2POAA

Schistosoma mansoni sm14 fatty acid-binding protein: improvement of protein stability by substitution of the single cys62 residue
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
133
structure length
133
Chain Sequence
b'MSSFLGKWKLSESHNFDAVMSKLGVSWATRQIGNTVTPTVTFTMDGDKMTMLTESTFKNLSVTFKFGEEFDEKTSDGRNVKSVVEKNSESKLTQTQVDPKNTTVIVREVDGDTMKTTVTVGDVTAIRNYKRLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 14 kDa fatty acid-binding protein
publication title Stability improvement of the fatty acid binding protein Sm14 from S. mansoni by Cys replacement: Structural and functional characterization of a vaccine candidate.
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Lipid binding protein
total genus 25
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2007-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 2poaA00
3C78X 1EUOA 1H91A 3NQ3A 4YGHA 3WJBA 4TKHA 1ALBA 3FENA 2CBRA 1MVGA 3BRNA 3MBTA 4A8ZA 1ZNKA 1MX8A 5BVQA 4LZUA 2WQ9A 3ELXA 4ZHHA 1DV9A 1KQXA 1ERBA 5D8JA 1QFVA 3SAOA 4OS3A 4XMEA 2A3FX 4ORYA 2HYSA 3KFHA 4YDAA 3TGAA 1RLBE 1KT6A 2HZQA 5AQ6A 3O22A 3BSZE 2OVEA 3BU1A 1A2DA 4YGGA 2QM9A 1B0OA 1I05A 1SY0A 1TVQA 4TKJA 1MDCA 4D6BA 4YMYA 4YCHA 1X8NA 4Y0SA 1B4MA 5HWZA 3STKA 3WJEA 4BOEA 3APVA 2WQAE 1IFCA 4XMDA 1QY0A 3JS1A 4I3DA 5EDCA 3NR3A 1ZNDA 4LZVA 3KZAA 1G5WA 2JU8A 3U9PC 4TLJA 2GTFX 2GJ5A 2WEXA 2FR3A 3G7XA 2AT5X 3HWGA 2KTDA 5FAZA 4YCEA 4N7CA 4QGWA 4ARHA 1OPBA 1IKEA 3NQ9A 1KOIA 1TOWA 2WR6A 3PECA 4AZRA 1HN2A 5IO5A 3FA8A 4ZHCA 4R0BA 1ERXA 4XMHA 1LKEA 5F6ZA 4I3BA 2FS7A 4IB6A 4TNNA 1X8PA 3STNA 4OS0A 2BLGA 3U0DA 1LICA 1FEMA 3NX2A 5LJGA 4BQUA 1E06A 1GX9A 4AYHA 1YIVA 3FR5A 1UZ2X 3CBCA 1KT3A 2W2BA 3U03A 3Q6LA 2G79A 4KIIA 5C0NA 1TXLA 3AKMA 1JBHA 3FA6A 2PY1A 4HPAA 4WBKA 4TJZA 3VG7A 4AZMA 1YWDA 1D3SA 1I4UA 2E4JA 5LJKA 5HZ8A 3FA7A 3FLLA 1OBUA 4ZHGA 4HPBA 5HA1A 3B2KA 1CBQA 4QZTA 1KQWA 2HMBA 2IFBA 3DTQA 5HZ9A 3P6FA 4ORXA 4BVMA 3IA8A 1EW3A 4ZR2A 5HA0A 5IO7A 1ZNLA 1X71A 2YG2A 3TZSA 1FENA 4Y0QA 5FENA 1BBPA 2POAA 1X89A 4DQ4A 4ZH9A 3APXA 1IW2A 2X46A 1SY2A 3EM0A 3L4RA 1PM1X 2WWPA 4K19A 5H9LA 3VG4A 1DFVA 1OEKA 2W2FA 4ODDA 1BM5A 3B2JA 3CQNA 1BSOA 3KQ0A 5H9KA 4LKTA 2JU3A 4TQ2A 5D47A 1DF3A 1CJ5A 1GT4A 2CM4A 2RA6A 4DQ3A 2NNDA 1ZRYA 1D2UA 2NP1A 3C76X 1YP6A 3GAQA 1GT5A 2ASNX 4ALOA 1ICMA 2RD7C 5HZQA 1HMSA 3P6EA 4Y0RA 3K3LA 1ZNGA 4MVKA 1DC9A 3BDRA 3JSQA 1L6MA 2LBAA 4QZUA 1UREA 4IMNA 3ZUOA 2WEWA 5LJCA 5EEEA 1YP7A 1BWYA 1AVGI 3WVMA 2ACOA 1BRQA 2R56A 1S7DA 2AKQA 1B8EA 3B2HA 4HPDA 2KT4B 4UU3A 2OVDA 2FTBA 5KHPA 1B56A 1FTPA 1ADLA 5LJBA 3P6GA 1GX8A 1QWDA 4NYRA 1PBOA 4HFOA 3WJFA 4EXZA 1KXOA 4A1HA 1BRPA 3CWKA 4QAEA 1IKJA 1HQPA 1ML7A 2L5PA 1BLRA 4WFUA 5HCEC 4ORWA 4QGVA 2AT0X 1E00A 1TOUA 4M6SA 2FRSA 3NPOA 1EPAA 2RCQA 2X45A 1U18A 3P6CA 5KIDA 4I9SA 1P6PA 4QYNA 1JYDA 2L67A 5H9AA 3RSWA 1OPAA 1YWAA 4IAWA 1AQBA 3AKNA 3FW5A 5DPQA 2OZQA 1GKAA 1GT1A 3D96A 3RZYA 3WBGA 3FELA 3HWEA 2OFRX 4EFGA 3TGBA 3F8AA 3OJYC 4YKMA 1KT5A 1DZMA 2O62A 1HMRA 4QGXA 3EMMA 1CBSA 1NGLA 1AB0A 2A13A 1U17A 2GC9A 4XMCA 2LBVA 3HK1A 5LKFA 3VG6A 3P6DA 3CR6A 3WJGA 2K62A 1EPBA 3FEKA 4NP1A 3UEUA 4YGZA 2W2AA 2A2GA 2RCTA 1OEEA 4IB7A 1LFOA 3EYCA 4MVIA 5F6BA 3HWFA 1FE3A 4TKBA 5IO6A 1QQSA 4ZFXA 5HTDA 2AMMX 1DZKA 4YFRA 1EIIA 3EBKA 5L8NA 3BU9A 1A3YA 1LIFA 4NLJA 3PPTA 2HNXA 1EXSA 1IFBA 3ZQ3A 2A0AA 1G7NA 1FELA 2FWVA 1X8UA 1GKAB 1O1VA 4UU2A 3VG3A 2Q9SA 3APWA 2OFMX 1HMTA 3KFIA 5D48A 1RBPA 1LF7A 3KFFA 2R73A 1E02A 3PH6A 2Q4NA 2QO4A 1U0XA 3BS2A 5EZ2A 1KT4A 1Z24A 1ACDA 1BSYA 2CZTA 3WJDA 1JJJA 3B2IA 2JOZA 2Q39A 1CBIA 4NYQA 3FR2A 5F7GA 1QABE 4PSQA 4ZJ0A 1NP4A 4NNTA 1OBPA 3MVFA 4I9RA 5K06A 3UEVA 3BY0A 4GH7A 2AT8X 2CZUA 2K23A 3S26A 1LIEA 2LFOA 4O9SA 4OS8A 4ORUA 4IBAA 1KZWA 3IFBA 1ZNHA 2XSTA 4GNWA 2A2UA 3I0AA 4MVLA 3NX1A 3CQRA 1NP1A 1T0VA 4AW8A 4GETA 3FMZA 2G7BA 4RUUA 2MM3A 5EPQA 2HZRA 1YWBA 1HBPA 2EU7X 5BVSA 4CK4A 2DM5A 4QYPA 1XCAA 4RUNA 5L8IA 2Q2MA 3BX8A 1QY1A 2L68A 3NP1A 3P6HA 3TF6A 4ALBA 5F1EA 5HTEA 3APUA 1S44A 5EDBA 3DSZA 2HLVA 4GE1A 4I3CA 3VG2A 1MX7A 2XKLA 1BSQA 4ORSA 1LIBA 1DZJA 3I17A 2AH7X 4EEJA 5HZ6A 3QKGA 1I06A 2FT9A 4IAXA 3UEWA 2WUTA 1G74A 4YBPA 1BEBA 1VYGA 2FLJA 1VYFA 2N93A 5CE4A 2F73A 4IB9A 1PMPA 4WFVA 3FW4A 1LNMA 1SXWA 4YDBA 5LJDA 5L8OA 1A57A 2LB6A 4IMOA 3KFGA 3PH5A 1GXAA 3O19A 1SA8A 2G78A 5H9NA 1LIDA 1A18A 4OMXA 1I04A 5FFHA 4A1YA 4NLIA 1X8OA 1S2PA 2RQ0A 1GM6A 2OVAA 1ICNA 1SXYA 3B2LA 1R0UA 2CM9A 4ORRA 5H8TA 1IIUA 2QOSC 1KGLA 4A60A 5LJHA 4ZHDA 1SY3A 1LPJA 4YFPA 4ZH6A 3NADA 1VPRA 2AT6X 4ZGUA 4XMFA 5EEDA 