2PO7A

Crystal structure of human ferrochelatase mutant with his 341 replaced by cys
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
359
structure length
359
Chain Sequence
RKPKTGILMLNMGGPETLGDVHDFLLRLFLDQDLMTLPIQNKLAPFIAKRLTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDCIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrochelatase, mitochondrial
publication title Altered orientation of active site residues in variants of human ferrochelatase. Evidence for a hydrogen bond network involved in catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 137
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2007-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2po7A02
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2po7A01
2H1VA 1N0IA 3AQIA 3HCOA 2HRCA 4KMMA 3GOQA 2HK6A 1DOZA 2PNJA 2QD5A 2XWSA 1C1HA 2PO5A 2XVYA 3W1WA 3HCRA 2AC2A 2QD1A 4MK4A 1TJNA 1L8XA 2JH3A 1LD3A 3HCPA 2XVZA 4CCSA 4KLRA 2QD2A 2HREA 2QD3A 2DJ5A 3M4ZA 1C9EA 3HCNA 2AC4A 2PO7A 1QGOA 2H1WA 2XWQA 3LYHA 2Q2OA 2Q3JA 2C8JA 1AK1A 2QD4A 1HRKA 2Q2NA 2XVXA 4KLCA 4F4DA 2XWPA 4KLAA 1LBQA
chains in the Genus database with same CATH superfamily
4L2IB 3ZLBA 3SR3A 1ZS9A 5LQSA 1WBBA 1KJZA 1N32B 1YCDA 4NMXB 5G3YA 3FFTA 2XCTB 1ZR2A 3RTEA 4N5DA 2GWHA 1XZNA 2XNKA 3ZEIA 1I3NA 1OCEA 2JGLA 3JQCA 3QE3A 5AK4A 4QOHA 1YR1A 5HFNA 3WZMA 3L8ZA 5BUZA 1JIQA 4CETA 3L4BA 3K0FB 3NJRA 2C94A 4M55A 1CUAA 2CXSA 3MERA 4IICA 4C7KA 4DLWA 2KX7A 1ZD2P 2JAHA 5IBPA 4D3XA 1AQLA 4BFSA 4BTVA 1F2VA 3WLAA 2OP1A 3HWSA 2D2XA 1JDPA 2NQTA 4JR0A 1YULA 4EATA 1N0WA 3ESXA 3MRSA 3VZPA 1AQNA 2POCA 1OLSA 1W5FA 3MFQA 3BMQA 3RC2A 3AEXA 4EFMA 1U0BB 2LNDA 4GRAA 4TROA 3P96A 3ZX5A 4IO0A 1AHNA 3RHFA 3L6OO 1M8KA 5FOSA 1F9EA 1H85A 3WLSA 3A9VA 1GXSB 2K5UA 3OU6A 3M8KA 4KZPA 1S01A 4B32A 3TAHA 2A2ZA 4RF2A 5FPPA 5KREA 3JQQA 2QNBA 2JPDA 4YP0A 2J5XA 1EESA 2FN9A 5LUAA 3S5UA 4UVIA 2PDAA 3K1TA 2R4TA 2Q27A 4N65A 4V3BA 5HXAA 4CMAA 2RG1A 4L22A 3UAWA 4XM1A 3VAAA 2Q6KA 1OI3A 2H1CA 4N0DA 3CF4G 1ADBA 3E4CA 1CBUA 4B6JA 2H54A 5BN3B 4DWJA 1DO8A 4TVBA 1E61A 1RM3A 4I7EA 4ZRNA 3QKTA 5AW3A 4LIPD 4KNYA 1MAWA 1DWOA 4PPQA 2HV8A 3CG0A 4GX2A 1GL9B 1PFKA 1BJRE 4GHWA 4YS6A 4N48A 2VZ9A 4B31A 2COUA 1PIWA 2HDWA 2A1TS 2FJ0A 3AOEC 3F67A 2LDBA 5LQRA 2HQRA 4R0VA 1K5PA 4QTZA 4UJ5A 4MI3A 2FKNA 4UAVA 4WY2A 4XPIB 2WJGA 4YREA 4DG9A 1DFIA 2CYAA 1FUKA 2RBKA 3JQGA 4H1VA 3OJWA 5CM8B 2PBZA 3WJ2A 5JPCA 1VKJA 3SLRA 2ZJBA 5KNDH 1VYTA 3A6PC 1JG1A 2JZCA 3AW8A 4HXEB 4JP8A 4B82A 5JRDS 4IIEA 3RVRA 3MBOA 4J8PA 2VTBA 1UKBA 4M9ZA 1NBMA 1JR4A 2IJGX 2PRJA 1P1RA 3DXXA 3QLVA 2BMWA 2RGDA 4GPTA 4G0UA 1E59A 2DWPA 1WHTB 1J9EA 1RWBA 5TX7A 1V7PC 1P18A 1CY1A 2Q3HA 4U2DA 2PEZA 4CHTA 3TZ6A 5KTRA 3PXXA 2OO5A 3IDAA 1OH8A 1CQPA 3RK0A 3H6HA 1TRKA 2LZ0A 1FSFA 3TTSA 1T6ZA 3WAKA 2OGWA 3W6OA 5CLHA 1YOBA 2GKGA 2WG2A 1LI5A 5J63A 1VB5A 5FBRB 3AVPA 5IC4A 2ZJ1A 3MCAA 1S8AA 4N54A 3USZA 4CE6A 4RKWA 3RVPA 3MF4A 1SUEA 1VHTA 4W9RA 2QG4A 4LNUA 2I67A 1OA0A 3D8NA 1HNNA 4IQFA 3W5IA 1VPTA 2Q3FA 3CUKA 4DXAA 3OP1A 3HJBA 1PR2A 2PR7A 3CPSA 3LU1A 5FOTA 2ORVA 3HXKA 3O0TA 4A8PA 3WR5A 4DM4A 5C8DA 3ZGNA 1U7PA 3RUCA 1MG0A 1WTAA 2C4WA 2PH5A 2PKQP 2M6KA 1RQ7A 2R1TA 1U99A 2PMDA 3QX8A 4W1RA 3W5HA 1ZN8A 2V7XA 3WK8A 1GRNA 3NPAA 4MEBA 2EKLA 2RK6A 5JAMA 1TXGA 2YXPX 3UXMA 3OFJA 4E11A 1LBQA 4I6JA 3H5NA 4FN5A 1GLVA 1GRCA 1SUAA 1RXIA 2IIVA 2ZE5A 5C8YB 1K7YA 1GTRA 1NMZA 1ZJJA 4M4SA 2B98A 3MCVA 4C4TA 1DNPA 3VJRA 5EIXA 1FDOA 3MLBA 1O87A 2G9QA 1MC4A 1JWLA 1TT7A 4FU0A 3D3KA 1D7OA 1Y7HA 4DR7B 5C4IA 2FMKA 1QGYA 1QIKA 5F3RA 5SZHB 4KIFA 1YR9A 1UH5A 2FSVC 2FRDC 3PDJA 4NYJQ 4O4JB 1EX9A 4OQZA 3O2JA 3UICA 3QXCA 4LJAA 1CIVA 2AFIA 1P17A 3V7WA 3UA4A 1XTRA 2KLBA 1QVAA 1J20A 1RP7A 2WU1A 3GLGB 3RSHA 1PSWA 2R1ZA 1N8KA 4FEYA 3GLFB 1KP3A 1V9CA 1K06A 2KYRA 5HJEA 4BX9A 4NIMA 2H7CA 4N8DA 4DLUA 4Z6KA 6Q21A 3UBMA 4QECA 3WGNA 1X8KA 2Q4DA 4WKBA 3GNQA 4OYHA 4F11A 1WMDA 3GLKA 5CA1B 4D44A 5C8YF 2GM4A 4S0XA 3ZGVA 2WWHA 2J07A 3C3BA 4B73A 4A8JB 1BFDA 1MVLA 2WSMA 3F6BX 2ESRA 5ANRB 1NG1A 3RIGA 2VAPA 3G9UA 3CLRD 4YT8A 3UKJA 1JZTA 3AUTA 3ZE8A 5A5DA 2JD0A 4FFBA 4PFKA 1RYFA 5F2KA 3SHOA 7GPBA 1RCUA 1OX4A 1W75A 2I3DA 2Q50A 1WP4A 1M2VA 1P4RA 2J3HA 4FHCA 4O4JF 4G09A 4RYDA 2HLHA 2GNOA 4XGRA 3PNOA 3PDUA 1DOHA 1SK8A 4TRJA 2E48A 2PS1A 4AL4A 3TL3A 3MIIA 4I5GA 2WUVA 5C35A 5JBQA 1Z6AA 1VE7A 1D4OA 2O54A 1V1JA 4YRFA 2G7ZA 4P54A 1LJUA 2P3SA 3DCYA 3R3YA 3E5NA 1PR1A 1ZH4A 4NX2A 5AUQA 3V8MA 5HKAA 3NJ8A 2I7TA 2G5GX 1CK4A 1FSSA 1M8GA 2IUSA 5KYUA 5DBGA 4XM0A 3UHFA 4DR1B 1QVZA 3OT1A 1K4MA 5CA1F 1Y6JA 5AIAA 2ZR8A 4JCCA 1U63A 2H9AA 4Q9LA 3AR6A 4HGQA 4A7PA 1RC0A 1IOVA 4YJHA 3MIZA 1IRXA 2QSZA 2ZYGA 1F4PA 2XKBA 3EFEA 1DAGA 3DVRX 3GY0A 4HBGA 4URYR 1DEXA 8OHMA 1N0VC 1TW3A 2YH2A 4OGKA 4TV8B 2CKDA 4Y7DA 2Q1UA 3T7SA 4X6XA 2ZUDA 4BMZA 2HCJB 5JROA 3O8NA 5DNVA 2QRGA 3V2GA 2VCEA 3C5VA 1JA0A 1W4RA 3RV4A 2XCSB 4CFSA 3GFFA 4IRUB 1KHHA 1U2GC 5CA0A 5FKJA 2GJ8A 3I2KA 1SXGA 2LPMA 1BSVA 4UOQA 4MUMA 4B3HA 1UJ6A 1QFMA 5FYQA 4E03A 5IJZA 4M9RA 4GXQA 1HFJA 3PDIA 3QKSA 5C7LO 1BG6A 1P0FA 4D98A 1EXMA 5EP1A 3DHNA 4D8VA 3QVLA 2HJSA 2VHXA 