EF5A 1YJCA 4GAEA 3LRTA 3QVKA 4LNHA 4DIOA 3FW1A 4P4SB 4IRUB 4PSVA 4U63A 3H6GA 3K4QA 4KVGA 3V34A 4R0VA 2DQ4A 2P2CA 3TTWA 1IBRA 3HKEA 5EZYA 2B8EA 4R1NA 2GDJA 4EJSB 2G80A 1SC9A 4FFLA 1HK7A 3L49A 4LEIA 1KE1A 3SZGA 4QASA 1MGOA 2Q5FA 3P4UA 5DI3B 4D3YA 1KI6A 4TWIA 1J49A 3IPCA 1KIAA 3N0RA 3QEMB 4R1OA 4DCTA 5KJCA 2V9ZA 1U1GA 4IVRA 2BP7B 2FFBA 1P7ZA 1XZJA 1UBKS 4LDNA 2RGUA 3PCTA 3EWIA 4HAZA 4O1MA 1I6KA 4EG8A 3DH0A 2QAGA 1IQ0A 3HWX1 4RAQA 1OZAA 4P5PA 4MA4A 4N3GA 5DBFA 3GFPA 4H6WA 1EIZA 4BKPA 2IXFA 1GRVA 3IT1A 1ZP6A 3C4VA 5JFOA 3F8TA 1WZCA 3FVTA 3IUMA 3RIGA 3VOAA 2O6HA 4WSOA 4YYEA 4JI0B 3MOIA 3PUHA 3MOSA 3SBDA 3F6PA 4MZXA 1MOZA 3D43A 5HK9A 2ONZA 1O95C 5JBNA 1X9HA 3QXHA 3MIIA 5GWXA 1VGRA 1XDGA 4NCHA 1SXIA 3Q15C 2GFIA 4D1YA 3OI7A 1ZAYA 1G5QA 2ZDQA 4MV8A 4PHHA 3V33A 3GCGA 1KQFA 1C7EA 4Z1MA 3R7WA 2JFOA 1FDVA 2PZLA 3GQBB 1LK0A 7ABPA 5KPJA 1COWA 3SDZA 2OGWA 3R77A 5FO1A 1NPYA 1ITZA 5H83A 4EBBA 3G0IA 4C4PA 1U6JA 4BFTA 4FFSA 1ODKA 3URMA 4QPCA 5IN5A 3O4IA 1WD5A 3CEHA 3MIZA 2O8BA 4ZK6A 4G2NA 3K96A 3IQGX 3EUWA 2JAHA 3MRTA 1K5PA 1CUSA 2GF0A 2HUPA 2O3RA 2RK6A 4NJEB 4R51A 5FBLB 3RR2A 2HX1A 4AMVA 4MZDA 3UT6A 3R9XB 2WK1A 2FEKA 3AKCA 4G8DA 4H6VA 1KEPA 2VDNB 3CTPA 4HJRA 1KQOA 1LX7A 4MITA 4YMUA 5J2TB 1KI7A 3KFLA 2YWEA 3VPAA 5K0ZA 2G1PA 3X2FA 4WZBE 4TLCA 3OA2A 1Q0PA 3OZTA 5IUJC 2AEJA 2IDMA 2WJGA 2HAEA 4CN9A 1N2CA 4EB6A 4DDUA 1QK5A 5I4IA 2QAGB 4E88A 5E2AA 2P5YA 3NUQA 1NXPA 4IZIA 5GIOE 4YRBA 3RVNA 4UZEA 3QEJA 2BE9A 3E27A 4U00A 2JRCA 4I1OA 3C3CA 4QUGA 3FFBA 3TQQA 1KOGA 1K68A 2ESRA 2ZIXB 4LOHA 5JYCA 1NRJB 2CHGA 3HLYA 2ZYIA 3MWEB 4OQYA 5EHNA 1R0YA 3LDHA 3UWSA 1JQKA 2HJVA 5CLIA 1SIWA 5FF9A 2VT7A 1P91A 4XGQA 3PQ8A 5I3CA 4AY2A 3G5LA 2Q0QA 3UQYS 1WXXA 1U9JA 3S2YA 5LOVB 2CDCA 3HA7A 1D2HA 1FMLA 2A14A 3NALA 2BFFB 3B3AA 1TYZA 2HV8A 1GKUB 2QENA 2WYUA 4I2VA 4IG4A 4ME6A 1Y1RA 3TLEA 1FLAA 2QGZA 1IJKA 3KYBA 4CDNA 4NOJA 1C14A 3ZVNA 3V1YA 4XA8A 4INOA 3NEPX 3CPJB 1W47A 3ONWA 4RKQA 1Z5VA 4JJAA 1FA9A 1L4LA 5LSAA 2HQRA 5JI3E 4RD1A 3A6HA 1TD9A 1TM3E 3V1KA 5CT6A 2SCUB 4DLSA 1Y1QA 3JX9A 4PBRA 5IXJA 3KZNA 4ZPJA 4BNXA 1OBOA 3OIDA 4KVZA 3MLBA 4I36A 3KR0A 3WOHA 3ZCVA 3E9DA 1RQGA 2WTMA 2X6TA 3VR4H 2J4FA 5KTNA 1W5SA 1GGKA 3UCEA 4R2MA 1GL7A 2WSSD 3IAEA 3QE4A 2IGBA 2AN4A 1SG6A 2X8JA 2Y68A 4RVFA 5JQGB 1GGJA 4AS1A 2XITA 4IOJA 4J90A 3KVNA 3HZOA 5EJ5A 2MSCB 1FIUA 2ZB2A 1YC2A 2Q2NA 1BSVA 1ID1A 2NUPB 2I7VA 3ENWA 3NM5A 5BY2A 2J3IA 3EOZA 4WLVA 3ZDBA 2WWYA 1KO8A 5EJ7A 1V9SA 3O1JC 3ABZA 4G41A 4R8SA 3ACCA 4GYYA 1FP6A 1M0TA 3LVQE 4L76A 2Z3WA 5HDQA 3STHA 2EJVA 4B0PA 3ZD9A 1VMKA 2V5AA 5DEOA 3ZY4A 4MP6A 3HNRA 3WRXA 5C9ZA 2A9FA 3A10A 3W2IA 1S8OA 3TG2A 2XQIA 3K09C 4FD3A 3FYCA 5IP5A 2OXCA 5E1BA 4UNQA 3KHSA 2AK3A 2IYPA 2NOAA 2QT9A 1QO0A 1IZ8A 1P2FA 1V4NA 2V03A 3DOJA 4BY9E 3QIVA 1Y8CA 5BOSB 1V47A 2P68A 3UJ9A 1RLUA 4FUQA 1J1IA 2G07A 4V0LA 4XDZA 2WSLA 1DXHA 1ZGGA 2VTBA 1Z08A 1GKKA 1IM5A 4CKBA 2JNWA 3LX4A 4R7TA 1EUDA 1KZ1A 1KXJA 1UANA 2O7RA 3FPGA 3UMFA 3EGDA 4CODB 1ZBQA 5HYVA 1QQBA 1N2XA 2HK7A 1WM1A 3BCRA 3JD1A 2GSDA 2XYPA 1RJGA 2H7YA 3A1WA 3ITEA 2JAQA 4K40A 1XMOB 3TCNA 4ENVA 3H8VA 3FZQA 2WKSA 5IM4A 3GLFE 5L3SA 1YVEI 2FZCA 2Q50A 1Z6AA 3IHLA 5TQ2A 4BQEA 3CISA 2ZZNA 2Z3ZA 4K28A 3T9AA 1SVNA 3AUSA 2FZEA 5I3ZA 3GUVA 4LYFA 4B31A 3TLAA 1T8SA 1G6Q1 3SIPA 4DRYA 1NU8A 2QUIA 3MJEA 1OV6A 2HSJA 2R86A 2YIMA 3KBOA 2Y92A 2XIQA 3IC5A 3QJGA 4QWMA 1HDYA 1GD1O 4YECA 5EXDA 3VU9A 4R9NA 4TV9B 3SLRA 2J67A 3QE2A 1A76A 4CM6A 2L18A 4Q3NA 4QUEA 4MV3A 3IJ5A 4ZVPA 1JE1A 1V3TA 4RVDA 4QHYA 1QSGA 2GVZC 4W5OA 4WV3A 1DAEA 1N9GB 4Q1AA 2V8OA 3DM5A 4YXWA 4CMKA 4RMGA 4NBUA 2ZUVA 4C43A 3BQ9A 1SBZA 2ZYWX 3A6KA 4I4NA 2WVJA 3CLSD 3X1ZA 1N6KA 4L4ZA 1HC7A 4RA9A 1Q7GA 4JNKA 4M1EA 1HLGA 2QTFA 4ZYWA 1KMNA 1NMQA 4XJXA 3BWYA 3GD7A 1PL0A 1XJQA 5K6RA 1N36B 4M8LA 2H5EA 4PFKA 5JAPA 1JUDA 1UR5A 1E98A 1JEQA 1X13A 3AI7A 3M5DA 3DJYA 3UJCA 2YQ5A 1C0IA 2EFEB 3F6RA 4QVKA 2FQXA 3CY6A 1A9TA 3OCYA 3L8MA 1NX9A 2G0NA 3B1FA 1X7WB 3QKSB 2W7TA 4TUYF 4WZ6A 4XJSA 4DFDA 1E2PA 5LMNB 3V4OA 1YZTA 1CUIA 2YWCA 4KE7A 5K4GA 4DKJA 3PTLA 1PGQA 4QGAA 1PQ4A 2JHGA 4H3VA 4JP2A 1Y4AE 3HVIA 1SOAA 2OAGA 4LYJA 4M1KA 3EZ2A 2BWJA 3SY8A 3WKCA 1GGEA 1O9BA 2FK8A 1R0SA 2C9YA 3KJEA 2H4FA 3OCUA 4QIHA 5CBPB 2AVDA 4R1MA 5BUQA 3RUPA 4F84A 4B6FA 1RI1A 2FP3A 3HCAA 1ZI8A 2BDEA 2OA0A 3KUKA 3DLPX 1VM6A 3V55A 3ZLTA 4ZI7B 1MDFA 1KK2A 4G23A 4XJTA 2UU9B 1JWAB 4HCJA 3P8ZA 3M1LA 2VEDA 1O96A 1PBNA 2PZAA 3HVUA 4YI3A 4F9GA 4XEHA 1W4LA 4HLDA 3W9UA 1PTKA 1ZM2A 5BN3B 5HIIA 3E18A 4A7PA 3FN4A 3IIKA 1AF4A 5DW0A 3TUZC 4WK6A 1BYIA 2ZPUA 3R2JA 5EPOA 5FUXA 1TTHA 3I6BA 4EB0A 2MSNA 4RCYA 1NUHA 1BE8A 1B14A 4HC4A 2EF0A 4CPDA 4BZPA 1W4BA 3LVRE 3SMVA 1I94B 1FSFA 2VSFA 2RAPA 1A9QA 2RCYA 4F60A 3HXQA 1NXQA 5HJ7A 2V6GA 2IIQA 3CZAA 4EDFA 1AJEA 4C1BA 2G04A 4FN5A 5A4IS 2XEXA 1X3LA 4MINA 5AOCA 3HDHA 