1SXUA 4AZOA 2NNEA 1XKIA 3WJCA 1YWCA 2JU7A 1KZXA 3BLGA 3HWDA 5BVTA 1TW4A 2Q2PA 4GRJA 5HCDC 3CMPA 4LKPA 1EIOA 3PP6A 5B27A 4D6AA 2NNQA 4YFQA 2QO5A 3FEPA 5F58A 1HBQA 2L9CA 4NNSA 1JZUA 5HCCC 1AELA 4YH0A 1OEJA 3D97A 2CBSA 2AL0X 4ZHFA 4AZPA 4AZQA 3BX7A 1PEEA 2ACPX 5LKEA 3TGCA 1EQDA 5HBSA 3FIQA 2WSJA 3ELZA 3PEDA 1YUPA 5HZ5A 3FR4A 2LKKA 5KICA 3D95A 1BJ7A 4OMWA 4GNYA 5DG4A 1O1UA 3T1DA 1QY2A 4IB8A 2R74A 1SY1A 1X8QA 3O2YA 4EDEA 1OBQA 2MO5A 3WXQA 1GT3A 1CBRA 3EBWA 3VG5A 1FDQA 2P8GA 1CRBA 1JJXA 1N0SA 1O8VA 3F9DA 1KT7A 2ANSA 4ZCBA 2AT3X 1T68X 5JR8A 1MUPA 1T8VA 4Y0PA 4YKOA 2FR2A 2MJIA 4AZNA 3FA9A 5HAEA 1E5PA 3STMX 1QG5A 5D4AA 1SXXA 4N7DA 1JV4A 1ZNEA 1JYJA 2QO6A 3C77X 5LJEA 4YBUA 1GGLA 4GKCA 4M7MA 2FS6A 2JN3A 3UEXA 1G85A 1EALA 4XMGA 5B29A 5D45A 3CBSA 4ES7A 4HPCA 3ZUIA 1DZPA 1QFTA 2ALLX
chains in the Genus database with same CATH superfamily
3C78X 1EUOA 1H91A 3NQ3A 4YGHA 3SLJA 3WJBA 4TKHA 5IRWA 4BX6A 1ALBA 3FENA 4FGIB 4O3WA 2X55A 2CBRA 1MVGA 3BRNA 3MBTA 4A8ZA 4Z2VA 3SLTA 1NC9A 4JO6A 1ZNKA 1MX8A 4O3YA 3VU1A 5BVQA 1UYNX 1WUBA 4LZUA 2WQ9A 3ELXA 1VWRB 4O3ZA 4ZHHA 3PQSA 3FYFA 1DV9A 1KQXA 1ERBA 5D8JA 1QFVA 3SAOA 4OS3A 4XMEA 2A3FX 4OEMA 4ORYA 2HYSA 1VWBB 3KFHA 2I5VO 4IABA 3FIDA 2LA7A 4YDAA 3TGAA 4DCBA 1RLBE 1KT6A 2HZQA 5AQ6A 1Y53X 3O22A 5K68A 1W5RA 1E2TA 3BSZE 2OVEA 3BU1A 1A2DA 4GJVA 4YGGA 2GTLM 4NV8A 1GX3A 2QM9A 2FHLA 1B0OA 1I05A 1SY0A 1TVQA 4TKJA 4BX6B 1LDQA 1MDCA 3PK2A 4Y59A 4D6BA 5LJKA 4WHIA 4YMYA 4YCHA 1X8NA 3S60A 5AJBA 4Y0SA 1B4MA 5HWZA 3STKA 3WJEA 1NDJA 4BOEA 3APVA 2QOMA 5CSEA 3RDXA 2WQAE 1IFCA 4XMDA 1QY0A 3JS1A 4I3DA 5EDCA 2IZCB 3NR3A 1ZNDA 4LZVA 3KZAA 4CPEA 2G8CO 2JU8A 3P02A 3PDFA 1G5WA 3U9PC 1VWIB 2GTFX 4TLJA 2GJ5A 2PI3O 1STPA 2WEXA 2FR3A 1STRB 2BT9A 3E3CA 3G7XA 3LHNA 2AT5X 3HWGA 4YVBA 2KTDA 1SWLA 5FAZA 4YCEA 4N7CA 4QGWA 2VFBA 4ARHA 1OPBA 1IKEA 2IZJA 1KOIA 2X8TA 3NQ9A 3RDSA 1TOWA 2WR6A 2UZ2A 4GGTA 4ID2A 3PECA 2YMSA 4AZRA 1HN2A 3CKFA 2OF9A 2RTKA 2OL7A 2BSZA 4QNIA 5IO5A 3FA8A 4FBOA 1EI5A 4R0BA 4ZHCA 1ERXA 4XMHA 1LKEA 5F6ZA 4I3BA 2FS7A 4IB6A 3T2XA 3VGWA 2F09A 2RTNB 4TNNA 4BBOA 1X8PA 2RTOB 3GE2A 3STNA 4OS0A 1SRJA 2BLGA 4Z2OA 3U0DA 5B11O 3ZW1B 1LICA 1FEMA 3NX2A 5LJGA 3WZNA 4BQUA 1E06A 1GX9A 4AYHA 1YIVA 2RTHB 2IZFB 3FR5A 1UZ2X 3CBCA 1KT3A 1HQQA 2HKDA 1JJUA 1K3BA 2DJFA 2G5LA 2OVSA 2BHVA 2W2BA 3U03A 2RTPB 3Q6LA 2G79A 4KIIA 5C0NA 2CAMA 1SRGA 5AJCA 1TXLA 3AKMA 1SLFB 3FA6A 1SWBA 1JBHA 2PY1A 1SRFA 4HPAA 4WBKA 4TJZA 2BC3A 3VG7A 3SOTA 1YWDA 3VHMA 1D3SA 4AZMA 4MVEA 1VWNB 1I4UA 2E4JA 3VE1A 3WYPA 5HZ8A 3FA7A 3FLLA 3RDQA 1OBUA 2RTEB 4HPBA 5HA1A 4ZHGA 3B2KA 4GGRA 1CBQA 4QZTA 1KQWA 1LCWA 2HMBA 2IFBA 3DTQA 4JGLA 5HZ9A 3P6FA 4ORXA 4BVMA 3IA8A 5CHKA 1EW3A 4ZR2A 1VWKB 5HA0A 5IO7A 1RXHA 1ZNLA 3OBLA 1X71A 2JW1A 3KVNA 2YG2A 4JNJA 3SZIA 4EKVA 1FENA 1PBYA 2IZHB 3RE5A 4O4OA 1RAVA 4Y0QA 5FENA 1BBPA 3CKGA 3WZPA 1JQPA 5F2BA 1SWOA 2POAA 4KH8A 1X89A 3EW1A 4CDCA 4DQ4A 1N9MA 1VWQB 4ZH9A 3APXA 4U8UM 1IW2A 2X46A 2IZLB 1SY2A 2X56A 3EM0A 2C4IA 4O4XA 3L4RA 2RTBB 1PM1X 2WWPA 1SWDA 4K19A 5H9LA 1LUQA 4KT5A 2IZAA 3VG4A 3LV4A 1IJ8A 2QCBA 4EXZA 1DFVA 1OEKA 2DJGA 3OD9A 2W2FA 4ODDA 1MK5A 1BM5A 3HOEA 1VWPB 2IZEB 3B2JA 4COTA 3CQNA 1BSOA 3KQ0A 5H9KA 2X4MA 2JU3A 4LKTA 3N91A 5D47A 1VWJB 4TQ2A 1DF3A 1CJ5A 1GT4A 1KL3A 2CM4A 2RA6A 4ON1A 3WZQA 4DQ3A 4Z6JA 2NNDA 1ZRYA 1D2UA 2RTIB 2NP1A 3C76X 1YP6A 3GAQA 1GT5A 2ASNX 4ALOA 1ICMA 2RD7C 5HZQA 1HMSA 3P6EA 4Y0RA 3TZSA 3K3LA 1MEPA 5K67A 1ZNGA 3F6ZB 4MVKA 4HWMA 2QMIA 1DC9A 3BDRA 3JSQA 1L6MA 2LBAA 4QZUA 1UREA 4IMNA 1NQMA 3ZUOA 2WEWA 5LJCA 5EEEA 1YP7A 1BWYA 1AVGI 3HTYA 3D4RA 3WVMA 2ACOA 1SWFA 4MEEA 1BRQA 2R56A 3RDOA 1S7DA 2AKQA 1B8EA 3B2HA 4HPDA 2KT4B 4OELA 4UU3A 2BS6A 2OVDA 2FTBA 5KHPA 5AEOA 1B56A 1FTPA 1ADLA 2KTSA 2OY5O 3RDUA 5LJBA 3P6GA 4B55A 3VPJE 1GX8A 3NQKA 5B2AO 2OF8A 1QWDA 4NYRA 1UYOX 4CPIA 1PBOA 1SWRA 4HFOA 2OL6O 1KXOA 4KC8A 3WJFA 4A1HA 1BRPA 1Y52X 2RTDB 3CWKA 2FHNX 1SLEB 2MHDA 4GU8A 4L3RA 1IKJA 1HQPA 1ML7A 2L5PA 1BLRA 4WFUA 5HCEC 4ORWA 1SWQA 4QGVA 2AT0X 1E00A 1TOUA 4M6SA 2FRSA 3NBXX 3NPOA 1EPAA 5CYBA 2RCQA 2X45A 3S5VA 1U18A 3P6CA 3ZW0A 5KIDA 4I9SA 1P6PA 4QYNA 4GD9A 3RDMA 1JYDA 2FKGA 2L67A 2OY8A 2Y3FA 5H9AA 3RSWA 1SWHA 2C1SA 2X8FA 1OPAA 4CDEA 1YWAA 4IAWA 1AQBA 1JMXA 3AKNA 3FW5A 5DPQA 2OZQA 1GKAA 1GT1A 2ZAGA 3D96A 1HXZA 2GH7A 2IZKA 3RZYA 3WBGA 3FELA 3HOLA 3HWEA 4I60A 2OFRX 2RTJA 4EFGA 3TGBA 4BCSA 3F8AA 3OJYC 4YKMA 1SWKA 1HMRA 1KT5A 1DZMA 2O62A 3EMMA 1CBSA 1NGLA 1AB0A 2A13A 1U17A 2GC9A 2OYBO 4XMCA 1N43A 3HK1A 5LKFA 2LBVA 3VG6A 3P6DA 5B3MO 3CR6A 1LCZA 3WJGA 