3E5HA 1ULUA 2F9FA 4JT8A 3KU1A 3HJNA 4G84A 4YMHA 4WZAA 2G5CA 3TJMA 4X3CA 3D6JA 1FP1D 2ZLBA 3SEAA 1B43A 2AQHA 2MU1A 3CSDA 3OJXA 2IW3A 4ZYZA 3DLAA 2XUZA 5JE8A 4I1YA 3AHCA 1EPUA 3D2LA 4YT2A 3KVRA 1EUDA 4TV8F 2OZVA 5AM5A 3ZJ5A 5IDQA 1SB8A 2JIDA 3FRHA 3SNKA 3K6SA 4C3UA 1YRWA 3ZXSA 1Y81A 3TW0A 1JILA 3A6LA 1RBZA 3GFOA 2BFAA 4G8BA 4MKXA 1N7GA 2WQ7A 3BG5A 2W4QA 2D5CA 2IDJA 3PXDA 4XW2A 3WBFA 1YGPA 4LC9A 4CEHB 1JEQB 2OFXA 3OPVA 3AWDA 1UJ4A 3WB0A 5EJ6A 5A4KA 4X54A 2HX1A 1K08A 1IJBA 4WY8A 1MNQA 3L0PA 4OHBA 1TCUA 3PPWA 4HWSA 1A2QA 3LDFA 4DG8A 2XZTA 2XAUA 5A4AA 2VUTA 5BUCA 1TVEA 1Z5PA 2X1LA 2ERCA 3R5KA 1N0IA 3T3EA 4FHFA 4NH0A 1KFJB 4YHHB 2GCEA 2X22A 4RFLA 2QD5A 2FEAA 2PUCA 1CXZA 2DPLA 3KWMA 2ZB7A 4FFOA 1ECFA 3AFMA 4PPYA 1RHUA 4OHXA 4YT5A 3T6KA 1XU7A 2IUEA 3IMFA 5ALWA 3T7JA 4B4KA 1YL5A 1V6AA 4OUDA 2I2DA 1RJGA 2JVIA 4F71A 2WLTA 3TUZC 1HZZA 4DN6A 3HB7A 2J4FA 3QXGA 1TM1E 4LF5B 2G72A 3KEQA 4NLLA 2VOJA 4AJIA 4EBFA 1FL9A 4MQFB 3TSAA 4MAAA 1VHJA 4BVGA 4ZV7A 3O8CA 3AUXA 1U7XA 4NZZA 1SOUA 2Q3JA 2I8AA 2OAGA 2Q41A 2IYAA 3E3AA 3H9QA 2DY0A 3A14A 3N2KA 3SLKA 5JCXA 4NBRA 1I6WA 1R5BA 5THXA 2XEXA 3IUPA 4C0BA 3WV4A 2C7OA 3V4OA 3F9CA 5EJ8A 4YJDA 2GCGA 3MJFA 5JZOA 3OIGA 4I46A 1W1WA 4LOAA 3V1NA 1SVLA 2O9JA 4F4IA 5AVSA 3BT7A 2HC9A 4V0RA 2A5FA 2ZKIA 3GYBA 4XB1A 1ORVA 4J0IA 3DBOB 4JQZA 5JC8A 1BKYA 3DL2A 3S2UA 2YYSA 4DR5B 2LDXA 3NXSA 2BGWA 1Q14A 3G88A 1OI7A 3WZ2A 1WM1A 3KQKA 2RIRA 2QZPA 4NXNB 3IDOA 1HDCA 3DVAA 1FDWA 1KK0A 1SQSA 2C5BA 2BT4A 3PC7A 4I14A 4M1SA 3U0VA 1R74A 5BURA 2BCGY 3WGMA 1TK2A 1QMPA 5JAZA 2W8BB 2VJCA 1R8JA 1XA3A 1TZJA 3W9UA 1RRGA 1U9CA 2PQ0A 1JXQA 2JGDB 2M6RA 4S2UA 4ZCQA 4PU0A 3FYTA 3IQGX 4S1PA 3BJEA 1WXXA 1CPYA 3O2NA 4FC7A 4GG1A 4JR1A 4UU8A 4WERA 3RC1A 1X15A 3BUSA 5FO1A 3L1IA 2G8LA 1EIWA 4LHVA 2XHEA 4RZIA 3FCAA 4D25A 5HZHA 4ITRC 5LB4A 4C08A 1X1DA 2YXBA 1K4KA 3HR4A 4RA9B 3TDNA 3C45A 3TKLA 3WDSA 3ZIAA 4EUEA 5EVCA 2H4WA 4YV7A 4UCWA 3NV7A 4G1MB 2O2SA 3RSGA 4E31A 4HG2A 4I50A 4KMOA 4FD3A 4YRMA 3GRRA 5CFMA 2W2MA 1JPNA 3HN2A 2O3TA 4HEHA 2A1UB 2BTOA 2VWPA 4JQYA 1G1MA 4RS3A 4U7WA 1OFHA 2X23A 3E9MA 3Q2OA 4GUAA 2C5GA 1EK1A 2NM0A 5K3FB 3OQMA 1ULZA 4D9NA 2P77A 3E2MA 4X1IA 4MV7A 3GC6A 5F77A 5AKYA 4W1SA 1P77A 3DD1A 3KVYA 5TGDA 3A28A 5KVCA 2JCVA 5LJIA 2CMKA 3L8CA 3QKRB 4LI3X 2WIBA 1FY2A 3KVOA 4IIVA 4JYPA 2BBOA 4L0DA 1M1NB 1NRWA 1L7DA 2YZ7A 5K7SA 5HUHA 3U31A 1AK9A 5KPJA 1N9ZA 3VYUB 2QHXA 3N8KA 2HSEA 2QLLA 5DBEX 2HTFA 1P5JA 4XWKA 2CUTA 5AVKA 3NDBB 1EFVB 1MW8X 1GGHA 1G4AE 2UUCB 1GZHB 4AY5A 1F17A 2OHOA 2OCYC 4EAQA 1IAVA 3WWZA 4TS3A 4LJ8A 5EIFA 4M8KA 3LUJA 1MT0A 1T9ZA 1THTA 3B48A 4YDRA 2PJDA 1EYZA 1FLAA 2HA6A 2GO7A 3JYLA 1I80A 5LQJA 1E9CA 1RYEA 5ULLA 4AY6A 2FDCA 2YWHA 1E99A 2IYVA 1XDGA 3E1SA 4HZGA 3GAAA 3HA2A 4TT8A 3VOTA 1M6WA 3I12A 2NACA 3U44B 2YXEA 3JYOA 4JBIA 3ZLTA 4ESHA 2JIPA 2EJWA 4M0EA 1YK1A 3HBNA 3WQBA 4CQJA 2JS7A 3GVXA 4K88A 4PZDA 2H57A 3TBFA 1D2GA 3TJZA 1TTPB 1G8GA 1Z18A 1KOJA 4MTLA 1XQ1A 4C5BA 3EGCA 3I9MA 2PWYA 3PUKA 3RUIA 1YMUA 5KYWA 4DV5B 1MA3A 2AG6A 2AGVA 2ZULA 3VNVA 2BR3A 1JJIA 4HB0A 2PKRA 5FWAA 1G8HA 1QJ4A 2G7MC 3I30X 1XOIA 4CR6A 2I3GA 4ND4A 1YRLA 1EMDA 1Y5IA 1E1RD 4RETA 2I34A 3H5RA 4KXNA 4TM7A 1P0PA 2WBLC 4R31A 1AV7A 1FVHA 2FY8A 3DE3X 3PUJA 5EZSA 1RIIA 4BVKA 3UQYS 1UBSB 1NW7A 1N6RA 3DKPA 3IQFA 4C03A 5ADUS 3J80A 3W8FA 1XLVA 2I6QA 4CHGA 3ZNNA 1A7JA 2EWMA 2LTAA 2WIDA 3A4IA 3ITDA 5FUXA 1NSYA 2D1TA 3WWCA 1HOTA 2R85A 3GNTA 2C20A 3E9EA 4Q93A 3L0OA 3ZV4A 4ECAA 4QG3A 4CLRA 1SHUX 1C1DB 2HDOA 1NWCA 2PT9A 4B6GA 1XFDA 5F9HA 2V7QA 4Y2YA 1G1AA 1YR6A 3QH4A 2NUTA 5I7SA 2QYOA 3V5NA 4X3OA 3IVGA 3N5KA 5DLYA 3BHNA 4LTNA 4JP3A 1DFHA 4M3NA 4ZVNA 2O0MA 3ESQA 3KPUA 4GZ3A 3FM9A 4HR7A 1QIJA 1I10A 2QN3A 3VHQA 1NF9A 1QHNA 4P80A 3T7RA 1U28C 1NPYA 2YFHA 5LL6P 3MD9A 2PT5A 2IOYA 1QHSA 1TK3A 4J16A 5FOVA 1F2UA 3E3LA 5EWJA 1SXJB 5CT6A 5F7XA 1P7ZA 3TKYA 3ZXUB 1WCV1 4HTAA 5JXIA 3ZKAA 4B3XA 2VRWA 1E3DA 4MMYB 4XDYA 2BP7A 4X92A 2G5PA 2GILA 5DNEA 4C89A 2IUTA 3HKDA 3R6WA 1FTSA 3UKOA 2XA2A 1XE3A 3NHBA 3DBVO 3MWKA 3EIFA 4IQ8A 5EN4A 5H70A 1FTYA 5J5VA 2WI8A 1IZ9A 1U5CA 2WVGA 3MS4A 4YCSA 1XHLA 3F4KA 2QP4A 2JAOA 3DDSA 5CYOA 3RF6A 3T12A 3AIOA 1JFVA 2WYHA 1NXOA 4MVJE 4RM3A 4TSRA 1DINA 3TRFA 4EECA 1GEGA 1KFBB 3DC2A 3LPAA 4P32A 4ASUA 4YMUA 3JQAA 5G3ZA 4JC0A 2I54A 4HDRA 3BGDA 3OTHA 1JMKC 4ZZ2A 3C3PA 3UK0A 4FFMA 3SKXA 1F14A 2C83A 4Y9TA 5CM9C 3RODA 1U0FA 2DC1A 3HLTA 4EHHA 2XBLA 1NI5A 2EEPA 5AVRA 1ISPA 1RVDA 4P33A 4XVUA 3RK4A 3UMJA 1YTUA 2QR5A 3I1IA 4E15A 2BSXA 5G0VA 5JHGB 4O4LB 1B15A 1SPBS 5TF0A 1Q1ZA 4DGSA 4ZJPA 1B0AA 1P39A 1RU3A 1PTKA 2IL1A 3C43A 4LPSA 4XSHA 2ZRFA 4BO3A 1PW7A 4MNTA 2OKCA 5EZYA 2H1IA 4UD6A 1VE3A 3I73A 3PEYA 5AESA 2D06A 2EATA 3EIHA 3H7IA 1E7RA 5B1DA 3W4JA 1ORRA 5HUQA 4F60A 3PQ2A 7ABPA 2X40A 1ZUIA 3P19A 4Q05A 5KTNA 5MN6A 3FOZA 3ZBTA 3G0OA 1J8QA 1QORA 1UXOA 4KHZA 4X62B 1FPQA 4KWCA 1B1CA 1LPSA 2JKYA 3T3PB 3A6ZA 3CBQA 4Z1MD 1OSNA 1YC2A 4DJJA 2P9GA 3I1JA 2PTHA 2Q8NA 1N2ZA 2FPRA 3WFZA 3VDXA 4YACA 3RYIA 5AP9A 2PYZA 1LF5A 2YMQA 2ZEJA 4NULA 4RLSA 3T99A 4UEKA 3MYYA 4M1YA 3VRHA 3MTQA 3V8RA 5F2EA 2VLBA 5K3SA 4MDYA 1JWBB 1G3RA 1QTIA 