5EP1A 3RFVA 3CKMA 2QWXA 5AUPB 1JEOA 3OEHA 4C7MA 2Q3DA 3PKJA 3ZN2A 1QIFA 1T25A 2VRCA 4A2WA 4IZOA 4LHZA 1FFBA 2VJKA 3PC8A 4QEZA 5LZ7A 3QPWA 3WV5A 1Y7HA 4LKRA 4JROA 3B5EA 2W6ZA 4I1VA 1E3LA 4B9EA 1SXJD 2PEYA 4YMTA 1BG6A 6ADHA 3MMNA 3N0TA 3M7IA 1M7GA 1Q1NA 2D0DA 2IBMA 4OTZA 3W5JA 4M0PA 2F9FA 1Q6YA 3PQ2A 5KZMB 5CCBA 4KPYA 2B2XA 2IHVA 5E6SB 3AG5A 4GE0A 1UT8A 1ZN7A 4TTRA 4ZJYA 6ABPA 4FEGA 5A7GA 1MO3A 1MVNA 3C4QA 1WX1A 2QMQA 1F14A 4PHGA 5DNEA 4HLNA 1W0KA 5CM9C 3T1OA 3EVEA 3V4LA 2EHDA 4RFSA 4LRXA 2ZRKA 3CU5A 3VNQA 2FSFA 3AVWA 2G5TA 2QPAA 3DLCA 4LI3X 2ZR0A 2TS1A 3VR0A 4DGSA 5DYYA 1DELA 4BO0A 1L1FA 4GBMA 16PKA 1FE8A 4H0FA 4CF7A 1D2GA 4JP3A 1VMDA 4JLSA 3JQGB 4N49A 1J99A 1NDUA 1W2WB 2I6TA 5C7LO 3KPWA 4L2IA 1KRHA 1KOFA 2B3DA 4O2AA 5CP8A 5FNZA 4BVLA 4HNVA 3D7SA 1G7CA 4LI0A 3STXA 5CA1B 1S3IA 4FWIB 5DCYA 3GVXA 4B7AA 3TJRA 2AE2A 2EU8A 4IJKA 1X7YA 4UBJA 4YMLA 3S2ZA 4HDSA 1X39A 3AUUA 3DW1X 2XQFA 5DRYA 1I6WA 1U5AA 4LJLA 3ADBA 1K3FA 3HYLA 1F8GA 1G5PA 1KA9H 2R6AA 1K7FB 4W63A 4BDTA 2C1EA 1T2EA 3LBYA 4UEKA 4DMMA 1C9EA 2FZVA 2W58A 1ISJA 1SBNE 3CFYA 3FDIA 4U5XA 4ZVLA 3OZEA 2G9NA 2IYLD 3TPFA 4RJIA 3UF0A 4GC5A 4IM7A 4QU5A 2HLNA 5H70A 1TW3A 4FGLA 4B2LA 4CTOA 1T6NA 5BXQC 4L9RA 1KXZA 3D4PA 4EITA 2BHTA 5A04A 5SZKB 1MJHA 2HO4A 4E15A 3C5VA 2JJMA 1OLSA 5LZ4A 1CZOA 2COEA 3CINA 1ZUD1 4G5SA 1M34E 2O5CA 2VC2B 2XF8A 4K6OA 3QLVA 2FSGA 3EIHA 3FFXA 2W90A 2LUOA 2G77B 4W7SA 1WB9A 2DVMA 2J9XB 3RTDA 4X7BA 3ZNPA 4JUIA 2PLFA 2A8YA 1NMYA 5FHRA 1CR2A 1RQ7A 1RPAA 2HPHA 3KT8A 3SEQA 2ZRPA 1JG2A 3E2IA 1MG5A 2AHOA 2DMRA 2O3SA 3PYMA 1FX0B 4FNMA 3VO9A 3FCXA 4B71A 1YQWA 2IC5A 4JVOA 5CNJA 3ET5A 1WNTA 2PN1A 3WDLA 3H5TA 4ML3A 1R3UA 1CKEA 4OK6A 3N2ZB 1FZQA 4QTUB 2WJHA 2Z5LA 3W04A 2PSJA 3GZTB 5EJ9A 1S4QA 2IYQA 3EA0A 1O0CA 3EZYA 1DUSA 3TD9A 3AR8A 2WUWE 4W1RA 2R8EA 2ZP1A 3H5NA 3LPAA 4YK7A 3WBBA 4F71A 1ZUIA 3SLGA 1KSJA 3HU5A 1DUIA 4JWTA 3AC0A 1E1CB 2Q29A 1UFOA 1ZHHA 2WU8A 2CB9A 2FSHA 2XT6A 2Q3CA 4HQOA 3CWCA 3ZHOA 2QX4A 1U2DA 4Y9RA 4QM7A 1HNZB 4A6PA 4BXOB 1YRLA 1PNTA 4YQEA 2ZK7A 5BN4B 4GM4A 3PT9A 3C7AA 4PGMA 4C4RA 4I5GA 3CLRC 3THWB 1W581 4EA9A 3PFFA 4YR9A 5JARA 1JEYB 2GZ2A 4DW8A 2IYSA 1YA8A 3FH0A 3O2QB 4JR2A 1ISSA 3OQHA 4WNIA 1IBSA 1W1IA 1DBWA 3LJKA 1KO1A 1PR9A 1M9NA 3ANMA 2HU2A 3QHQA 1IXZA 4M0FA 1JHAA 1P44A 2FZ4A 2ID7A 3DTYA 5CHYA 2O59A 2ZGVA 4O6VA 3SJUA 4RDCA 2X7JA 2VK8A 2JI9A 3QPAA 5AVKA 1NPTO 4ND6A 3CF6R 4Q7KA 1T3SA 3T52A 1T10A 4DPLA 3AP3A 2WJWA 2IXDA 3M34A 2RH9B 5JATA 3NDPA 1P80A 4UMVA 4ENSA 2C1ZA 2ILVA 4Q9LA 5JDIA 3DXXA 2YMMA 3FYUC 4HLCA 4M22A 5F51A 1E63A 3SHFA 3G6WA 5FQNA 6LDHA 5IW8A 1ISGA 1Q6ZA 2HHJA 2OZEA 2QM8A 4J0KA 4JODA 2WMOB 4ZALA 1SXJE 5BQ3A 1MJGA 1VP3A 3FPFA 1V3UA 2A4MA 3GCZA 3IUPA 3KKEA 1JJFA 4IV5A 4OMCA 1XALA 5GGXA 5JHGB 3AHIA 1U4SA 1JXQA 1NVBA 3PNMA 4RS4A 3ICQB 3PIRA 5CAEB 1Y3HA 2AS0A 4BUCA 1NW6A 2A2ZA 4I5IA 4GT1A 2O5EA 4BU1A 1NN3A 2IUFA 3OIVA 2HA6A 1FEZA 3KB2A 1A69A 3RVRA 4JJ4A 5BR4A 1PL6A 4HOYA 3W6ZA 3PR3A 3MRVA 3L5OA 3TEJA 2XMRA 5D6NA 2CUTA 5EAIA 2Q9CA 3EXAA 4FFMA 4YI5A 4LC0A 3AR3A 3R5TA 4JLBA 3H5OA 3G2HA 4ZV7A 5BN3A 1IVYA 4EFLA 5FUVA 1P4RA 1O7JA 2AF4C 5E1OA 3HRHA 3QKWA 1SUSA 4Q3AA 1LI4A 3A1CA 5DTIA 5TQ0A 2RHMA 4L5CA 1XCLA 2GN6A 3UKOA 1GLNA 1ZUWA 4ZQGA 3MBIA 1NBOA 3CO0S 5HKLA 2PEZA 2RGGA 2XV1A 3X43A 2WFLA 2WUFA 5LA6B 4L7QA 3OECA 4FZRA 2XXAB 3SX2A 4LS3A 2G5GX 4V1CI 4G3XA 1GUFA 1BGXT 3GJQA 1T43A 3D5EA 1K6IA 3ZXYA 5KNLA 3DBHA 2Q4RA 2NV6A 5GONB 3AEXA 3GT4A 3MTBA 3WOVA 4ZZIA 2QN3A 3BHIA 3TXYA 1CS0B 1BYUA 1P0MA 4OQXA 1C81A 1EINA 3AWDA 4P08A 5IEBA 2OAP1 3FNIA 4O4LB 2ONJA 2I3GA 4XZ3A 2X13A 3WAKA 5TQJA 2Z9BA 4F91B 3C14C 4DY6A 1GU7A 2DECA 3W5CA 3EA4A 3K15A 3NBQA 4KFUA 5THQA 1SZDA 4YJ3F 5EE3A 1ZEJA 3OJ0A 4CM8A 1SXJB 1GADO 4HNQA 4E7PA 2JS7A 1QGYA 1YNSA 3KVOA 4Q02A 2BRUA 4HN4B 4MLZA 4RF5A 1WSBA 3FTPA 3KKOA 2WD8A 3E8XA 4HB2A 2I8LA 2ONKA 3UMJA 4LTNA 3VR6A 3RYFA 5CDHA 1K9SA 2IEGA 1F8UA 1G8YA 1OYYA 1U1EA 3R6WA 5D84A 2A6PA 3HKCB 3FVRA 3TW0A 1KZ9A 4I3FA 1YONA 4WK4B 1BOOA 3R7SA 1TC2A 2RHCA 5KVQA 4R4JA 3FSJX 3HNPA 1MT0A 1BKSB 1MJFA 3RU7A 3DLAA 1NVMB 1TTQB 1XZIA 4FYMA 3DDCA 1XPUA 1VG8A 2HA5A 4DDMA 4RVSA 1V6CA 5DM2A 4PRYA 2XUDA 5EUCA 5ALTA 3PC6A 1IN5A 4GX0A 4R6WA 4CI9A 3PIDA 4O4HA 4UAGA 4V24A 1KYVA 4ZT4A 2Y9PB 4KKXB 2X1HA 3QXSA 1E99A 2WDPA 4GG1A 4YT2A 4QLOA 4TUYA 1J6UA 1BHSA 1JN0A 1P7VA 3WHPA 1A72A 5HW0A 4BNWA 3ETDA 4E46A 4EELA 3ZHSA 2J6HA 2JZNA 3WJ7A 5KOJA 2X0DA 1J0EA 3SR0A 2OP1A 1J00A 3AEKA 1FBTA 1DADA 3Q7QA 4H31A 4F5WA 1RWQA 3Q8LA 1N7IA 1DQRA 2GBLC 4PTLA 4BFUA 3K70D 1VRWA 1EM8B 2EG9A 4WBNA 3AV0B 1IVSA 3NUZA 2HSWA 2R5NA 3MUOA 1H1TA 3N5KA 1FU4A 1SM4A 2WTNA 3W4KA 4KPEC 1WMEA 2BM1A 2J6CA 2YN0A 4PYOA 5BT9A 3ZHRA 1UOEA 5C8YF 2LV8A 2R11A 4XQ9A 4QDZA 2C9OA 1NN1A 2CNDA 1DFHA 3LBFA 2NSDA 1A8UA 5M34A 4JUAA 4EHNA 4FFDA 2BFDA 4RF2A 4RL4A 2E1RA 4JJFA 