2PO7A

Crystal structure of human ferrochelatase mutant with his 341 replaced by cys
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
359
structure length
359
Chain Sequence
b'RKPKTGILMLNMGGPETLGDVHDFLLRLFLDQDLMTLPIQNKLAPFIAKRLTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDCIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrochelatase, mitochondrial
publication title Altered orientation of active site residues in variants of human ferrochelatase. Evidence for a hydrogen bond network involved in catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 137
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2007-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2po7A02
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2po7A01
1TJNA 3M4ZA 4F4DA 2Q3JA 2PO5A 4KMMA 2HREA 2H1VA 1LBQA 2XWSA 2Q2OA 2QD2A 4KLCA 3W1WA 2XVZA 4KLAA 2XWQA 2QD3A 2HRCA 2QD4A 1LD3A 2HK6A 3AQIA 2PO7A 3HCOA 3LYHA 2C8JA 2QD5A 1DOZA 1QGOA 1L8XA 2PNJA 4CCSA 2H1WA 1C9EA 2XVYA 3HCNA 1HRKA 2DJ5A 1N0IA 4MK4A 2AC2A 2Q2NA 2XWPA 2JH3A 2QD1A 2XVXA 3HCPA 1AK1A 3GOQA 3HCRA 4KLRA 1C1HA 2AC4A
chains in the Genus database with same CATH superfamily
1T0UA 1AS2A 3BXFA 3OJXA 1FP7A 3QPAA 4B74A 4FNAA 2WY2D 5AUOB 2VF7A 4Y6RA 3A9VA 3S5JA 5JSQA 2Q6LA 3DZJA 4O4IB 2VH2A 2D1QA 2VHXA 3H8SA 3KLNA 4CKEB 3AL0C 1MC4A 3A0RB 3UV6A 1LC0A 1UDWA 1CULC 1EVQA 1B4DA 2PM8A 1NXXA 3AEQA 1J7JA 2HCFA 3HZZA 3MELA 1MO4A 3Q88A 2HV8A 4MHSA 3GG9A 2HCRA 2I4RA 4WACA 1TM4E 1U8EA 2QQFA 4EI7A 4F06A 1XAIA 3DW3X 4BZWA 2XA1A 3I09A 4MEBA 2WAXA 1ECGA 3SHOA 5DBEX 1TTTA 3LPLA 2H1LA 1X70A 4Y9TA 4AC9A 3C7AA 5CXSA 3HYRA 1NV8A 2P90A 4WDRA 2IEAA 3D0RA 1YL5A 1S96A 3OA2A 1HFKA 4HDSB 4IEEA 1A27A 1C0EA 1YNSA 3HS3A 1DBVO 5CDHA 2EZ8A 2PH3A 2IC5A 4Y9UA 2EJCA 2DKOA 4HN2A 1KVUA 2X42A 5DGTA 3SSNA 3OM8A 1TVEA 3HACA 5KHLB 5JFGA 1EUDA 5JSZA 1GFSA 5IHPA 3KJNA 3SYMA 3FJ1A 3Q4GA 3IEUA 4LTDA 1NVKA 3FLBA 1OE0A 1R9NA 2VHVA 1WBDA 2ZG6A 3CRZA 5EJAA 1HT2E 2G5PA 3NAZA 2LPMA 3U19A 1Z06A 4JJZA 3NV9A 3OI7A 4NCBA 3PUIA 4G89A 4X1KB 3CCCA 3AUUA 3DEIA 3LOPA 1YUMA 3EAGA 1XTQA 5E2BA 1RBYA 5IK2D 2FZVA 4MVJA 5AUPB 4CNQA 4YMTA 5LDGA 5JVDF 5K8UA 4WCFB 3EEOA 1E4OA 4I4IA 4MJXA 5LP1A 4ALKA 2W6MA 4DNOA 4H4EA 1T4GA 3Q5EA 1WZNA 4S1NA 2B25A 4NY1A 4Q3BA 3L46A 1Z7BA 2XRMA 5K01A 4J0QA 1XMXA 3M2TA 3FRIA 3W6UA 1AHIA 1E1RD 1T0IA 2DPLA 2QI9C 4RVCA 1LFAA 5LDDC 1QOQB 1R0YA 3CPSA 3I3OA 4O33A 5DTJA 4G5YA 2EP7A 3QKTA 3RAJA 3ZE8A 3RBZA 1KFKB 4EQ6B 3W34A 3N28A 5DEOA 4W1RA 2I67A 3BF7A 3AY3A 1ETHA 1KE1A 1YZYA 5FOUA 2ROQA 1NGSA 4NFHA 4WLFA 4L73A 9GPBA 5LP6B 1P0MA 1XVLA 3JARB 1F2UB 3NTRA 2PIDA 5TB5A 4CXMA 4KDCA 3ND6A 3JQAD 4ZT6A 1HSOA 2KM1A 4AUMA 2RHOA 1E6EA 1WSAA 2JGKA 3OM1A 1XN4A 2QM8A 3PSHA 2I9KA 3CZQA 3I58A 5FBWB 1QG6A 4D9NA 3WLEA 3WWOA 2YUIA 1O54A 3KPJA 3QVXA 1E5QA 1R6AA 1TLTA 5DLPA 4ZIRB 1F4PA 1JJVA 1CJCA 3FNRA 3M1AA 5ALIA 3A06A 1D5CA 3EUFA 3L4KA 1N7HA 1KZ1A 1TUIA 4OHXA 2JIMA 4B9AA 4PX3A 1RM5A 1QTNA 2V1XA 3EVDA 1R66A 1VLJA 1X87A 4AYXA 1DFGA 5EZ6B 4DIMA 3S81A 4L8FA 1RZRA 4BECA 4L4ZA 5FI3A 1E8DA 1YK1A 4HJRA 1H2XA 3HJGA 1PG0A 2Q2NA 2Z04A 1K6XA 2ECPA 4MWOA 4KR3A 2HU2A 1EFTA 1Z0ZA 3HUDA 4NDAA 4EHHA 1NBWB 1UL1X 4AXBA 1OGJA 2FFHA 2GVZC 2RHJA 1TOAA 2W2QA 2DBZA 3GN1A 3U3DA 5BNIA 1KQPA 2QXUA 3REQA 1KARA 1QHXA 4JEUA 5A7HA 2QT1A 3HRKA 3CT4A 1AGXA 3QVVA 2XVMA 3EIWA 5AO9A 2VH5R 1DI0A 1VPVA 1YRQA 1FDVA 1G0NA 1Y6RA 2EZ4A 4UHJA 1GZ5A 2O2GA 3MLBA 3H5WA 3EPRA 4I3FA 1TPZA 3ER9A 4QGFA 5F64A 4GP7A 4L08A 4JL8A 3EZ6A 4C04A 4Y9RA 2WMNB 2VTVA 3P1JA 2DWCA 1R0SA 4M3NA 1LZLA 2XVXA 4YRDA 4BMOB 4RKWA 3ZWKA 3C8DA 3OEYA 1GZDA 2F8TA 4R6WA 1W85B 2R8YA 5HTKA 3F8SA 3VZRA 2DOKA 1E9SA 2XUAA 5EUMA 4BV3A 5FL7A 3IUYA 1SCUA 3TTYA 3B36A 4BVEA 4PTZA 4PQGA 2RKWA 1EXNA 3EQ2A 4A2QA 4D8UA 4C0JA 3OM0A 1P81A 2GCOA 3QFRA 4DCOA 2YFHA 1MZVA 1N0WA 3AY0A 4PS1A 4WOBA 5ICGA 1I7SB 4KU4A 5MN5A 4ODIA 4YQZA 1YR6A 2ZAMA 3HXLA 3KTAB 3FJYA 4MW1A 4UXJA 3A6PC 4TWRA 1RZVA 1GG9A 3UMGA 1LK0A 1FLAA 1JIIA 5A06A 3N2LA 1Y9AA 5K4AA 1QFYA 4Z4EA 3HEBA 4L7QA 1M67A 3W9UA 3GQBA 2NO1A 1J8MF 5CIQA 3E22B 3JD3A 2ZOSA 1M1NA 2O8DB 4U2CA 5CVVA 1P62B 4YUWA 2GPYA 4XB1A 1T35A 2CD7A 3FPCA 5LXTB 4B2PA 1TU4A 4YMGA 2HDNB 2GT1A 5C7LO 4F12A 5LMCA 2W00A 4HB3A 4IRMA 1YF3A 2NXEA 2PZJA 4HGPA 4G5FA 2AA3A 4HDNA 4KYVA 5HZGA 2PVCA 3B6KA 1KMQA 2W6JA 3Q85A 4DJ5X 3HN6A 3I30X 4TUYB 1AKRA 2GILA 1KZGB 2B30A 5LD2B 1J39A 3EGCA 4H3HB 4LS3A 1HE1C 1I9GA 1NT2A 3SVLA 1DTWB 4TXJA 1GAWA 2PGAA 4JQYA 1OY1A 1XHEA 1XVUA 3DJFA 2FF5A 1NJ6A 1T3HA 2P9GA 1IULA 1LI4A 1UWKA 1KI3A 4Y2YA 3HYSA 5F9MA 3OKFA 1CW2B 4R1PA 2RK4A 2CVFA 4B32A 5AVJA 4M0KA 3W05A 3T94A 3BMQB 5DHPA 4LGCA 4CR8A 1MEEA 2H1HA 4XUDA 3SX2A 4AN4A 5K8CA 2HLPA 3RKUA 1J6UA 1N57A 2HWUA 5TMDA 5A1TA 2D8AA 2HHCA 4PX2A 2ZI6A 1F14A 1MIOB 4ZGWA 1PWXA 3QYJA 5LJLA 1EUQA 2XMPA 4GXTA 2O8NA 3KKMA 4FR2A 1G60A 2B20A 1BKDR 1T2CA 3ONWA 4URZR 3EVZA 4DT1A 5KCMA 3DVQX 1G4UR 3ODGA 1Q2XA 3PHBE 2H5IA 3VAAA 2X8JA 4DMRA 5BORA 1N7IA 5HP4A 3PPWA 2RGRA 3PVCA 1BCSB 2PGDA 4KAAA 4D9BA 1TKCA 5HUHA 1A50B 5H02A 1DG9A 1Y8QB 4YDQA 1FTGA 1C50A 2FR8A 4B7XA 4HXFB 3RFUA 1RIIA 3D5TA 1DVRA 