1YE5A 3C3MA 5IKEA 1Z2PX 4FGSA 1T9GR 2ILVA 4O4LF 1GPLA 1MOQA 3DSRA 4YCCA 1U0EA 3UTDA 1MJGM 3ZPXA 2YXLA 1WABA 2E7ZA 2WFLA 3JATB 4HMQA 2QVLA 2Z6VA 1DL5A 4I8XA 1CY2A 3WSTA 3VPCA 4EFLA 4EUHA 4G86A 5JYDA 5HG0A 3PF9A 4OREX 1PVDA 4DL9A 2VF8A 5JDCC 4U7TB 5FFNA 4R68A 3JR7A 2AUMA 2GEUA 2HPVA 1G20A 2YY5A 1K0UA 3K5IA 3NOOA 1JAZA 4HPWA 4IV0A 1KSGA 3RVLA 3JCZA 3LLSA 5D6OA 4BMPB 4AQDA 4C29A 1QHYA 4DLNA 2A9OA 4JBYA 2PMWB 5AXBA 3WXMA 1IZ7A 2R7AA 4D0SA 2V0NA 2IKQA 3ENWA 3FWHA 3LK6A 4NMLA 1CV2A 1E5DA 1U90A 1MDBA 2JFNA 6PFKA 1EGAA 1RXYA 3C24A 3O3CA 1DQSA 3R5FA 8ABPA 1APBA 3BREA 4ZI7A 4XR4A 1OA1A 1FFCA 1VHWA 4JGIA 3GNLA 3J81A 1J9GA 2NOAA 6LDHA 1DKQA 2MDTA 4HNHA 1E2IA 3WYDA 1EP1B 1J09A 2V8OA 1ZVJA 3M83A 1JAYA 1T0HB 2ZI6A 3DYIA 4HI0E 1WB6A 1H0HA 4IEFB 4N0PA 4NV0A 3UH0A 3WNBA 3I6IA 3OFKA 5JAUA 4AKIA 4L08A 2DKNA 3MN1A 3K30A 1YVUA 3FGOA 4IVPA 2VXYA 4RADA 2PMBA 2O6LA 4QEDA 1Q1EA 1WWKA 3O95A 4IDAA 4QXRA 1MIOB 1P0CA 3C3WA 4P4UA 3AETB 4ZTBA 2I29A 1T5LA 3IALA 2WAAA 1L0BA 1MB0A 5JPDA 5FBQB 1XEWY 2LBPA 3WRVA 5BWCA 2VNHA 3QFCA 1HURA 2PVSA 2WWXA 1CZHA 3ZXIA 3QPCA 2BTQB 1O95A 4Z9XA 4N76A 2BEVA 2FR8A 3JZAA 2F55A 1X1CA 3FA2A 3LC1O 5DBHX 5K09A 3WMEA 4NFLA 5IPFA 3STVA 4R8MA 5HJ7A 3WKCA 4WSOA 2PEYA 3SQLA 5C1DA 1DDIA 2WOOA 3DCIA 4J7XA 4WCFB 5B1SA 1JHPA 5TEWA 4X00A 5HOEA 4D8TA 1T0BA 1Y3HA 2GERA 2PLFA 1IQ0A 4MVJI 1QPZA 3ZC3A 2PUDA 3LNCA 1KARA 4FD2A 4N3CA 4PYLA 2RH9B 3GGOA 4XYMA 3SXJA 1C7JA 3RFCA 3ZU3A 1NKSA 3OAAD 1E66A 1VMEA 2CZCA 2IS6A 1CZOA 4IMJB 1PJ4A 2WE7A 1M2OA 4HRXA 2P9FA 1U81A 4LSZA 3D7LA 4O29A 3FWKA 5FFMA 2R1VB 1KC3A 3QMMA 3IVMA 5DRTA 3VDQA 1VP9A 4IIJB 4EUNA 3KJZA 5IU6A 5K3OA 5L6MB 4U00A 4PYIA 3I53A 5H1YA 1M83A 5T4EA 3W4IA 3C41J 4QOIA 1SBYA 2IXAA 2RONA 2WSBA 3GD7A 4L8VA 4RZ2A 2C4UA 1VKNA 4BO8A 4BNMA 4BO0A 1XVVA 1D6NA 4FS8A 1LLCA 2YUIA 2FSIA 5IUNC 4AJ2A 3QE9Y 1MVOA 3HCEA 1FTGA 1Z8NA 3S44A 4PM4A 1PGNA 4TPKA 3W8EA 1BD4A 4B6PA 3CZ5A 3DEAA 5FB3A 2XVZA 4CM3A 1MC8A 3LBYA 2BZ1A 1RJ9A 4LJ4A 4F56A 1CQWA 3DPIA 3U81A 4B3SB 3FTPA 5IKPA 2HWXA 1K9SA 1XAGA 4R7TA 1X7XA 4KN8A 4WKOA 1T35A 4PAMA 1SHLA 3BVPA 3DAFA 3GPDG 2WWVD 2F9LA 1YRAA 1EZ4A 3H1TA 3DQZA 1VL6A 3EUWA 3L7JA 4IIJF 5A6VA 4X6LA 3F98A 4ZMRA 1BWPA 2EGUA 3D1LA 1CJVC 3TEFA 1P91A 521PA 4UW9A 2ZZKA 5DI3A 4F38A 2CC2A 4WV3A 4M1EA 4AECA 3A1SA 3GZNB 2VK8A 4QDXA 1AV6A 2QNIA 3IBSA 1B2RA 1TM5E 1PZFA 5H4GA 1ZH8A 3DTVD 1T5IA 5AMXA 4BYGA 3T41A 5CB8A 2ZT8A 5BMVA 2YFQA 3P9RA 1Z6XA 4II2A 3FXAA 2ZE7A 4RF5A 4UAJA 4BNLA 1L5FA 1W96A 2WJ3A 2ZK7A 2RHTA 3RBAA 2BM1A 4KVZA 1X1SA 2Y1WA 3KHUA 4L4ZA 4IIDA 2YBDA 5G4KB 1MG5A 3CF4A 3VH4A 5DHPA 2WWIA 2IC5A 4NE7A 4B71A 1GLNA 2FOLA 2ID4A 1R0SA 2OP0A 3VYSB 1Z2OX 5J2UB 2CL5A 2FPGB 2IYXA 1N6OA 2YN4A 4XTRA 5H68A 3IDZA 4Z4EA 1KKLA 1UMBB 4M76B 5IJ9B 2FE1A 3PUHA 1LPPA 3P9YA 3HRKA 3QLUA 3TQOA 1TCBA 3HJRA 4G0WA 3EVEA 1STOA 4KODA 3W2TA 4FGUA 4HDNB 1U3GA 3B5JA 4H1HA 4XQGA 2OFOA 2ZJ3A 3EDMA 3MLAA 4G0YA 1U0SY 3FGPA 2BV3A 2GEFA 1KP2A 1SG0A 3QELA 3GAMA 4L51A 4DBVO 1G3UA 1IN4A 2F43A 4O4IF 4URVR 5IJWA 5LZ9A 4S05A 1H8EA 2DUJA 3C3KA 4J7UA 1GPH1 1K7CA 3VC1A 2BL4A 2XIJA 2XB2A 1V6SA 3D6NB 4JBNA 3EEOA 2IUFA 4LYAA 4UBIA 1O97C 5CT9A 1C30A 2ZU6A 3FLAA 2J3MA 3A2KA 4K9SA 4DV6B 2V7GA 4D6PA 1FJXA 3RU9A 2HHCA 4J1NA 5JCOA 3A4NA 3A04A 4ZD6A 1BROA 1KZ7B 3ZVKA 1ZHOA 4HVCA 5ES4B 5KQRA 4Q5IA 3WIUA 4BLSA 1PX2A 3U6BA 5J2UF 3OJ0A 4WBSA 4KIJA 2R8ZA 2PAAA 1NOJA 2WQ6A 2C5LA 3Q8XB 1ILEA 4GGMX 2A5GA 2VRBA 3ADDA 5IAJA 1OAAA 3N3AC 2LRHA 3O0DA 1G8AA 3OLZA 2J33A 1UKAA 1CQIB 4FNGA 5L95A 2A92A 1Q11A 1O96B 3L41A 5ALOA 2W83A 1UBNA 2CVFA 4EG4A 1UPFA 2GVZC 5C3MA 2E3JA 5ERYA 5CCEA 4MUEA 3LQ4A 1T5SA 4CKXA 1JYEA 2XWJI 1B6GA 3CR3C 3K09C 3MQ2A 3LOUA 4OJNA 4UUNA 4YUWA 1UFRA 5CVTA 3E3NA 4MWZA 2GLTA 1DWPA 2P4EA 3DZGA 2R84A 2JJ1D 3CVVA 4FFNA 1V8PA 3HADA 4FJ1A 4S0ZA 3T61A 3TE6A 3WI7A 3OKFA 3B6ZA 2E18A 1HLGA 2YNMD 1JP7A 1T0JB 1JE1A 2B9EA 2IH4A 1X3SA 4CQLB 1XRNA 1IVNA 1Q5PA 2DFPA 2G63A 5KI6A 1Y5LA 4D9CA 3TM5A 3LQRA 5IW8A 4TLLB 1PS9A 5JY6A 4IOJA 4CW7A 2RHJA 1CVRA 5KOHA 4KR9A 4RWEA 2O8EA 5E6UA 2WEKA 2PO7A 3GN1A 4K3UA 1OH6A 4TYQA 4I99A 4TRRA 1TE2A 1QH0A 4R3UC 1PQPA 2C03A 3S2GA 4JLWA 3T8YA 4RFSB 1IZ8A 2AOUA 2DHDA 2GVDC 2YHUA 3UJAA 1CNFA 5REQA 1II0A 4CM9D 4MUNA 4PY2A 1O94C 2UVPA 4OHFA 1A27A 4X1YB 4ERXA 4NBSA 5JH7A 4TMXA 3RBVA 1YZGA 3W2FA 3GZ4A 4EQ6B 3EGDA 2NXWA 1UIRA 1IM2A 1XQXA 1G21E 1GTJ1 3E2PA 3GEIA 3LUKA 3UN1A 3NHMA 5C5IA 1KEEA 5TARA 1UWLA 3I9V1 2QLMA 4KTVE 3TBHA 4AJ4A 4IAOA 2OQ2A 1LI7A 3F5DA 3FB1A 3PP8A 4PGGA 2PLNA 5I8ZA 3V1YA 4V02A 3OQOA 4WWHA 3OLYA 5BT9A 1W0KD 4XA8A 3D1JA 5BWNA 5AVZA 3KZXA 2WAOA 1NURA 2Q4RA 2Q6VA 4F7WA 2SECE 1VKRA 5G53C 4GXTA 3SIPA 3WA6A 2FPMA 2W6QA 3H2HA 3I52A 2GI4A 4TYWA 1LBHA 1YS2X 2XNDD 1E6EA 1Z6TA 4MWCA 1Y6RA 4N4AA 5JD4A 4R1LA 3KOOA 2QU7A 4Y1RA 2B6NA 3KXPA 4D42A 5KTKA 3G0DA 4JR2A 3U3JA 3V7UA 3VUEA 2DPXA 4C7BA 4HNVA 1YCFA 3C5WP 2IU0A 1GN9A 1YS9A 4P3KA 4TUYB 4EA8A 5F23A 3HL0A 3TZBA 5EIWA 4BQEA 2JCYA 1NJ5A 1N3BA 1PAUA 1JECA 1MV8A 4B84A 1R1DA 2I5PO 2VPTA 2XSZD 1G38A 3FCUB 1YIDA 2YHIA 3HCNA 3RUEA 5E1BA 2PE5A 1H94A 3FPKA 2JZOA 2IEAA 2EL7A 3IXQA 3MS7A 4WE3A 1L6RA 5TGZA 5KMGB 2FPOA 