3I8OA 3LUGA 1CQJA 1QYXA 3C6YA 3WYBA 4ZANA 4Q3EA 4A9AA 4OHMA 3MJHA 5JC1A 1WOYA 2D4HA 4LMPA 1ZK2A 5DYGA 5IJ0A 3UH1A 1UAAA 1JILA 1SQ0A 2G7ZA 3UXHA 5AVWA 2QRZA 5K20A 3DDWA 5CB0A 2F3TA 3AVYA 3NYIA 1V8FA 2CDRA 4IXNA 4LF7B 3JQEA 4N12A 1CR4A 1O8BA 3H1GA 5HJEA 1AS3A 2A86A 3EEYA 2A5JA 2AFHE 2I3ZA 3PNPA 4URWR 1ORWA 3VPDA 2FE4A 1CETA 1KFBB 1KO7A 2X7HA 3RJTA 1PV4A 1E62A 2QZ4A 1BGVA 1NMXA 3NWJA 2DG2A 3BT7A 3MT7A 1VMIA 3YASA 1U4NA 3AILA 2HZ7A 1NW8A 2V98A 4JVNA 2ANBA 3KC2A 3AFNA 3SOPA 3CLUD 3UGJA 4ZXPA 2C97A 4DZZA 3N53A 3ODGA 3RT9A 5LUAA 3JATB 2EX0A 3HSYA 1VSQA 2N47A 3C7KA 3WJ2A 4F12A 5JMOA 4L3VA 1RE1A 1H6BA 4FFVA 3CW2A 1V11B 1XL1A 4JFRA 4LWQA 1LEHA 3MINA 3N8DA 3OKCA 4DDHA 4JQYA 3HZZA 4UEOA 1OX4A 3WL5A 1RHUA 3Q72A 1EWVA 3QUCA 5JH7B 3I83A 2FPOA 3C74A 3MS4A 3HGQA 5JZBA 2P3SA 5DGXA 5JS8A 4O2BB 1SHJA 4N39A 1KARA 2XUZA 4GI3A 2CKDA 2JFFA 3GOHA 2FW6A 1PTJA 3HB4X 2F17A 2OSBA 1NVTA 2B6HA 3ZHCA 2OO7A 3A8TA 3JATA 1NVXQ 3NHAA 1BEUB 4KOEC 4F93B 1ENZA 1JT9A 1SWVA 2ZTUA 3M6MD 5ADUS 1JI0A 3PXEA 4LF4B 2VSQA 2PD3A 2EP8A 3FVWA 3BJZA 5E9AA 2WDZA 1DMSA 3TLBA 1ACLA 1UZAA 3N3BC 5EIEA 3C8DA 2CMFA 3CX4A 3TSYA 4MPDA 1YUMA 3KE9A 2N0SA 2ZSKA 4HAIA 1L7AA 4KVFA 4M87A 4XPIA 3WISA 4QQFA 2VQ3A 4QUAA 4IJ6A 1WETA 1T0HB 1BQ3A 3B9PA 2FG7C 4HLUC 3KQSA 1LPAB 2PMDA 4WJZA 2B83A 1U63A 1TYBE 1XHLA 4F3TA 1T1JA 1Z2AA 3U6KA 5J2TA 1AOXA 3L40A 1E79A 4PAQA 4ZGGA 1T5HX 3L02A 4EY8A 5KOHB 1FMTA 2YUIA 3HACA 4OO3A 3VX4A 4WKCA 3EIWA 1J2YA 4YP9A 3R1IA 4D98A 1W5AA 2XOKA 3GMDA 2FSSA 4OLJA 1DC3A 1I7PA 5ELMA 3WXMA 1RQNA 2WZQA 4MPJA 1WZUA 1G3IA 3B8EA 1EIWA 1ZH2A 5WRFA 3LCRA 1T4CB 3ESAA 1X0VA 5AW9A 4ZDKA 4YMIA 3GRZA 3L0CA 1AUXA 5AVOA 3NORA 2DT5A 3GEGA 3T7KA 1U2RA 2M6SA 2PRSA 1SHLA 3TQTA 1O87A 4I9GA 2FJUA 1EFUA 1G4HA 4NXMB 4OXNA 1DCFA 1SXQA 1XTQA 3O90A 4FW8A 4F8JA 3BEDA 4BP1A 4M6WA 5CFQA 2XODA 4OM7A 2HRQA 1Y1KE 2YVKA 4JOSA 1RWPA 1ADCA 2A88A 3EYWA 3M5PA 2VXYA 4NSNA 4Q4AB 3WO1A 1RLIA 1XGKA 3I6IA 3KEMA 1O94C 4TLMB 1WDWB 4POOA 4QQRA 2H4ZA 5CVEA 4GC9A 2X41A 2IQ5A 2DC1A 5FOUA 1TM1E 1H65A 4F3CA 3LDUA 4CIDA 2HCTA 1UUFA 3HZHA 4FCVA 1RRVA 3AESB 2REXB 1R3DA 3JQ7B 2WU0A 1GDHA 4FC7A 2QX7A 4WD3A 3H8SA 4Q6BA 3OCXA 1L5OA 1Z4OA 5L4LA 1M2KA 4IH1A 1MIOB 4RVNA 2JLVA 1L0BA 1IQUA 1LPPA 1P0PA 2WIJA 2FV8A 3K0BA 4CQLA 4DXDA 1HDZA 1Y81A 4MWTA 1T1GA 2GYYA 3H0CA 4Z2YA 3RS5A 4WKPA 1G8AA 2OTCA 3K2IA 2SKEA 5KWEA 2VXOA 3ETHA 1W88A 2I1VB 1YD7A 1J42A 4C05A 4HEHA 3DOHA 4QPZA 2IPNA 1NUAA 4I9UA 2ZYVX 3EUEA 1KMHA 3EH1A 4U6SA 4YJ2F 3Q5DA 4FJ2A 4EEZA 4YRGA 2BH2A 1JHUA 3OH8A 4J2TA 4LSZA 4AMZA 3GU3A 3PHLA 2VPIA 4XTCS 2Y2VA 4HQNA 1KERA 1C7FA 1Y9JA 2XWBF 4TUYB 5LP6B 3WKDA 1ZCBA 4X1IB 4D4JA 2RE8A 1YB7A 3DEZA 1M2NA 2I9PA 4BLTA 2BFPA 1VL0A 3GP3A 1T8UA 3O2NA 4WKGA 5AJYA 1RI5A 4GSLA 4P83A 2R1TB 4N7MA 2WFZA 1J2RA 1YL6A 4Y7DA 2RBGA 5KQLA 1FSPA 3KNZA 2QQGA 4YO8A 3HY6A 2K87A 4OJYA 4QYSA 5TE9A 4V39A 4LSGA 5LCXA 3EXG1 4NNPA 2P90A 3GBVA 4BV9A 2RH8A 3V2IA 3N28A 4G24A 1ZGJA 3ASYA 1IJFA 3S6JA 4UCXA 1K98A 3LO8A 3DZGA 4L0MA 4V02A 4GMHA 3CUEF 1KDPA 4IFEA 3UGKA 3VQTA 2XTAA 5JDIC 4NBNA 4J6EA 1T2NA 2I4NA 4LVNA 1Z2PX 4TV9A 3COSA 2PBFA 4D9IA 1LFAA 2PRJA 2YY5A 3HXKA 3Q3CA 5E9QA 2W6JD 4JA2A 4ISCA 5FLKA 5JVDB 1QP8A 1X3SA 2A1UA 1IOWA 1JBEA 3PXDA 4ACBA 1TQDA 1N2OA 1QMPA 2WJZB 3DXFA 2R7LA 4TV9F 1J33A 4Y2XA 5JCOA 4HDQB 1EXWA 1E3SA 4F0JA 4L6CA 4JBGA 1OAKA 3EAGA 5EFZA 3QVMA 5JLAA 4JN6B 1T4MA 3MFYA 3HO6A 5TARA 4B87A 4EEXA 4ES6A 4RIFA 4ESHA 2FWJA 4UU1A 2D62A 1XTTA 4DR7B 3HB5X 3I1YA 5EEGA 2X15A 1X9IA 4CHTA 1PUJA 2FFJA 2DBRA 1HO3A 3WL7A 3S55A 1U2GC 1U28C 3FDZA 4IIHA 4M0KA 4TVOA 3I5UA 1WSAA 4W82A 1IRIA 3ZYCA 4DJJA 3RJ9A 3ZCRA 4JU9A 3RSLA 3JV7A 3TOSA 3W8FA 4GX5A 4C2AA 5FI3A 1U3FA 4BO5A 1R5BA 5JAQA 1KQGA 3GZNB 1SKQA 4E5DA 1KY3A 2AF3C 2HYDA 2IP4A 2QJRA 3VDXA 1F5NA 3SYKA 2QLLA 5HR5A 2HWKA 4PC6A 3GGOA 3FKSA 3O4JA 1H9AA 1V45E 1EGMB 1N4DA 4GOOD 1E5DA 2ISCA 4Q1DA 1T5LA 4ZT7A 1CY7A 2ZBPA 4F1KA 3D6UA 4B7UA 3E48A 3OPQA 4UHBA 1YHYA 1N1EA 3L1KA 5EWLA 1VLJA 2ECQA 1UDCA 1PGJA 2GM3A 4M83A 2JKZA 4HO1X 5EKXA 4C3OB 1J90A 3EE6A 3JR3A 4LRTB 2JZCA 2FWPA 3KXIA 3B6IA 3LPCA 1ZKDA 3W8EA 3UK0A 3Q40A 1Z5NA 1SCDA 1Z2NX 1XZKA 2YFHA 3PD0A 4HPJB 4LGCA 3FWPA 1O1YA 4IDAA 4YDSA 5BN4A 4G4JA 5U4QA 1HTBA 3SKYA 2ZYDA 1G38A 2CVPA 2GRAA 2WWRA 3A1TA 3JTEA 5HK8A 1ZHFA 3HCDA 2QU8A 2ACEA 2Z6QA 3UCFA 2FAXA 5F35A 1S2IA 5JMPA 1GZVA 2WAOA 3O4VA 3TPCA 4CE6A 1XD2A 3UJDA 2QJTA 3DO6A 4LZAA 5LYYA 2NP7A 4EYKA 3KLMX 1D4OA 5C4GB 3ZQ4A 4P93A 4UFPA 4NK4A 1AA9A 3HJFA 3OUZA 3NXKA 3ZZ1A 1LC0A 4HWKA 1UPCA 3BMQA 4PLHA 3GROA 1Y6FA 3KCNA 1T4CA 4NEHB 1MABB 2QN8A 3BPSA 5TXGA 3WFZA 1R6XA 3NHMA 2P62A 1JEDA 4ASUA 2YRXA 2YZNA 4OSEA 3VZSA 5B53A 2FSIA 3LA8A 4MICA 3IHWA 4W5NA 3ETNA 1ZUHA 3MCWA 1KVUA 3KPUA 1XXHB 1G8HA 1R5OA 2YXEA 1P0IA 1MD9A 1VIVA 3BSYA 1AMUA 3MTJA 4LCEA 1FFXB 3ND8A 1KJ9A 4PO9A 3O1LA 2BCGY 