5K3SA 1I3LA 3TG8A 2Q4TA 5AVRA 3F0TA 1XTVA 4FFLA 4XYBA 1RI4A 2DBQA 2R87A 2AHRA 3DG9A 3LS2A 5HJ5A 4FMPA 4V0ME 2PKXA 2YWXA 4BNLA 5K51A 5LBUA 4TSFA 2MT9A 3HCDA 3M5PA 5KYYA 3OOEA 1WULS 3FCEA 1SU6A 2D7CA 3AWIA 3G7NA 3TDMA 2PH1A 3LDAA 3DS8A 4L8YA 3RNLA 4XUCA 3EHDA 4O2AF 1QP7A 4JJKA 3QVWA 1I80A 4KXMA 2E1RA 5BSTA 2IF0A 4V24A 4UOQA 3TRFA 1ODLA 2KLHA 2XKJE 4P34A 1BXRB 4CFSA 1Z0KA 1KP9A 1H2HA 4JUAA 2P5YA 1XAHA 3B6JA 3RS3A 2NV0A 2QE7D 1QUFA 1QDLB 1GKYA 3ILSA 3PCXA 1D4OA 1HA3A 2PS9A 5IJ9B 3GUCA 4CIDA 4ISCA 3ZZTA 1JRLA 6Q21A 4FWTA 2PKCA 2PZ8A 2B78A 1D6JA 3WFZA 3Q3VA 1N3IA 2GJ4A 2NU9B 4YRMA 1UODA 4KREA 1X1EA 4WGGA 4OXIA 3VKUA 3U1BA 4PLHA 1T9ZA 3DLAA 3GEHA 2PUFA 3MJVA 2CT8A 1N7JA 3QFFA 1QVAA 3ET4A 2GJAA 4OSEA 4B34A 2I8AA 4KX3A 4MUXA 2YMMA 1AO0A 4L22A 3WGZA 3LECA 4BWYA 1H9BA 3LNCA 4LYYA 1XJQA 4FBMA 4TYNA 4PQEA 4TRMA 3K0AA 5T5QA 4DCPA 3FYTA 3JASA 1TYBE 5FO0A 3N2IA 4KQIA 4D8VA 3K1AB 5IJ0B 2G25A 1EVZA 4CIBA 3BDIA 4X91A 1EFLA 1WUYA 4KK4A 2FSIA 3MN1A 3OCWA 1UKBA 1U1EA 4BMYA 5HRCA 4FMCF 4FLFA 4PO9A 4CWAA 2BP7B 4WK2B 1S89A 1Y89A 4UAUA 2ONCA 2AYYA 3OPMA 3TXAA 2VUTA 5E3JA 4MW0A 4CIWA 3AB7A 2WC1A 3B5IA 5JIBA 1T8TA 2RGNC 1K89A 3IUJA 5FPQA 3Q0IA 2G5GX 4UTRA 3EPJA 4J75A 3GPIA 2XMRA 1TA9A 3HUFA 1JDPA 3PEYA 1OAKA 5H3CA 1MJ5A 5GY7A 1U02A 1VZ2A 5CLFA 1Y7HA 1JP7A 1KI4A 4HZIA 3D43A 3SNKA 4XFKA 4XSVA 1C9YA 2DFDA 2EFYA 2YZ2A 3W4JA 1CP2A 1QVZA 4A2PA 1GZ6A 1P7ZA 5HX7A 3ZHCA 4IDHA 2AJDA 4H59A 1ZNQO 4RTSA 3QLJA 1ZR2A 1TCUA 5HK9A 3IEIA 3EIFA 4L5JA 2Y0BA 5ECDA 2FN8A 3JSXA 1CY4A 2X3FA 3H17A 4XLZA 4RHEA 3TNLA 1VC2A 3HKDB 2M1XA 1FEZA 3DD1A 1H0KA 1MCZA 3IPAA 2XTZA 2OCYC 3C97A 5DPMA 4AMUA 2WJVA 3SZUA 4E5KA 3AESA 3FYDA 5DI3A 3FLEA 2NZXA 2RAUA 3QVKA 4B35A 2V7PA 1ORWA 4J4TA 1CUIA 3VR6H 1QG2A 4MPJA 4BNDA 1SUFA 3ZCQA 4H0FA 4TV9B 3AF0A 2W2NA 3RS2A 2QM3A 3GFOA 5IT4A 3LI2A 3R7WA 4FFWA 3SMQA 3QOWA 1OH6A 1NW6A 3JVIA 5FV7A 1AIPA 2Y0PA 1M3SA 2FE1A 5T57A 3R7LA 3BK2A 3ZQ6A 1FUUA 1ZQ9A 2X4LA 3HB5X 4NOMA 1KJQA 5DO9A 4NCAA 3LUCA 3SBOA 3ENZA 4X54A 3DBLB 1OWPA 1SIUA 2LDXA 4EW1A 4EY4A 3VPSA 1B6GA 3RVJA 4ND6A 4HAYA 3IQHX 4JR0A 3JZDA 1E9AA 3U4HA 4ZAFA 3O73A 1XPOA 1RMTA 1WXFA 2Q1YA 4R1LA 5EERA 4DILA 5D3QA 4NFLA 2ECOA 3WGHA 3U48A 2J5BA 2VPXA 5J40A 1SCJA 1W5BA 3DR3A 5TSDA 1RLJA 2JAPA 1SXJE 2BKVA 3ADOA 5LLSA 4JJEA 4YI5A 4OYYA 1MQ8B 1N2OA 5IMBA 3WAJA 1JH9A 2AUMA 5CGZA 2QTLA 4NULA 1HTTA 4KO3S 4RDXA 2F9LA 1MTZA 4E5UA 1H6BA 4P5PA 3TQSA 4RD2A 3H3FA 1HT3A 1USVA 2A30A 1XNHA 3K32A 5E9AA 3TDNA 3OLQA 4TTIA 3LW7A 3TQHA 3EPLA 1NF9A 1R4NA 1RJWA 1YQGA 3PNOA 1KYIA 4F11A 1YB1A 5FADA 3K8OE 4GR9A 2QK4A 3KTDA 3L84A 4JOCA 3I9OA 3O1JC 3K8YA 2XIQA 4KMRA 4MVWA 3WZLA 4QYIA 4ZHSA 1Y1PA 2OE2A 5IG2A 3KZ1E 5TGTA 3WGJA 4FK8A 4X97A 1O3YA 4A6EA 3OOHA 4GOKA 2GWHA 3ZQJA 3CLVA 4WN9A 2QMZA 2SKDA 1N7GA 4HL6A 1PD1A 3T3HA 1OFVA 1CUDA 4CT5A 4JLUA 2Q2QA 5D5HA 3QBJA 4MNTA 5I48A 3IUQA 4QHSA 5FB3A 2QL5A 1OC4A 4Z0HO 3GN2A 1NYQA 1Y7TA 3C3DA 3O3CA 1CEQA 1KO1A 2ZU0C 3F73A 1J2YA 4W63A 2J9YB 3I53A 1M2VB 1I3OA 2BEJA 3FZQA 3RRNA 2NO7A 1DTSA 3P19A 3BL5A 3A10A 4ENVA 2FKAA 4POOA 1Z5WA 3I6IA 4OLHA 5FWYB 3TZEA 3P9ZA 1JXAA 1F5SA 4DIEA 1FFSA 1NXOA 2EXXA 4BMPB 1E61A 1G5RA 3Q1LA 4XTCS 1XKTA 2PANA 1LCIA 1ZN8A 2D3WA 2P2ZA 2B4AA 1WHSA 2AN3A 2FMHA 1XRMA 2HJHA 2OMKA 5J4VA 4C1NA 2HH9A 3D8SA 4BE7B 2N47A 1D2AA 1JEOA 1N8TA 3KIPA 4EMTA 3VU8A 3KD2A 5AM0A 1KJNA 1Q0HA 3EZXA 3OC6A 4KQWA 2ZXUA 1OBOA 2HMSA 2DHEA 3G0BA 1JEJA 5FTJA 3EVCA 3GZJA 2CK3A 2FWPA 5IM5A 3N59A 1B0UA 1YBHA 3L7OA 2Z2KA 3S2FA 4QGHA 1QCCA 3RBXA 2NQ2C 3EXEB 1H05A 2OXIA 2C00A 1LDGA 2WOJA 1PEYA 1OJ7A 3B51X 5JUWA 1HDZA 1YV9A 3BQMB 3PQ6A 4PHCA 1W2WB 4NMWA 1X8JA 2Y67A 1FNBA 2LR0A 1U9YA 1Q16A 1WP9A 4IH4A 4BLVA 4DMLA 4D3XA 1QTRA 2AG8A 1Z62A 2A1UA 1QJCA 1QAOA 3A04A 1M5RA 5AKXA 1L7DA 2PQ0A 1GL7A 2QUAA 2XCOA 4D3YA 3HVRA 1DJPA 1DXHA 5DTIA 1BD3A 1NDUA 1JPVA 4BKOA 3T3GA 4JUFA 3W5VA 1GJRA 1P4HA 2AX4A 2XVZA 3MCZA 3QJ5A 3EXFA 4MVCA 3LDUA 2Z8YA 4A7PA 2EBWA 1KFCB 3GD7A 4HPXB 1EVLA 3H42B 2P2NA 3QPCA 3FHLA 1D07A 2R1ZA 4EG0A 4A15A 4D9EA 3GMSA 3KB8A 3HXOA 3T35A 2A6PA 4UE6A 4Q0MA 5KIAA 3PXCX 3FIUA 5F5NA 1IIBA 5DIFA 1JDBC 2PMBA 3F6CA 5ARBA 2PUCA 3AR8A 1BXGB 2IIBA 4R8SA 4O2AA 4C9BA 2AFIE 3ILYA 1UR5A 2QE6A 3EG5A 5LVAA 4AJOA 2WIAA 5K2OA 1RS0A 2WG1A 4NCNA 3AFHA 5B7PA 3O3NB 2HRDA 2XBUA 4EATA 1RQPA 1P72A 2ARKA 3WHIA 3R9XA 2OYCA 3Q1KA 1B8OA 1R6VA 2FPIA 4UTOA 3WMGA 3GRUA 1QH8A 5IDXA 1H0RA 2ILTA 4MYTA 3ECSA 1DO8A 6NULA 4OK6A 4QDOA 2Q49A 4B71A 3AF3A 4LBWA 4BFXA 1DOAA 1TKBA 1RQLA 3JAKA 2SHKA 3ML1A 4GAEA 3R0VA 2QG6A 5SYNA 4EKYA 4ZJYA 5KBYA 3GI1A 3M81A 3NW9A 4PZDA 3UK0A 1YBFA 3IE1A 4EHKA 4HB4A 1CE8B 3DLHA 5CT6A 2B6NA 4YY3B 3WBFA 4PZ9A 1VSQA 4AP9A 5EMKA 4OHMA 1QYDA 5KAPA 4JBXA 1RDFA 2OORA 3HBFA 4JBLA 3NG1A 1RHMA 4MW5A 3HY3A 4WK0B 1ZGZA 3VHRA 5HK8A 4D9JA 5K0EA 2X0JA 4QX6A 3ZHBA 3UUGA 1DAMA 1QHEA 2WE8A 5JANA 2UZ0A 3ZD8A 1DC3A 2QTZA 3H99A 5JD3A 3VPBA 4AZ3A 4G67A 4F5EA 2WU4A 3FBTA 4LWPA 2H7XA 2OMEA 3T5GA 1YR8A 1HRDA 2ECKA 3LWZA 3JD4A 3REFA 3BCSA 4PQFA 4C7MA 1Q15A 2Y2VA 2BBSA 2BMVA 3OZCA 3TW8A 2D5AA 2RCNA 4ZV9A 3I2IA 2Q3BA 4CHGA 4UUAA 1OX4A 4JVOA 4KDRA 4LQ4A 4F46A 5AVSA 5LU8A 