2Z0MA 1A8IA 1V16B 2VYND 3L9WA 4CVNA 4DUPA 4ZQFA 1GGVA 5I4KA 1KWKA 3T1TA 4QL3A 3UGJA 4XX0A 3L1HA 4Q4HB 4ESEA 4P7GA 1Z7YA 1U1IA 2YX1A 5FPTA 1OIVA 1EX1A 4EGJA 4MW5A 1XWWA 2O2XA 3DV2A 5KQSA 1BHSA 2E1PA 4YMVA 1VYHA 4EG5A 2ACKA 4W5TA 1MO5A 1R0RE 2FN4A 3PFCA 1KS2A 1ORIA 4NFYA 1KK1A 1NATA 3UZUA 3G3EA 3WRYC 1WPRA 5B3LA 3MLEA 1R6XA 2HIHA 2H63A 3ESBA 3HACA 4TV9A 3S2IA 1Z75A 4TUYF 2Q8QA 4LQCA 3EVBA 1L8QA 2C2KA 5HS6A 3SZ3A 4GBMA 3UTCA 2WE8A 1SXPA 1V43A 2RB5A 1CQJA 4CV2A 3CZ4A 3F8SA 1ISRA 5JBNA 1IVYA 1JEDA 1BE8A 1BX3A 1GPAA 3ILHA 4JGBA 3QVKA 4Q4DA 4Y6QA 1HRKA 3BMOB 4RIIA 1JJ7A 5SY6A 4ATNA 5IHXA 1ML4A 3EG9B 4UTOA 4WCVA 3D4PA 3L7OA 1Y80A 2ZYHA 1I01A 3FYSA 5K3BA 3KR9A 4REOA 4C4ZA 1SHZA 1MO6A 2BFPA 3NIDB 4MKRA 3WBBA 4DDUA 1YZTA 4MHSA 5ALQA 5K0TA 3NFYA 1F7UA 1C7QA 4FINA 1SQ5A 3RRMA 2O2ZA 3GBSA 4GRDA 3K71B 3L6UA 2GPNA 1R4MA 2XGMA 1CY6A 1V8DA 4EG8A 2F3PA 3OQHA 3QFSA 4E46A 1DG3A 2HM7A 5I7RA 5KU7A 3G68A 4QE3A 2R5NA 4KN9S 3NV9A 4L5BA 2AFHA 1O0CA 1KZ4A 1L1FA 2H0RA 3RS0A 3CB2A 3C3DA 4N8SA 3OO0A 4Q3CA 1OVMA 2Q0XA 1QKKA 3W6NA 4B3IA 4B3JA 3NNDA 1ZC3A 1TOAA 1NBME 1ZIPA 3M4YA 3MRXA 3BB4A 1RQGA 3LX6A 2BKEA 4RA6A 4MW0A 4EITA 1I2DA 4ZO8A 3AK4A 4CMEC 2GA8A 1KFCB 3CUTA 3LT1A 4LC0A 1NIJA 3UCFA 3UMYA 3ZKWB 5TPWA 5KHLB 3CNQS 2ETVA 4K87A 5ITWA 5IT9A 5UKDA 1O8CA 1VZ3A 2YQZA 3VR5D 1ZRSA 1I9GA 3JAKB 3W1VA 2C8JA 3BXZA 3HJCA 1KH1A 1AUXA 1RRMA 4L2IA 3W9SA 1XRQA 2F1JA 5A6SB 2GBLA 2TMDA 3C97A 5DTRA 4PR0A 1KKMA 4C4SA 2QGFA 3B6MA 2WMNB 1Z0UA 1DBRA 5TT0A 1VL1A 3PHLA 1QTRA 1UZMA 1MMFB 3T1YB 1LPBB 2AQIA 3K0FA 5DHRA 4XCXA 3RS2A 1GOTA 3F0TA 2NZUG 2O7QA 3G9QA 4H2DA 3C3YA 2DR3A 2HCRA 4FMDB 5ICMA 4MO9A 1F7VA 1KPHA 3UC5A 4YO8A 4RANA 3II6X 4OLBA 2JK0A 3IERA 1A3CA 5ALGA 5HF5A 1UK6A 1WD7A 3WNCA 2XB4A 1PYDA 2MYPA 2OUKA 4FQ8A 2DGDA 4R05A 4LFAB 1IUOA 1GSOA 2GZ3A 2PWBA 1H6CA 5HKLA 2X3UA 3HDQA 4PF1A 1ECPA 4F2WA 5M29A 1EFDN 3P0IA 3UXYA 1JMVA 1QQTA 1UZAA 2QZ9A 3K53A 4HB4A 5IC6A 3ZS8A 1GXSA 1YL7A 4B8WA 3N07A 2JLYA 3RS4A 2D7DA 3Q12A 3QP9A 4UTVA 3BF7A 5JMWA 1F0YA 4LCBA 4RH3A 5E3IA 4B4WA 3VVLA 2M6SA 3JPYA 1JIJA 3EZ9A 4RZHA 4PLGA 4B79A 2OPBA 3BSFA 4QPCA 4D4KA 1X77A 2AEJA 3KJFA 2SKCA 2Y6UA 3BXXA 1Z2EA 1NUUA 3ZW8A 1BWRA 3HDJA 4C4YA 1TADA 3S40A 3M34A 3AJAA 4FMDF 5P8WA 2AFIE 2P2NA 4QBGB 1XCMA 1HM5A 3GJSA 4YCJA 2OHJA 4FQ7A 5L9AA 4QHSA 4ZQIA 3KZVA 1XTTA 3N6VA 3RAPR 3ZBPA 2DHCA 4WW0A 2HDHA 2VHWA 3NCTA 1PR0A 3KKOA 1DE0A 4ZQGA 3DBHB 4DLYA 5EFOA 1RBQA 2UYCA 5GV8A 1JVSA 3ANLA 3BA1A 4EHLA 5ALJA 3SJZA 3TM4A 1CDDA 2PS9A 1TKRA 1OGJA 3WLRA 3TECE 1LLDA 4OUKX 4RU1A 1L8XA 3UO8B 3F9RA 3HK2A 1H2RS 3RWOA 4CI9A 3EY9A 3PC8A 4OSPA 1LPNA 3K6KA 4QOJA 5BV0A 4EH1A 4XPIA 3L0ZA 2PGLA 4OVKA 3RADC 8GPBA 5K0NA 2P9ZA 2JJ8A 4JQCA 1ZAKA 4IJUA 5DGTA 2CLFB 2WFMA 1JG7A 4PG5A 3RIMA 3BK2A 1QCYA 2Z4RA 3KXKA 1VJ0A 5CVJA 5D3QA 3UJCA 3RVJA 5DZSA 4RSRA 1RQ2A 3GWGA 5FLKA 1SCKA 2RHLA 1Q7CA 1JYFA 1S5PA 5AI5A 4C14A 3OU2A 1WHTA 2XTAA 4RVOA 1JHMA 2BE7A 3GCXA 5LYJB 5EKXA 2YQ4A 3ZCPA 3WB1A 3VZDA 4OOFA 4D3ZA 1KFKB 5IT4A 3X0DA 1DRJA 3JD3A 3ECSA 1CY7A 3BDVA 5GTDA 4LQDA 5KINB 4ZCPA 1MJFA 3EAFA 1GAWA 5ALEA 1DQPA 3G5UA 5HX7A 5WRFA 2CD7A 2RHCA 2J0SA 1DBSA 1YZUA 1CG6A 3I1FA 3NCHA 3COSA 4OQFA 1YS4A 2W42A 4MLPA 5IP5A 1NVMB 2B5OA 2FPPA 2R6AA 4YAJA 1NC3A 4X71A 3Q9UA 3F3YA 2PBFA 4XB6B 4NESA 1JDBC 4M9SA 1C41A 2Y2VA 4GAEA 1MUUA 4K6FA 1BE6A 4LRYA 4NU5A 1JH8A 2NNLD 1T5BA 3RHSA 2JGRA 1U1FA 1FTWA 2JCSA 1R0XA 4LGVA 3UUFA 4B83A 4B81A 1PJRA 5T3YA 5LYJF 1CKEA 4AMUA 3KD2A 3PUVA 4WZAE 1NW5A 2NZXA 3U7FB 3COJA 1R5JA 1M8PA 2KBFA 1GCIA 3QK7A 1MB3A 4PPNA 3VAYA 1FZTA 2IIPA 1J8DA 1KEKA 4IZ6A 1PN3A 1R5NA 4RVCA 5C8YA 1JU3A 3GUZA 5AKHA 5A03A 1QQ5A 4MB2A 1Z34A 4IDOA 3AY7A 1PR5A 3D59A 1LVUA 3FI0A 1IK6A 4FQ5A 3O4IA 4RD6A 4QGAA 4DPMA 3HQ4O 3C2QA 5CBPA 4YIHA 4LE1A 4OP1A 3R5SA 4D3YA 2KM1A 4MDEA 3PGLA 4BU1A 2PSHA 2DRIA 4WXRA 4QO8A 3WLFA 1ENZA 5GZ3A 1T25A 4OATA 4O4JA 5JS1A 5DTQA 1L5OA 2B99A 2JLAA 4C6SA 2HHAA 2YHAA 2B92A 3GLGA 1INLA 1E9SA 5EVJA 3VGPA 2JATA 2WUDA 3VHRA 3GLFA 4EUKA 3DXYA 4TGLA 3I32A 3NHUA 3NPMA 4P93A 4OHZA 1DDOA 3CTPA 1ONNA 3DMPA 1E3QA 3Q9SA 3ZD7A 4MYRA 1RM5A 1UWCA 5AM3A 2O2YA 3GT3A 5CA1A 5AW2A 1SVIA 1XNGA 1GPDG 1P72A 3NORA 5C7OO 4A8JA 1UP6A 4CMGA 1DAKA 3EWAA 1AHIA 1T2FA 2JASA 4DCGA 3CONA 5LMNB 4AN4A 3MTGA 5IHPA 4CGZA 2G6BA 2O0JA 2YJTD 5FHRA 1DJQA 1YDMA 3V9AA 5I45A 3NP7A 1J2UA 5IJ0A 4C7OB 4HAXA 3LQ1A 4H7HA 3BC1A 3LGSA 4OV6B 3VU1A 2Z1NA 5DN6D 1AK1A 2HF7A 4Q03A 4ND8B 4YAIA 3Q4GA 1BAPA 1ZUHA 3H87A 1WETA 1MX9A 1OXMA 1F38A 1AKUA 3HUDA 4CQMD 3FUUA 4MKHA 5AHXA 2HF2A 1D1QA 3W3AA 2J45A 3ZDXB 2ET6A 1NDHA 2P9HA 2H5JA 1HE4A 2P91A 2OHFA 4GZMA 4IV5A 3IKLA 1U0JA 4FZJA 4JENA 3AF6A 5CVDA 2FG7C 1V5GA 1X9HA 4YEDA 4X8MA 4AJLA 3AVQA 2CDAA 2B61A 1ARZA 4GX5A 3CSSA 4D4IA 2OXCA 1XJCA 4AQYB 2CLKB 2P7HA 3AL2A 3DMTC 2QZSA 1RVV1 4GI2A 1RSZA 4P58A 5BMOA 5JMTA 1E6MA 1B7GO 4BECA 4TV8A 4WOBA 1D6JA 1OFGA 3PGMA 4W1PA 4B47A 1OROA 1VIAA 5DM1A 3OLVA 2H5LA 3WLOA 1PQUA 4PRYA 4EVQA 3T9DA 4JAVC 2J85A 1NV9A 3Q8MA 4Q1VA 2AFRA 4QYTA 2PPVA 3FHCB 3AWIA 4WADA 4EARA 1T8TA 1Z4NA 3E82A 5JSQA 3LUFA 3ZTWA 4JASB 3IAS6 5IARA 1QO0A 3H13A 3EQ7A 1C3VA 2P9BA 