2J3MA 4HZGA 1NIJA 2F7SA 2HF2A 4Z7OB 5A3JA 3WTBA 3BMCA 2X1LA 1U81A 1QH1B 4HUQB 4OFXA 3AO0B 3DMTC 2RJNA 3PTAA 4IX1A 2VDOB 3MRSA 2Q49A 5CFZA 3H9UA 2J48A 1Y34E 1NA5A 5KTKA 1L7QA 1SB8A 2VYCA 4I4IA 3D2LA 4L8VA 5LWQA 3IAUA 3A70A 2QD3A 4J7AA 3PJEA 4AO8A 2PKYX 2Z2XA 2I03A 1JLHA 4B5KA 4EX6A 5IM4F 2QY9A 3MWKA 1WE2A 2A4KA 4FDVA 4RV4A 4ZOEA 3OJOA 1EFCA 5SY6A 4A6XA 1T1SA 4N9QA 3WLTA 2ORYA 1CF2O 5BYAA 3GI1A 2MIIA 3C3AA 3OOWA 5D51S 5KUTA 2IYAA 1Z34A 4LBVA 2DXIA 1URPA 2ZWMA 1NX6A 2W6JA 2RG7A 3BWXA 3F9RA 1NC1A 3KFVA 3PS9A 1P2SA 2DPMA 3L0BA 4H0NA 2ZIWB 4NU0A 4YAKA 2P67A 2BZGA 2VYVD 2FP4B 3DAGA 3GLUA 5F76A 1QNFA 2OCDA 3NTXA 1P0FA 2JKYA 3COYA 5AI8A 5DTEA 3DTVA 5FA5A 1PQPA 4E5NA 3NNNA 5K3CA 3BIJA 1VPDA 4E5MA 2XDQA 5JISA 3IBCA 3T3MB 3CX7A 4JB3A 4C0XA 4C5CA 1TLTA 3L7DA 4R1QA 4WFIA 3DZDA 2IQIA 3OBBA 3UAWA 4OJKA 1F3OA 1L7EA 5F2EA 1K1EA 2VDMB 3TCXB 4C7KA 4ZC1A 3BX1A 5M7EA 2H1HA 3MTQA 1HOXA 2R4QA 3LUDA 4EGJA 3ASZA 1EXDA 4OATA 3GB9A 4MTLA 1J24A 4F5YA 4HXYA 2OESA 5GOZA 5AQ1A 3LD9A 1UJBA 2F48A 1MOSA 4C4SA 1LLFA 1N5RA 3AW9A 1UBOS 2FCAA 3MD0A 3NR2A 5EJAA 2JIPA 5HS6A 4C4TA 1PNVA 2VNJA 2X8WA 4B46A 1UXGA 1DKPA 1FPQA 4C4OA 2FPPB 3R4CA 4ENTA 1P1RA 1U8FO 3GGGA 5CITA 5IF9A 2R60A 2R66A 2NG1A 5JXGA 3TLJA 1RXEA 3N2YA 4R3WA 3MWFA 1W1UA 2BT4A 5EWMA 3DOIA 3BH0A 4LHVA 2V0GA 3MPUA 4K8RB 1OXTA 1FU7A 2EBFX 1VL1A 3A1NA 1U9IC 3WLLA 4AVYA 1B73A 2NADA 3NX4A 3NAMA 2FUG1 2J85A 3ZDDA 4C89A 4MVJA 2IKQA 2Z1NA 4ZCRA 3CRNA 3G8BA 3WLRA 4ERNA 2VBIA 4BBZA 4DLUA 2Y1EA 4Q6WA 5KYKA 2W9XA 3D8BA 3QZUA 3RVJA 1G3RA 3TOCA 2GERA 4HH4A 3SX4A 1VHJA 4BHTA 3VPFA 2BY4A 3ZJ4A 1HYEA 2RB5A 1I2MA 3O2JA 1VI6A 1FC0A 3ICVA 1F0KA 3UWMA 5ISMA 2AE1A 3TQFA 3V2UA 1OBHA 3IEIA 3P1JA 5GINE 4K3VA 4MYDA 4LNAA 4RD6A 3SJAA 4FU0A 4BKOA 5BUZA 2JA1A 1JJ7A 3THXB 3R09A 4NCKA 1COWD 1GZ6A 4KO1S 2HQSA 4G63A 4MPTA 3U9SA 5B6JA 5CEFA 3RGWS 1NQ5A 3ZWAA 4D96A 9ATCA 3WHLA 1IXRC 2QTCA 3CT6A 3D6JA 1MH1A 2JFUA 3Q3JB 2SBTA 1EVEA 4U6QA 1RLMA 3OLWA 1U65A 2D2VA 3ORSA 1C0PA 1GKLA 3M6UA 1I10A 2OP0A 1A2KC 1E3DA 2J5KA 2Y3IA 3DMNA 3N6XA 1TT7A 4I55F 3ZZ0A 3F73A 2A1IA 3VKWA 4FN4A 2EWMA 4TOIA 3ZI4A 1U2PA 2YVUA 1SVLA 1JHDA 2MDTA 3DNMA 5IYZB 1C7RA 3U7EB 3CLTC 2V4ZA 4N0EA 1GKIA 2PSEA 5B6IA 3EEBA 1JRLA 3OLQA 3ELUA 1AZLA 2VDWA 3ZXXA 4EKGA 2JD1A 4UVDA 5L4SA 3HYTA 2AXQA 3BGSA 1JAZA 3Q98A 4B3MB 5AW3A 2V7GA 1S3SA 2A33A 3UG6A 5DMHA 4LOAA 5ABPA 3GV0A 5DHUA 1C9NA 4W9RA 3T0FA 2PGOA 5FUBA 3A1UA 3ZZMA 4FCWA 3RLIA 1WW3A 2V0CA 4LZNA 1ZIYA 3SE0A 1M6WA 3VAYA 1GTRA 3EFOA 1UK8A 1QQ7A 4PN3A 5EHIA 4PF1A 1MC1A 5C1IA 3GFRA 4GICA 1FS5A 3CH4B 3G8YA 3PICA 2DR2A 4AB1A 3QP9A 1GUAA 4BKUA 3WL3A 3KO8A 4RLQA 1O6CA 1CJBA 1O58A 2QN7A 3RYHA 4FSXA 4P0PB 2MTBA 4CKEA 2VKTA 1FOEB 4PQYA 5L3QA 2VJYA 1Y7LA 1CDDA 3FSGD 1VE5A 1RKQA 1GCUA 5HXAA 2FWNA 4HDCA 4D74A 3FSGA 3TR5A 3T06B 2X2PA 2O8VA 1ZOLA 2L69A 3OP4A 1ZRMA 4US2R 2PANA 1KFEB 1SQFA 2VDQB 1XAGA 3EVBA 2W70A 3A6GA 1VB3A 4YUVA 1F17A 1Q19A 3GUZA 5KSWB 2WVHA 3CUKA 3H16A 4MCIA 1TZCA 3HUUA 4HAXA 2OQRA 2KSQA 4DMKA 3Q8KA 2Q62A 4TV8B 4F9TA 1P0CA 2YZ2A 4CR8A 1OI7A 4OQDA 3ZW7A 1NBMA 1Z26A 4HQLA 4RHEA 4CU2A 4RTJA 1RRMA 2BFBA 4GPAA 4CHGA 4G97A 1IN6A 3UT5A 2ZIFA 2FUG6 2X9QA 2BI4A 1AGNA 4MS4B 4D42A 3OC0A 1X1AA 5G41A 1Z37A 3ZKWB 4QXOA 4UTRA 5JNTA 4C2UA 4IDQA 3UWDA 3CNNA 4NZYA 4DRXA 4QECA 4G0WA 3GY0A 5L9AA 1M2EA 4ZVQA 3UATA 3UXMA 2CEAA 3P0EA 3WNCA 2GM9A 1E96A 4O02B 1Z8HA 3ILVA 2OL4A 3TFQA 2QM0A 5J1TB 1JAHA 5J59A 1D6NA 4UTPA 3EASA 3OAAD 4KO8A 3T1NA 1KFJB 3T94A 4AJ2A 5IZCC 3JALA 4KACA 1XX6A 2RC6A 3TZKA 1DC4A 4CIVA 1E64A 4PGGA 3C6MA 4TTIA 5F7OA 4M1QA 4CMCA 4F11A 3QU7A 2RHOA 4CQMD 1JNYA 3FOEC 4EPVA 4ZIRB 1ABFA 3PDCA 5MDHA 1TQHA 1I80A 2EJUA 4ZVVA 1Z7GA 5DM1A 1IONA 3DE2X 4ZDIA 3TSCA 4GGOA 4JNCA 2NUTB 1IOLA 4YGYA 1RHQA 1WHTA 1ZNXA 2Q5EA 4PQFA 4UAJA 3DKRA 4WA8A 2DRIA 3VSEA 4P9NA 3MQ2A 1EQAA 2WMYA 5AHRA 1HL7A 2WJ6A 1BIFA 1CY2A 1L4KA 3VZRA 1T0JB 2CJYA 5MN5A 1ZXBA 2X9NA 3LT4A 1HT1E 1CEQA 2ZJZA 4XD2A 5CW1A 4U9IS 3CYFA 5J63A 4KO2S 2JLUA 1EHYA 4Q4HB 1NRWA 1JIIA 3W34A 2R5FA 4M8NE 3IJPA 2OGUA 4OGKA 1EE9A 4K9OA 3ICCA 2LDBA 3I64A 2VQDA 5AI6A 5KJEA 1GFSA 2X5OA 5LPNA 3AY3A 1A1VA 4ENQA 4GPBA 1OI2A 2NU9B 1GPWB 1F1JA 4RQAA 2DFKB 4XX0A 1TTTA 4WLNA 2ZUDA 3PDHA 5I7EA 2QR2A 4INAA 1TMYA 2IW3A 3WICA 4EBFA 5K03A 1RYYA 1KZYC 2GDZA 3OD1A 2H0QA 4AP5A 4R0MA 3CCBA 3LLMA 1A2QA 2POQX 2X40A 3N39C 2XAAA 4CQLB 5TV2A 4BO7A 3F6SA 3OIWA 1QG0A 1PEKE 4D4LA 3E6AA 2DR0A 1VFNA 1E4EA 2XZPA 3BJRA 2IELA 5AHXA 1QHIA 1ESDA 4MRRA 5FULA 4B48A 5M5BA 4N47A 1MFZA 1QYWA 3GJ0A 1WHSB 3VV2A 1NTRA 4AMYA 1YZVA 4U2KA 4ZVTA 4DCOA 1YI0A 3ZS8A 3Q9NA 3PX7A 3IHTA 4U2DA 1VL5A 3Q1LA 1QWSA 2HA7A 5J4HA 4JY7A 3A2MA 4EEKA 5CB4F 2A0UA 1Y5MA 2W2TA 3WLMA 3RS3A 1R27A 3ZCXA 3IPLA 4HEJA 5EZ6B 4QQKA 4KX5A 4ZCQA 4Z4IA 1L3BA 4LQLA 1ISHA 4MUXA 1EDEA 1KR2A 2R2GA 2RGNA 2CXRA 2VNSA 3JQ9A 