1GPNA 5K3FB 3WLFA 3LKVA 4BGIA 1O8CA 4TQ9A 1QIDA 3E5MA 2C3PA 3RYCB 2CHVA 4UBJA 4PC7A 2DEUA 1JR3E 3AEYA 2IBMA 3C6MA 1OFUA 2QS9A 2HM7A 4X20B 1LSJA 2GZMA 2VDKB 2A57A 4GLFA 4FGUA 2NIPA 1WVMA 3K3PA 4GI5A 4BVAA 3M7IA 1J0XO 2V5UA 1P6QA 2HXYA 2QT0A 4EKGA 3K6KA 5JAHA 3NHZA 1H2EA 2GPBA 2VRBA 4XRRA 1GA4A 5C7YA 5GJBA 4PONA 1EVEA 1NFFA 1E5LA 1I32A 2FWBA 3D3JA 3QUBA 3K2EA 3ESCA 1SFRA 3IE2A 3DQZA 1M2JA 4DSZA 4BGEA 2I54A 4CM9A 1U7PA 3RFVA 1OWMA 3KPVA 4WT7A 2HQOA 3TX6A 1KQFA 1QGAA 1E2NA 2JS7A 3IUNA 3OPVA 3P9CA 2WSYB 4RMNA 4I3HA 4E88A 2L82A 3CF2A 3L4SO 4OM7A 5BT9A 2DKNA 5G1OA 3I6QA 3N2YA 4CM5A 4C4AA 1DQSA 2GM5A 2CFSA 1K98A 3FWNA 5FPTA 2RBKA 4BKRA 4TMFA 4L57A 3T9DA 1Q57A 1SIBE 4BV9A 4CIYA 5KVSA 4RIGA 3L4BC 1E9DA 3MUNA 2NWQA 1RXYA 4NJOA 4WRRA 1Y7PA 2FPXA 4CQJA 4ZICA 3IUBA 4ZT4A 2W6NA 3ZHUA 1PR9A 3FHTA 3OQHA 1R18A 4MV4A 5HZKA 1M5UA 1PZXA 3F71A 3CJQA 2HEIA 4K05A 5C2JB 4P58A 3GEBA 3ZCSA 1KY3A 4GOOD 4BO2A 1DT3A 1PP4A 2DTXA 1M34A 1IVNA 1SBHA 2R6R1 3BHNA 4NZOA 4MWSA 2G36A 2FPGB 4Q1FA 1D6MA 5I7VA 4WKNA 1YKFA 3OCYA 1NATA 1X7DA 1X7WA 3OPXA 4MUEA 3L1IA 3ND5A 3D8HA 4ZO4A 1FJHA 4H0NA 1E69A 4MHOA 4MARA 3R41A 1XTBA 4H31A 3S7ZA 3V4SA 5K8TA 3PPXA 1A4XA 3PCRB 3TINA 2IODA 3AV3A 1C4KA 4K2HA 3UOAB 1KIFA 1V1RA 2ZIUB 4LVCA 4PCUA 1A7KA 2YNMC 5LYJB 2FEAA 4GZ3A 3QKWA 2DLNA 3GT0A 5KWJA 4H7JA 5ADUS 1IPEA 1CS0B 2NGRA 5CB6A 4OKSA 4PX5A 1JL3A 2J0SA 4KYUA 1DQRA 1GRNA 1GUAA 4DBLE 1I9CA 2Z5LA 3QVLA 3EXG1 3A6JA 2Y76A 1E89A 2VJNA 3DDNA 3E82A 4LYJA 3TTTA 2H2IA 1DKPA 3IUSA 2BMJA 4R1QA 3UATA 1C1YA 1X74A 4IHJA 4XIIA 5EJ8A 5IJZA 4FOSA 3ZCXA 1XRNA 2Q1TA 2NXNA 1YL7A 1F2DA 1P80A 1U90A 2OQRA 1R6BX 2OR3A 3BXEA 3NB0A 4OAPA 5TRTA 2GCIA 1UBSB 4AICA 3K1YA 3AJDA 4O02B 2HYIC 3MOIA 3NATA 5HJEA 2Z8XA 1IY8A 5IT9A 1MIHA 1I2DA 3D0QA 4Y2QA 3ESAA 3WWCA 4BMCA 1JBEA 2RGBA 3EXHA 4HXEB 5F1PA 3K70B 4M76B 1O9BA 3U4MA 1LGYA 1JHVA 1XG5A 4BUCA 3QMVA 1M8FA 3HCCA 4BNHA 3AFNA 1DAFA 1VJRA 1QQ7A 2HLHA 3M4ZA 5BP7A 3O2SB 4B6FA 3W5SA 3VHLB 1Z2OX 2WD7B 5CU7A 4HH3C 3A26A 3O38A 2VPWA 3H86A 2P2SA 3SJAA 3IALA 1OB5A 4G1MB 3H2YA 1IHYA 3A9TA 5A05A 1VRWA 5AJHA 1L7VC 1RE1A 2EFDB 3ZG6A 3G2KA 3BBLA 4MMZB 4F92B 4R7TA 1F60A 2V7GA 3ELUA 5DF1A 5B3KA 2CGEA 1Q77A 1WF3A 4OXKA 5A04A 1EXMA 2X1LA 3JD1A 3DE7X 4AO7A 4DV1B 3MBIA 2D5BA 4FOLA 4QELA 4RPGA 3KOZA 3AJEA 2JLUA 3MAJA 3G0OA 1XEXA 3R7AA 2ZAIA 4Y2JA 2CLOB 2UUPA 2ZWVA 4DSTA 3RVLA 4F1JA 1XZDA 5FUVA 2JK1A 3B12A 2VYNA 3PD7A 4JP2A 4CUKA 3KRTA 3ESZA 4CM8A 3C7KA 3CVWA 3P45A 5HKOA 1Y5IA 4NG4A 3B8HA 1OKKD 4AIIA 1UMDA 3OZRA 4O59O 1G8GA 4MSUA 4GX2A 5JV5A 1PI3A 5CJJA 1INLA 3H2KA 2CDBA 2IS1A 4XRGA 1SB9A 2BHSA 2ZS9A 4FGLA 3L7YA 4FT4A 3A9CA 1VPDA 4IX9A 2DRIA 2Q5OA 1P33A 1M6YA 1JFTA 4BVFA 1VLZA 2GEUA 5HDBB 2PFSA 4LRYA 4C30A 1FP4B 1JYSA 1CV2A 4MIKA 2BFNA 2HJ9A 3QEMB 3B1YA 4PY2A 1BWQA 2BRUA 2G09A 1GAXA 3PICA 2IH2A 1IN6A 1CNFA 1U2TA 3DE0X 3OOSA 5CT4A 4DDHA 4Q9HA 4CKEA 2H00A 2DH5A 3IXLA 2FDRA 1ODJA 3UAGA 1NW7A 1EIWA 2JFNA 2V7XA 5CJPA 5FPSA 4KE9A 1SUBA 2I7DA 2XLCA 4DJTA 1O0CA 2P6NA 2FG6C 3GEGA 1X7YB 3K5HA 4MO2A 3FSRA 4OVKA 2ZDQA 3NEPX 3UMJA 3RIGA 3JWHA 2CNKA 3PBKA 4BEWA 3ADBA 2BGLA 4ZAWA 1LBEA 1OXKB 2BTEA 3RSGA 3TB4A 2FPRA 1KK2A 2H6EA 5EHZA 4HDSA 1JN0A 4TT3A 3T7TA 1G3MA 3T5AA 1G7TA 4HGQA 3AILA 3FF1A 4A3SA 4DLVA 5I4KA 2Z2ZA 5CXUA 1P60A 1JPNA 1QFXA 3KJZA 3G0CA 4F56A 4IJVA 5CAEB 2JCGA 4FDTA 3MJTA 4DDMA 2BSAA 3LBYA 5DN6A 2C2HA 5E4FA 2A9JA 4FOTA 1AS0A 4JX9A 1GIAA 3PHGA 1NR7A 3OSZA 1C30B 1PJ2A 1RWOA 2BFFB 4JQZA 1AF7A 1LF0A 2RH5A 4L16A 4N4AA 1VYUA 4ZU1X 1RPZA 1QRTA 5CG2A 1Z8FA 4QU9A 2J9FA 2DB3A 5CH3A 4IXNA 3T5PA 1DKOA 3HBAA 4Y6OA 2QP9X 4PNEA 1GDTA 1ZCFA 2P91A 2WQZA 4TL9A 1YCHA 3BAFA 5MN4A 3UMRA 2LKCA 4UU1A 4FBLA 1DG3A 3A7EA 3AO0B 3EFEA 1GXSB 4ZT3A 1G1AA 1XSEA 1NUSA 4FJ1A 4AYWA 1XZFA 3E5RA 5BV8A 2QQEA 4JT2A 1PZGA 2J3LA 2WSIA 2G4CA 2PBFA 5CCBA 1K6EA 3K0FB 2F3UA 2Y8EA 3KSRA 3QX9A 4NF2A 5G2OA 1SOMA 3THYB 5EWJA 3DONA 5F35A 3U60B 5IAKA 1JWBB 3ETGA 4D4IA 5IXJA 2D1SA 3OO0A 3UW3A 4BMVA 3P2EA 3CRMA 4N0MA 4Z1MD 2JASA 5KKCA 3E3AA 2CXPA 3E3MA 1IM5A 2CEKA 1G6KA 1MO3A 5LN1A 1OBVA 1B23P 3RS5A 3JARA 4ZYVA 1NVEA 1LC3A 1RWNA 4C08A 1W581 5KQGA 2R47A 3FF4A 4KPGA 4AL4A 3AERB 4BY9E 1U6JA 1E9VA 3QF4A 5DX1A 1ZC3A 3ZJ5A 4EQZA 2EHDA 4FGJA 1VMIA 1XCMA 2IW1A 5CFRA 2DPHA 3I6ZA 4JJ7A 1CZLA 2AH5A 1AURA 4JL5A 4GYJA 2DUJA 2H48A 3LWDA 1OXVA 3L79A 4J7AA 3KCNA 4M7RA 1Z0IA 4IHQA 3OQIA 1QH1A 4UHDA 5FTKA 1L5OA 4R16A 5BRNA 4HDRB 2GASA 3AH8A 3NM5A 4BX9A 3ICQB 1C41A 1WPRA 3WIVA 4KR9A 2A0YA 4M36A 4TROA 2A92A 1TGVA 3B1FA 4NMXB 3MC1A 2G0NA 3C0KA 2H4YA 4IS3A 1F48A 2EF0A 3DHNA 1KQOA 3N8IA 1T5DX 1RKUA 2BGIA 4XDGA 2XGOA 3CXRA 3ENWA 1EM6A 2IYUA 4LF9B 2O7QA 4EABA 4ZDIA 2QI9F 3STTA 1MW8X 1NJ8A 1LK7A 4DOMA 4KR6A 3ISTA 2PUBA 1XJ0A 2E48A 3RRXA 3I05A 1TQ4A 5ARDA 2ZEJA 4Y6QA 3DHYA 3EC1A 1KYQA 1HL3A 2B8WA 2P0YA 1FJ2A 1BS2A 1NF3A 3ILVA 4MQLA 4MS3A 1Y8RB 4E1VA 4W5HA 4ZCTA 1F3OA 3SMVA 5IVHA 4FR0A 2IQIA 2XOXA 4H7EA 3DFZA 4O3FA 4Q4HB 4RVDA 3PFKA 1RAEA 3LPNA 3SVZA 3DKIA 4YEDA 4HFMA 4IKEA 1CT9A 4GRAA 2JZCA 4PHHA 1CZOA 1GG5A 4QG3A 1DIBA 3D59A 1QIMA 3SZLA 4BMXA 3S44A 2NSLA 4K9MA 2MSWA 3H6GA 1NURA 3O4FA 