3MWDB 3MQFA 4FC6A 4F9TA 2CDNA 2ZI9A 3WYFA 2VPIA 3GJYA 4PLFA 3OOJA 1WXWA 4I0WB 1D7AA 4LCEA 4QFCA 2FWAA 1KVTA 1XK7A 3K0HA 1UXKA 4P35A 1WRBA 1UM9A 2E4AA 821PA 2ZS9A 3A1UA 2G3YA 5TEVA 2B7CA 3AM3A 2QUHA 3MGBA 2CLLB 4RD4A 3T7KA 1TQ2A 2I2AA 3AHJA 3BWBA 2B0CA 3K9CA 4FTWA 4NENB 4IO1A 4QATA 2BM9A 2VYQA 5T3UA 1OYYA 1U98A 3W79A 1HUQA 3H11B 1HQKA 2QM3A 4BO6A 2NTEA 1HH4A 1QLJA 1RI4A 4LSMA 4B9EA 4BB5A 2EIXA 3ZV7A 1B4DA 2LKCA 4UBMA 1PFVA 4QOGA 4CEHA 4OHOA 1JEQA 1GCGA 4FJ2A 3UJ9A 5C9ZA 5ITZA 5IWCA 3EJ6A 2FW1A 4CIXA 4MRAA 3TD9A 4CG3A 3PL1A 1DG1G 4YRJA 2CHVA 3MJCA 1C14A 2D8AA 5ER6A 2VDOB 5KHOC 1JPJA 3K35A 2A9PA 3EGVA 3Q3GE 4F5WA 1EHYA 2AXQA 4UU1A 1J99A 3VPAA 1GQSA 3EHDA 4F85A 3TIVA 5JNWA 1GQRA 2QT0A 1JR3A 1ZUWA 3N53A 4KKXB 1I1NA 1FDVA 2BUCA 2IT1A 4C06A 4NPAA 4UPDA 1V3QE 1XVUA 1Z17A 2V7VA 1JHAA 1Z5OA 3NJ4A 4MVWA 5DLEA 3SC3A 2PKXA 3G1WA 1Z4LA 4KTTE 4PO8A 5B57C 3LD9A 5AKLA 3MJDA 3ED1A 4A1OA 4BNUA 4BGDA 5AJHA 1N5RA 3S29A 5EWLB 5ICCA 4JI2B 3G5LA 4YRBA 4NYMQ 4EHKA 1DTWB 3PFBA 4MQFA 2ORIA 3LBFA 1M7HA 2HEGA 1RQLA 2Y67A 2FV8A 1Q1QA 3CLTD 3FX2A 3NKLA 1LBIA 2IHJA 4MV9A 4F12A 3HCBA 4UQLA 4AMBA 3W5AA 2F8TA 3V1KA 1LB1B 1S9DA 2V5AA 2VKTA 4FNMA 1RLJA 4IOKA 4RD2A 2QTMA 3ENNA 3LIPA 2D5LA 1GYPA 3HJTA 3L6DA 1UPUA 4DCPA 2W6IA 4CTKA 5D2CA 1SBCA 1O77A 2VUSA 3UW3A 3T3IA 5JDIC 1V48A 1W85B 2AG1A 1FUIA 3WRXC 4NE9A 1OKKA 2WK1A 4AJPA 3H1BA 4DG5A 5I3ZA 2FMXA 3GJ3A 1OE0A 1UODA 1EEXB 2O4CA 4RIFA 4I1PA 3EYWA 4FONA 2IXFA 4YI5A 1FW6A 2CLEB 4C7VA 3CU5A 1JQ5A 2ZI4A 5JDIA 1U9ZA 2XCRB 4M9UA 3BZWA 2W8BA 4LV5B 2ANCA 1VG0B 4XTCS 3SQXA 5DHAA 2OLJA 3AHIA 3ZVRA 4ZK2A 2JGDA 4NL4H 2P5SA 1RJWA 2JJMA 4UASA 2I71A 1E6LA 3MRTA 2CCKA 1FFSA 1Y7IA 3TDKA 4JYBA 5JU6A 3MQ4A 4NMWA 1H9BA 4X93A 2Y1XA 1OUMA 4C6RA 2WF9A 2WYVA 3NWPA 3D64A 1FFHA 3BIWA 3O5AA 3Q5DA 3ZWBA 3DUFB 1EFHA 2ZYRA 1Z4MA 1ZIDA 5AKGA 3C8MA 2H92A 2FHPA 3S2ZA 1RKVA 4RCYA 1PS8A 2B8TA 4TRMA 1EBUA 3GFBA 5BW5A 1M2WA 2ZPTX 3H3XA 3BTOA 4QLBA 2A1UA 2G67A 2NO0A 1P9RA 4NBUA 4RSMA 1T9KA 1Z13A 2EX4A 2DE0X 3B1VA 4QLOA 5D00A 1DC7A 1R12A 2FWRA 2X9LA 2WR8A 5BSGA 5K3FA 3L7KA 3SVZA 2E2WA 2ABWA 4KFSA 2GM9A 2YWCA 2P6PA 3RTBA 4BEWA 4CEJA 1GNQA 3EVDA 3U9LA 1GPWB 1K8ZB 1N5LA 3I3SR 4X8OA 3SJBA 1J2JA 5K3CA 5IK2D 3ZHRA 3QKRA 3Q7SA 2G1PA 1VSTA 1KXJA 1M1NA 3QA9A 3MUFA 4BP3A 1XTVA 2X9NA 2XDYA 3RRNA 5LLDA 2UZ1B 3OHSX 4TMKA 4UMDA 4J4BA 4OHCA 2ZYDA 1WULS 1HT0A 2Q5IA 1EFVA 3VU9B 1Y37A 1WDMA 2XCUA 3RT1A 4PFQA 3ACBA 4Q9DA 5AI8A 5TPZA 3F6SA 1TL7C 1J6UA 2Y66A 2DJ5A 4F3YA 1UCFA 1Y4SA 4B7AA 3GH1A 4TQUS 4Y2PA 1AGNA 4DW8A 3D5TA 3MGCA 2AZMA 5E6RB 5LVAA 2XZLA 1RXCA 1RKUA 4IWYA 5SYAA 5GPBA 1VIDA 4GPBA 3U4GA 5HIAA 1Y8QB 1MTZA 3PHHA 4MIOA 4PO3X 4Q1EA 3U44A 3OQ6A 4QGHA 5BSVA 1Y6FA 1QG6A 3G6WA 3I2YX 1P5HA 2LV8A 3TNJA 3OM0A 3HKCB 3PEVA 2JIBA 4DDHA 4HSEA 4DCTA 1W8DA 2QY6A 2NZWA 1P3DA 2W6ZA 1Y34E 3ELDA 4TMTA 1F60A 1QVRA 4OP3A 1I5EA 3V1MA 4NECA 3Q3VA 2Q07A 2EHDA 1VTKA 5A4IS 2BGNA 2Z3VA 1VP3A 5AKEA 3TTUA 3LC7O 2OXEA 5G2OA 1LTQA 3CX3A 2Z83A 2ZXEA 4D46A 1N8SA 1DADA 1P9NA 2WNIA 2FGJA 3GJ6A 4PSVA 2PRYA 5CDFA 4ETNA 1G20E 1LWOA 3V55A 3FIUA 1E2PA 3V8EA 4Q4LA 3NBYC 3LF1A 5BV8A 1E3EA 2IXEA 5G0UA 2JAPA 1BDBA 2DWCA 5G0SA 3RH0A 3ZD8A 3KZNA 1C1DA 2X4DA 2JD1A 1QLWA 1SWWA 5BSTA 3VOAA 3Q41A 2YDYA 4G5QA 4XFKA 4BEVA 1M66A 1HRDA 2FU5C 2J08A 5G41A 4ECEA 1ULSA 4HVLA 2VK1A 2Z2XA 4G8CA 3O92A 4MV4A 1URPA 4TWRA 4C22A 3ASZA 1JWAB 1C4XA 1YZHA 2RI0A 1I3CA 4PQRA 1DJLA 1G66A 1HE3A 2FZGA 1ZA1A 2X13A 5EEHA 2VNIA 2ZJAA 4HDSB 4UPVA 3T34A 3DP7A 5M3BA 4KIGA 2G25A 4RMJA 3IEPA 2V7EA 3F7OA 3K8ZA 2HRBA 1SXJA 2V6FA 1V0JA 5FR1A 2P4HX 2PXAA 4POOA 5K4HA 4OX9Y 2ZIWB 1MO2A 3IR5A 5CNJA 1C9YA 5GWXA 1IQUA 5FI1B 3LWBA 4WN9B 2C95A 4DDVA 3NEJA 4DLPA 3G2HA 1RHMA 5COBA 2DP4E 1ZGHA 4R3WA 3PPIA 4BLPA 2MINB 4LE2A 1VQ1A 4OU4A 1A1VA 4MPJA 1U65A 4BJ5A 3UXEA 1GLGA 5FLEX 5BV2P 1E3JA 1JTVA 1E2HA 2WV7A 3W7VA 2WA1A 4CM6A 1AN0A 1SVMA 3QXSA 2GK6A 1FMJA 2XMSA 3D7KA 3RVBA 5I48A 4W5HA 1RWNA 2RAFA 1MRZA 5CLGA 3KETA 4NAVA 4QUBA 4ZREA 3TW8B 3TSOA 1W6RA 2CNBA 1UXGA 1F8XA 3AR2A 1NU6A 4RJTA 2JA1A 4ZODA 4AC9A 1DLIA 1R6UA 4M83A 2NYRA 4WHMA 1VGRA 5K45A 1EK6A 1MC5A 3ONNA 3PPVA 1ZSNA 1CUYA 1TRHA 3N6RA 4O4LA 1HDEA 2FUG6 4B6QA 1NE7A 4LYHA 1Y4AE 4QJIA 2VNKA 1FQKA 1K68A 2X9VA 4L16A 2EBHX 3ZCTA 1TCCA 2KLHA 3QJ5A 5DU2A 2AA3A 3V8NA 1PTJC 4J4HA 3FVVA 3G2JA 4RS4A 3ESAA 2XMQA 4NCNA 1EDDA 4NG5A 1PGQA 1AUVA 1WUJS 4B8YA 3HRIA 4BZXA 1FE8A 3TEMA 2G0TA 2R00C 4DA0A 4CI0B 1LRKA 1VMKA 3DM9B 1A96A 2E82A 4LXQA 3RKSA 2WA2A 4L8FA 1IXRC 5C1OA 4CV1A 4MP6A 2VPYA 2O48X 2G9RA 3GRCA 2Z8YA 3EPPA 4LK2A 5HIIA 3KLBA 1GPKA 2G1JA 2HA2A 4DV3B 2XBMA 3IKJA 4PONA 1ADGA 2XCIA 4MGZR 2QAGC 3EE6A 4EY6A 4F2PA 2E55A 1IY8A 5GOZA 1FP6A 1POXA 1NNLA 2GSWA 2WKWA 1ODTC 3BD9A 3AUFA 4HLUC 1EJBA 4RGBA 3B1XA 3BULA 3GNSA 3JATA 2QMQA 3RREA 5C1PA 4U8GA 1LJLA 1T43A 1EP3B 3X3HA 1JB9A 2HLNA 3EDCA 4QRDA 2QAGA 1WL8A 4RUKA 3I23A 5IXJA 2X86A 3JVVA 3Q6IA 1R50A 1X14A 2IY8A 4G5XA 2AYZA 3KOMA 4C6HA 2ST1A 3LG2A 1SKBA 2WPDA 3E7WA 4XQ9A 3DMRA 5HGXA 1E2GA 4DNXA 2MYNA 2ZZNA 4LUCA 4U7FA 4JVNA 3S7TA 1OZHA 3AEZA 4DABA 3M2TA 5A7FA 2XTZA 1YKSA 4YAUA 1JAHA 4DUGD 3COWA 3W5UA 