4P53A 4YJFA 5L3QB 5AUNB 4MV4A 4DYHA 2ENUA 2FLWA 4FILA 5D1NA 5E6SA 4WESA 3KQVA 5JNLA 3X1KA 3MLAA 4KR9A 1WWKA 3WK4A 4LBYA 3R0IA 1X74A 2ZXFA 1A8PA 1EVIA 2DY0A 2PD4A 5JH7F 5DHTA 1QCDA 1TEXA 1YQUA 3HHEA 3MTGA 2FSVA 1MNAA 4O5OA 1WABA 3ICOA 3VNSA 1XJ0A 3MTAA 4GGPA 5I9BA 5BNIA 1L5YA 4XD7D 5HF6A 2J5QA 1P45A 1DIAA 1V26A 4MAAA 3RSQA 5EMJA 2P9QA 3H1BA 3WXBA 3OUUA 2X14A 1L7VC 1WULS 1YIOA 2A30A 3NT5A 4KQ1A 4TZTA 1UBMS 1N2CB 4B47A 1XN4A 3AY7A 4Y0VA 1UBFA 1S2OA 4M60A 3E3NA 3EF0A 2HJ9A 4MP3A 1ECGA 2RGDA 3FNRA 4V3BA 1OGIA 2YWDA 3TLKA 1BN7A 5EP2A 4FR5A 5TS2A 2R1VB 4YJHA 1R7RA 1O03A 2ZTSA 3TW8B 2F8TA 2WYHA 3NDBB 2IE8A 2VOJA 3TLMA 1WHSA 2G72A 1DQNA 3R0VA 3RI3A 4BKMA 3K9GA 1NUQA 2VUUA 1CRPA 2C2KA 2X4LA 2F1KA 2X1MA 1GQFA 1WNFA 2Y0CA 3N2LA 2R65A 4URYR 5LB2A 4AXXA 2VJDA 4CR6A 4DJTA 1FJ2A 2UZ1A 3NETA 1H1DA 3TL2A 2G6TA 1E5LA 2FW8A 2ZJFA 1NZDA 2ZR8A 3PFBA 1R9NA 5LBIA 2Q0XA 3D6VA 3W7VA 2RAFA 2FTKE 5JWHA 5C32A 3NWBA 4H6XA 4QOEA 1GGVA 1RKUA 2NVUB 2HSZA 2PQ6A 3D5TA 3TKYA 3VYRB 4O0MA 3V6LA 4MRSA 3M5CA 2Q2VA 3VVLA 1VL8A 2AG1A 1G98A 2XKAA 1XZLA 3AEUB 3QE3A 4R40A 1TJ3A 1QFZA 1JMKC 2G5PA 2FMUA 3DFIA 5EXPA 3ZHZA 4EK9A 3KQKA 4Q3OA 5CYOA 3BC1A 3SXUB 3HYSA 4IDHA 1BEZA 3B1VA 3EX7C 3SXJA 3I0ZA 4BP9A 4O4IF 1H2WA 1S6YA 2ZCUA 4M88A 2VO1A 3KTAA 2FP4A 2C3UA 3PWZA 4JBWA 5EJ6A 5CK5A 3KZXA 2BFBB 2VWGA 2Q6IA 1WXQA 3HI6A 2P79A 4L72A 3ZUPA 5K8CA 2OGSA 1RWOA 2DR3A 3UAOA 4E1BA 1ESZA 1G3MA 4MQMA 3QEMA 4S35A 3DQPA 3TBKA 4F92B 5LXTB 2R6ZA 4RGQA 3W8DA 1TNDA 5BYBA 1YQDA 4JC4A 2O8DA 1HI9A 3MRXA 4JI1B 1ULTA 3BQMB 3A1SA 3CWZA 1LI7A 3Q7IA 2CNWD 1EZ4A 3BHJA 1TYEB 2F9LA 2UXCB 1KH1A 1SQ5A 3S5JA 4R1SA 1S2DA 2G76A 3IMKA 2B35A 4ZYTA 1NV9A 2R6CA 5FFMA 1SVMA 2B1QA 1HNXB 4J9UE 2BFEA 5C7OO 1UDXA 5CDFA 4CDRA 2I1QA 4P34A 2R7NA 4DM3A 4MUFA 1SRQA 2HIHA 4KGVA 4CDGA 3K6JA 4GDMA 4CLOB 5A1TA 2EGUA 3I9OA 4JLPA 1P5RA 1PG5A 4DLVA 5FTWA 2XMDA 4EJFA 1TT5A 1AK1A 4DUGA 1U3DA 3A0RB 1E0SA 4J03A 5JRJA 2JK0A 2GXSA 3P2JA 1VLLA 1YTUA 3ZZUA 4XYLA 1UBLS 4ATNA 4BLVA 1TKRA 4JXXA 5BVHA 4OUDB 2Y1LA 3AETA 1BS2A 3N74A 1K27A 2DFPA 4MR7B 5JNWA 4OUKX 1EK0A 5LIPA 4HDNB 2QN6A 4W1QA 3W5SA 3G82C 2ZE6A 3KR2A 1FLNA 4G5GA 1E92A 2XY4A 2QRKA 5H02A 3T9BA 5TVKA 2Z4RA 3O7MA 1PVVA 3A1VA 1QHGA 3LYAA 4B6RA 4C6TA 1DKRA 3I42A 4X8MA 4LJYA 3TIVA 1B6TA 3OZSA 4HR7A 4WVLA 4M1OA 1Q74A 1UOQA 3DNPA 4X60A 4YJ3B 2VHUA 2H4JA 3IOYA 5B58T 3ZH9B 2DUNA 2WOOA 4F04A 5ALVA 1C3XA 3VU9B 4TVSA 621PA 1KZ4A 1QK3A 4G0UA 2ZIGA 3ENZA 4EYEA 1P6UA 2ZRMA 5BNFA 2H63A 1UK6A 1NXVA 4XCQA 3Q8MA 2OBNA 2OFPA 4Y0NA 1Y80A 4Q19A 1M2OB 1NVVR 3HP4A 2J3KA 1CDZA 5KYYB 4IJUA 1PGOA 3QXJA 3R4VA 3GG2A 2DFDA 3LC0A 3U4IA 5C3UA 4CIAA 4BX9A 1V4BA 3F1KA 1B0ZA 2BONA 3CNLA 3VOBA 3RO7A 3EXIB 4OMUA 2QF7A 2JZOA 4TV8A 3QXXA 1SUAA 4LDZA 2UZIR 3QHAA 2W00A 5FPSA 1HQCA 5REQA 3TD6A 1NW5A 2CHFA 2ZQZA 3NPAA 1EUDB 4IRMA 1FXUA 3UPUA 2ZM6B 2BZSA 2IJGX 5AMXA 3FYSA 4YCNA 2ZJ8A 4KWHA 1NKTA 1V5WA 2GLUA 1VPWA 1W0JD 2VXBA 3OE7A 4M9RA 1Z4KA 3D7MA 3DKVA 4WY8A 5CNMA 3RD5A 4EUFA 1PR5A 1X70A 1RFGE 3O38A 4L95C 1MX1A 1UKAA 2JJ1A 3I2JA 4NRDA 1FUKA 2JCSA 1BD3A 2D7JA 3E1KA 4U2BA 3TQOA 5CLJA 3ESQA 3BE8A 1M74A 2BF4A 4JV5B 3BWCA 3BXZA 2WW8A 5M04A 3KT3A 1N2IA 2CFIA 2Q28A 1P1KA 1RACA 4LJ5A 4ZCLA 2HGSA 1D2AA 2DFVA 3F4BA 3GL9A 3IA2A 1KBQA 3L0ZA 4G5HA 3BWVA 3P27A 3EF3A 3N0XA 1UP6A 4G1VA 3QTBA 4XVHA 3U7IA 4B85A 2VF4X 2C7RA 4CJXA 1WQ3A 4MW9A 3C45A 4RMHA 4ZREA 1DBSA 1NULA 1WCV1 2JEYA 3OSUA 4ND8B 1O9HA 1ARZA 3JQFA 4Q9NA 2E5LB 2GEUA 4WKNA 4CFZA 3OM8A 4HZUB 2X8LA 4B4UA 2PGAA 4E08A 4DG9A 4LVOA 2WJ4A 2E4VA 1KJJA 3OPYI 4CG1A 1Y8QB 1GM5A 3H4VA 4P33A 4RJLA 3PEWA 4KQ2A 1WBJB 1WPRA 3C43A 3DD5A 3IVAA 4JS0A 2EBHX 4O3FA 2POCA 3OF3A 2CL5A 3BS4A 2ZI7A 4OREX 1TVKA 4ENWA 2Q0SA 4EHAA 1T5DX 2G9QA 2PCLA 3CZRA 1G9XA 3B12A 1J5PA 4CTKA 1YBMA 1UQTA 4BWYA 4YP7A 4BNLA 1TIBA 4J2OA 2I2DA 5BNTA 4HTFA 3U09A 2QVZX 2X3FA 3M2PA 4YFYA 5ALHA 3VC3A 1BXGA 1I6MA 4L9WA 5T57A 4G6ZA 4YROA 4QJ3A 1YVDA 3OTGA 1KGDA 2NACA 2R7AA 1WJGA 3NRCA 2OBBA 4QGFA 4AKSA 4ZMSA 1QS0A 4I6JA 5AVUA 4L8YA 3R7NA 4JI4B 1Y7IA 2LR0A 1H4SA 4ZMRA 3HSKA 3NXSA 3QE9Y 1F0NA 1HNNA 3VO2A 4G0MA 5C4MA 2JF0A 1NMEA 3IMGA 3SXUA 3WGGA 3MCVA 4IR7A 4JEUA 4EJMA 2ENWA 3VC7A 1OBCA 5GJVC 5KOYA 1ECBA 1LU9A 1W75A 2ZJAA 4TGLA 4NDAA 4YRTA 2WFMA 4YCMA 3R9KA 1W94A 2NU8A 5CHEA 3FHJA 1VYUA 3A6FA 4DMLA 2CXTA 4KCGA 5FA6A 4CUJA 1LLQA 4OJQA 4RGVA 4HSGA 4LZOA 1D2RA 3BA6A 3NYRA 4WCVA 1GNVA 1Q84A 4UUPA 3RRMA 2FEXA 3G9ZA 4QSHA 2JLCA 2VBGA 3EFBA 5T4HA 5JSYA 3W2EA 4B6EA 3ZX5A 5DN9A 1GPJA 1T9AA 1JGTA 1TIKA 3LBNA 1RAAA 1NQUA 2ZB4A 3RHTA 1JKXA 4FNOA 3FMIA 5IARA 1RYZA 4JT2A 4PLWA 4BVAA 5EHXA 4JI8B 3OEYA 3LNCA 3ESXA 1A97A 5ED4A 5K0LA 1PWYE 1QIHA 3STWA 3EDCA 3DZ8A 4A2QA 3HWRA 1B8UA 1PL8A 3I9LA 1UP7A 2YN4A 3UJ8A 4XRRA 5AJWA 1DQZA 1CG6A 3WYEA 4EUNA 1L3IA 4DR6B 4R8LA 3G79A 4HQRA 3ROMA 3PJFA 3ZUGA 4QT0A 