2K62A 1SREA 1EPBA 3FEKA 2A5CA 4NP1A 4Z28A 1SRHA 3UEUA 4YGZA 1RSTB 2W2AA 2A2GA 2RCTA 1OEEA 4IB7A 3RE6A 1LFOA 3EYCA 4MVIA 4FBVA 3MX7A 5F6BA 3HWFA 1FE3A 1SRIA 4TKBA 4GJSA 5IO6A 2RN4A 1QQSA 1VWLB 4ZFXA 3ZW0B 5HTDA 1SWSA 4QRLA 2AMMX 1DZKA 4YFRA 1EIIA 3EBKA 5B10O 4BX5A 5L8NA 3BU9A 1A3YA 3ZI8A 1Y0GA 1LIFA 2F01A 4NLJA 3PPTA 2HNXA 1EXSA 1IFBA 3ZQ3A 2A0AA 3EW2A 1G7NA 3P24A 1OSPO 1FELA 2FWVA 1X8UA 2ZAIA 1VWGB 4U9CA 5IXGA 5BYPA 4QAEA 1GKAB 3ZW2A 1O1VA 3JQOA 4UU2A 1I78A 3VG3A 1NQNA 2Q9SA 2Y32A 3APWA 2OFMX 4EQAC 2AVIA 3SZJA 1RXKA 1AVEA 1HMTA 3KFIA 1AVDA 4Y5DA 5D48A 1RBPA 1LF7A 4Z2PA 2VFCA 1VWAB 3KFFA 2FKJA 2R73A 4FBRA 1E02A 1LDOA 3PH6A 3RWXA 2Q4NA 2QO4A 4BX7A 1SWNA 1U0XA 3BS2A 5EZ2A 3WOVA 1KT4A 1Z24A 1ACDA 1BSYA 2CZTA 2X8SA 3SLOA 1SMPI 2IZBA 3WJDA 1JJJA 3S5XA 1SWCA 3B2IA 3RY1A 4CSBA 3HPEA 2JOZA 4KCAA 2M4LA 2ZSCA 4BGFA 2Q39A 4DNEA 4INNA 1Y9TA 2RTMA 1CBIA 5B5FA 4NYQA 5IRAA 3FR2A 5F7GA 1QABE 4PSQA 3V8UA 1NP4A 4ZJ0A 4BJ8A 4NNTA 2IZGB 1OBPA 3MVFA 4I9RA 5IRUA 3UEVA 3BY0A 5K06A 4GH7A 2AT8X 4BX5B 1VYOA 1MOYA 2CZUA 2K23A 2X34A 3S26A 1LIEA 4GDZA 3T6LA 2LFOA 4O9SA 4OS8A 4ORUA 4IBAA 2JMBA 3IFBA 4GGZA 1ZNHA 2XSTA 1VWDB 2A2UA 3I0AA 1STSB 1DF8A 2IZIA 2OFAA 4GNWA 4MVLA 3NX1A 3CQRA 1NP1A 1T0VA 2KD2A 4AW8A 4GETA 3FMZA 1FJ1E 2G7BA 4RUUA 2MM3A 5EPQA 2HZRA 1YWBA 1HBPA 2EU7X 4GUZA 5BVSA 4CK4A 2DM5A 4CV7A 1VWEB 1XCAA 4QYPA 5FQ6E 4RUNA 4O3XB 5L8IA 1HXLA 2Q2MA 4LQZA 4BX7B 3BX8A 1QY1A 2L68A 3NP1A 3P6HA 1W4TA 3TF6A 4ALBA 5F1EA 3RBYA 3VHIA 4ZGFA 4FQBB 5HTEA 2MWHA 3D9WA 3APUA 1S44A 5EDBA 3DSZA 1MM9A 1LCVA 2HLVA 2WPUA 4GE1A 4I3CA 3VG2A 3WYQA 1MX7A 2XKLA 1BSQA 5FQ7E 1SWUA 4ORSA 1LIBA 4O4SA 1DZJA 2OY7A 4IRWA 3I17A 2AH7X 3AEHA 1SWEA 1N4JA 4EEJA 5HZ6A 3QKGA 1I06A 4MISA 3SZHA 2FT9A 2UYWA 2GTLO 4IAXA 4OKAA 2OFBA 1KL5A 2RTGB 3UEWA 2WUTA 1G74A 4YBPA 2VDFA 1BEBA 1JMZA 2Z4IA 1NBXA 1VYGA 2FLJA 1VYFA 2A8GA 2N93A 5CE4A 4MIRA 2F73A 2RTFB 4GK9A 4IB9A 1PMPA 4WFVA 3FW4A 4ML7B 2OL8O 1LNMA 1SXWA 1VWMB 4YDBA 5LJDA 5L8OA 3LTWA 1A57A 2LB6A 3MM0A 4IMOA 3KFGA 4NW4A 3PH5A 4U3QA 1GXAA 3O19A 1SA8A 2GTLN 1N7YA 2G78A 5H9NA 1LIDA 1A18A 2X32A 1I04A 2AF5A 2OY1O 4OMXA 5FFHA 4NLIA 4A1YA 1JIWI 1X8OA 1SWAA 1S2PA 2Z4HA 2RQ0A 1GM6A 2OVAA 3QQ2A 1Y55X 1ICNA 1SXYA 3B2LA 1R0UA 2CM9A 1SLDB 4ORRA 5H8TA 1LELA 1RSUB 1IIUA 2QOSC 4PJ2A 1KGLA 4A60A 5LJHA 3Q34A 1VWOB 1SY3A 4ZHDA 1LPJA 4YFPA 4ZH6A 3NADA 1VPRA 2AT6X 1VWFB 4ZGUA 4XMFA 5EEDA 1SXUA 4AZOA 1VWCB 2MF6A 2NNEA 1HY2A 1XKIA 2Y3EA 3WJCA 1YWCA 3FDCA 2JU7A 1KZXA 3BLGA 3HWDA 2C1QA 5BVTA 3VHHA 3RKGA 1TW4A 2Q2PA 4GRJA 5HCDC 3CMPA 4LKPA 3RY2A 1EIOA 2JGSA 3PP6A 5B27A 4D6AA 2NNQA 4YFQA 2QO5A 4JHQA 3FEPA 1N9YA 2BS5A 1HBQA 5F58A 4CDDA 2L9CA 4NNSA 2IZDB 1JZUA 1W6FA 5HCCC 1AELA 1KZWA 3AUMO 1OEJA 4YH0A 4GDAA 3D97A 2CBSA 2AL0X 4CPHA 4AZPA 4ZHFA 4I95A 3MG5A 2RTQB 4AZQA 5L3YA 3BX7A 1PEEA 2ACPX 1I9HA 5LKEA 5B5GA 1EQDA 5HBSA 3TGCA 3VE2A 3FIQA 1K24A 1Y9LA 2WSJA 3ELZA 3PEDA 1YUPA 5HZ5A 3ZW1A 3FR4A 2LKKA 1SLGB 4QGXA 5KICA 1SWJA 3D95A 1PTSA 3X00A 1BJ7A 4OMWA 4GNYA 3UAQA 4GZVA 5DG4A 2RTRB 1O1UA 3T1DA 1QY2A 5JD2A 4IB8A 4CDFA 2R74A 5FQ8E 1KL4A 1SY1A 3ZWEA 1X8QA 3O2YA 3EC5A 4EDEA 1OBQA 2MO5A 1VWHB 1WBIA 3WXQA 1GT3A 3OE3A 1CBRA 3EBWA 3VG5A 1FDQA 2P8GA 4L1NA 1CRBA 1JJXA 3ZZVA 1N0SA 1O8VA 3F9DA 1KT7A 2ANSA 4U8UO 4ZCBA 2AT3X 1T68X 5JR8A 1MUPA 1T8VA 3WZOA 4O4UA 4Y0PA 1SWGA 4YKOA 2FR2A 2A5BA 4CPHB 2MJIA 4AZNA 3FA9A 5HAEA 4CPFA 3PQUA 2FGSA 1E5PA 1RXJA 3STMX 3T6FA 1QG5A 5D4AA 1SXXA 2I5ZO 4N7DA 2RTAA 4U46A 4Z27A 1JV4A 1ZNEA 1JYJA 2QO6A 1SWTA 3C77X 3H3IA 3T2WA 4YBUA 1GGLA 4GKCA 4M7MA 2FS6A 2JN3A 4U8UN 3UEXA 5LJEA 1G85A 1EALA 1SWPA 4I6SA 4XMGA 5B29A 1KFFA 2RTCB 5D45A 3CBSA 4NV7A 2KW1A 4O49A 4KC7A 2RTLA 4C5PA 4HPCA 3ZUIA 4ES7A 4QQ1A 1DZPA 1QFTA 2ALLX
chains in the Genus database with same CATH topology
3C78X 1EUOA 1H91A 3NQ3A 4YGHA 3WJBA 4TKHA 1ALBA 3FENA 4FGIB 4O3WA 2CBRA 1MVGA 3BRNA 3MBTA 4A8ZA 1ZNKA 1MX8A 4O3YA 3VU1A 5BVQA 4LZUA 2WQ9A 3ELXA 4O3ZA 4ZHHA 3PQSA 3FYFA 1DV9A 1KQXA 1ERBA 5D8JA 1QFVA 3SAOA 4OS3A 4XMEA 2A3FX 4ORYA 2HYSA 3KFHA 4IABA 2LA7A 4YDAA 3TGAA 1RLBE 1KT6A 2HZQA 5AQ6A 3O22A 3BSZE 2OVEA 3BU1A 1A2DA 4YGGA 2GTLM 2QM9A 1B0OA 1I05A 1SY0A 1TVQA 4TKJA 1MDCA 4D6BA 4WHIA 4YMYA 4YCHA 1X8NA 3S60A 5AJBA 4Y0SA 1B4MA 5HWZA 3STKA 3WJEA 4BOEA 3APVA 2WQAE 1IFCA 4XMDA 1QY0A 3JS1A 4I3DA 5EDCA 3NR3A 1ZNDA 4LZVA 3KZAA 1G5WA 3P02A 2JU8A 3U9PC 4TLJA 2GTFX 2GJ5A 3E3CA 2WEXA 2FR3A 3G7XA 2BT9A 3LHNA 2AT5X 3HWGA 2KTDA 5FAZA 4YCEA 4N7CA 4QGWA 4ARHA 1OPBA 1IKEA 2X8TA 1KOIA 3NQ9A 1TOWA 2WR6A 4ID2A 3PECA 2YMSA 4AZRA 