1KSFX 3BCRA 3ME5A 1OTYA 4IBOA 5FI0B 1ZINA 4HH4A 5K8LA 4D9GA 2D00A 3CISA 4R40A 4EG0A 3M5CA 5FUMA 2H08A 2D3WA 4LHSA 3U3KA 4B2LA 2HCTA 1ADCA 1JHYA 4TTVA 1Z4QA 3DDHA 4ZDIA 2IHYA 1K27A 3A37A 3KQYA 1ISHA 3ZQ6A 3TIXB 1TKBA 2PSSA 3GEMA 4LGYA 3ISJA 5EIHA 5DX0A 5A3QA 1Y7PA 3A1DA 3NBZC 3ZS9A 2F9MA 3LCUA 3R7DA 1QH9A 4W9NA 2FSPA 5IM5A 4DQUA 2QQGA 2Y9PB 3JQ9A 2AEMA 2B8WA 4UBOA 1W5AA 2PL3A 1L4GA 1W4LA 2JFVA 1QDLB 1MIOA 1H42A 5A05A 3DEFA 3Q0IA 1ESNA 1WUTA 1L6IA 3GFRA 4PHCA 3VYTB 4A2PA 5K0SA 2OOSA 4L75A 1JQDA 1SELA 3I0MA 3CINA 1HXHA 1QK4A 2E5WA 2GEVA 2BTQA 3JRWA 3M4ZA 4L1KA 4QASA 1D1SA 3HDGA 2C4KA 4QQNA 4ND5A 3V1UA 1G5HA 2P62A 4HAOA 4M1OA 4P81A 2ZRPA 1RYYA 5E7IA 2G36A 1XMOB 4JCOA 1YH3A 2FFJA 3OCWA 5CEFA 1OMOA 1J56A 2C9DA 2C29D 1G5FA 1HNZB 4Y6PA 2ZRQA 4N5NA 1MNAA 1Z2NX 2C98A 4WCFA 4JN6B 1XMSA 4WESB 4LBVA 4KOAA 2NUPB 4R2XA 3EPLA 4HFRA 5H9VA 4UNIA 3ANTA 1Z0SA 2B4RO 3C4QA 3NI2A 2OQVA 4Z4IA 3FOAA 1WTCA 2D13A 2VS1A 3LXMA 4W1QA 2VHQA 5T4BA 3I6MA 1U2DA 3L1JA 3B70A 3LM8A 2P9TA 5NULA 4EO9A 4QXOA 1IY0A 1KC1A 4QREA 1GPYA 3B5IA 3KB1A 4UHCA 4A0FA 3UT5B 4JI4B 3D02A 3RW9A 2C7VA 1ZD4A 3ENVA 2ANBA 2DQ4A 1KI8A 1XLWA 3EFOB 5GVSA 2XJ9A 3QBEA 1JIIA 4IIJA 4D9IA 1XZBA 4CKZA 4TWJA 2HWKA 1MRSA 3AI2A 3JSXA 3LW7A 5IZCC 4NCKA 1X80B 5H82A 2NLOA 2O5RA 3G2KA 4OEHA 5FWXB 4MZDA 1LC3A 3UMGA 3BKWA 3BWDD 2C4VA 3FSJX 2WYOA 3OY7A 4JDUA 1ZD5A 2WHPB 4MW6A 4NTZA 5EUCA 5TVGA 3ZYZA 3R8FA 4EW3A 4KX3A 4FHEA 3QBJA 3KUXA 3NRBA 4TWIA 1PWXA 4GMGA 3V8QA 4R1SA 4TLDA 4EB0A 1LFDB 3HJFA 1O89A 2QRLA 2BFBB 5IKOA 3WMXA 2P6OA 4R84A 3OCVA 3AY6A 2GN2A 1V3TA 2VJQA 3ETDA 1ORWA 5AXAA 5L7YA 3V4ZA 4UBLA 1P9LA 4UM7A 6REQB 1OAKA 2JHAA 1H23A 1H9CA 1G3MA 5A0VA 1KKUA 3WDMA 4CM8B 4QPZA 1AHPA 1ZX1A 3DYBA 5EMNA 1NVDA 2P3QA 3R0XA 4FB5A 1XVAA 1IN5A 1U0RA 2OV3A 1A82A 1E69A 3DPSA 2FFRA 3DEKA 3CNHA 1OX5A 1IOZA 2X2FA 2QRQA 3A9TA 4BMOB 5JHHB 1AXGA 1R64A 1UKVY 3GZNA 3OG9A 3PFKA 3H2IA 3FOBA 1Q44A 2M1XA 1USVA 5B58T 5AQ1A 3IMGA 2MIIA 3DOFA 1E9AA 4IOMA 1KAQA 4LBWA 2IYQA 1H69A 2AVDA 3HJUA 3DTVB 1N4AA 4RTNA 3K0SA 2IIQA 2IQ5A 3E15A 3VV3A 2BR5A 1TD9A 5IULC 3F46A 3UK1A 1FFGA 5JYEA 2PSJA 4MUXA 5G4KA 4KH1A 4BY9E 3ICEA 4RIEA 4DMRA 2I2XB 1P1HA 3NM6B 4RLFA 1X0VA 3G0IA 1ZCJA 6YASA 5J2UA 1PR3A 2FPGA 3M6VA 1Z0JA 2B30A 2ODBA 1XRSB 3G8AA 4OI1A 1QGZA 1BS2A 5ABPA 1UMBA 2R9VA 5IJ9A 5KTSA 1U9IA 5B58C 5CXQA 2XVAA 4IHKA 3IRUA 2PS0A 4HDNA 2RGXA 3I64A 1CRWG 2M32A 2V98A 4HHEA 4BRUA 3PNYA 1FS5A 4B45A 1SVSA 3EASA 2O1XA 3L7CA 4HZUB 1HETA 2CNKA 4PV7A 5C5CA 2R8YA 1ZEMA 3IAFA 3LRTA 3ND7A 1NLYA 3K2EA 3WICA 4AF7A 4AMVA 3EZLA 1FF9A 3U3DA 1W6UA 4B2IA 4YRZA 5BVHB 2GGSA 4Y2SA 5F52A 3R7WB 3EVZA 2YMPA 4TQGA 4C0WA 5TY0A 1SM4A 4D6XA 1DZ3A 4IX9A 1YQWA 3HP1A 6ADHA 3EQ6A 2POQX 4R41A 1QQ6A 1WVIA 3EXEB 2WYUA 1C8BA 2Q21A 1JKMA 4DRYA 4JS0A 4WACA 4EI7A 4KQ1A 3EVFA 2O8FB 1QCDA 3AP2A 3FWPA 4ZQEA 1JKIA 4N82A 4DWVA 1KZHA 3G2IA 3I01A 1WPQA 3TXXA 4YR7A 2OQRA 4RHCA 4E51A 1E0SA 1CQIA 2ONKA 2VF4X 1UBHS 2IE8A 3HO6A 1EK0A 1IJEA 1KY3A 1DO0A 1O96A 1HT3A 1H2EA 2DM6A 4WXYB 4RD3A 5EHZA 2QX7A 2YIDA 1XTBA 4WUTA 2PN1A 5I9SA 4D6YA 2JI4A 2F8MA 2PLAA 2QN8A 5ECWA 3ONFA 3LT0A 4OH1A 2ZU0C 1QPGA 1WA5A 5ITSA 4QPJC 3PC6A 3ORFA 4NJMB 1V2HE 4NCIA 3O93A 3TNDA 4CTNA 3BK7A 1LVHA 2YMMA 2BFMA 1NFQA 3DOEA 5LUBA 1P1JA 4EA7A 1BDHA 5AW1A 4EDFA 2HA0A 3R9XA 4OOEA 1LZLA 3LRPA 1G2PA 3BL8A 5LQNA 5AT1A 4CQLA 1I51A 4HWGA 1XALA 1UBKS 4IW3B 1ZZEA 2A59A 2XGOA 3JQRA 1XAHA 3TQQA 3U0BA 2G88A 3NHLA 4BCCA 2W2OA 4MEAA 5L45A 4ITVA 3QBVA 2RGCA 1DCKA 3NWEA 5LD2B 1XL0A 4R1OA 4RFSA 4C4OA 4A15A 3BTVA 1Y89A 1NI3A 2JIZA 2W8ZA 16PKA 1ZG3A 2VAWA 1W87A 4C3ZA 4EFDA 1GTMA 1IE3A 2HA5A 4X1YA 1UMDB 1YRBA 5FD8A 2NVUB 2HD4A 2WD7B 2C2ZA 3EZXA 5EMKA 3IVAA 5LDHA 1W4BA 4XIGS 2XVYA 4N18A 1PWHA 4EQ6A 2C7PA 1QOQB 2VXOA 4BJ1A 5JXJA 1V39A 2Y1LA 3ENQA 4PFSA 5T41A 1I32A 2WB2A 3WP1B 5TVKA 3A7DA 3ROPA 4UOEA 3CWQA 3E61A 1WB5A 5DTJA 3I58A 1RXUA 1XCGB 4BLQA 1OGYA 1HZJA 2RH5A 3O8DA 2A94A 2IHVA 4CV0A 4NV3A 4TLCA 1RNLA 1PJ3A 1WZ2A 3H04A 4CTOA 3NG1A 3KLOA 3KO8A 3BL5A 4FYJA 3Q7EA 1JDZA 3AU9A 3LP8A 3TVTA 1R3UA 1NWHA 3LDHA 4RKFA 1A9ZA 2HA3A 1XCOA 3AQIA 3P2OA 4QU9A 1SZDA 3HDVA 3ZHTA 5I6DA 2VOEA 3M1LA 1HYQA 2RH4A 2Z1DA 3QNUA 3G49A 1YQUA 3WZLA 5HKOA 3UPDA 3UK7A 1AZWA 4UOZA 1WVGA 4TUYA 3LX8A 2D6FA 2HPHA 3GCGA 4I08A 3GEDA 3VQTA 3FGNA 5EHXA 2J1LA 3QU5A 2IIBA 4KI7A 4FNAA 5BRNA 3G0GA 1HDYA 2O8BB 1Z4PX 4C2TA 5H0IA 1N6LA 2GCIA 5BN4B 2C42A 2Q5EA 1EFTA 1Z16A 3BJZA 3QUAA 4JX9A 5KMGA 2H1OA 2D74A 4EI2A 4ENUA 4DLKA 1OTHA 2A4MA 4YX9A 1V16A 5KKNB 1E2UA 1LW7A 1GGMA 4UC0A 1VPDA 5I7AA 1K7EB 4GPAA 1PZXA 3RT7A 1C0LA 4Q4HA 2OFWA 5D3MB 1HPLA 5L53A 3KK0A 5EJAA 2AW3A 1EFPB 3SOZA 1T1GA 5THQA 4JL6A 4GKVA 5E3HA 1J7JA 4B5KA 3IUQA 3C6BA 1D2RA 2JGKA 5LWHA 3CRNA 1A9TA 1AU9A 2R11A 2JAXA 1DKLA 3EDYA 3GO4A 1OLUB 1G4UR 2XOEA 2UAGA 3KE9A 1GA1A 3T9BA 1Y1SA 3GDWA 2F00A 5K51A 2VNJA 4KE8A 4GLOA 4WRRA 2BN4A 5FT9A 4F04A 1U7UA 3D7RA 4L6CA 5HHTA 1NW6A 1E5LA 2BFFB 3F78A 2B9VA 2A1IA 4H35A 4X8LA 3BMOA 2Y77A 1FDRA 4HJXA 3EG9A 2CUZA 5JOQA 2E87A 1N1GA 1YACA 4LZAA 1DKMA 5DYNA 2JBAB 4TSFA 2E85A 3FKQA 4LRWA 3R9IA 1BWSA 2OLKA 2VJMA 3IILA 3O74A 4FXPA 1PFGA 1EHCA 2Y1DA 2J0UB 4Q00A 5FPYA 1VJGA 2QROA 4I5FA 4S2EA 3M49A 4JXKA 4MYTA 4KGZA 3T1HB 4EY7A 2QRMA 1HLDA 4JA2A 3U1TA 2IEYA 2JB9A 3N05A 5ICFA 4EKGA 1IOLA 3DE0X 4QFMA 4O63O 1YL6A 4Q3EA 4P0TA 4BJ3A 4Z4QA 1ADJA 3WFIA 1Q0HA 4EMBA 4DQVA 1PJSA 3B8HA 4NICA 1IEVA 1AN9A 1XDZA 2WKSA 1GITA 3FZYA 3E8SA 1G16A 1L9XA 1U0NA 1MDFA 1HI9A 4GDFA 2X9GA 3D6UA 1Q3KA 2K7FA 3MZ0A 4BGUA 1T1IA 1F0PA 2C7BA 1NBWB 2DT8A 4JKOA 1PLLA 4NCXA 3KR0A 1GG5A 2EV9A 3HCDA 1K2VN 3I2JA 3EXHB 4G5RA 3E70C 1EX7A 3H2GA 5JXHA 1SZCA 1F9AA 2AWOA 4JT2A 4X66B 6AT1A 1H4QA 2XPCA 3LKZA 1KYYA 3FNGA 2P79A 3G23A 3MTIA 3R23A 1ODFA 3VH3A 3KJQA 1UBOS 2CXUA 3SZMA 5B4UA 2FZ4A 2NZ2A 4Y1FA 4DMUB 1ODKA 3EFBA 1N3LA 2YRWA 3ZKWA 1C5KA 3U5TA 5ELMA 1TEVA 2FX5A 4RHTA 4YCBA 1OPXA 3RS7A 3ZE0B 2VBCA 1DBVO 2HSDA 2XLCA 2E1RA 3JAKA 1BDIA 1Q17A 2RH8A 4TYYA 3DO8A 2HU8A 3MT9A 4PSAA 1PEKE 4FILA 3GUVA 1T4MA 4ZXFA 1OJ7A 1W59A 1DB3A 1W4ZA 3DZJA 4PINA 5A6SA 4KJZA 2LW7A 1Z4IA 3JRXA 3IJPA 3QE0A 3OFVA 4Y2RA 1KK3A 4QXPA 1PGOA 1HMYA 3BB3A 3ETLA 4B3DA 2WF8A 5D1NA 3MINB 3N2LA 3O6VA 5IAEA 2EJBA 2GASA 1RYZA 1D6SA 4U5XA 5DWVA 5EMJA 2BIFA 4ZA2A 3SC6A 4ER6A 2NO1A 1Z7WA 1W47A 3K32A 1MO3A 2QDXA 3GJRA 2BY4A 3QU7A 4GU5A 1YQGA 5FYDA 1WPGA 2GTPA 4MUAA 1EWRA 1TGVA 1XZJA 1ZRMA 2ILTA 1PNQA 5FP0A 1AO0A 1HSZA 2BJWA 1E7SA 2AJCA 5H16A 2V4MA 3RDPA 4HQ6A 3ET4A 1E2MA 2ZANA 1VLLA 3TLXA 3IMEA 5GGYA 3KELA 4QGGA 5AXCA 4C0KA 4DMGA 4WEOA 1EB9A 4G5FA 1K8RA 5F7JA 2XNCA 4LQ4A 2XDWA 4PLYA 4YO7A 1I4TD 2K87A 3CCBA 5L3QB 2HU5A 1ZZGA 2ALJA 1Z9BA 1HYGA 1VL8A 2EU8A 3K6JA 3D0OA 1WNTA 4FOSA 2QUKA 5LP6B 3R2JA 3OT4A 5CMLA 1EEHA 2EC5A 4ZI5A 3IP1A 3PLNA 4L4YA 4DJAA 3AVVA 2A9RA 3TI9A 2TS1A 1LTKA 5KYGA 1OC2A 2HRDA 3TSWA 1AE1A 1U7OA 2ZE6A 3MWJA 4HCJA 5IDVA 3GLGE 3LWNA 10MHA 1ELOA 3ZDQA 4D3DA 3ZDCA 1XV5A 2QVXX 1L4NA 1SUBA 5EIEA 1H0RA 2A5LA 4ER3A 5DULA 5E1MA 4ML3A 3DBHA 3E3OA 3UJPA 2IDZA 1IY1A 1N5IA 2P7IA 3BXFA 2PWAA 4KRXA 2VP0A 4NPCA 5SICE 4KFCA 1UPBA 1PZGA 2X8JB 3JWGA 1L4UA 5JLAA 1ISIA 1U2QA 2A58A 1TUGA 5MDHA 1PBNA 3MEQA 4GXRA 1SIOA 3NH6A 4G5GA 4GOKA 3GRPA 1A1SA 3KWFA 1BN6A 1YZ3A 4OXRA 4Q6WA 2FZ5A 3MTDA 1JNXX 1UK7A 2AF4C 4G0QA 3UT6A 3WGHA 3EIEA 1Q20A 5LP6F 4XYBA 2XI4A 4FYWA 1L5WA 5IBCA 2ZP1A 4EB3A 5C46F 2DLCX 3JQ8B 5DCYA 1A9XB 3LQFA 5HRAA 2R86A 3WYAA 3IP7A 4COOA 1PZHA 3ETEA 5BP7A 2DQZA 1X7DA 2AL7A 4RV9A 4RO0A 4RV5A 3TTXA 2A7XA 4CT5A 3C7KA 2FMFA 3KPJA 3C6XA 2CF5A 3BEDA 5LYJA 2VZ0A 1N7IA 2G71A 2I1VB 1ID8A 1CR4A 4DLTA 3JQDA 4IMIB 1J2EA 5GQSA 2IHBA 4F21A 1N2HA 2MHCA 4OGFA 3NGLA 4L0MA 3VKUA 1P2DA 4F6LA 3MC1A 3DWIA 5DHQA 2YN2A 3DQPA 4QBFA 4EA9A 2J9RA 4QICA 4BUJA 1WEHA 2WJPA 2XB8A 1DFGA 3OMLA 2SHKA 1TUEA 4E2YA 1W44A 3ADBA 1C9DB 1GADO 1FJ2A 2YHSA 3VVBA 1KZYC 4GMXA 3EQ8A 3QPAA 4I9GA 1V35A 2QTNA 5AIBA 3HYNA 1WQ3A 4DLRA 2G40A 4IINA 1ZU4A 1SUWA 5DHFA 4FDTA 4J0HA 3F7MA 1ENPA 4G07A 3WKEA 2WD9A 1O97D 1IATA 3EGXB 4JJZA 1EGMB 1X39A 3BQNB 3UW1A 3JS5A 4ZAXA 3M3DA 1H2BA 3EH2A 1CFJA 3TB6A 4LXGA 1YKFA 4IYJA 3PV0A 3IV9A 4LYGA 2MYTA 4R51A 2AZXA 1HG1A 2R47A 1EG7A 3CRZA 4MW2A 4HNRA 3IVRA 3M6IA 4DM3A 4GEKA 4BWGA 1W5SA 3DNPA 5J5AA 1KJYA 1R6BX 2WM3A 3FJOA 2EP8A 4F4JA 1RDFA 1AIPA 3WJ1A 3CLHA 1Q0UA 4JXJA 1KMNA 1DIGA 1E3SA 1H2YA 1TJPB 1JHXA 4IJ5A 2O7SA 1JHUA 2YV4A 3UB4A 2Y68A 3W1WA 3D31A 1Y1LA 3A6FA 4PYOA 4NNJA 3RSOA 2R79A 5FUQA 3QSYA 5KSOA 4N9QA 4E5YA 2A8YA 2JLZA 3SQNA 5M7EA 3AF2A 1ULHA 5IAOA 2B3TA 5DPMA 1BS9A 1SKUA 3N2NA 1C0EA 1JKXA 4Q0MA 2QR2A 1PFYA 1CUXA 1SVOA 2AW5A 2W6NA 2YWEA 2Z5FA 3O3MB 4IXNA 1KOFA 1FLDA 2R7MA 3I28A 4FHDA 4N1AA 4ZOEA 2JLVA 2BKXA 1N1DA 2EBUA 4IRMA 3E5MA 4IM7A 1ACJA 1XQYA 1Z68A 1QDEA 3ZI7A 4Y67A 1QRRA 3I1YA 3A31A 5AJUA 3TTTA 1YVRA 5DM0A 4CBVA 3RFTA 1W4AA 1M8JA 3O3OB 1TAUA 4YRNA 3MSCA 1CF4A 4Q3LA 1JR3E 2AZ4A 1KZGB 4HPXB 1ZNXA 4US2R 4K81B 1Z88A 1NF8A 3AJ8A 4GL4A 1UFQA 3D54D 3UOGA 4Z5XA 1XA0A 4R0MA 2QQEA 2AUNA 3TRKA 4PEVA 1MAVA 1OAOA 1P33A 2FPIB 3L8MA 4KN6A 3GGGA 3NBUA 3CVOA 4U39A 4WBNB 3K2IA 4C7OA 4A91A 1DRVA 1XP8A 2FETA 2NYVA 4FI3F 4ND8A 1A76A 3UWSA 1ECCA 1XBTA 3A3YA 4E4TA 1GHTA 2RK4A 3AVWA 1CLEA 1NQVA 1ND5A 4FYVA 4S12A 5CT4A 3QBTA 2H3HA 4K86A 2JLQA 5DISB 3RUFA 1RYBA 2CCGA 4EVSA 1F5SA 4CQMB 3VR6D 1C0PA 1MBZA 4MUFA 4TS4A 5TSDA 1J2RA 1GRRA 1QAMA 3I72A 3INNA 4YAFA 3ZU6A 1ONSA 1Y98A 1BCRB 3GFQA 1G291 2WHYA 4Z9FA 1U0HC 3VPDA 5I7HA 1UEXC 3WWPA 2RGYA 1FRVA 2ICAA 3SVLA 2COKA 2NYUA 3WISA 3G8DA 4LF9B 1MEEA 3DAOA 5FNVB 1DC8A 2CB0A 3DB2A 2O8NA 3P9XA 4MW4A 4RPIA 4WBNF 1LBSA 2CVOA 1UBTS 1U9YA 2QIPA 1QCZA 2Q5JA 1Q7EA 4M22A 1HFEL 1TFRA 1AF7A 2XUKA 3WIVA 2AN3A 2OVFA 4BNNA 3PR2B 5HM6A 3ROXA 1U3UA 2I3BA 3L05A 1Q7TA 3O2QB 4R9NA 3V1LA 5TMDA 3S6JA 4BNYA 5TS3A 5DIZA 3T4EA 5AQEA 1GKUB 3CEAA 5GAJA 1I2ZA 2P5UA 2V6MA 5I9MA 4D99A 4FDLA 4F8JA 2DTDA 3MWDA 2KB0A 2I1LA 4D9BA 2M6LA 3INRA 1NYRA 1J4AA 3C74A 4PBSA 3GLHB 3KTFA 4G8JA 5H02A 3V4FA 1ZWKA 1GL7A 1XZLA 2GM5A 2WUWE 3CURA 4PG4A 4X24A 1KQNA 1MR3F 4OLHA 5FO0A 3UG7A 2LUOA 3VJLA 2V7PA 1EE1A 4E6EA 1OHHD 1VIMA 3CS3A 1YZLA 4KWEA 3WO0A 3WRWA 4EPTA 3NBMA 4RTPA 2C2GA 3Q3EA 5MN5A 1UOPA 2HIGA 3QU9A 2CEKA 4YMWA 3O9VA 1ST2A 3NLLA 5FNVF 2IWRA 3IKTA 3A32A 4Q9AA 2WWTA 2CWWA 3AILA 3D3JA 