5AW6A 5DWDA 1JR2A 2FDRA 4YAGA 2YFQA 4JFAA 3KYDA 4KQHA 4MX8A 5DNAA 4CIWA 1NMSA 1QG2A 2Z4SA 4IHJA 5CDTA 3MILA 4UU8A 1C0EA 2C9CA 5D3MA 1G2OA 3RASA 4KQ6A 3BKWA 1I9CA 4KRYA 4R2WA 2VTEA 3UH0A 2JBHA 3OTHA 3FZGA 1EK2A 3FPCA 4KQCA 1DHRA 4LYEA 1B00A 3QMWA 4QUIA 4D0LB 3KQNA 5ALWA 2HTEA 2QTRA 9LDBA 2AL7A 4FBLA 5JCJA 3PENA 5EP4A 2MSKA 1PWEA 1OX4B 5JANA 3AOGA 1XXHA 1NBME 1ORIA 4EPTA 3DMTA 4U8HA 1QUEA 2QUJA 5LA6F 2QRUA 4X3CA 2V7PA 1IOVA 4EZIA 4DV5B 4KE8A 1AKNA 4IHJB 2PS9A 4J75A 1MC5A 3I6YA 5K3OA 4L4SA 3M5WA 4QT4A 4YV0A 1A9PA 3GJTA 1KAOA 2CFTA 5EIWA 5HX7A 2AZDA 1UMCB 5JU6A 3RDPA 1E2GA 1DKUA 4MS1A 1QGDA 3TJMA 3FVVA 2RHGB 2VBFA 2Y1GA 2YMLA 1U7TA 3UVEA 4QUHA 4P7FA 4IQGA 5K0SA 2X0KA 2AQHA 2GCPA 4BMDA 3WE7A 1EGHA 4JT4A 4B7ZA 3IPXA 3ASVA 3UAYA 5BQOA 1N8SA 4K2AA 1LPOA 4QBFA 2DETA 2Q9UA 2UUCB 4FIZA 5GMOA 4OAPA 4DC9A 2GZAA 1J2JA 4Y1RB 3OQIA 1X7DA 3FM9A 5G40A 3PVSA 1SUEA 3K70C 1JU4A 1XA4A 2XUPA 3UOAB 2HWYA 1EFKA 2VRNA 2VZLA 2I66A 4FMBB 4B6QA 2XT9A 2DSTA 4MVJF 4CIXA 4R41A 3EDYA 5IUNC 2PK3A 1Q1ZA 4DR4B 4UVGA 2D6FA 1Z7YA 2RB4A 3FB4A 2Y0DA 1E0DA 5AK5A 5BURA 1JXMA 4J1SA 1XZEA 3WTCA 5HOQA 2UYCA 1CR1A 3TL3A 3N2IA 2AFIA 4GIBA 1UKBA 3RIEA 2Q41A 1H8HD 1E9RA 3LP8A 3P2EA 5TMDA 1VIAA 3EZ6A 3D7RA 1AZWA 4OHZA 1ENYA 2G1JA 1UOOA 4IH4A 2C2GA 2YR0A 4BWFB 3K0KA 1CRWG 4I8DA 3LF1A 2O2YA 1YFLA 3IE1A 1OWLA 3LZ6A 4DV0B 2Q2WA 3JVUA 2WHRA 4W5WA 1KHHA 5BQFA 4DJ5X 1B6GA 3R7FA 3WGOA 5HHTA 5KYVA 3UO8B 4PSKA 3VHRA 1X1CA 1RHMA 1ILEA 2Z0MA 4DEVA 4BNKA 1UMDA 1YJAA 1MC8A 3VKHA 5JR3A 2ZBFA 1PE0A 2WTUA 2M6LA 4GW3A 4F6LA 1IAQA 1ZN2A 2Q6VA 1MW8X 5CB6A 1VOTA 3TSOA 2CCJA 3K31A 4UCWA 5TY0A 4LOIA 3SFTA 1LDGA 2GHTA 1RBZA 2CLHB 4U9HS 2XT0A 4WXYB 3VKGA 2P27A 2V1XA 1TZBA 6YASA 4D4HA 3L93A 4UATA 5IMSA 1N3BA 1N7GA 3IELA 4BMCA 4M89A 5CIQA 5CCEA 5J3JA 2VPYA 5CCDA 4C76A 4JGBA 4CNBA 3U44A 4H9GA 4NZZA 2H08A 2RCNA 5FBRB 3P2YA 3CWQA 2CNBA 4E3ZA 1EAMA 4LXTA 3FAKA 2Z6AA 2P0AA 1NF3A 3E3AA 3JAKA 3P5SA 1YKFA 4KO3S 2YL2A 2EJBA 5HCUA 1SOUA 2CF6A 2DQYA 4BPBA 4M2LA 3GNSA 3QG1A 4JYCA 3T4XA 3CMMA 1DTWB 4ZJUA 4Q4JB 3RUCA 3FMFA 1NHGA 4NBRA 1QKIA 2XUGA 1YRBA 2CYBA 4JUCA 5HE9A 3S8YA 3NDRA 2A7QA 3WP0A 1IPHA 4PYQA 1K7SN 2GLTA 3QXGA 1KU6A 4AG6A 5EGSA 5IM5A 5E3HA 4JYZA 4DILA 5B6PA 3AKYA 2VYQA 4DIKA 3SR3A 3BWBA 2P6MA 2W0SA 4ZZ0A 3FOCA 2NTJA 1LS6A 2GNAA 2LIPA 3X1XA 3A4TA 1DIHA 1P39A 1V5GA 3BKXA 4HH3C 1GARA 4MRMB 1CSEE 2OAEA 4FMDF 4PW0A 4LCBA 5K8LA 3C5WP 1SK8A 4AECA 4RDXA 5K3FB 4GZ3A 1RRKA 2ZJBA 3SC6A 5FUMA 3LY7A 1OZGA 3P32A 3VRHA 1Q2UA 1S0UA 5CM2Z 2GN2A 3GN1A 3JWJA 3RUHA 5K0FA 2W6OA 3H7AA 4ZT3A 4QVIA 3IE2A 3T3GA 3TIFA 2P2NA 4Q7JB 3PDIB 5FWYA 3SS7X 3H6HA 4K9DA 4W1SA 1L7XA 1EFVA 3TRKA 3E5MA 4OBBA 3VV3A 2ZJ1A 3W8RA 4AP6A 3K9HA 3AT1A 4LK2A 3WBFA 4QRIA 4E3WA 5DHQA 3F6YA 4YQYA 5HFJA 1Y5IA 1X0XA 4P3OA 1OX6A 2O07A 3WLOA 3A37A 1RC1A 4I08A 4DWWA 2LVBA 3LSTA 2Q2OA 1E7MA 1LSOA 2H7XA 2QZSA 3L0DA 4HQFA 4DYVA 1ZL0A 4MUIA 4EA6A 1TU4A 1Q0RA 1G66A 4G1UC 3GAAA 3DP7A 2J4DA 2OC4A 3HXPA 5F7ZA 2PG3A 1JQDA 4DM4A 4JYAB 1Y5RA 3BEOA 2IOFA 2KB0A 3GDGA 4LHYA 5KQMA 4KFRA 3UMVA 1P2UA 1WB5A 1NZJA 3PXUA 4QHTA 1QOPB 2A0XA 1AE1A 1U2TA 1CRLA 2R84A 1N77A 2V7TA 3VZBA 2M98A 3G8AA 2FUEA 3U4AA 2GN0A 1OCEA 5HUJA 1QYCA 4PLFA 3RCBA 2WKRA 3B3GA 4V0ME 3AG6A 2FRVA 5JECA 4W9NC 4K87A 4X93A 2C8LA 2BYTA 1QYIA 1RI4A 1CZKA 2ISQA 1FNNA 2JJ8A 1C30B 4H7JA 4TLDA 2G8LA 2SNIE 4XLLA 4KBYA 1GNTA 1KJZA 1T0PA 1D0IA 3F5SA 2CHEA 2H2FA 3CX6A 4TL6A 3SZ3A 3RARA 3VAZA 4BKRA 1HKUA 2FE1A 4EPWA 1RJEA 1HE1C 1HY3A 2PL9A 3PPXA 1Z5PA 2I2AA 3NBMA 1FVOA 2CL7X 1SPBS 3QVSA 4QSMA 3AB8A 1Y4DE 3FKQA 2IIVA 1CUDA 2JHAA 2OFXA 2YINC 5KSOA 3SNHA 2ZTVA 2QTZA 3NHUA 3UICA 1XZBA 4UBIA 2R1TA 1FXSA 1KRXA 1QH8B 5DJ5A 3ZS9A 4EG0A 2AUMA 3HCNA 2GS9A 3LVFO 4HADA 2YHSA 1FDIA 3KYCB 1FP7A 1LNZA 3M9XA 4AIRA 3MELA 1IHPA 2H0RA 5E7MA 3RF6A 2BGJA 1QPZA 1FNDA 1Q1AA 2ALJA 3ZIDA 3A3NA 1SR8A 1BDMA 3C1AA 5DW3A 4OYYA 1PGNA 2GYVA 2HGZA 3KOXA 4HHEA 5DMXA 1UADA 4J0GA 5LDDC 2YXDA 3IYLW 3V80A 4O4JF 2QSJA 1ML3A 1Z6QA 3K1YA 1WXIA 2EW1A 1V16A 3EIUA 4PCLA 4RHFA 4CNQA 5HPYB 4EY3A 1GO2A 3QELA 1H5NA 1LPNA 2FETA 2X3UA 4NLLA 3RTEA 3KQTA 5IBCA 2J0QA 2JIZD 1NVUQ 1IBMB 1EEXB 4MJLA 1XYYA 2VRCD 4KQMA 4X54A 3N58A 2CV0A 1QF6A 1FMJA 2Z58A 2IHTA 4NZPA 1RZRD 1LH0A 2RG1A 4MOWA 4N8SA 2XRZA 2TMKA 1RXUA 3TLZA 1W0JA 3OE7D 3NT4A 5CX4A 3BRCA 1NN5A 3HKBB 4H4CA 3Q85A 3ASUA 3F78A 3K8QA 3ZGVA 2OD7A 4RV5A 4QU0A 2VH2A 2ZAYA 5MHTA 4GFDA 3PF9A 5AJHA 4HNUA 6AT1A 2I6GA 4RY8A 1E2BA 1WMAA 4Q7EA 1VJ5A 1KFKB 3F3MA 4QHSA 5P21A 2RAVA 1DEXA 2E49A 1QZ3A 2BKLA 2YV5A 4XPIB 5ESDA 4AX4A 1JMVA 2NVOA 2VTVA 1A95A 5IS2A 4L74A 3EPKA 5ES3A 1EJ2A 1XVIA 1WY5A 1L1QA 1NUSA 2V7XA 3L9WA 5CG2A 3GXBA 3GRRA 3HUFA 1BFDA 4LJKA 2SKCA 1M6NA 3NWPA 4KIJA 4OHKA 1KI9A 1CT9A 4EG1A 1E3MA 1UMCA 1TMKA 4R83A 2H1VA 4Z9XA 4DMFA 5A2GA 1ZC3A 4GR5A 5A3QA 2A0FA 2QZPA 1YZGA 