1CQXA 1RQGA 4Z49A 4RPHA 2LNDA 1PN3A 1NF2A 5THXA 3RARA 5J63A 2RAPA 4ZPJA 4C76A 1J2EA 3TLAA 4DNXA 3D6TB 3WWZA 2FDCA 1W25A 5FX2A 2VSFA 1ZICA 3I1IA 1NVBA 4AP5A 3CUEF 3DMHA 1MG5A 4TKUB 2HA3A 4EGFA 1E7RA 4XAQA 3U1VA 4BC1A 2FQYA 5ED4A 3U7QB 4YASA 3SQOA 3INYA 1JR3D 1LTQA 4PYQA 2Z1MA 2ZYUX 5BYJA 3PVSA 5BV2P 2Q4OA 1Z16A 1W4RA 1XJWA 3UAXA 4UNPA 3KALA 5AP9A 3HYLA 2Z6QA 6CHYA 2IV2X 3C3WA 1X94A 1Z4MA 1U1CA 3WK5A 1DELA 5DGIA 4A8PA 2GLXA 3JZFA 3QPUA 4QTTB 3M89A 5T41A 1QP4A 1XZJA 4I4NA 1WD5A 2XRYA 2EGHA 4GOMD 2P1ZA 3QFHA 2MDTA 2R25B 4FFBA 4FMDB 4OHZA 2RGAA 4BVJA 4E07A 1U2QA 3J80A 2ZI7A 4IQ8A 1XL1A 3SD7A 2XHEA 1G4AE 3SHFA 3DOHA 2C94A 1EP3B 1XD2B 4LOKA 1VJCA 1DEAA 1MNQA 4R1OA 2BPOA 3B9BA 4M1WA 1UBMS 1E0JA 2X9LA 2CJWB 4OI2A 2VYFA 121PA 1G3QA 1LDYA 1JI3A 2Q3FA 2OK8A 1E9CA 1OSNA 3LFHA 3LT0A 4L2IB 2O2JA 1K7YA 3BMQA 1JH8A 2YY6A 4IGKA 4X8MA 1P9WA 2UU9B 1OYVA 4H2DA 5EIOA 4DQKA 1NY5A 1O1YA 2C61A 3L01A 1X42A 2I6UA 3KZCA 1WCYA 4MWGA 1IUOA 5CDSA 3ZD6A 2JZOA 2XV1A 1SR8A 1MIOA 4ENUA 1DOZA 4DDTA 3OWXA 2O8BB 1R6XA 2P5TB 2A84A 2GHTA 2EYUA 3PZBA 3MHTA 4Z3DA 3MLEA 5FDFA 4RF3A 5LJIA 1Z07A 1T5IA 1QRRA 1B3BA 4D4GA 4DG5A 1BCSA 3FFXA 4ZGBA 1UP4A 3HB4X 4V0RA 1Y8QA 1TA4A 4N41A 5C4IA 3OPYA 4FCVA 1E2FA 4CL8A 1Q1ZA 1RBZA 4PZYA 3CIFA 1C0IA 2GPWA 3NKLA 4UBOA 1MPTA 3NJ8A 3OQ1A 4XM2A 4DCSA 4HH4A 1TKRA 2NU6B 2ADMA 4YIHA 4GOND 1WEKA 5K8LA 4M83A 3CNEA 2C3YA 2FUNB 3UVEA 4E15A 3W8NA 2OBLA 3RK1A 3ZXXA 4UPEA 1XCGB 1HDOA 3AUAA 3EGXA 1SXHA 1Q14A 5B57C 2CDAA 4I50F 3VOSA 4BQQA 1DQPA 4LYGA 1QWOA 1QCDA 4JV5B 2CXXA 1C7ZA 1FRNA 4LXHA 3EULA 5KNDH 3B3JA 1YZHA 3DMPA 3S55A 1BJKA 1BXRA 3QSYA 3NRCA 1M74A 4ZTBA 2GO1A 3E35A 4FHCA 4QEZA 3Q10A 4KXVA 1KVQA 1ABBA 3BMNB 5IJ9A 2PX3A 4C88A 2BEVB 3PQ4A 3G1TA 5CNIA 5ENDA 2O20A 5JEEA 4KE8A 1E1NA 3BGVA 3OD1A 4H7FA 4XSHA 1XZAA 1TU0A 4OQNA 3UGKA 4WZZA 5ULLA 3VPDA 1SVNA 3LX6A 4A82A 4RHYA 4EL0A 5AM2A 4UBNA 2P2DA 2YQZA 1GT6A 2F7SA 1BKSB 3HKEA 2WKPA 4N7JA 1VB3A 5H9VA 2I4LA 5LQSA 2Z57A 1Y3HA 3BX1A 3QLVA 1Q2UA 2WSSA 1BMDA 4JB3A 1XWIA 3LGSA 5DH9A 3BJMA 5DYIA 3DDUA 3MTEA 2R6GA 5IAGA 1UMBB 1HTBA 2QMOA 4B6JA 2V6IA 2HDOA 2W6QA 1CRWG 1KO7A 2XCSB 4CMIA 1RAGA 5C53B 4F8JA 2JHCA 4EP1A 4RGVA 3EC7A 3IOYA 3O4IA 4AY4A 2EQAA 5B1YA 2II6A 3L6UA 3T1NA 5BPFA 1UJ5A 1WXXA 4DUPA 4C7VA 1Q1AA 3TL2A 2R86A 2YCBA 2AJTA 3JR7A 4J1TA 3U39A 2C9OA 2BP7A 3K9GA 4F72A 2O2HA 4XQEA 3GEEA 2KWIA 1NULA 4KXQA 1T6XA 2XQKA 2YWRA 2WICA 3AOEA 2C4NA 3C3PA 1FMLA 4KKVA 4LJ4A 3GVCA 4AROA 1XZ8A 4BMSA 5LZ7A 2QQ5A 1CJSA 4AK9A 2UYQA 1IZ7A 3M6LA 1RVV1 3WRYC 1Z6TA 2BI4A 4NSNA 3R3JA 1TC1A 2ECFA 1GV0A 1WZCA 4RLQA 1D4AA 3EEQA 4UBIA 5KTOA 1P0IA 3RGGA 1CPYA 3M9XA 5CEFA 4B3RB 3BM5A 4F3RA 4W7SA 4QDZA 1RWPA 2F1KA 4LIPD 5D7BA 1MEOA 4MEJA 2Q2WA 3H5RA 1PFUA 1UPCA 2JGFA 3OQMA 3UANA 1ZGCA 3KEMA 3COWA 4ND8A 4RJIA 2QXYA 1LLUA 1JIUA 3H6KA 1PVOA 4KQHA 4JLKA 1T8WA 1KMCA 1D4ZA 2CLDX 3FNBA 5FWDA 2AKYA 2I2AA 3AVTA 3MT9A 1H9CA 2EYQA 4KEAA 1HNNA 1GCUA 1K8XB 2AOVA 1YVRA 3BSSA 4JBNA 4N54A 1IQ0A 2HWWA 1FNSA 3P9RA 3UTCA 2JIDA 3DV2A 5CVDA 1CDOA 2NO6A 3EJWA 4XWAA 1A5BB 2OGUA 4EW6A 4RZIA 1CUGA 4QVIA 2H65A 4RSHA 4NXNB 4MAFA 5IS2A 4P98A 1Q6ZA 4U7DA 1ONPA 1PNOA 2HXGA 2MSEB 4YRAA 1EX9A 3TIFA 2JVJA 3K05A 4YCDA 1V6CA 2FKNA 2RHHA 3GLUA 4AZSA 2V65A 2ZYVX 1Z18A 3UMBA 3I72A 4TV9A 4EHLA 3OUUA 1QCZA 4EJSC 2YMQA 2BGNA 2W48A 3B2NA 4HLUA 3ZDAA 2WSLA 2Q21A 4DA9A 1ZBDA 4CM4B 4UTNA 4BNMA 5COBA 2XDWA 4CN8A 3WZ2A 1E4YA 2NSDA 2ZJ5A 3EOBI 3OLWA 1XZNA 3CGGA 3B6MA 1GQYA 1ZCZA 2GI4A 2P9TA 3FE2A 3L0OA 4GUAA 4HATA 2P67A 2ZRNA 3KELA 5AK0A 4FUQA 3DUFA 1RKXA 4BLWA 1H6AA 1YS2X 4LZWA 2H52A 4GVLA 2P2CA 4WCVA 2W8BB 4WFJA 3UK1A 1ZL2A 3FCAA 2ZUVA 4DMMA 5LA6F 5EJIA 5AVXA 2WPDD 3QHPA 2BEWA 3WAKA 2OCXA 3E15A 5HPYB 4M86A 1ULUA 4NFSA 3ANSA 3FTPA 5JARA 1B8NA 2WA1A 2FR0A 2ZWIA 4J0KA 2Z8ZA 1NNLA 4P5DA 5AT1A 4C5CA 1TUEA 2FR1A 3FYSA 3HWRA 3QWFA 4EG1A 1P1IA 4AURA 1RHUA 5EXDA 3PRKE 4G6ZA 3RF7A 1A9OA 4F93B 1X1QA 3O4HA 2VIIA 2QJWA 5EJ2A 4O8ZA 3V6MA 4B1FA 6ADHA 1O6BA 2FJPA 3ICCA 2AEEA 3D6JA 3KR0A 3L5OA 1K3TA 3C4QA 1YJCA 1ANKA 2CZQA 1LSOA 2QRGA 3LA6A 4KQEA 3ZK7A 4R98A 4E51A 4OATA 4EYEA 3NBZC 7MHTA 1TYEB 2BHLA 1G20A 1UDXA 3SDBA 3WIBA 5F7OA 5IXSA 2FW8A 2ZRCA 1P1RA 4CF3A 4DABA 1GN9A 2ZTSA 4FDVA 5ABPA 4JXJA 3WDKA 3KQHA 3WAGA 1N5IA 1XL0A 3KQYA 4OQYA 5FOWA 1VLLA 5FP0A 2BJVA 2XB9A 3TOZA 2LWIA 3PXBA 4IXTA 1K66A 1SM4A 2H1WA 4N01A 5CT5A 4HUQA 1KQNA 4FPXA 1L4LA 3U4IA 1AB6A 3BXXA 3PYLA 3D4LA 3HXPA 4BN4A 1PG2A 1RRVA 2XQVA 3JY6A 4ZYWA 5JALA 3U3KA 1K4MA 3DBRA 3N70A 3PI6A 3ZWWA 2RGUA 2BR5A 5F52A 3N05A 1UEXC 1SHUX 2C29D 2WF6A 1EGVB 1ECLA 1EYZA 1M2VA 2JDIA 2XH8A 3PNKA 4HAOA 2YJ5A 3RSCA 3RC7A 1IOZA 2PPLA 3V2GA 3ZY6A 4YCJA 2Y77A 1II8A 1SC9A 4UM7A 4LRUA 1XKQA 4YJFA 3PTZA 2P9JA 5I9SA 5EP4A 3WLJA 3EODA 4OBEA 4QODA 1DT5A 1FBNA 5B2EA 1MRNA 3FROA 5AM4A 4DR2B 5CRIA 2R00A 3I01A 1TJ4A 1N3YA 4NZMA 1UFOA 3GRFA 4HH0A 2AC4A 4I81A 3ZJ4A 2OCLA 1YS9A 2DF8A 4DM3A 4QZVA 4RTPA 2ZS7A 3PNYA 4Z1OA 3ND9A 3E2IA 3U7IA 1K2WA 5L45A 3UBTA 1KRWA 1AUXA 2XCLA 1YHYA 2K87A 3DXYA 3OEED 4IEIA 2OG1A 4CM1A 4IIXA 4KRGA 4NICA 4JLDA 4LRWA 4KW7A 5AI0A 4CMEC 1OYYA 5A5DA 1FXUA 1I4LD 1N1MA 