1HN2A 5IO5A 4QNIA 3FA8A 4FBOA 1EI5A 4R0BA 4ZHCA 1ERXA 4XMHA 1LKEA 5F6ZA 4I3BA 2FS7A 4IB6A 2F09A 4TNNA 1X8PA 3GE2A 3STNA 4OS0A 2BLGA 3U0DA 1LICA 1FEMA 3NX2A 5LJGA 4BQUA 1E06A 1GX9A 4AYHA 1YIVA 3FR5A 1UZ2X 3CBCA 1KT3A 2OVSA 2BHVA 2W2BA 3U03A 3Q6LA 2G79A 4KIIA 5C0NA 5AJCA 1TXLA 3AKMA 1JBHA 3FA6A 2PY1A 4HPAA 4WBKA 4TJZA 3VG7A 3SOTA 1YWDA 4AZMA 1D3SA 4MVEA 3VE1A 1I4UA 2E4JA 5LJKA 5HZ8A 3FA7A 3FLLA 1OBUA 4ZHGA 4HPBA 5HA1A 3B2KA 1CBQA 4QZTA 1KQWA 2HMBA 2IFBA 3DTQA 4JGLA 5HZ9A 3P6FA 4ORXA 4BVMA 3IA8A 1EW3A 4ZR2A 5HA0A 5IO7A 1ZNLA 3OBLA 1X71A 2JW1A 2YG2A 3TZSA 1FENA 4O4OA 4Y0QA 5FENA 1BBPA 2POAA 4KH8A 1X89A 4DQ4A 4ZH9A 3APXA 4U8UM 1IW2A 2X46A 1SY2A 3EM0A 4O4XA 3L4RA 1PM1X 2WWPA 4K19A 5H9LA 4KT5A 3VG4A 3LV4A 1DFVA 1OEKA 3OD9A 2W2FA 4ODDA 1BM5A 3HOEA 3B2JA 4COTA 3CQNA 1BSOA 3KQ0A 5H9KA 4LKTA 2JU3A 4TQ2A 3N91A 5D47A 1DF3A 1CJ5A 1GT4A 2CM4A 2RA6A 4ON1A 4DQ3A 2NNDA 1ZRYA 1D2UA 2NP1A 3C76X 1YP6A 3GAQA 1GT5A 2ASNX 4ALOA 1ICMA 2RD7C 5HZQA 1HMSA 3P6EA 4Y0RA 3K3LA 1ZNGA 3F6ZB 4MVKA 4HWMA 2QMIA 1DC9A 3BDRA 3JSQA 1L6MA 2LBAA 4QZUA 1UREA 4IMNA 3ZUOA 2WEWA 5LJCA 5EEEA 1YP7A 1BWYA 1AVGI 3HTYA 3D4RA 3WVMA 2ACOA 1BRQA 2R56A 1S7DA 2AKQA 1B8EA 3B2HA 4HPDA 2KT4B 4UU3A 2BS6A 2OVDA 2FTBA 5KHPA 5AEOA 1B56A 1FTPA 1ADLA 2KTSA 5LJBA 3P6GA 3VPJE 1GX8A 3NQKA 1QWDA 4NYRA 1PBOA 4HFOA 4KC8A 3WJFA 1KXOA 4A1HA 4EXZA 1BRPA 3CWKA 4GU8A 4L3RA 4QAEA 2MHDA 1IKJA 1HQPA 1ML7A 2L5PA 1BLRA 4WFUA 5HCEC 4ORWA 4QGVA 2AT0X 1E00A 1TOUA 4M6SA 2FRSA 3NBXX 3NPOA 1EPAA 5CYBA 2RCQA 2X45A 3S5VA 1U18A 3P6CA 3ZW0A 5KIDA 4I9SA 1P6PA 4QYNA 1JYDA 2L67A 5H9AA 3RSWA 2X8FA 1OPAA 1YWAA 4IAWA 1AQBA 3AKNA 3FW5A 5DPQA 2OZQA 1GKAA 1GT1A 2ZAGA 3D96A 3RZYA 3WBGA 3FELA 3HOLA 3HWEA 2OFRX 4EFGA 3TGBA 3F8AA 3OJYC 4YKMA 1KT5A 1DZMA 2O62A 1HMRA 4QGXA 3EMMA 1CBSA 1NGLA 1AB0A 2A13A 1U17A 2GC9A 4XMCA 2LBVA 3HK1A 5LKFA 3VG6A 3P6DA 3CR6A 3WJGA 2K62A 1EPBA 3FEKA 4NP1A 3UEUA 4YGZA 2W2AA 2A2GA 2RCTA 1OEEA 4IB7A 1LFOA 3EYCA 4MVIA 4FBVA 3MX7A 5F6BA 3HWFA 1FE3A 4TKBA 5IO6A 2RN4A 1QQSA 4ZFXA 3ZW0B 5HTDA 4QRLA 2AMMX 1DZKA 4YFRA 1EIIA 3EBKA 5L8NA 3BU9A 1A3YA 3ZI8A 1LIFA 4NLJA 3PPTA 2HNXA 1EXSA 1IFBA 3ZQ3A 2A0AA 1G7NA 3P24A 1FELA 2FWVA 1X8UA 2ZAIA 4U9CA 5BYPA 1GKAB 3ZW2A 1O1VA 3JQOA 4UU2A 3VG3A 4EQAC 2Q9SA 3APWA 2OFMX 1HMTA 3KFIA 5D48A 1RBPA 1LF7A 3KFFA 2R73A 4FBRA 1E02A 3PH6A 3RWXA 2Q4NA 2QO4A 1U0XA 3BS2A 5EZ2A 3WOVA 1KT4A 1Z24A 1ACDA 1BSYA 2CZTA 2X8SA 3WJDA 1SMPI 1JJJA 3S5XA 3B2IA 4CSBA 2JOZA 4KCAA 2M4LA 2Q39A 4INNA 1Y9TA 1CBIA 4NYQA 3FR2A 5F7GA 1QABE 4PSQA 3V8UA 1NP4A 4ZJ0A 4NNTA 1OBPA 3MVFA 4I9RA 5K06A 3UEVA 3BY0A 4GH7A 2AT8X 2CZUA 2K23A 3S26A 1LIEA 4GDZA 2LFOA 4O9SA 4OS8A 4ORUA 4IBAA 2JMBA 3IFBA 1KZWA 1ZNHA 2XSTA 4GNWA 2A2UA 3I0AA 4MVLA 3NX1A 3CQRA 1NP1A 1T0VA 2KD2A 4AW8A 4GETA 3FMZA 2G7BA 4RUUA 2MM3A 5EPQA 2HZRA 1YWBA 1HBPA 2EU7X 5BVSA 4CK4A 2DM5A 4CV7A 4QYPA 1XCAA 5FQ6E 4RUNA 4O3XB 5L8IA 2Q2MA 4LQZA 3BX8A 1QY1A 2L68A 3NP1A 3P6HA 3TF6A 4ALBA 5F1EA 3RBYA 4ZGFA 4FQBB 5HTEA 2MWHA 3APUA 1S44A 5EDBA 3DSZA 2HLVA 4GE1A 4I3CA 3VG2A 1MX7A 2XKLA 1BSQA 5FQ7E 4ORSA 1LIBA 4O4SA 1DZJA 3I17A 2AH7X 4EEJA 5HZ6A 3QKGA 1I06A 4MISA 2FT9A 2GTLO 4IAXA 3UEWA 2WUTA 1G74A 4YBPA 1BEBA 2Z4IA 1VYGA 2FLJA 1VYFA 2N93A 5CE4A 4MIRA 2F73A 4GK9A 4IB9A 1PMPA 4WFVA 3FW4A 4ML7B 1LNMA 1SXWA 4YDBA 5LJDA 5L8OA 1A57A 2LB6A 4IMOA 3KFGA 4NW4A 3PH5A 4U3QA 1GXAA 3O19A 1SA8A 2GTLN 2G78A 5H9NA 1LIDA 1A18A 4OMXA 1I04A 5FFHA 4A1YA 4NLIA 1JIWI 1X8OA 1S2PA 2Z4HA 2RQ0A 1GM6A 2OVAA 1ICNA 1SXYA 3B2LA 1R0UA 2CM9A 4ORRA 5H8TA 1IIUA 2QOSC 4PJ2A 1KGLA 4A60A 5LJHA 4ZHDA 1SY3A 1LPJA 4YFPA 4ZH6A 3NADA 1VPRA 2AT6X 4ZGUA 4XMFA 5EEDA 1SXUA 4AZOA 2NNEA 1XKIA 3WJCA 1YWCA 2JU7A 1KZXA 3BLGA 3HWDA 5BVTA 3RKGA 1TW4A 2Q2PA 4GRJA 5HCDC 3CMPA 4LKPA 1EIOA 3PP6A 5B27A 4D6AA 2NNQA 4YFQA 2QO5A 3FEPA 2BS5A 5F58A 1HBQA 2L9CA 4NNSA 1JZUA 5HCCC 1AELA 4YH0A 1OEJA 3D97A 2CBSA 2AL0X 4ZHFA 4AZPA 4I95A 4AZQA 3BX7A 1PEEA 2ACPX 5LKEA 3TGCA 1EQDA 5HBSA 3VE2A 3FIQA 1Y9LA 2WSJA 3ELZA 3PEDA 1YUPA 5HZ5A 3ZW1A 3FR4A 2LKKA 5KICA 3D95A 1BJ7A 4OMWA 4GNYA 3UAQA 4GZVA 5DG4A 1O1UA 3T1DA 1QY2A 4IB8A 2R74A 5FQ8E 1SY1A 3ZWEA 1X8QA 3O2YA 4EDEA 1OBQA 2MO5A 3WXQA 1GT3A 3OE3A 1CBRA 3EBWA 3VG5A 1FDQA 2P8GA 4L1NA 1CRBA 1JJXA 3ZZVA 1N0SA 1O8VA 3F9DA 1KT7A 2ANSA 4U8UO 4ZCBA 2AT3X 1T68X 5JR8A 1MUPA 1T8VA 4O4UA 4Y0PA 4YKOA 2FR2A 2MJIA 4AZNA 3FA9A 5HAEA 3PQUA 1E5PA 3STMX 1QG5A 5D4AA 1SXXA 4N7DA 1JV4A 1ZNEA 1JYJA 2QO6A 3C77X 3ZW1B 3H3IA 5LJEA 4YBUA 1GGLA 4GKCA 4M7MA 2FS6A 2JN3A 4U8UN 3UEXA 1G85A 1EALA 4I6SA 4XMGA 5B29A 5D45A 3CBSA 