3RC3A 1KI8A 3A9WA 4HX5A 3RWMB 1XRQA 2NXEA 1ECFA 3K1AB 3C3MA 3BD9A 1SVWA 3HO8A 4XM0A 3KOWA 3PGXA 5C7IO 3D3WB 4WTOA 5F9HA 2C4HA 3HKDA 3DKKA 4CLEA 3NFRA 4XDYA 3NGLA 3FF4A 1CUZA 2AQIA 2VTDA 4LTMA 2DPHA 3C8MA 5TDHA 3T7SA 5IK2D 1I7QB 2FX3A 1PG0A 1DEOA 4YMSA 4KG7A 3SGLA 4F8EA 1H42A 3C6BA 3GRAA 1DPGA 2IPLA 1L3CA 2X22A 3CUSA 5JSQA 3DS8A 2DYKA 4D8WA 1RWMA 3DGFC 4B3GA 1J25A 1NJ2A 3D5QA 2QI9F 5AI0A 1CUGA 5HVNA 5ENZA 3OESA 2P69A 1EP1B 1X7HA 3ILHA 4EP1A 4CMAA 2YV1A 2H2WA 4FHFA 4UFNA 5KVSA 4R1TA 3FHOA 1GVNB 2NQTA 5DNWA 5K0CA 4L85A 4PZYA 3I3OA 2DT8A 2P9BA 4F9EA 1DINA 3CLTD 4CMEA 1PSWA 3I37X 3PGKA 3SZRA 4J7UA 1UC8A 3JRNA 5A5EA 2V9PA 5AI5A 3HQ4O 3GJ8A 1YQEA 2GT1A 4OK5A 4FT4A 3SCZA 5BSGA 1ZDMA 1NLUA 2GHRA 3KVVA 4XIYA 1USVA 3Q7TA 5NLLA 3KDPA 4WNCA 3ZCQA 1JIKA 3M82A 5IYZF 1HGXA 1PZNA 1VDZA 3KYCA 4DC1A 3DR5A 4JXKA 2P30A 4LAFA 3EVGA 4OIFA 1ZVMA 2YWRA 4KE9A 4ESVA 3J7AC 1N5LA 3FAZA 2VYVA 2WSSA 3ZIUA 5SZJA 1EB8A 1I1QB 4GBGA 2C5FA 2OCGA 3GH1A 4JLNA 4EI8A 1J23A 1KBZA 4Z86A 2GRJA 2ODBA 2XZLA 4HDMA 3CB2A 4BNNA 3QSYA 1D1PA 3GFBA 4CV3A 3SHVA 5CXUA 5T5QA 5C18A 3HC7A 3OJWA 3VVMA 4OAQA 4R1LA 1AHIA 1G5IA 4B4DA 1A9XB 1N9GA 1SA0A 3WFIA 5CBKA 3H75A 2GKOA 2IF0A 5IHXA 3DLHA 2V7UA 1AVTA 2Q8PA 5CA0B 3ONEA 5LIRA 3C7CB 4WEOA 1OB2A 1MF7A 4P80A 1J8FA 1XTKA 4LF6B 2I4OA 2X0FA 1MRZA 1BD4A 1VKNA 2B4RO 2C2BA 2OZKA 1Y5LA 3RFCA 2Z8YA 1QP0A 3H9GA 4EB8A 1OAOC 1V48A 2JGDA 2VUHB 3A9VA 3OEEA 5IKXA 3ADCA 1N2ZA 1YB5A 1Q21A 1HLFA 2C57A 2PSSA 3DV0A 3K7EA 5EIHA 1XPJA 2E5WA 4Y0AA 5F2NA 4L6AA 1R74A 2BKAA 4AUNA 2GTHA 2QVXX 3P20A 4FOOA 3DNFA 2CMDA 5IVKA 3EISA 4GBED 5LDHA 4J3NA 1YBVA 1K4YA 4ZZ1A 5BW6B 3QRWA 4Q48A 4WKOA 2H17A 4OB8A 1XUOA 5DF1A 5CYFA 1T5TA 4S1TA 3HEBA 4D9EA 4Z51A 3GPBA 3QHPA 2PMKA 3KXLA 3M3HA 4Q4JA 2FCRA 1GNLA 3CRW1 1HE4A 2ZRIA 1CPYA 1W5BA 3THSA 5JXJA 3GLGE 3RJMA 1BU5A 1J21A 1T29A 2Q3LA 2VOEA 3CW9A 5K1ZA 1THTA 1V5FA 1L9KA 3HB0A 2FXVA 4TSKA 2O4UX 3CH7A 4RH0A 4C78A 4UEQA 5KC9A 2HWXA 3OA0A 3I23A 3MK31 4L5YA 3T4UA 4IVQA 4BLWA 3BDIA 6GPBA 3BD8A 3OOEA 3CVJA 3QU4A 2UUPA 3G1WA 1SY7A 3NVDA 4D9MA 3T7EA 1ZM9A 3ZGZA 2OB2A 1E6CA 4L73A 3FGZA 3BULA 4FI3C 1HOTA 4Y6QA 2A0WA 1Z62A 2WLSA 3RAJA 5DYNA 2DKFA 4KAJA 4OP2A 4ZICA 3MD9A 4H60A 3WNVA 2CVZA 2JAUA 2OEPA 5AVYA 2PFSA 5LM3A 3HRIA 2PVCA 4OHXA 2UUOA 3DVAA 2W48A 2XHZA 1FYXA 4DLRA 5J5CA 4YB8A 2J0VA 3ZE1B 1I2CA 4E13A 1R10A 2HK9A 1MRSA 3BWDD 3QBVA 3O8BA 1O89A 2OT3B 13PKA 3L7MA 1CJSA 1DKLA 3WADA 4JSYA 1USGA 1B6RA 1K7YA 1WV1A 5FJIA 1E9BA 4GKBA 4BB0A 1VLMA 1YNOA 5A5GA 4AIIA 4R3NA 2UZ4A 3TRIA 3I2FA 1UXKA 3PPYA 2X8JB 4M36A 4UUQA 7ADHA 1AC5A 1QGAA 3HJCA 1Z2OX 1ZGAA 2QJFA 2FMFA 5D2CA 3MG9A 4KFTA 5IRCD 2D7DA 2OFWA 1CP3A 4QTYA 1NW4A 2BEUB 1BKDR 2IW1A 2ZYSA 4LGVA 3ZD7A 2DLNA 1KNQA 2ZS7A 3EHDA 3VU3A 3RFUA 2CLEB 1FDTA 4DAOA 5TT1A 4KQ9A 1VA4A 5JRDS 5ER9A 5B7PA 5GZ6A 2JASA 4NOLA 2FGJA 3SBOA 1OIVA 2PPVA 3VAAA 1RAEA 4QODA 3AVQA 2BEKA 5COAA 2D1SA 3SDSA 2IL1A 1A5TA 2XOEA 4QQ8A 4BO4A 4ZYVA 1JEYA 4PC2A 3ZY3A 2JFGA 2OBMA 1H1LB 5EJMA 6PFKA 4ICIA 3UY4A 3BK1A 3G9UA 3RVKA 1AK2A 4EF6A 4W9MC 2CJFA 1NVKA 1AO0A 3EXHB 3DMGA 1VE1A 1RC0A 3TIGA 3F8SA 4QLAA 4E30A 2AOVA 2PH3A 2YMQA 2C2HA 2BKVA 1I5RA 4W5HA 5KAPA 5B30A 1BCRA 1HR0B 1XDZA 2YOFA 3G5TA 1SUBA 1XWFA 4Q9HA 5EIAA 1VKZA 3PBKA 3GLIE 3EIQA 5CB4B 1HQKA 1IB0A 3DWGA 2E3JA 2WNHA 2HD4A 1JXOA 3FSRA 4J07A 4OKSA 2HF7A 2ZZKA 3D2BA 3ZBUA 5CA1A 3UK2A 2QXUA 2B36A 3EQ7A 3QTLA 4CM1A 3UJNA 4M3NA 3SQMA 3AM4A 2CYAA 2DJ5A 1H22A 2R6FA 1D5CA 1TJ4A 4WXMA 1AHHA 1FP1D 1HT2E 4V38A 4XOIA 3AUXA 5TS3A 4D3DA 5JTTA 2QS9A 1G9TA 1VE7A 4AYWA 5KKCA 1II8A 2Q3MA 4JJZA 4JKYA 1JU9A 3I12A 4TTQA 3L2OB 3HXMA 3ZHVA 3EGWA 2Q7DA 1C8BA 1XVTA 5I01A 4ROSA 4JD5A 3BGVA 4JCCA 4A6DA 3M3PA 3OZDA 2C0QA 3ES9A 4DA4A 3U5TA 4WOPA 2JEZA 5GQSA 4KN8A 4CIBA 4YCAA 2O1WA 9ABPA 2OFFA 1RIIA 1X1DA 3C15C 3UB2A 1ZA1A 5IKEA 1MO5A 5KNCA 3TRHA 4Q9AA 1VFPA 4ECAA 2W6CX 4CKYA 2B1JA 5PGMA 1XZFA 2JGNA 1VRVA 3BG5A 3REOA 2XKBA 1JECA 2VH1A 3O2SB 3PU6A 2I3AA 2QTVA 1MX5A 1XBTA 3Q0EA 1WIWA 1EQ2A 5EJ8A 4PXYA 4MVCA 3G2KA 4A0HA 3KXPA 1P9RA 4K9NA 1U9YA 2R25B 4PR0A 4QBKA 4K86A 2QYHA 2WTXA 3KE8A 4UVEA 3W77A 2IHUA 4F3KA 5JV5A 3FUWA 2XBMA 1R1DA 2QT0A 5DB4A 4YUWA 4MI3A 1EXMA 7GPBA 1K88A 3FUVA 4E5KA 4TYNA 4P7KA 1G8KA 2VP5A 3UWKA 4K3UA 5BW5A 5DT2A 3ISTA 1QP4A 3VOSA 1U9CA 5AVTA 2OECA 3TMYA 2LRHA 2X4DA 4N7JA 5EXTA 1NVAA 3G89A 1VA5A 4KUHA 4PICA 1QDLB 2WMNB 1F8YA 1UBHS 3AR6A 3IUNA 4HTFB 1Q77A 3KKLA 3W5VA 4BXOA 1K4KA 1CJTC 5DP2A 5JAZA 1GUZA 3D1LA 4CMJA 2NN3C 3E2PA 1KEZA 3LCVB 2WP8J 1MPTA 2AOUA 4OEHA 4R2HA 4ZVUA 3P2IA 1JYEA 2MINA 3QELB 1RPTA 4OGLA 1UMBA 1K4MA 1JLMA 1FUYB 2G71A 4LJ8A 3KSRA 1DG1G 3DV9A 5AKEA 2DBZA 3OJEA 3O4FA 5JNSA 1XU9A 1OXXK 2P1RA 4BEJA 1YCDA 5FH9A 2I4IA 4DB2A 1Z9BA 2EX1A 1H66A 1EKXA 4OOFA 3QYPA 1ACJA 1GRRA 1BNCA 1LV8A 2H1WA 2R8PA 3WJAA 3H18A 2X0JA 4EHFA 