1GOTA 1SKAA 3EZ7A 3EXEA 2OQ2A 4O4JF 4PU0A 1ZC4A 4R8MA 3LUAA 3AX6A 3PE6A 1ESEA 1IONA 2I3AA 1EUZA 2QMUA 2H0AA 1C3JA 3GOHA 2IE0A 3WL5A 4DRXA 4B3XA 2O2CA 1VKNA 1W1WA 1Z5UA 2I03A 2PGOA 3OURA 4XWWA 3A4LA 1ADJA 2QLLA 3GBSA 5KTKA 1XYYA 2ET6A 4MVJI 2XXJA 3H4TA 4KHZA 4YUZA 5JMTA 3U3MA 1ORDA 4IJQA 1Z12A 1AMUA 3HO6A 5B2ZA 1T6ZA 3FI9A 5HKLA 3UOGA 2ZI3A 1H4QA 1O4VA 4RM3A 3O4VA 4M0EA 3E18A 4ZKEA 2OFWA 3GHHA 4PNZA 1ZNWA 3LT2A 4Q47A 1SBQA 2BKXA 2H2AA 2EP5A 3CNBA 1T2VA 1CUUA 1L5HB 4I36A 4WVFA 1USIA 2PG3A 2Q3EA 5KQRA 1BXGA 4YRTA 1ZS9A 2V7EA 3EW9A 4I50A 4S35A 5IANA 1J99A 4TOIA 3NT2A 3MMSA 1KMNA 4RIHA 3BXZA 3KYDA 5BV7A 1U81A 4F5YA 1BWPA 1ZL0A 2G9ZA 4E94A 1VKZA 2AL7A 4GPEA 3RB8A 3RASA 3WNBA 5BWBA 4JOBA 1JR6A 3COSA 4KN5A 1BD4A 2VSYA 3PHHA 3LQYA 4HKTA 4Q18A 4E3WA 4HLNA 1NHWA 5K0BA 1DG1G 1J2JA 1IZYA 2XSZD 1ENPA 3N0RA 4KL8S 4KPUB 2GBIA 2CKDA 3G9QA 3HA5A 2IY9A 2X76A 3GGOA 3QGMA 4M98A 3ANTA 3RIXA 4NC9A 3HTXA 2CHUA 2HX1A 3PFHA 4HS4A 3KETA 1S2GA 2PO7A 3CEMA 5DYWA 1EB8A 3DWGA 3WRXA 4A8HA 3GFGA 2Q3HA 3OCXA 3MMZA 1ZNXA 3ELDA 3HZOA 1QQBA 1ZISA 2PWPA 1XJCA 3WLRA 2FCAA 5TPZA 2W98A 5FPHA 2WTMA 1UPBA 4IIYA 2REBA 2VK1A 2O7RA 4JBYA 4QULA 1E64A 1URPA 3TB6A 3UY4A 1KS2A 1NNSA 1DCMA 1JIJA 2BM9A 1JPJA 4FNOA 2FV8A 5AI9A 3SF0A 1UBKS 3PDCA 2Z4TA 3GVIA 2P4SA 3GJQA 1J0CA 2FZCA 2LZ0A 4IIJB 2EQ5A 5HCIA 2WM3A 1NRXA 4MIOA 4ZHQF 2WNSA 3HN7A 1JTFA 4AWXA 4G2TA 4Y2TA 4CTMA 3PNMA 1IC6A 3FPKA 4M1KA 3TR0A 2ESRA 3BB3A 4AKEA 1Z2NX 1FFBA 3NTOA 2Q99A 1M6HA 2FSVC 1SXJB 4WERA 2VPTA 2GPAA 1V7QA 1Z0AA 2C5BA 4ENPA 2FNAA 4D3FA 5FLKA 3I23A 3C6ZA 5IU6A 1BRTA 1H22A 3EF3A 2JARA 3OE7D 4JN6B 3U0VA 3WLQA 5KVAA 5BN4B 1MGOA 2HY7A 2PIAA 3NASA 4RVNA 3NHYA 1FTYA 3PNLA 4HN9A 1QG4A 2IXDA 5EP1A 4L5YA 2NG1A 2Q4EA 3AI2A 1HV8A 1UT6A 2Y4OA 4D7AA 5ITVA 2OO7A 3MJ4A 3JZAA 3O2JA 1ZSVA 3RYCA 2DECA 2Q6TA 2WAOA 3LQFA 1XCLA 1UBCA 4RK0A 1PL7A 4UCFA 3T7DA 4X20A 3NHUA 4EITA 3SJBA 2YYZA 1ISMA 1M8PA 1RPJA 4KGXA 4EJ2A 1ZJ5A 2BH9A 3BWEA 2J33A 2HCJB 2I65A 1H5NA 4ZVOA 1Q7RA 1YNOA 4TTQA 4ZT2A 5G4LA 2M32A 2HN9A 1AD2A 4ZEVA 4UNNA 5FUWA 4C0LA 1SU7A 1U5CA 4HD8A 5LB2A 5DHAA 5BT8A 5H1YA 2XNCA 4OQXA 4WKPA 4NV3A 4QYSA 2D59A 2GXAA 1C9KA 4N12A 2GAJA 3CW9A 1QHGA 2BE9A 4BP1A 3TLMA 3AR2A 4HQOA 3K96A 3H5LA 3L5KA 4AMYA 1N2CA 5AESA 4YR9A 2GN4A 3FMIA 2QN8A 4TLBA 4U39A 4TM8A 2F62A 4TWBA 5TQVA 1VTKA 5DMHA 4DEYA 2RHCA 2W2PA 3BMCB 3VHXB 3R0IA 4H6XA 1JJFA 1JLMA 1RBQA 3N0WA 5U4XA 1K75A 2A9FA 1PJAA 4KV9A 2I6TA 1R00A 3EXAA 4HAVA 4URXR 2JAQA 3SYKA 5FWXB 3NWJA 4YJKA 1M2FA 5DM0A 2X2PA 1W2HA 4L4RA 2AUNA 2W5UA 5IK2A 1N33B 1SZPA 1AE1A 5EE1A 1XZQA 2NTYC 2MIIA 4CYMA 4E5VA 2F1IA 2RGNA 3DPIA 4IEFB 5AKIA 5KB3A 3PQ2A 2V1UA 4MVYA 2OGWA 3T3NA 1NWCA 3CVYA 3N2GB 3ZE7A 3OIDA 4IV8A 4YRNA 1VE3A 2GPJA 3GBVA 3IE0A 4FFVA 4J91A 3WK7A 1ZJ4A 5BNWA 4BVBA 1IDN1 1O8BA 2ZZMA 1FPQA 4HEA1 1E1RA 3DL4A 1ZIDA 3FMGA 1IG3A 2DT8A 3O2QB 4NYMQ 5LWHA 3H4VA 3OX1A 4KSCA 5FPKA 5IH7A 3ZGZA 1PTJC 3DBOB 1IBSA 2HDHA 1RMYA 3MF4A 1U7WA 1W34A 4RA6A 2OGSA 4UBMA 5IZCC 4KODA 1IY2A 4RMGA 5BR7A 1SOWA 1NBEA 1PJRA 2G7MC 3CRRA 1S5PA 4FFOA 1Y5RA 5LYJA 1E3MA 3VC3A 3NBFA 1CS0A 2OB2A 3HCNA 1GQFA 4QDKA 4QNNA 4ZZ1A 1S01A 3GFSA 3CTMA 4N49A 4DWOA 4ZARA 1L8LA 1PZHA 4XGRA 3JQAA 4CL0A 4W9NC 4R2IA 1XOIA 1G5HA 1A9SA 1BYIA 1IOLA 1HL7A 1IQPA 1T2FA 1V9LA 1YFZA 2B94A 4MMYB 3S5UA 4I5FA 2Z0MA 1JG7A 1GUDA 5FJJA 2O5VA 3BDVA 3KPYA 4UVDA 4LZZA 2Q3CA 1R0KA 4BLUA 3RNOA 1RKBA 4WA8A 1WEHA 1XPJA 8ABPA 4RXMA 3NHPA 4YMLA 1JHYA 4O08A 2IKSA 1ES9A 3WGGA 1BIFA 2WKSA 3WVNA 2PMWB 2O3QA 4BFYA 4KVGA 2DQYA 2ACVA 1ZG3A 1JHZA 5ERGB 1Y3BE 4TL8A 1YR2A 3QKRB 2NAFA 5IC5A 1FJGB 3ZTWA 4QECA 1BEZA 2I2BA 3E9YA 4ZEMA 4DV3B 2P6PA 6GPBA 3PVZA 4B6QA 2QORA 1D6NA 2QNRA 3CVJA 4BTLA 5ECYA 4XD7D 5DLQC 3ESDA 4M89A 4YRRA 3E3NA 4DV0B 1U65A 5GZ1A 3P5BA 5AOAA 1WVIA 4RW0A 5EUBA 2EZUA 5J4HA 3EFOB 5FFFA 2MOKA 5KREA 3ROEA 1OMOA 3AR9A 4TQAA 3AR5A 3EASA 3WRWA 3VPHA 4IW3B 2VUHB 4EY6A 2GYWA 3D2CA 4F4JA 5CA1B 4IRXA 2XI4A 4UQPA 1FFXB 3PQCA 5LZ9A 1L7QA 1SGWA 4W9RA 2ZAGA 2WZCA 2GEKA 2YFKA 3L7KA 2G6TA 1GU1A 3BD9A 1JEQA 3NKVA 2QPLA 1NN1A 3TVTA 1HWYA 3VPXA 3KQLA 2RGEA 3R2JA 3RVBA 3MRTA 3RIHA 4F97A 2ISQA 1SQ6A 3GOQA 4YCMA 2VBIA 3AK4A 3RVRA 2COUA 2FVYA 2XWJI 1ISHA 1Z8DA 3ZKAA 4DN6A 5L6LB 1R0BA 2ZPTX 4KIWA 4LUCA 4RQBA 4N5IX 2VP5A 5KWSA 2VJAA 3TDKA 2HQSA 2P35A 4PQRA 4LDQA 1BE6A 1RKVA 3U40A 2C95A 2PX6A 3MT0A 3OFVA 4MQFB 3W8FA 3WSTA 1XQ6A 2J7PD 3U17A 3F7MA 1RHJA 1MMFB 2FFBA 2HZBA 1IAVA 3EUEA 1GTRA 4AULA 2BOVA 3AUFA 2F1JA 4DLAA 4RF2A 3ZV4A 2HRZA 4IWXA 5FI5A 4NESA 2X0NA 4QQFA 2FLWA 2WIJA 3DHWC 3I32A 4L28A 2RHMA 4XR9A 2A5LA 1P0FA 2D1TA 3LX5A 4LOAA 4XVQA 1DAEA 1FP4A 2NW6A 3I52A 4HEA6 2ODQA 4L02A 4MI3A 4MPDA 3QEMA 2OQIA 2ZANA 1EE1A 5AVZA 2P65A 1V11B 1MJFA 3UICA 4CTJA 4IKPA 4EUFA 2CLMB 1M10A 3M6MD 4GUDA 2WUDA 5ALXA 3NHLA 2LKDA 1ENYA 5BRJA 3CA8A 1FXWF 2B1RA 3UW1A 1VCNA 1OASA 5HWSA 4L95C 4PZUA 4BJHB 2RBGA 2A1IA 1H4SA 3OUTA 3T4PA 3ZYCA 1L5FA 2HIHA 4BX8A 4UHEA 4WH0A 2OHJA 4JT4A 3KU1A 1Z4QA 4RS4A 2OV8A 4CMHA 1P0QA 5A4MS 1TM2A 3TPCA 1RXVA 1QHIA 3GT4A 2I2DA 2RG7A 4G8JA 5FOTA 5KDDA 3ABZA 2QBYB 3UXMA 2AG1A 2BFDB 3KEQA 4YB8A 4GBGA 1IH8A 