4NENA 2ZJ5A 2AMLA 1NG9A 1YI1A 2A35A 2ODEA 1O9HA 3E7XA 3H11A 5JO9A 1J0EA 4L9SA 2QR3A 4DLAA 1L7AA 2BMFA 2IGBA 1KA9H 2CSUA 5F3WB 1YQQA 4QZVA 3T4XA 3A10A 2D4AA 1RAEA 1FS4A 4CUKA 1T2DA 4Q37A 3PNSA 3LT5A 5EHGA 5TS2A 4A6XA 4GD3Q 3V6MA 1DMRA 2FVXA 1DGQA 3H9BA 1Y9ZA 1H8HA 4IJMA 1YIAA 4QDZA 3ROKA 1RWVA 4KAAA 3AIIA 3L1KA 4IIGA 1R0ZA 2GARA 3WJAA 4RIHA 1YZVA 3TSZA 4B85A 1ORDA 5F1PA 2G83A 3KYBA 4HB2A 3ZWMA 4YWJA 3BGSA 5H81A 3D8SA 2H2DA 4PVCA 4ID9A 3SBXA 2Y2UA 5CW1A 1XJ0A 3PRYA 1V2GA 3P97A 1PFQA 3HB4X 2WIFA 2DR2A 2VP9A 3ZDYB 4BMDA 1EFUA 3R74A 2BMEA 1FFDA 5CVVA 1NBEA 2YZKA 1LV8A 2WU8A 3AUYA 4G9EA 4JEUA 4C87A 2HOQA 5EWLA 1KIAA 5KVAA 2QI9F 1DTWA 4H1WA 4UDNA 1ZGGA 4LVOA 4K5QA 4LE0A 4JSTA 3V7NA 2H0QA 3DLCA 3JX9A 4UCQA 2OG2A 4Z2AA 4JHXA 2GYVA 3DMNA 4XLTA 2G80A 2XKKA 3UHPA 2G04A 4ZALA 2X7JA 4H0FA 2PCJA 3LMKA 1FXWF 5J58A 1NM5C 5HEKA 1WXHA 3OEED 2X19A 1FNSA 4BKQA 2ZKLA 3G2NA 1V7CA 1ZONA 4IZOA 3HI4A 4FBLA 4KITB 2Y8EA 1NC1A 1GR1A 4D4MA 4FZ5A 3N8GA 4CWAA 1I4OA 1W85A 1Z47A 3O3NB 3OCJA 4NATA 3VZCA 1P8JA 4B6EA 4BC1A 4D9JA 3BTSA 4NI5A 1S3IA 4Z0PA 1G17A 1QKIA 3I0NA 3RPEA 4AM8A 3VVMA 2VATA 3H5OA 1RCFA 5KNBH 1BGWA 2OVBA 1JN0A 1TQ6A 1UEIA 1HF3A 2Z09A 4H1UA 1E1YA 1C9EA 2QYTA 4J29A 2ACVA 1J0BA 2EKPA 2VH1A 4CUJA 4J1TA 2NWQA 2QM8A 3DTTA 4Q7QA 5C7IO 1Y8RB 4HBZA 2C2WA 3UXHA 2E5LB 1OZFA 1WEKA 4KACA 1EUQA 2J3LA 3SF8B 2P35A 3U39A 4NEQA 2NSJA 2H1HA 4KI0A 5C80A 2VT7A 5IYZB 4QTXA 2I66A 1TYBE 3DUFA 4DA8A 1WV0A 2ZREA 4JITA 2IPMA 1BN7A 2QJTA 2JFGA 2Q9UA 4H7KA 2RGNC 3QE4A 1YU9A 4GNRA 2BH9A 2X7XA 5I7FA 5KC8A 1JDUA 1EQ2A 1GQ2A 3OE5A 5G4LA 3U7IA 1XEXB 4E12A 1E7MA 1FVXA 1OREA 2VUIB 4YECA 2D1QA 3AG6A 1H0SA 1KMHB 4GQBA 4QPPA 2EYQA 3MMZA 4QEKA 5DRYA 3AR4A 4B17A 3I5AA 5IFLA 4YUVA 3WK6A 1Q22A 1A2BA 4D56A 3DNMA 3KSAC 3ZJTA 1B41A 4URWR 4CL8A 1B00A 3D8RA 1ICIA 2EQAA 3KUUA 1T2AA 4G36A 3JU3A 1DQRA 3IH5A 4UTZA 1ML3A 1WIWA 4R8LA 4QFBA 4C20A 1PL7A 4AY2A 3E58A 1TTQB 2UZ1A 4UFPA 3P26A 2J87A 5IYZF 3SXPA 1PJQA 2ZBEA 3VU9A 4QKQA 1UT8A 3DGEC 1GDDA 1TMYA 3LYAA 3PQ6A 3BQMB 4ZXPA 1V47A 2OGTA 3AX6A 3QEJA 4HVTA 1EAYA 5FI5A 1NXWA 1T6XA 1SA0B 3IQDB 3DQQA 3DTYA 3EVCA 4KMSA 1D9ZA 2QRJA 1ISFA 2JG3A 5C34B 3D6VA 1ZYUA 1J24A 4EAAA 3KLNA 3E8XA 3D8BA 5E6RA 3CF2A 1FYXA 3JQGB 1OWMA 1SU4A 3S3TA 1NT2A 4BU0A 1Y8QA 4FYMA 3QX9A 4U1RA 3BD6A 1S4MA 4E13A 4JSYA 1J39A 4KWHA 3ZU5A 3HWX1 3AIMA 3LQKA 2NT3A 4M7RA 4EW1A 3DFKA 2OSBA 3JVUA 4HXFB 3LS2A 2OTCA 3UV3A 3JVIA 1E92A 3EY4A 4GWLA 4A2WA 4B7UA 3L9XA 2WJAA 3UWOA 3FNFA 4M0KA 4MMZB 2RGRA 1ZIOA 3FFXA 1KQ3A 3UJ7A 4Q1FA 5JYCA 2QN1A 5A9SB 3LO5A 1K7FB 2R4QA 4A0GA 1A8HA 4EG3A 3QF4B 1NUTA 2ZSDA 3HTXA 1L4FA 2XOKA 4HGRA 3VXKA 5TRTA 4IVRA 1KYZA 3KQPA 5NLLA 3O4VA 5KKAA 3C6KA 2XCQA 4IDBA 3R0QA 4IMRA 3SIRA 3OTOB 2W37A 3CF0A 3TUIC 4JI0B 1H5NA 1TCAA 1HMPA 3PUZA 5AW4A 3HCFA 2H1VA 5H9WA 4QSHA 5EERA 3LC0A 1W2WB 1V26A 5TT1A 3UAOA 5FH9A 4AZ3B 5JT1A 4BJ6A 2Z3WA 3T4PA 1OZGA 1PUJA 2CXRA 2O0HA 3EULA 2XF8A 2OC9A 3C6QA 1NXQA 3I9KA 4HO1X 3D3QA 1PQYA 4XQ0A 3SLGA 2QTRA 3PFHA 1XGKA 5DGDA 1D1PA 3F3MA 2B34A 2UYYA 1XJQA 5G0TA 1KEWA 4I1SA 4BWFB 1G6OA 1KEUA 2PKWA 5EKDA 2GD6A 5E4FA 2XCLA 2NV6A 3MPUA 4XQEA 1AK2A 2HK8A 1MZPA 2B2XA 3IP8A 1ZY2A 2QD2A 1EDEA 3FUXA 3FYUC 4JK3A 1U3FA 4KXXA 5HJ5A 4P98A 1RTTA 1ZMOA 3FPCA 1G19A 5F7OA 2QMYA 1W36C 4IF4A 3C0KA 1O4VA 1NOKA 2EW8A 3IE0A 4I1IA 1I3OA 4FDMA 4JFAA 4KQWA 3BQ9A 4HDSA 1XRLA 4BB0A 1N2JA 2PZ8A 2F1RA 3UF0A 2VJPA 5C4GB 1USUA 1S8FA 4PSUA 4S35A 3EWIA 4B46A 3KPVA 5B3JA 2WFAA 1EBFA 4HFMA 3CNLA 4NF2A 2XMGA 2H5EA 2I4NA 4B35A 3NHSA 1BNCA 1ESMA 3EA4A 3HXOA 1F1JA 3L18A 4BZQA 3FOEC 3M6LA 3FG9A 1E2DA 3AKDA 5B1IA 2MINA 3B1FA 3REQB 1TM3E 3SYKA 4N0QA 4TN1A 1XVIA 1GGFA 1HOXA 3RD5A 2KMLA 3WGIA 3B1YA 4R83A 2J9FB 2YIMA 3SEZA 3T3OA 5TXGA 3LT2A 2IXTA 4RXTA 1TTHA 1WX1A 1WMEA 3SZRA 2OHGA 4DLXA 3AJDA 2ZJOA 4NSNA 1D1TA 3OD1A 1B0UA 1NRIA 1VRCA 4RVFA 2EGHA 2J4CA 2IPLA 3VX4A 4CG0A 4UAGA 1QNFA 1U9JA 3GJ7A 2DTEA 4BIMA 4OXXA 2XEDA 1HV8A 3RBZA 4LZNA 5JNVA 4NWIA 1X1QA 1PK8A 1XD9A 3SNHA 3KG2A 2WUFA 3ZH9B 1GPNA 4B7ZA 3LT4A 4D9HA 2Z4TA 1A8SA 4WNIA 5CG1A 4JH0A 1SAYA 2AJDA 5HCUA 2P6NA 2WSSD 4FCWA 1EWKA 4FYKA 1RLIA 3Q87B 2PZEA 2VHEA 4BFUA 4CNBA 3ORHA 5FBKA 1PQWA 1M2VB 3QPDA 2NNWB 3MTAA 3LCRA 1XUOA 1P62B 4I19A 1GPMA 1PYOA 4RENA 4BFYA 5A4FS 5AOCA 2PGJA 4M8NE 4XXHA 3TLGB 2FMIA 1Y9JA 5IXSA 1V7QA 2F1KA 1DKOA 5TQJA 5DCLA 2Y99A 4A5SA 3PCRB 4AZVA 5EOVA 1YUBA 3RE1A 1HEYA 5CK4A 4MGEA 3ZEAA 1E4YA 1E98A 4A6EA 4YMTA 4Z1MA 4ABYA 4JLAA 2CFSA 2AG0A 2OLEA 2D5IA 4Z8YA 3FCSB 3QBDA 4IPTA 1ZESA 4REMA 2ZE8A 3LUGA 1YDEA 3NHFA 4P5DA 3PIRA 3KB2A 4D43A 2MSWA 1EM6A 3PNLA 4FE7A 4C6TB 4RH0A 5AW8A 4UTRA 2JD2A 1KQFA 3NH9A 2CLSA 3A6DA 3GIWA 2BBTA 3M3HA 4Q4JA 3EVGA 4Y3UA 1V45E 4BFZA 3L0BA 3OZGA 3PQCA 4URFA 1N6HA 1Z35A 2WAMA 2ZSJA 3M5DA 4NDNE 4DEYA 1VG9B 3W5DA 3JZFA 3QXHA 1EGHA 1PKEA 3X2SA 4ZANA 5BR4A 1KIMA 1Z28A 4Q47A 4ILKA 4R2HA 4MW7A 3GBPA 3VDNB 1NVWQ 2E0IA 3ND6A 3WX0A 2Y1OA 3DMYA 1RFGE 5E8RA 1HKHA 4CLDA 4L95C 3K70C 1IU9A 4PG8A 5JSUA 1EU1A 2OGUA 2NYAA 4MS4B 4CRWB 2VF7A 3NTRA 3N8IA 3QITA 2C59A 4X3PA 3SDZA 3S2SA 2GHRA 4ZPJA 2GCOB 3T15A 3DPUA 4BN4A 3D5EA 1QMGA 2GNPA 2KI5A