1N0HA 4RAOA 5I7OA 4J0DA 4P4NA 4LQ4A 3REFA 3WFJA 4HDOB 3PEEA 1CUBA 3AUAA 3WIUA 4AWAA 3R7AA 3U3JA 4W8OA 4UUOA 5EKSA 3NRBA 2J3QA 3WKBA 2PT7A 1ZK3A 1HG1A 3OM9A 1SPXA 2CNNA 2IGTA 4B6GA 1HXHA 1AKVA 2FKNA 4WOKA 4EAAA 1CUJA 4CM9D 4ESEA 1NBMD 4YAUA 3ZJUA 1CZUA 3OURA 4ND1A 1OHHD 1OFUA 1WVGA 4I5EA 1VBMA 1LDEA 4OQ4A 5D3QA 2FR0A 3ZU4A 2WIDA 2PGIA 5KYUA 4CEHA 2D59A 3SYMA 1TVKB 1U0OC 1NYLA 2AG5A 4MO9A 4CTJA 4Q5IA 5K0NA 1P9LA 3NBXX 2NVBA 1E2QA 3W0LB 1S9DA 4YCBA 4BQOA 5IG2A 2IPOA 1KVQA 5IT0A 1TX4B 3A9TA 1FVHA 1SOMA 3K0CC 1ZWKA 1FP2A 2NTEA 4PPNA 5FLYA 4F6RB 3IQHX 4U2CA 5AW2A 2EGHA 1PQUA 3CRMA 1ETHA 4DE5A 1JVBA 3JD3A 5JZ9A 1RPNA 3U3XA 2L0XA 4IS3A 3MT9A 3ZWNA 2HZBA 4Y9SA 1N7JA 2ZPAA 3CZPA 3R3UA 4JKOA 4WQMA 4B81A 2QTMA 1RQLA 3HA2A 4FYYA 4AUKA 3P9QA 1T2FA 5TQ2B 5BSHA 3H9BA 2VJQA 3L9XA 4LMBA 1DAGA 2LKDA 4TTTS 4OPMA 1LBTA 1BWSA 1O94A 4QXRA 5AKLA 1G63A 1XTUA 2GAAA 3S8MA 3SK0A 4ZODA 1C8LA 1K75A 2D1QA 3JZIA 3NAQA 4G0QA 4URFA 3KFXA 1JA9A 2JGIA 3EIOA 3A31A 2HW8A 3E7DA 1HX7A 1ZD4A 3SF8A 4GRDA 2CUNA 1EE2A 4LV5B 4Y8VA 5REQB 1B1AA 4IGIA 4N4AA 4L0QA 2NU8B 1RWWA 3LP5A 1GXSB 1V8ZA 3O95A 3L6DA 3P9KA 4UM5A 3L8FA 4Z3OA 2FG6C 4XFJA 5LYJB 4KRFA 5K0TA 2OMKA 4MQLA 2AWNA 2EYUA 4H1TA 2Y6UA 3K0FA 1Z5WA 4Y1GA 1BDBA 2ZSDA 5HG0A 1PT8A 2AH5A 2O2XA 2QW0X 4WZAA 3ZLBA 1QO9A 2Q1UA 4B3BA 1JEQB 2I2FA 2OBFA 5ICGA 3AZQA 4FEYA 4JJGA 5FWAA 5HFAA 3NBZC 4BNDB 5IH7A 1VHWA 1AS0A 1JKIA 1ULBA 2B92A 1LJ8A 1NW3A 2AKYA 3E70C 1MC4A 1FY2A 2EW8A 4TWBA 4YJ3A 5FPPA 1Z39A 3VBCA 1T0BA 1UIRA 2ZCVA 2BMAA 1SG0A 1ZGCA 5FXMA 1FYDA 3RK4A 1FNCA 1TUGA 4F5DA 2VYFA 4M1YA 4RMIA 4XAQA 4WOCA 3EXFB 5LA6A 3KDAA 1N0WA 4TTJA 4CBVA 3Q7PA 1H8EA 5HA5A 3H8JA 5I7FA 3ISJA 4H0CA 5BNZA 2OLKA 4WHMA 4OQZA 2JFPA 2MYTA 5G0SA 2X5XA 1I30A 5C46F 4RUKA 4DCJA 2XCTB 4DCVA 4JC8A 4MGIR 1NYRA 4KJZA 2PKQO 2VHXA 4RPLA 4B6PA 1C9MA 3Q8XB 1Z0SA 1KJ8A 2ZYTX 2JLWA 4IDPA 1NOJA 1VG0B 4PNZA 3M4XA 1Q7EA 1QH9A 3HJGA 4UTOA 5ALGA 1PUIA 5ARCA 4D4MA 5EVCA 2GQ0A 1BROA 3I0NA 3CKKA 1E7SA 2CNOA 3MCAA 5FTMA 3VOTA 1TUBB 4L16A 5EEHA 4OU5A 3V8PA 1IZYA 3T41A 4N5MA 1Y9ZA 1UPXA 2HNBA 2R8OA 4PHFA 4ZI7F 3V00A 1TK3A 4F45A 4D0SA 4EMBA 1LRLA 2ZRDA 5KWIA 4X41A 1DOHA 2IEZA 4O4IA 3HXLA 3IVGA 4MW1A 5DV9A 5CAEA 4CKCB 2H57A 4A2CA 3H4MA 4DV2B 3R5HA 1H2HA 3OJCA 3T15A 4NENB 4E2YA 3OF5A 2DCUA 3RGGA 5TGDA 1MIHA 1ISRA 1EE1A 2WU3A 5E6RA 4IFIA 2P4EA 1NY5A 3EBPA 3LPNA 5DBGA 3ZWMA 3EZFA 3K9LA 4MVJE 1I9GA 2EVWX 4I3HA 1GQQA 3T54A 3EIXA 4E70A 2Y1OA 3RAFC 2BBOA 4E5YA 4M54A 4KQXA 3ZNNA 4KGXA 4OHVA 5IDWA 3G0DA 4QRHA 1HDRA 3L92A 5HF5A 2A57A 1UBSB 3WSTA 2HJGA 5I9NA 2CXSA 5EJIA 3E9QA 2WWTA 1B74A 2IOFK 4JB2A 5FBQB 3BUSA 3W4IA 3R0ZA 3N8GA 3AETB 4CCWA 1E1DA 2BGLA 1M10A 2C2OA 1TCBA 3LQFA 2V1UA 1P0QA 2ATVA 2H1IA 2P1ZA 2V74B 4HQ0A 5E8JA 5K2OA 1HYGA 5AKJA 2FFAA 4QU9A 3R3ZA 2AD5A 2D8AA 4K9RA 4MUBA 4AJIA 4DLZA 2WKPA 1NQXA 2H3EA 1O57A 2PZEA 4WI1A 3THWA 2NV2B 4AZ3A 4GS5A 3RU2A 3AUYA 3SP1A 5DPMA 2AI1A 4HTAA 4NOMA 2FW9A 3X1MA 1MV8A 4AJLA 1GZUA 2ORIA 1Z4MA 2IK8A 1IZ9A 5J43A 1F12A 3FZNA 1OXSC 1JLSA 3R3SA 1U7HA 5IC5A 1YB1A 1WDLA 1JHQA 1T9HA 1VYTA 1H23A 4EKYA 5J2TF 3VZCA 3WZLA 2C04A 2R7KA 3B1ZA 4MYSA 2P6NA 1UKYA 2I4RA 3NU1A 4H77A 5JSUA 2H2IA 2ZIXA 1SBCA 2H2GA 3BH6A 1U2GA 1U28A 3JRXA 4JU8A 1WCIA 3X2SA 4JVSB 2XCQA 3ZD8A 1ODFA 3PQ3A 3QI7A 1RR6A 4MULA 4BJ1A 1W36C 1JAXA 3OT1A 4M76B 3OFKA 1JDBC 2ZRAA 1BC5A 3DLTA 2Y9MB 3KVYA 3EXEB 4O59O 4X1KA 3TDNA 3SI7A 2DCMA 3A9SA 3RSHA 2RARA 4RD0A 4CQMB 2FG5A 4Y9TA 2XLCA 1XNGA 2OCPA 2AUNA 1Y6GA 3DZBA 3FUCA 2AWOA 2PVPA 5ULLA 5A7FA 4N48A 1KQ3A 3JASB 1G60A 1HQYE 4HNTA 3U3MA 1P4JA 2DH5A 2BFWA 3B70A 2V4MA 3H9QA 4Z8XA 3SJCA 4GOXA 4DR5B 1N2HA 1VXOA 5KPDA 3C41J 3QFTA 1ZIDA 3BBPA 1E60A 4RA6B 3C5EA 4XYGA 4EQZA 4IEIA 2AKEA 2R4UA 4HEA6 4JWKA 4D0NA 1IVNA 4HAUA 1SB9A 3T99A 3DDOA 5AWFC 3QWBA 3TDKA 4DQUA 3JD4A 5JY6A 1VP9A 1XNJA 2C4UA 3QU5A 5EHQA 5KKAA 1WG8A 1JEJA 1EESA 1XZ8A 4WT7A 4QULA 3NASA 5DZSA 1DBIA 3JRWA 4KYVA 2JAPA 4IYJA 4WE3A 1EI9A 3DE4X 3CVUA 2ABWA 3K35A 2BFCA 4J0QA 3NKFA 2NO5A 3I01A 4Q00A 5ITWA 4J0HA 1XYVA 4BBJA 4E2FA 5KMGB 4OGFA 2GNOA 3D54D 1H2BA 2X19A 3R75A 5KYGA 5JQGF 3K9QO 1YGYA 3K16A 2QQ0A 3VR4D 5T3UA 3D6NB 2GUGA 4S24A 1GNQA 2CLLB 3N6RA 4GEKA 3NHJA 4XQ0A 2HSDA 2ZJ0A 4HGNA 4UW9A 3DEHA 3E7WA 2MHCA 1ML4A 1W9HA 1SUDA 4I6GA 2CJWB 3NBYC 3TSWA 4B45A 2GEFA 1UWLA 3GNTA 3LTEA 4M0UA 2LWIA 3GT3A 2BI8A 4INZA 1K8XB 3KZMA 1ORRA 3L5KA 2NPIA 1W0CA 3FKSD 4TX1A 3AVXA 1C7JA 2OCAA 2Q1XA 2WIBA 5AYVA 5FI5A 5TX7A 4AYTA 3E03A 3KEFA 1UJNA 1DJLA 3UJ6A 5DBEX 3CVXA 3RVBA 5AVRA 1TO6A 1G7TA 5A5FA 1SXGA 1CVRA 1E2UA 3HVHA 2RGWA 3HR7A 4MWCA 4I1PA 4CMBA 5AIBA 4EARA 4M8SA 3INTA 4P3NA 4JLVA 2IZZA 4YJFB 3BMCB 3S2EA 4BX2A 3VA7A 1TF7A 2D00A 3S40A 1RWKA 4O1IA 2PS1A 1XPRA 1Z4QA 3DMRA 1BX3A 1OX5A 2FZWA 2Q8NA 3QITA 4ZV9A 2YJ6A 3ONDA 2GMWA 2Q7OE 5IWCA 5JD4A 2R1VA 4YJHB 5AP9A