3M0EA 5H70A 4D82A 4W5OA 2J3IA 4IILA 3V8VA 3AVXA 5ECWA 2B98A 1JR2A 2G9NA 4P2GA 5A9TA 3ROFA 4JI4B 5CAEA 4HLDA 5HS6A 5HZHA 2DSNA 2PH7A 3GFRA 3VSAA 1L2TA 1ONSA 2ASVA 3DAPA 3TTUA 3U7RA 4Y8VA 3HWX1 4D0LB 1JBKA 5JSUA 2W2XA 4JYPA 1PS9A 4V2IA 2HA0A 4UBKA 4AW9A 7REQB 1E2MA 1C30A 3WYNA 1XA4A 2NNLD 5IAAA 1TAGA 3BSYA 4R9RA 2Y1LA 2ZSDA 1JS1X 1SCKA 1ZH8A 2VP0A 2VBFA 3IPYA 1DLJA 4ICIA 5JH7B 3K94A 3ETDA 3HYNA 4N7RA 1J0BA 2JBHA 3PITA 2WIBA 3RPEA 4DJFC 3D6HA 2P11A 3KVOA 1N6NA 2VAWA 1R4AA 2NUBA 5K4GA 1P6UA 2DZDA 2FSUA 4PAWA 2ZB8A 4BNGA 1B6SA 1ISGA 3CEPB 1VJGA 1VJ5A 2QN9A 1EZ1A 2XNDA 4N0QA 1I4WA 2AG6A 1PQUA 3RVMA 3T7IA 1KC1A 4P4TA 2FZ5A 2G77B 2PRKA 2BKLA 2P9EA 1GUYA 1GAEO 3SS9X 3WGOA 3WLNA 5EJ4A 1E8NA 2JJ2A 2ZR0A 2FQWA 3QNMA 2ORYA 4FGSA 4U0JA 5L3RA 2ZJOA 5JISA 1VCMA 3H11B 3MQ2A 2PUGA 3PC7A 1M8KA 1YGYA 3WQSB 3WHKA 1MJGA 4ZRDA 1U94A 1IG0A 1VI6A 1O6GA 4US2R 3NH6A 1AHPA 3D6FA 2PUEA 1ND6A 1VL2A 4GBMA 2ZCJA 1DARA 3LVFO 4D4MA 3LIPA 1XXLA 3OQVA 4R05A 3AERA 1OT3A 3AYZB 3WMXA 2YL2A 4NARA 3EZFA 2QE7A 3VR2D 1LTKA 1NJ2A 4E21A 2D0IA 5TX7A 3ZGXA 1GR0A 2E4AA 1UPTA 2RI0A 3DTVA 2H3EA 1ZHOA 4QGAA 3GXOA 1QHFA 1TUBB 3PK0A 1I6LA 4BQFA 2VDLB 1EDBA 1A7AA 1MPXA 4DANA 2BFEB 1CIJA 4M0PA 4DEXA 3TKAA 1X39A 2FOLA 5B1HA 1HE8B 1U7ZA 1RJDA 1UP7A 2AXPA 3H2SA 4XB6B 3IEVA 1LQTA 1X8KA 2NVWA 4N18A 1NMXA 5CFMA 1X1DA 3GNLA 5DT2A 3FVQA 4NNJA 5KSOA 3FSJX 4EECA 1KY4A 3MK31 4Q1EA 4LF5B 1DIAA 2IYOA 5F33A 4CLHA 3T3OA 3VAYA 2YQ5A 2FPPA 1QZZA 4R40A 5CW1A 3ZV6A 1DBRA 5EIAA 4ZN6A 4P4GA 3KO8A 3FIJA 3MPOA 4DPLA 1ESZA 3FETA 4AN0A 4ALMA 5ICMA 4YQYA 2EDCA 3PWKA 3F5SA 2FGJA 4LJLA 3SYTA 4B3FX 3BRCA 5KQPA 3ZGOA 5CVTA 4K28A 2QOEA 1TQ8A 1Y0BA 2W37A 3K9NA 4JVLA 1V1MB 1UT5A 4MP6A 1O5IA 4G4SP 1E2UA 3DE1X 4MDYA 1HDXA 5EJFA 3ABRB 1FA9A 4UD2A 3T3PB 3G6WA 4JYZA 3ZX5A 4CLRB 2C2BA 1N92A 1ZW1A 4MCJA 2RHRA 3H5AA 5J1TB 3RVPA 5CDTA 4Q1DA 3F7TA 3HA2A 4OQLA 2VC2B 1X7XB 4CMBA 2ETXA 1ND5A 2F9FA 3WYGA 2JLVA 1IBMB 1NRJB 4L15A 4MUYA 4QUAA 1N6HA 4G25A 3HUUA 5AK3A 4EL5A 4C5AA 1SQ5A 3OJWA 4AJEA 1JXMA 4OYHA 3T3DA 1RRFA 1XCJA 1XZBA 1C2TA 4PG5A 1ID8A 2QRPA 4D02A 1Q50A 4WFQA 3RJ9A 2VTEA 1FY2A 1LDBA 2D0OB 4M37A 5GM2A 1WPQA 1T8PA 3IERA 1KGDA 1B73A 3ECCA 3MD0A 2V96A 3UH1A 1AZTA 1WB6A 3W5IA 4OCZA 1NJSA 1O5OA 3FNHA 3OT1A 2EEZA 4ME6A 2WJ4A 4W4TA 1IB6A 5AW7A 1C8KA 1CEYA 5F12A 2YC4C 4BIMA 4V39A 3H4MA 4PPFA 1VI5A 5CX4A 4GQIA 3TEMA 1CBUA 1PHRA 3RD5A 5ADWA 5JJLA 4HH1A 3UMVA 1AKWA 2C2KA 5DZSA 3RJMA 1SBIA 1DLIA 3D0KA 1QV6A 6AT1A 1K6MA 1BGVA 3AZQA 4BB9A 4M4SA 1G0OA 1C3VA 3QEAZ 4OJKA 2QRVB 2ACEA 1TK2A 4PSAA 3ZUGA 1FSZA 1GP2A 4JZYA 4OGGA 3DH0A 2GVNA 2QRMA 3CUTA 4U63A 4EH1A 4K9LA 3BWMA 5G4KA 2OWEA 1XEWY 1RCUA 1U1DA 2I4TA 2A86A 2J9ZB 3PYXA 3UWKA 1PGNA 3E9EA 4Q4CA 3GLGA 1VMEA 4O4LF 1SD2A 2VQ3A 4RHFA 3G59A 3IO3A 4M9QA 2JCXA 3WQBA 4PG8A 3QU5A 4AMBA 3BXOA 2E3JA 2HSEA 5LU9A 2XEDA 3Q72A 3VZQA 1E32A 3L4BA 3I0NA 3HHPA 3LQ1A 4H4CA 4HUJA 5IEJA 5L53A 1EVKA 1XD2A 2BV3A 2M1ZA 2F9MA 3PGVA 3CE9A 1AN0A 2VHUA 4NV1A 4P7FA 2PMKA 2G63A 3PJDA 4M1YA 4TX1A 4GR4A 1ZXLA 4XYGA 1HDRA 4FFSA 3UO8B 2OC9A 3SX4A 4RZUA 3NETA 5M29A 4WZAE 3FDIA 5ADVA 4LDJA 1UQUA 3L0SA 1JILA 1C81A 1QYCA 4JJIA 4WNYA 4IIEA 1XNJA 3FAZA 5J5AA 5P21A 1GGHA 3MWKA 3FKJA 4JGIA 5TLSA 5LNK6 1RC8A 1D1PA 3QFSA 1U2GC 3G2QA 1GLVA 5DP1A 1ST2A 2AFHB 3A4IA 3F98A 1NAHA 2JEYA 3A6EA 4UBLA 1CXZA 2QTBA 4JC5A 3VFDA 1L7AA 2XWPA 1Y3AA 2OEPA 1WCIA 1KBZA 4LQLA 3AB3A 2YY5A 3ZWMA 5JCOA 4EYQA 2G9UA 1J09A 2R48A 1OPXA 4ROTA 3AM3A 2YYSA 3W1VA 3PNQA 1QXSA 3PSAA 4MQUA 1XHLA 3ZBQA 2GM4A 8AT1A 1XEFA 2ADOA 3DEHA 3AI7A 4NBSA 5BVHB 3TQRA 3AU8A 3A1WA 3QUTA 1XZIA 2NU6A 3BMOA 3IEKA 4XCQA 3DXFA 1T6BY 3RANA 3ST7A 4JROA 1DZIA 1W4ZA 1GITA 4LJYA 4E2XA 1PNRA 5GTDA 4MDEA 3REGA 4EGSA 3O4GA 1FFEA 1MENA 1A77A 3FI0A 5GP1A 1G4HA 1Q1QA 3M1IA 4MW9A 2PYZA 5GONF 3LTNC 3KLPX 3D2BA 3PC8C 1AZWA 4WI1A 4B8ZA 4BMDA 1JU9A 2Z4RA 4UOEA 4LGYA 3EBOA 4JH0A 4HDMB 4QBHA 2PLWA 3TF5A 1XE3A 3W5AA 3ZWQA 3WMRA 2PR2A 4X0EA 2Y1CA 1N5JA 3E7PA 1A88A 4IO1A 2F43B 2P0EA 4O4HF 4YECA 1BZYA 1RABA 2ABWA 3LMKA 1NQAO 2J0UB 4LCEA 1GV1A 1OX6A 2R9VA 4MQ6A 5IVDA 1I6WA 2Y9PB 4TZKA 2CJXA 4F6RB 1V5EA 4G4IA 4ZCLA 1SHTX 3ZLBA 4EJ6A 1SC3A 3GLQA 1LV7A 4QLAA 4BEJA 4HT3B 2DMRA 3QFTA 3AEZA 2QZJA 4GHWA 3BGDA 2VWQA 4JR2A 3WFJA 1B0ZA 1RYHA 3V9PA 3WGNA 1BJTA 2NACA 5C3MA 2ONKA 2PKQP 2Y0CA 3QTTA 4L4SA 3W2TA 3COVA 4EW2A 5KTNA 1ISSA 4EMSA 3W2GA 4F38A 4WLOA 1UMBA 4Z5XA 5I4BA 4I7EA 4P35A 2XWBF 6LDHA 3WL7A 5KNCA 2HRBA 1YZTA 4JI5B 3PC3A 2JHGA 2OUIA 1H2FA 1X92A 1A72A 2WYOA 3HFSA 2HOQA 2A5YB 2GKOA 2JHPA 2Q9UA 3Q3IA 4LMRA 3AVUA 3TRKA 2VYVA 3WK8A 3ZQUA 2WSBA 4BX2A 2JIPA 1D0SA 2PZGA 3OHPA 2JGAA 1HDCA 2WVHA 4DQVA 4CI9A 4ESOA 3EARA 1O5TA 4JI1B 3DLBA 5LIPA 1BTOA 4OU4A 5LMUB 2WFMA 3KTOA 1CUBA 3LQQA 3NTUA 4P4LA 4DJJA 1JKIA 2IWRA 3W5HA 5KSWB 3SWWA 4EX6A 2NUPB 1ZOPA 2FZKA 4MRMA 4D45A 2C31A 5FBKA 1UXJA 1HT0A 3QM1A 3S1LA 2VHTA 4CDGA 4F04A 1QGYA 2W4IA 5J2TB 4LYHA 4C7BA 2W2TA 4R9UC 3K53A 2E4XA 3D7KA 4GX1A 3GLIE 3T99A 3UG7A 1IXSB 1W88A 4QRIA 5KOHB 1CETA 1B7GO 1JZSA 2H63A 1RM0A 4B6OA 4AQ7A 4AO8A 1M83A 2H8GA 3IHKA 1EFVB 1KFEB 2JGIA 1JXOA 2WU3A 3LUBA 4IH1A 