4ES7A 2KW1A 4O49A 4KC7A 4HPCA 3ZUIA 4QQ1A 1DZPA 1QFTA 2ALLX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C78 X;  1EUO A;  1H91 A;  3NQ3 A;  4YGH A;  3WJB A;  4TKH A;  1ALB A;  3FEN A;  2CBR A;  1MVG A;  3BRN A;  3MBT A;  4A8Z A;  1ZNK A;  1MX8 A;  5BVQ A;  4LZU A;  2WQ9 A;  3ELX A;  4ZHH A;  1DV9 A;  1KQX A;  1ERB A;  5D8J A;  1QFV A;  3SAO A;  4OS3 A;  4XME A;  2A3F X;  4ORY A;  2HYS A;  3KFH A;  4YDA A;  3TGA A;  1RLB E;  1KT6 A;  2HZQ A;  5AQ6 A;  3O22 A;  3BSZ E;  2OVE A;  3BU1 A;  1A2D A;  4YGG A;  2QM9 A;  1B0O A;  1I05 A;  1SY0 A;  1TVQ A;  4TKJ A;  1MDC A;  4D6B A;  4YMY A;  4YCH A;  1X8N A;  4Y0S A;  1B4M A;  5HWZ A;  3STK A;  3WJE A;  4BOE A;  3APV A;  2WQA E;  1IFC A;  4XMD A;  1QY0 A;  3JS1 A;  4I3D A;  5EDC A;  3NR3 A;  1ZND A;  4LZV A;  3KZA A;  1G5W A;  2JU8 A;  3U9P C;  4TLJ A;  2GTF X;  2GJ5 A;  2WEX A;  2FR3 A;  3G7X A;  2AT5 X;  3HWG A;  2KTD A;  5FAZ A;  4YCE A;  4N7C A;  4QGW A;  4ARH A;  1OPB A;  1IKE A;  3NQ9 A;  1KOI A;  1TOW A;  2WR6 A;  3PEC A;  4AZR A;  1HN2 A;  5IO5 A;  3FA8 A;  4ZHC A;  4R0B A;  1ERX A;  4XMH A;  1LKE A;  5F6Z A;  4I3B A;  2FS7 A;  4IB6 A;  4TNN A;  1X8P A;  3STN A;  4OS0 A;  2BLG A;  3U0D A;  1LIC A;  1FEM A;  3NX2 A;  5LJG A;  4BQU A;  1E06 A;  1GX9 A;  4AYH A;  1YIV A;  3FR5 A;  1UZ2 X;  3CBC A;  1KT3 A;  2W2B A;  3U03 A;  3Q6L A;  2G79 A;  4KII A;  5C0N A;  1TXL A;  3AKM A;  1JBH A;  3FA6 A;  2PY1 A;  4HPA A;  4WBK A;  4TJZ A;  3VG7 A;  4AZM A;  1YWD A;  1D3S A;  1I4U A;  2E4J A;  5LJK A;  5HZ8 A;  3FA7 A;  3FLL A;  1OBU A;  4ZHG A;  4HPB A;  5HA1 A;  3B2K A;  1CBQ A;  4QZT A;  1KQW A;  2HMB A;  2IFB A;  3DTQ A;  5HZ9 A;  3P6F A;  4ORX A;  4BVM A;  3IA8 A;  1EW3 A;  4ZR2 A;  5HA0 A;  5IO7 A;  1ZNL A;  1X71 A;  2YG2 A;  3TZS A;  1FEN A;  4Y0Q A;  5FEN A;  1BBP A;  2POA A;  1X89 A;  4DQ4 A;  4ZH9 A;  3APX A;  1IW2 A;  2X46 A;  1SY2 A;  3EM0 A;  3L4R A;  1PM1 X;  2WWP A;  4K19 A;  5H9L A;  3VG4 A;  1DFV A;  1OEK A;  2W2F A;  4ODD A;  1BM5 A;  3B2J A;  3CQN A;  1BSO A;  3KQ0 A;  5H9K A;  4LKT A;  2JU3 A;  4TQ2 A;  5D47 A;  1DF3 A;  1CJ5 A;  1GT4 A;  2CM4 A;  2RA6 A;  4DQ3 A;  2NND A;  1ZRY A;  1D2U A;  2NP1 A;  3C76 X;  1YP6 A;  3GAQ A;  1GT5 A;  2ASN X;  4ALO A;  1ICM A;  2RD7 C;  5HZQ A;  1HMS A;  3P6E A;  4Y0R A;  3K3L A;  1ZNG A;  4MVK A;  1DC9 A;  3BDR A;  3JSQ A;  1L6M A;  2LBA A;  4QZU A;  1URE A;  4IMN A;  3ZUO A;  2WEW A;  5LJC A;  5EEE A;  1YP7 A;  1BWY A;  1AVG I;  3WVM A;  2ACO A;  1BRQ A;  2R56 A;  1S7D A;  2AKQ A;  1B8E A;  3B2H A;  4HPD A;  2KT4 B;  4UU3 A;  2OVD A;  2FTB A;  5KHP A;  1B56 A;  1FTP A;  1ADL A;  5LJB A;  3P6G A;  1GX8 A;  1QWD A;  4NYR A;  1PBO A;  4HFO A;  3WJF A;  4EXZ A;  1KXO A;  4A1H A;  1BRP A;  3CWK A;  4QAE A;  1IKJ A;  1HQP A;  1ML7 A;  2L5P A;  1BLR A;  4WFU A;  5HCE C;  4ORW A;  4QGV A;  2AT0 X;  1E00 A;  1TOU A;  4M6S A;  2FRS A;  3NPO A;  1EPA A;  2RCQ A;  2X45 A;  1U18 A;  3P6C A;  5KID A;  4I9S A;  1P6P A;  4QYN A;  1JYD A;  2L67 A;  5H9A A;  3RSW A;  1OPA A;  1YWA A;  4IAW A;  1AQB A;  3AKN A;  3FW5 A;  5DPQ A;  2OZQ A;  1GKA A;  1GT1 A;  3D96 A;  3RZY A;  3WBG A;  3FEL A;  3HWE A;  2OFR X;  4EFG A;  3TGB A;  3F8A A;  3OJY C;  4YKM A;  1KT5 A;  1DZM A;  2O62 A;  1HMR A;  4QGX A;  3EMM A;  1CBS A;  1NGL A;  1AB0 A;  2A13 A;  1U17 A;  2GC9 A;  4XMC A;  2LBV A;  3HK1 A;  5LKF A;  3VG6 A;  3P6D A;  3CR6 A;  3WJG A;  2K62 A;  1EPB A;  3FEK A;  4NP1 A;  3UEU A;  4YGZ A;  2W2A A;  2A2G A;  2RCT A;  1OEE A;  4IB7 A;  1LFO A;  3EYC A;  4MVI A;  5F6B A;  3HWF A;  1FE3 A;  4TKB A;  5IO6 A;  1QQS A;  4ZFX A;  5HTD A;  2AMM X;  1DZK A;  4YFR A;  1EII A;  3EBK A;  5L8N A;  3BU9 A;  1A3Y A;  1LIF A;  4NLJ A;  3PPT A;  2HNX A;  1EXS A;  1IFB A;  3ZQ3 A;  2A0A A;  1G7N A;  1FEL A;  2FWV A;  1X8U A;  1GKA B;  1O1V A;  4UU2 A;  3VG3 A;  2Q9S A;  3APW A;  2OFM X;  1HMT A;  3KFI A;  5D48 A;  1RBP A;  1LF7 A;  3KFF A;  2R73 A;  1E02 A;  3PH6 A;  2Q4N A;  2QO4 A;  1U0X A;  3BS2 A;  5EZ2 A;  1KT4 A;  1Z24 A;  1ACD A;  1BSY A;  2CZT A;  3WJD A;  1JJJ A;  3B2I A;  2JOZ A;  2Q39 A;  1CBI A;  4NYQ A;  3FR2 A;  5F7G A;  1QAB E;  4PSQ A;  4ZJ0 A;  1NP4 A;  4NNT A;  1OBP A;  3MVF A;  4I9R A;  5K06 A;  3UEV A;  3BY0 A;  4GH7 A;  2AT8 X;  2CZU A;  2K23 A;  3S26 A;  1LIE A;  2LFO A;  4O9S A;  4OS8 A;  4ORU A;  4IBA A;  1KZW A;  3IFB A;  1ZNH A;  2XST A;  4GNW A;  2A2U A;  3I0A A;  4MVL A;  3NX1 A;  3CQR A;  1NP1 A;  1T0V A;  4AW8 A;  4GET A;  3FMZ A;  2G7B A;  4RUU