5KSYA 1ACMA 5LZ5A 5K3OA 4E4TA 2BSXA 2IXTA 4QQRA 5BWOA 4UEOA 4PR0A 1ZU4A 4PPQA 1PZEA 3I6YA 4D4JA 2E6KA 4N5LA 1E5DA 1PF7E 5E2AA 5JNVA 4E5YA 4BRUA 2ZS8A 1XT6A 3EEYA 1DJOA 1HMPA 1HRKA 5HOQA 4KOEC 3UMFA 5KNLA 2XUQA 1RRPA 3ISVA 4TXLA 5IPFA 5FOQA 2LCQA 4JI2B 5FUQA 1NZJA 2OSVA 1U98A 3DPSA 1IE3A 3UHAA 2HK9A 1ZM9A 2ZSFA 4FYIA 5CYOA 3I28A 4ZALA 2YOFA 3O0DA 3Q7PA 1RI1A 4IG9A 4ZZ2A 2IVZA 3E53A 3O74A 4PAOA 1G55A 5FLYA 3KUXA 3U3RA 3TIVA 1IHPA 3CBQA 3LUPA 3OFKA 3OT4A 1WLSA 2AE2A 3RU7A 5JYCA 1DC6A 5KX5F 1VFNA 4LGMA 3VPCA 1GZ7A 2PMDA 1QB7A 3GLRA 1QDUA 5E7IA 2YC2C 2ZSKA 3IVXA 4BN0A 2CFIA 1M1YE 2R8PA 4FJ0A 2GM3A 3F6PA 2QYTA 1E1QA 4GWLA 3BGOS 2QTCA 3O84A 2F1HA 3N86A 1V5FA 2DBYA 4HQ0A 1UWVA 1YH3A 4KC0A 4DGQA 3VTAA 1V16A 4BO3A 1OH5A 2ZIWB 1KHTA 1PFGA 4YO7A 5FUBA 5I5EA 2CXHA 2IXGA 5D84A 2WU8A 2G4VA 1G9SA 3F49S 5BQPA 2YJTD 2J4CA 1JQLB 4KO1S 3NTXA 4U5QA 3C6QA 4ZMBA 3EVTA 3KOOA 2AZXA 1F8XA 2OYRA 4RNDB 5BOSB 4I8DA 2RMKA 3U81A 4QSMA 1LJLA 3PS9A 4UDNA 4TXNA 3AJAA 3I4FA 4HAXA 4M99A 5LB4A 3DMDA 4PLGA 2UZAA 4NAUA 4NYJQ 4Y2GA 1A4IA 5HG0A 2R62A 2G80A 5I9LA 3F46A 4ER6A 4A6DA 3QFCA 1XK6A 3KM0A 4JGBA 4M49A 5G1PA 4DQDA 4V0MA 5FL7D 1Y5LA 4NS4A 3BWBA 4BCCA 2IEIA 3HP1A 2OLJA 3NAGA 2GDZA 4OIFA 3T1VA 5A5VA 2O8CB 3UWMA 1EGMB 3KSZO 2YRXA 3E9NA 5JE8A 3HB1A 1GTZA 1DHTA 2BUBA 1UEJA 2O5RA 2P4UA 1OXMA 3KWFA 4G0VA 3V1KA 3DFIA 3E8XA 1W44A 4DYVA 5JCPA 1OUMA 4LK3A 1QBGA 3C24A 4MLCA 5JDCC 1KYTA 3RSLA 2O2XA 3HCFA 3A6DA 4U3JB 3HM9A 5JMWA 1TVCA 1MC5A 2GCPA 5C7IO 3O9MA 2HQBA 1L4BA 3ZI4A 4Y6PA 1EUCB 5DX8A 1KDYA 3LUGA 3BF8A 2Q7XA 4HNAB 4KQ6A 3L7BA 4PQYA 1K6IA 4YQFA 2ZYTX 9MHTA 1HOXA 2R68A 1MD9A 4NMHA 4F5ZA 2XUHA 2B3TA 1N3BA 3TPZA 2IYSA 4OQPA 1TCAA 3A3NA 3GVPA 1RYFA 3JVVA 5L3ZA 3RUPA 4L6CA 4DWVA 4F45A 1DNPA 2QW8A 4ZCPA 5MGNA 1GGKA 5DYGA 1P19A 3ZYZA 1ZHFA 3U2QA 3E2PA 2DUUA 2HNBA 4EWLA 1G8PA 1NX9A 2GRJA 1I2BA 2VRNA 2GKSA 5EKXA 5AM5A 4ZYZA 4LF4B 4HGZA 4CCAA 4HV4A 2QMHA 4UM8B 3I12A 2JKYA 5JY1A 1YQWA 2XKBA 3MRSA 2XYPA 3C3AA 3NOQA 3NDBB 3R5SA 4B3TB 4UVIA 2MCFA 4ROSA 4CKWA 2YWCA 5EA2A 3KT0A 3VC7A 1DINA 1QFZA 2Q3JA 2WJYA 1PJTA 4B3BA 1GA1A 2UKDA 1E1YA 1SUPA 2VZ0A 3PE4A 3MSXA 4I2NA 4Z51A 5FWNA 1BHO1 1D2NA 1YJBA 3OQBA 2X1HA 2FF7A 3L1JA 4EMUA 1Y9ZA 3K2IA 3L8HA 1SVLA 4YH1A 3QLEA 1O87A 2O0KA 4U7FA 1W0CA 2FRVA 5D3KA 5A03A 2UUAB 3QENA 2Q62A 1JHDA 1U2DC 2LIVA 3KXIA 4OGLA 5FHRA 1Y33E 3VR5H 2DWUA 2ID7A 5CPFA 5KQMA 3ZX4A 4MQEA 3TKYA 3U4CA 3BH0A 4DZZA 1YRYE 1YCDA 1KSHA 3KJHA 4L3VA 4D3ZA 3EZ9A 5KQLA 2D06A 3LT1A 3NDJA 3IQDB 3CUUA 1CUVA 4BOYA 5CG1A 4I1UA 1ACLA 3BIJA 1QO0D 3DTTA 3SIPA 3UWSA 2ZRPA 4F9FA 4IIHA 1CQJA 4CLDA 3QUSA 3ZXYA 1SHKA 2BAGA 4ZVMA 3WB9A 1T25A 2CE7A 3AKDA 5AKGA 5C51B 2V4ZA 1X0XA 4KXUA 2XF8A 1PK9A 2VN8A 3PKZA 5HSGA 1U0BB 1ADYA 1YQQA 3AM4A 3B6ZA 3CU5A 3K1JA 5HF5A 4J3JA 5C5CA 2AYZA 3UUWA 4QXPA 2P9HA 3KQOA 3M4XA 2MINA 3TLJA 2CLKB 1GYRA 3B6IA 1L5HA 4CCYA 1XZKA 1DBQA 2VNHA 3BE6A 3W4KA 4CDRA 5KWIA 3G5TA 3H8JA 4ND4A 4TSFD 2GVDC 5GONA 2QD1A 2JFXA 3WADA 1GA6A 2VDJA 4N48A 2IDZA 1U0HC 5H0IA 4EGJA 1N78A 3WLKX 4O6VA 1R8JA 2XTNA 3I39X 4TYQA 3DEJA 3HRHA 3MPUA 5KSPA 1M2NA 5C8YB 1PJLA 4TLDA 4O4HA 6ABPA 1QPBA 2JHFA 4G5RA 1IDOA 4NE2A 4RU1A 5AKYA 3PIIA 1D1TA 3W77A 2FPLA 2V58A 7MDHA 4JEMA 1VSTA 1R8XA 4MVXA 5G0WA 1IZ9A 4EHJA 1EEXB 2ZJAA 4MDFA 1X9HA 3DSRA 5KUTA 3CZRA 3FTQA 2DETA 4JLPA 2ZI9A 3N5KA 1Z15A 2AN5A 3GUZA 1IHXA 3UC5A 4UNIA 3S8YA 5ITWA 1BDHA 4IIJA 2BGTA 1Y5NA 2FEWB 4RD4A 4YPOA 3PFBA 1V47A 3W8EA 4KMMA 5GGYA 3UAYA 3B38A 1JT2A 1O0SA 2JJ1A 3OF2A 4OUDB 1NSFA 1KP2A 3C1OA 2HDWA 4WXRA 3TGWA 1MX9A 1NVWQ 1XDDA 1OKKA 4RKRA 4BVGA 3BEOA 3IAHA 2Z3ZA 4LE2A 3N6XA 3H2GA 1K27A 4X6XA 4TYYA 4E5SA 2VHYA 2XT0A 4FX2A 4NBTA 3OEHA 1KJJA 4L74A 3PKIA 3LBHA 3ZNQA 3WKEA 2QX6A 1DADA 2IYEA 2ZUBA 3PF9A 2K2QB 1BO6A 2FVXA 5C8XA 4TRNA 3KG2A 1XTSA 4CL3A 3MWFA 3WGIA 1ZCJA 3DOCA 4ZK2A 1BMFA 1A7JA 4DB2A 1QR2A 3EPPA 1T8YA 3AW8A 3V80A 3QXSA 1AT1A 4HDKB 4N47A 3WG9A 1HLGA 2Y3IA 1MC8A 1O94A 2Z1NA 2HFKA 1HNWB 3CKMA 3QK7A 4JENA 1NQWA 1KK0A 4ZI3A 4CKZA 2UUCB 3RV4A 5DW0A 3BHIA 1UOQA 2J3MA 2VNJA 3EIEA 3HM2A 3I34X 4KP7A 1VL8A 4XPIB 2OV3A 1ZM2A 3OWHA 4HC4A 3H4IA 3NEAA 4CEHB 3OBIA 2VTKA 3F3MA 4RPLA 4BZQA 3JATA 1SZCA 4KH0A 4JLSA 2D4AA 4LBZA 5EMNA 5LPNA 2MMCA 3EDOA 3WYAA 1T6YA 1MGPA 2CUTA 2YHIB 3PEFA 4WLNA 4B48A 3X1ZA 1I10A 1M1UA 1UKCA 2EEPA 1Z26A 3B1XA 3GEMA 4HG2A 1UMCB 2WFLB 2FK8A 3MMXA 5IJXA 2AHOA 5AYVA 1T1IA 4IGIA 5EZYB 2PT9A 4R2XA 2PH5A 2PMEA 5L8VA 2BEUB 3AL2A 1I2ZA 4KUEA 1DC5A 2ZUSA 2YXEA 3DEFA 1LNZA 1Q6YA 2JI6A 2QEQA 3IMEA 4KQKA 4P7GA 8GPBA 2P40A 1OQAA 3BFVA 3FCOA 5CURA 3RK0A 4BYGA 2HK7A 5ALMA 5KX5A 3EXIB 4X6LA 4L72A 4LV5B 1Z35A 4LC1A 2N46A 2NUAA 4BKMA 4MAMA 1NSYA 4ZCIA 2XDYA 5IDVA 4Y1EA 4LYAA 4PIPA 3MTJA 3DDWA 2GM9A 3WB2A 1RLOA 1MT0A 1X2BA 2GETA 3WRYA 5DMXA 3ADDA 5KOYA 4EHNA 2FMKA 2A2ZA 3FYUB 1UKEA 4KQXA 2GN9A 2O23A 1P2VA 2OVFA 3KFLA 3ND7A 2F59A 4KO4S 2ZYIA 2XMGA 1Z2DA 5K3CA 5ALEA 2QN1A 2NTJA 1PUJA 2HIAA 4K7JA 5KC8A 1R5JA 1FS4A 3RUHA 2WTBA 3H8WA 1H8ED 2FQ1A 3BTOA 2BJHA 3O93A 2V9PA 3VR6D 3JZMA 3T9CA 1PQPA 2M6KA 1KBOA 1H23A 2GTIA 3G13A 5G41A 3VDRA 5EPOA 2DR2A 1NX6A 1T9GS 5FHQA 3OCVA 3UMYA 4DKJA 3WDSA 4K8RB 4PFJA 2KHZA 1SUWA 5B55A 2ZSEA 3IUEA 4JP1A 3E84A 4B2IA 1TVMA 4NEHB 3IDFA 2VXCA 1G19A 1ZITA 3ZJTA 1FFYA 5CDYA 3BIFA 1C0KA 1ULTA 3A31A 3KJEA 1KXJA 5JCZA 4ZVTA 1PG5A 2FW6A 1F4VA 4HNQA 1QONA 2FG5A 3HG7A 2B8EA 1PR1A 1XTUA 2XF2A 5BSKA 4BXOA 3RRZA 4BO7A 4UHFA 3FTEA 1E98A 2BZSA 3EXG2 3OPYI 4IWNA 1JSXA 1QK4A 3D54D 3L7NA 2PRZA 4MW4A 2NN3C 5EWMB 2HF7A 3S2UA 5IT0A 3QIVA 1V4BA 4URUR 1W36D 1FMFA 1W48A 2AFIA 1NG9A 2E89A 2AGVA 1JJ7A 1P5JA 3CM0A 4XVHA 4Y9DA 1E7QA 3SPXA 1T9GR 2IYNA 4OHYA 8LDHA 2H9IA 1R50A 4TSKA 3K2BA 3FNIA 1E8MA 2FHSA 2O0LA 3L82B 4HAZA 3U0BA 4CIVA 4EG3A 1NMYA 4E31A 1GNQA 1E2DA 1W9MA 3KT3A 4GYKA 2WF9A 4RESA 2E4YA 2OGZA 4A23A 3KYIB 4PTYA 3BA6A 3QIAA 1QO7A 3EFOA 5I01A 3EZGA 3P94A 1ICEA 3O8NA 4DM4A 4WVLA 3YASA 4MGKR 2LGJA 5F7JA 3FMPB 1CF9A 4M9UA 2X7XA 1GFZA 3C3KA 1DAKA 4OX9B 3V4OA 4OM8A 2IRWA 1J1ZA 4RH3A 2AMFA 2JCVA 2PL9A 4PHGA 4XJVA 4EX7A 1HC7A 3HRIA 1NYRA 2E37A 1XZLA 2R0QC 5D87A 4Y6GB 3GW8A 3KWMA 3BORA 5BO5A 5EY5B 3GYBA 1M6VB 2VZ8A 1CY1A 1Z4LA 5EIEA 3MJSA 3R7DA 2DX7A 1KQGA 4IRUB 4WK4B 5B12A 4A1OA 5BMVB 1ATIA 5BW8A 3U7HB 2Z08A 2XXBA 2QM0A 3GC6A 1EHCA 4A0QA 1IAQA 1KO5A 1P1FA 3C43A 2WMDA 3P2IA 3WYFA 1XXHA 4OLAA 3RVQA 5LQMA 1SBZA 2QUZA 2J0VA 1HBJA 2EFGA 3SG0A 1JQBA 4YXWD 3EGDB 3CWZA 1MA3A 1QOZA 1LSUA 3CSSA 1GUFA 2O1SA 3OFJA 3PT9A 4QIHA 5IF9A 4FFNA 2PYIA 5JPCA 5DRYA 3D7RA 3U3OA 4Q3DA 4RH1A 1X1AA 4PAMA 4E4YA 4RK6A 1A5AB 1B16A 3AHGA 4Q7MB 3HMQA 3V7WA 5K45A 1KIAA 2Q8NA 3OY2A 2I3ZA 3T54A 3I2YX 1SMKA 3THXA 2EKZA 2D7JA 5J5VA 1JR3A 1K92A 4J2TA 3EMDA 5JNTA 2KMLA 5CTJA 2IFTA 1V11A 2PBLA 4HVCA 2A33A 2JRLA 1BH2A 1N75A 2DFVA 3Q98A 1KO8A 3PXEA 4JLOA 4ZQCB 5K1ZA 4MH0R 3QYPA 2F48A 2FR8C 2XTAA 1M6WA 2DSTA 3D7NA 2IU0A 2OVBA 4QPJC 1BN7A 1H6DA 3WYDA 4BKUA 1XEWX 3FOFC 4DSUA 2P6UA 1HORA 1L5QA 3QVJA 4MQ5A 4OJYA 4CV2A 5J58A 5LLTA 1VMDA 4EB0A 4R8RA 5EUCA 4BDTA 2D2IA 1BFDA 4YA6A 5GADl 1KI7A 3PNPA 4ZREA 1YBAA 4V0QA 4YJ3B 4AY5A 3DYVA 5CFZA 3T95A 3A9SA 3LLUA 4G5GA 4F3TA 1T4CB 4C7JA 4F85A 1IL0A 3UHJA 4GPIB 1H2AS 1YJQA 1SZJG 4HWOA 3VVBA 4NKRA 1RXCA 1P61B 4QDXA 4BQSA 1K7SN 1MTOA 3TZBA 2ZB4A 2JA2A 2YMLA 2CFRA 3WHPA 2X0EA 3PQEA 3BB1A 4NE7A 5HVNA 1RXSA 5D51S 3DOUA 5JAMA 1OOEA 2IYFA 3W5DA 1E3JA 3MTIA 3WB0A 2E4VA 4IVNA 4JX8A 1C0LA 1LBSA 5D5PA 3J81A 4Y0AA 5C34B 1QIFA 1ZW6A 4A8JB 3ES9A 1UANA 2R6AA 5CUQA 1TEVA 3QOYA 4I19A 5EGSA 4ESEA 4MV8A 5NLLA 2H29A 4QGGA 4QUHA 2EJBA 1L4GA 4X6UA 3T06B 1T9KA 1E1CB 1CUYA 1Z4NA 3NVKI 2ZWMA 1EK0A 1FUYB 1EGHA 1Q7TA 1U28A 2BC9A 1RFGE 2HRRA 2CL0X 4KK3A 4V3CA 4CM6A 3R23A 4JEHA 1TO2E 1SXPA 4OA5A 3KB2A 5I9TA 1RMQA 3MINA 3Q2KA 1VYTA 2VJPA 2D00A 4C4TA 2CHFA 4AKIA 2ISSD 4KNVA 1RWKA 3IPCA 3SLKA 3TS1A 5L4NA 4MJ3A 2YFQA 1CG6A 1NQ5A 3FB1A 3IPLA 4C1BA 3GZNA 1ZZGA 1GSAA 2JEZA 2SBTA 4FB5A 5IFKA 2ZRKA 1Q95A 3H11A 3USES 3ZQKA 1P4JA 3OTGA 2BD0A 3INRA 4K8OA 3BWVA 4OJMX 1SD1A 4BO9A 2VPZA 3WY9A 2IDJA 3CXUA 3F5MA 2ZSHA 4DA7A 1BCRA 1EP9A 3IPRA 4W5JA 5I3CA 3G17A 1NVXQ 3O8LA 3WB1A 2WWHA 1KJWA 1J90A 3VTFA 2IOHA 3N0TA 1J21A 1YIAA 2YHUA 1UWCA 1MV5A 1TUBA 4YT2A 4CTOA 4O2BB 3IX7A 3GVHA 4G56A 4OYRA 4DS3A 1T5HX 4D3SA 1ZGBA 4PHTA 1E6LA 5KI6A 4ZO9A 3GFPA 4TL7A 5J5CA 3IV7A 4DV2B 5IVPA 1DO2A 1QGOA 2QW1A 4AZ0A 2VK2A 4XWOA 5TF4A 1SVOA 4EG4A 1XMSA 3JQBA 1SXQA 2PT5A 4I8XA 4YALA 5DHRA 4K9RA 5L95A 4MS1A 4GMKA 4Z3KA 1IXZA 2WYHA 4RAQA 4A0HA 2RKOA 1Q7EA 1TZJA 1YVUA 3CEJA 2YQ4A 2JAHA 4QA9A 1M8JA 1SKQA 3SBDA 2XT6A 2G40A 4NABA 3R4CA 4Z8YA 4KHPB 4JLAA 4E7PA 2GRAA 3LPMA 5DFAA 5KO2A 4G23A 1K4KA 2P9CA 1F7VA 3Q8KA 3F1LA 4HYQA 3HDYA 3P0JA 5BN3A 4GE0A 1UM9B 2FSVA 1MAUA 2BY4A 2G5CA 3AC0A 3DAHA 3DGEC 2FGKA 2PN1A 3BICA 4QUKA 4R84A 5FULA 3KQNA 1WQ1R 3HL0A 1CZNA 1Y4SA 1X7XA 3UMMA 1PR0A 2AD1A 2AFRA 5BSFA 3UQYS 1P9LA 1SC6A 3FTCA 4KYIB 2B4YA 4DMHA 4E33A 1ZOSA 1HE5A 3IP7A 5JECA 2CDCA 4RACA 1N2ZA 3OD5A 4KN8A 2WIFA 3C1TA 1QGUB 3S4YA 4M8IA 1RYMA 4QL3A 5CBKA 5H82A 3CB4A 3JU3A 3IKLA 1RACA 1ZD2P 2D62A 4FWBA 1UJ6A 1GILA 3E3OA 4M9SA 3RREA 3W2EA 1CY8A 1Z0DA 5TV2A 1JWLA 3I1FA 3PFNA 3A2NA 5JS2A 3D6NB 3EG9A 3TBKA 4WBNF 1ZMXA 2Y0EA 3URMA 1VXOA 3SC2B 4CBVA 2F1RA 2GEFA 3T9FA 1GPMA 2GBGA 4MV5A 3L8CA 3WLLA 2CUKA 4BLQA 2WJJA 5FBQB 3SJCA 4ZVUA 1E9EA 3H19A 3OOYA 1HNZB 3CH7A 1I8TA 1K5PA 1UBGA 1ZU5A 2KSQA 3OX2A 4GICA 4CCWA 3HSYA 3BRSA 2X14A 2JI9A 3B78A 2IEGA 3NBQA 4YLYA 4ID3A 1SCAA 2EGGA 2ENWA 2X7HA 2I6XA 2R7KA 3H7IA 4UM9D 3UV7A 4YMSA 1W36C 5JZOA 1XDBA 4ABTA 2PKYX 2NSHA 5K5EA 1LPAB 1R0XA 1VIDA 2H5EA 4PGAA 4AS2A 1C7QA 3CBGA 5E4YA 4ZV4A 3P71T 1YOBA 4C4YA 5A02A 1ZM3A 2FU5C 5EVJA 2BDUA 2B36A 4EUEA 4YUYA 5FL3A 3WLTA 3WBJA 4PTLA 2VXBA 2BDEA 4D74A 3TM5A 1AXGA 4P86A 3VBEA 5JTUA 3L0BA 3VU1A 5JAPA 5CCXA 2PUDA 1EH5A 4XYEA 1J49A 1YI0A 3IP6A 1XP8A 3AP1A 4KSBA 5FBVB 3PGA1 1NVFA 1S02A 3AVOA 2HK8A 3FLAA 4MPPA 1KZHA 4BLTA 3E05A 3V2IA 4A5SA 1RYEA 5HE8A 1EB9A 1I14A 1L5SA 3PZRA 1VSUA 1B00A 1DC8A 3ED5A 3LRPA 3NVAA 1C4XA 4G0ZA 2O6LA 1RM3A 3FHOA 1KZ9A 5JFOA 3SZ3A 3VR4H 1GGMA 1U3TA 2H17A 3V1LA 5IZCA 1G5IA 2HJRA 5C8VA 1XCBA 4GL4A 3AYXB 3GRPA 2LV8A 3OJCA 2OSBA 3DV0B 4TS9A 3KKKA 3VZPA 3IEMA 1KOLA 2FZWA 2JD0A 2FJUA 1MRZA 3C87A 3HH8A 4I4TB 4ZODA 3SJ7A 5ALG