A;  2MM3 A;  5EPQ A;  2HZR A;  1YWB A;  1HBP A;  2EU7 X;  5BVS A;  4CK4 A;  2DM5 A;  4QYP A;  1XCA A;  4RUN A;  5L8I A;  2Q2M A;  3BX8 A;  1QY1 A;  2L68 A;  3NP1 A;  3P6H A;  3TF6 A;  4ALB A;  5F1E A;  5HTE A;  3APU A;  1S44 A;  5EDB A;  3DSZ A;  2HLV A;  4GE1 A;  4I3C A;  3VG2 A;  1MX7 A;  2XKL A;  1BSQ A;  4ORS A;  1LIB A;  1DZJ A;  3I17 A;  2AH7 X;  4EEJ A;  5HZ6 A;  3QKG A;  1I06 A;  2FT9 A;  4IAX A;  3UEW A;  2WUT A;  1G74 A;  4YBP A;  1BEB A;  1VYG A;  2FLJ A;  1VYF A;  2N93 A;  5CE4 A;  2F73 A;  4IB9 A;  1PMP A;  4WFV A;  3FW4 A;  1LNM A;  1SXW A;  4YDB A;  5LJD A;  5L8O A;  1A57 A;  2LB6 A;  4IMO A;  3KFG A;  3PH5 A;  1GXA A;  3O19 A;  1SA8 A;  2G78 A;  5H9N A;  1LID A;  1A18 A;  4OMX A;  1I04 A;  5FFH A;  4A1Y A;  4NLI A;  1X8O A;  1S2P A;  2RQ0 A;  1GM6 A;  2OVA A;  1ICN A;  1SXY A;  3B2L A;  1R0U A;  2CM9 A;  4ORR A;  5H8T A;  1IIU A;  2QOS C;  1KGL A;  4A60 A;  5LJH A;  4ZHD A;  1SY3 A;  1LPJ A;  4YFP A;  4ZH6 A;  3NAD A;  1VPR A;  2AT6 X;  4ZGU A;  4XMF A;  5EED A;  1SXU A;  4AZO A;  2NNE A;  1XKI A;  3WJC A;  1YWC A;  2JU7 A;  1KZX A;  3BLG A;  3HWD A;  5BVT A;  1TW4 A;  2Q2P A;  4GRJ A;  5HCD C;  3CMP A;  4LKP A;  1EIO A;  3PP6 A;  5B27 A;  4D6A A;  2NNQ A;  4YFQ A;  2QO5 A;  3FEP A;  5F58 A;  1HBQ A;  2L9C A;  4NNS A;  1JZU A;  5HCC C;  1AEL A;  4YH0 A;  1OEJ A;  3D97 A;  2CBS A;  2AL0 X;  4ZHF A;  4AZP A;  4AZQ A;  3BX7 A;  1PEE A;  2ACP X;  5LKE A;  3TGC A;  1EQD A;  5HBS A;  3FIQ A;  2WSJ A;  3ELZ A;  3PED A;  1YUP A;  5HZ5 A;  3FR4 A;  2LKK A;  5KIC A;  3D95 A;  1BJ7 A;  4OMW A;  4GNY A;  5DG4 A;  1O1U A;  3T1D A;  1QY2 A;  4IB8 A;  2R74 A;  1SY1 A;  1X8Q A;  3O2Y A;  4EDE A;  1OBQ A;  2MO5 A;  3WXQ A;  1GT3 A;  1CBR A;  3EBW A;  3VG5 A;  1FDQ A;  2P8G A;  1CRB A;  1JJX A;  1N0S A;  1O8V A;  3F9D A;  1KT7 A;  2ANS A;  4ZCB A;  2AT3 X;  1T68 X;  5JR8 A;  1MUP A;  1T8V A;  4Y0P A;  4YKO A;  2FR2 A;  2MJI A;  4AZN A;  3FA9 A;  5HAE A;  1E5P A;  3STM X;  1QG5 A;  5D4A A;  1SXX A;  4N7D A;  1JV4 A;  1ZNE A;  1JYJ A;  2QO6 A;  3C77 X;  5LJE A;  4YBU A;  1GGL A;  4GKC A;  4M7M A;  2FS6 A;  2JN3 A;  3UEX A;  1G85 A;  1EAL A;  4XMG A;  5B29 A;  5D45 A;  3CBS A;  4ES7 A;  4HPC A;  3ZUI A;  1DZP A;  1QFT A;  2ALL X; 
#chains in the Genus database with same CATH topology
 3C78 X;  1EUO A;  1H91 A;  3NQ3 A;  4YGH A;  3SLJ A;  3WJB A;  4TKH A;  5IRW A;  4BX6 A;  1ALB A;  3FEN A;  4FGI B;  4O3W A;  2X55 A;  2CBR A;  1MVG A;  3BRN A;  3MBT A;  4A8Z A;  4Z2V A;  3SLT A;  1NC9 A;  4JO6 A;  1ZNK A;  1MX8 A;  4O3Y A;  3VU1 A;  5BVQ A;  1UYN X;  1WUB A;  4LZU A;  2WQ9 A;  3ELX A;  1VWR B;  4O3Z A;  4ZHH A;  3PQS A;  3FYF A;  1DV9 A;  1KQX A;  1ERB A;  5D8J A;  1QFV A;  3SAO A;  4OS3 A;  4XME A;  2A3F X;  4OEM A;  4ORY A;  2HYS A;  1VWB B;  3KFH A;  2I5V O;  4IAB A;  3FID A;  2LA7 A;  4YDA A;  3TGA A;  4DCB A;  1RLB E;  1KT6 A;  2HZQ A;  5AQ6 A;  1Y53 X;  3O22 A;  5K68 A;  1W5R A;  1E2T A;  3BSZ E;  2OVE A;  3BU1 A;  1A2D A;  4GJV A;  4YGG A;  2GTL M;  4NV8 A;  1GX3 A;  2QM9 A;  2FHL A;  1B0O A;  1I05 A;  1SY0 A;  1TVQ A;  4TKJ A;  4BX6 B;  1LDQ A;  1MDC A;  3PK2 A;  4Y59 A;  4D6B A;  5LJK A;  4WHI A;  4YMY A;  4YCH A;  1X8N A;  3S60 A;  5AJB A;  4Y0S A;  1B4M A;  5HWZ A;  3STK A;  3WJE A;  1NDJ A;  4BOE A;  3APV A;  2QOM A;  5CSE A;  3RDX A;  2WQA E;  1IFC A;  4XMD A;  1QY0 A;  3JS1 A;  4I3D A;  5EDC A;  2IZC B;  3NR3 A;  1ZND A;  4LZV A;  3KZA A;  4CPE A;  2G8C O;  2JU8 A;  3P02 A;  3PDF A;  1G5W A;  3U9P C;  1VWI B;  2GTF X;  4TLJ A;  2GJ5 A;  2PI3 O;  1STP A;  2WEX A;  2FR3 A;  1STR B;  2BT9 A;  3E3C A;  3G7X A;  3LHN A;  2AT5 X;  3HWG A;  4YVB A;  2KTD A;  1SWL A;  5FAZ A;  4YCE A;  4N7C A;  4QGW A;  2VFB A;  4ARH A;  1OPB A;  1IKE A;  2IZJ A;  1KOI A;  2X8T A;  3NQ9 A;  3RDS A;  1TOW A;  2WR6 A;  2UZ2 A;  4GGT A;  4ID2 A;  3PEC A;  2YMS A;  4AZR A;  1HN2 A;  3CKF A;  2OF9 A;  2RTK A;  2OL7 A;  2BSZ A;  4QNI A;  5IO5 A;  3FA8 A;  4FBO A;  1EI5 A;  4R0B A;  4ZHC A;  1ERX A;  4XMH A;  1LKE A;  5F6Z A;  4I3B A;  2FS7 A;  4IB6 A;  3T2X A;  3VGW A;  2F09 A;  2RTN B;  4TNN A;  4BBO A;  1X8P A;  2RTO B;  3GE2 A;  3STN A;  4OS0 A;  1SRJ A;  2BLG A;  4Z2O A;  3U0D A;  5B11 O;  3ZW1 B;  1LIC A;  1FEM A;  3NX2 A;  5LJG A;  3WZN A;  4BQU A;  1E06 A;  1GX9 A;  4AYH A;  1YIV A;  2RTH B;  2IZF B;  3FR5 A;  1UZ2 X;  3CBC A;  1KT3 A;  1HQQ A;  2HKD A;  1JJU A;  1K3B A;  2DJF A;  2G5L A;  2OVS A;  2BHV A;  2W2B A;  3U03 A;  2RTP B;  3Q6L A;  2G79 A;  4KII A;  5C0N A;  2CAM A;  1SRG A;  5AJC A;  1TXL A;  3AKM A;  1SLF B;  3FA6 A;  1SWB A;  1JBH A;  2PY1 A;  1SRF A;  4HPA A;  4WBK A;  4TJZ A;  2BC3 A;  3VG7 A;  3SOT A;  1YWD A;  3VHM A;  1D3S A;  4AZM A;  4MVE A;  1VWN B;  1I4U A;  2E4J A;  3VE1 A;  3WYP A;  5HZ8 A;  3FA7 A;  3FLL A;  3RDQ A;  1OBU A;  2RTE B;  4HPB A;  5HA1 A;  4ZHG A;  3B2K A;  4GGR A;  1CBQ A;  4QZT A;  1KQW A;  1LCW A;  2HMB A;  2IFB A;  3DTQ A;  4JGL A;  5HZ9 A;  3P6F A;  4ORX A;  4BVM A;  3IA8 A;  5CHK A;  1EW3 A;  4ZR2 A;  1VWK B;  5HA0 A;  5IO7 A;  1RXH A;  1ZNL A;  3OBL A;  1X71 A;  2JW1 A;  3KVN A;  2YG2 A;  4JNJ A;  3SZI A;  4EKV A;  1FEN A;  1PBY A;  2IZH B;  3RE5 A;  4O4O A;  1RAV A;  4Y0Q A;  5FEN A;  1BBP A;  3CKG A;  3WZP A;  1JQP A;  5F2B A;  1SWO A;  2POA A;  4KH8 A;  1X89 A;  3EW1 A;  4CDC A;  4DQ4 A;  1N9M A;  1VWQ B;  4ZH9 A;  3APX A;  4U8U M;  1IW2 A;  2X46 A;  2IZL B;  1SY2 A;  2X56 A;  3EM0 A;  2C4I A;  4O4X A;  3L4R A;  2RTB B;  1PM1 X;  2WWP A;  1SWD A;  4K19 A;  5H9L A;  1LUQ A;  4KT5 A;  2IZA A;  3VG4 A;  3LV4 A;  1IJ8 A;  2QCB A;  4EXZ A;  1DFV A;  1OEK A;  2DJG A;  3OD9 A;  2W2F A;  4ODD A;  1MK5 A;  1BM5 A;  3HOE A;  1VWP B;  2IZE B;  3B2J A;  4COT A;  3CQN A;  1BSO A;  3KQ0 A;  5H9K A;  2X4M A;  2JU3 A;  4LKT A;  3N91 A;  5D47 A;  1VWJ B;  4TQ2 A;  1DF3 A;  1CJ5 A;  1GT4 A;  1KL3 A;  2CM4 A;  2RA6 A;  4ON1 A;  3WZQ A;  4DQ3 A;  4Z6J A;  2NND A;  1ZRY A;  1D2U A;  2RTI B;  2NP1 A;  3C76 X;  1YP6 A;  3GAQ A;  1GT5 A;  2ASN X;  4ALO A;  1ICM A;  2RD7 C;  5HZQ A;  1HMS A;  3P6E A;  4Y0R A;  3TZS A;  3K3L A;  1MEP A;  5K67 A;  1ZNG A;  3F6Z B;  4MVK A;  4HWM A;  2QMI A;  1DC9 A;  3BDR A;  3JSQ A;  1L6M A;  2LBA A;  4QZU A;  1URE A;  4IMN A;  1NQM A;  3ZUO A;  2WEW A;  5LJC A;  5EEE A;  1YP7 A;  1BWY A;  1AVG I;  3HTY A;  3D4R A;  3WVM A;  2ACO A;  1SWF A;  4MEE A;  1BRQ A;  2R56 A;  3RDO A;  1S7D A;  2AKQ A;  1B8E A;  3B2H A;  4HPD A;  2KT4 B;  4OEL A;  4UU3 A;  2BS6 A;  2OVD A;  2FTB A;  5KHP A;  5AEO A;  1B56 A;  1FTP A;  1ADL A;  2KTS A;  2OY5 O;  3RDU A;  5LJB A;  3P6G A;  4B55 A;  3VPJ E;  1GX8 A;  3NQK A;  5B2A O;  2OF8 A;  1QWD A;  4NYR A;  1UYO X;  4CPI A;  1PBO A;  1SWR A;  4HFO A;  2OL6 O;  1KXO A;  4KC8 A;  3WJF A;  4A1H A;  1BRP A;  1Y52 X;  2RTD B;  3CWK A;  2FHN X;  1SLE B;  2MHD A;  4GU8 A;  4L3R A;  1IKJ A;  1HQP A;  1ML7 A;  2L5P A;  1BLR A;  4WFU A;  5HCE C;  4ORW A;  1SWQ A;  4QGV A;  2AT0 X;  1E00 A;  1TOU A;  4M6S A;  2FRS A;  3NBX X;  3NPO A;  1EPA A;  5CYB A;  2RCQ A;  2X45 A;  3S5V A;  1U18 A;  3P6C A;  3ZW0 A;  5KID A;  4I9S A;  1P6P A;  4QYN A;  4GD9 A;  3RDM A;  1JYD A;  2FKG A;  2L67 A;  2OY8 A;  2Y3F A;  5H9A A;  3RSW A;  1SWH A;  2C1S A;  2X8F A;  1OPA A;  4CDE A;  1YWA A;  4IAW A;  1AQB A;  1JMX A;  3AKN A;  3FW5 A;  5DPQ A;  2OZQ A;  1GKA A;  1GT1 A;  2ZAG A;  3D96 A;  1HXZ A;  2GH7 A;  2IZK A;  3RZY A;  3WBG A;  3FEL A;  3HOL A;  3HWE A;  4I60 A;  2OFR X;  2RTJ A;  4EFG A;  3TGB A;  4BCS A;  3F8A A;  3OJY C;  4YKM A;  1SWK A;  1HMR A;  1KT5 A;  1DZM A;  2O62 A;  3EMM A;  1CBS A;  1NGL A;  1AB0 A;  2A13 A;  1U17 A;  2GC9 A;  2OYB O;  4XMC A;  1N43 A;  3HK1 A;  5LKF A;  2LBV A;  3VG6 A;  3P6D A;  5B3M O;  3CR6 A;  1LCZ A;  3WJG A;  2K62 A;  1SRE A;  1EPB A;  3FEK A;  2A5C A;  4NP1 A;  4Z28 A;  1SRH A;  3UEU A;  4YGZ A;  1RST B;  2W2A A;  2A2G A;  2RCT A;  1OEE A;  4IB7 A;  3RE6 A;  1LFO A;  3EYC A;  4MVI A;  4FBV A;  3MX7 A;  5F6B A;  3HWF A;  1FE3 A;  1SRI A;  4TKB A;  4GJS A;  5IO6 A;  2RN4 A;  1QQS A;  1VWL B;  4ZFX A;  3ZW0 B;  5HTD A;  1SWS A;  4QRL A;  2AMM X;  1DZK A;  4YFR A;  1EII A;  3EBK A;  5B10 O;  4BX5 A;  5L8N A;  3BU9 A;  1A3Y A;  3ZI8 A;  1Y0G A;  1LIF A;  2F01 A;  4NLJ A;  3PPT A;  2HNX A;  1EXS A;  1IFB A;  3ZQ3 A;  2A0A A;  3EW2 A;  1G7N A;  3P24 A;  1OSP O;  1FEL A;  2FWV A;  1X8U A;  2ZAI A;  1VWG B;  4U9C A;  5IXG A;  5BYP A;  4QAE A;  1GKA B;  3ZW2 A;  1O1V A;  3JQO A;  4UU2 A;  1I78 A;  3VG3 A;  1NQN A;  2Q9S A;  2Y32 A;  3APW A;  2OFM X;  4EQA C;  2AVI A;  3SZJ A;  1RXK A;  1AVE A;  1HMT A;  3KFI A;  1AVD A;  4Y5D A;  5D48 A;  1RBP A;  1LF7 A;  4Z2P A;  2VFC A;  1VWA B;  3KFF A;  2FKJ A;  2R73 A;  4FBR A;  1E02 A;  1LDO A;  3PH6 A;  3RWX A;  2Q4N A;  2QO4 A;  4BX7 A;  1SWN A;  1U0X A;  3BS2 A;  5EZ2 A;  3WOV A;  1KT4 A;  1Z24 A;  1ACD A;  1BSY A;  2CZT A;  2X8S A;  3SLO A;  1SMP I;  2IZB A;  3WJD A;  1JJJ A;  3S5X A;  1SWC A;  3B2I A;  3RY1 A;  4CSB A;  3HPE A;  2JOZ A;  4KCA A;  2M4L A;  2ZSC A;  4BGF A;  2Q39 A;  4DNE A;  4INN A;  1Y9T A;  2RTM A;  1CBI A;  5B5F A;  4NYQ A;  5IRA A;  3FR2 A;  5F7G A;  1QAB E;  4PSQ A;  3V8U A;  1NP4 A;  4ZJ0 A;  4BJ8 A;  4NNT A;  2IZG B;  1OBP A;  3MVF A;  4I9R A;  5IRU A;  3UEV A;  3BY0 A;  5K06 A;  4GH7 A;  2AT8 X;  4BX5 B;  1VYO A;  1MOY A;  2CZU A;  2K23 A;  2X34 A;  3S26 A;  1LIE A;  4GDZ A;  3T6L A;  2LFO A;  4O9S A;  4OS8 A;  4ORU A;  4IBA A;  2JMB A;  3IFB A;  4GGZ A;  1ZNH A;  2XST A;  1VWD B;  2A2U A;  3I0A A;  1STS B;  1DF8 A;  2IZI A;  2OFA A;  4GNW A;  4MVL A;  3NX1 A;  3CQR A;  1NP1 A;  1T0V A;  2KD2 A;  4AW8 A;  4GET A;  3FMZ A;  1FJ1 E;  2G7B A;  4RUU A;  2MM3 A;  5EPQ A;  2HZR A;  1YWB A;  1HBP A;  2EU7 X;  4GUZ A;  5BVS A;  4CK4 A;  2DM5 A;  4CV7 A;  1VWE B;  1XCA A;  4QYP A;  5FQ6 E;  4RUN A;  4O3X B;  5L8I A;  1HXL A;  2Q2M A;  4LQZ A;  4BX7 B;  3BX8 A;  1QY1 A;  2L68 A;  3NP1 A;  3P6H A;  1W4T A;  3TF6 A;  4ALB A;  5F1E A;  3RBY A;  3VHI A;  4ZGF A;  4FQB B;  5HTE A;  2MWH A;  3D9W A;  3APU A;  1S44 A;  5EDB A;  3DSZ A;  1MM9 A;  1LCV A;  2HLV A;  2WPU A;  4GE1 A;  4I3C A;  3VG2 A;  3WYQ A;  1MX7 A;  2XKL A;  1BSQ A;  5FQ7 E;  1SWU A;  4ORS A;  1LIB A;  4O4S A;  1DZJ A;  2OY7 A;  4IRW A;  3I17 A;  2AH7 X;  3AEH A;  1SWE A;  1N4J A;  4EEJ A;  5HZ6 A;  3QKG A;  1I06 A;  4MIS A;  3SZH A;  2FT9 A;  2UYW A;  2GTL O;  4IAX A;  4OKA A;  2OFB A;  1KL5 A;  2RTG B;  3UEW A;  2WUT A;  1G74 A;  4YBP A;  2VDF A;  1BEB A;  1JMZ A;  2Z4I A;  1NBX A;  1VYG A;  2FLJ A;  1VYF A;  2A8G A;  2N93 A;  5CE4 A;  4MIR A;  2F73 A;  2RTF B;  4GK9 A;  4IB9 A;  1PMP A;  4WFV A;  3FW4 A;  4ML7 B;  2OL8 O;  1LNM A;  1SXW A;  1VWM B;  4YDB A;  5LJD A;  5L8O A;  3LTW A;  1A57 A;  2LB6 A;  3MM0 A;  4IMO A;  3KFG A;  4NW4 A;  3PH5 A;  4U3Q A;  1GXA A;  3O19 A;  1SA8 A;  2GTL N;  1N7Y A;  2G78 A;  5H9N A;  1LID A;  1A18 A;  2X32 A;  1I04 A;  2AF5 A;  2OY1 O;  4OMX A;  5FFH A;  4NLI A;  4A1Y A;  1JIW I;  1X8O A;  1SWA A;  1S2P A;  2Z4H A;  2RQ0 A;  1GM6 A;  2OVA A;  3QQ2 A;  1Y55 X;  1ICN A;  1SXY A;  3B2L A;  1R0U A;  2CM9 A;  1SLD B;  4ORR A;  5H8T A;  1LEL A;  1RSU B;  1IIU A;  2QOS C;  4PJ2 A;  1KGL A;  4A60 A;  5LJH A;  3Q34 A;  1VWO B;  1SY3 A;  4ZHD A;  1LPJ A;  4YFP A;  4ZH6 A;  3NAD A;  1VPR A;  2AT6 X;  1VWF B;  4ZGU A;  4XMF A;  5EED A;  1SXU A;  4AZO A;  1VWC B;  2MF6 A;  2NNE A;  1HY2 A;  1XKI A;  2Y3E A;  3WJC A;  1YWC A;  3FDC A;  2JU7 A;  1KZX A;  3BLG A;  3HWD A;  2C1Q A;  5BVT A;  3VHH A;  3RKG A;  1TW4 A;  2Q2P A;  4GRJ A;  5HCD C;  3CMP A;  4LKP A;  3RY2 A;  1EIO A;  2JGS A;  3PP6 A;  5B27 A;  4D6A A;  2NNQ A;  4YFQ A;  2QO5 A;  4JHQ A;  3FEP A;  1N9Y A;  2BS5 A;  1HBQ A;  5F58 A;  4CDD A;  2L9C A;  4NNS A;  2IZD B;  1JZU A;  1W6F A;  5HCC C;  1AEL A;  1KZW A;  3AUM O;  1OEJ A;  4YH0 A;  4GDA A;  3D97 A;  2CBS A;  2AL0 X;  4CPH A;  4AZP A;  4ZHF A;  4I95 A;  3MG5 A;  2RTQ B;  4AZQ A;  5L3Y A;  3BX7 A;  1PEE A;  2ACP X;  1I9H A;  5LKE A;  5B5G A;  1EQD A;  5HBS A;  3TGC A;  3VE2 A;  3FIQ A;  1K24 A;  1Y9L A;  2WSJ A;  3ELZ A;  3PED A;  1YUP A;  5HZ5 A;  3ZW1 A;  3FR4 A;  2LKK A;  1SLG B;  4QGX A;  5KIC A;  1SWJ A;  3D95 A;  1PTS A;  3X00 A;  1BJ7 A;  4OMW A;  4GNY A;  3UAQ A;  4GZV A;  5DG4 A;  2RTR B;  1O1U A;  3T1D A;  1QY2 A;  5JD2 A;  4IB8 A;  4CDF A;  2R74 A;  5FQ8 E;  1KL4 A;  1SY1 A;  3ZWE A;  1X8Q A;  3O2Y A;  3EC5 A;  4EDE A;  1OBQ A;  2MO5 A;  1VWH B;  1WBI A;  3WXQ A;  1GT3 A;  3OE3 A;  1CBR A;  3EBW A;  3VG5 A;  1FDQ A;  2P8G A;  4L1N A;  1CRB A;  1JJX A;  3ZZV A;  1N0S A;  1O8V A;  3F9D A;  1KT7 A;  2ANS A;  4U8U O;  4ZCB A;  2AT3 X;  1T68 X;  5JR8 A;  1MUP A;  1T8V A;  3WZO A;  4O4U A;  4Y0P A;  1SWG A;  4YKO A;  2FR2 A;  2A5B A;  4CPH B;  2MJI A;  4AZN A;  3FA9 A;  5HAE A;  4CPF A;  3PQU A;  2FGS A;  1E5P A;  1RXJ A;  3STM X;  3T6F A;  1QG5 A;  5D4A A;  1SXX A;  2I5Z O;  4N7D A;  2RTA A;  4U46 A;  4Z27 A;  1JV4 A;  1ZNE A;  1JYJ A;  2QO6 A;  1SWT A;  3C77 X;  3H3I A;  3T2W A;  4YBU A;  1GGL A;  4GKC A;  4M7M A;  2FS6 A;  2JN3 A;  4U8U N;  3UEX A;  5LJE A;  1G85 A;  1EAL A;  1SWP A;  4I6S A;  4XMG A;  5B29 A;  1KFF A;  2RTC B;  5D45 A;  3CBS A;  4NV7 A;  2KW1 A;  4O49 A;  4KC7 A;  2RTL A;  4C5P A;  4HPC A;  3ZUI A;  4ES7 A;  4QQ1 A;  1DZP A;  1QFT A;  2ALL X; 
#chains in the Genus database with same CATH homology
 3C78 X;  1EUO A;  1H91 A;  3NQ3 A;  4YGH A;  3WJB A;  4TKH A;  1ALB A;  3FEN A;  4FGI B;  4O3W A;  2CBR A;  1MVG A;  3BRN A;  3MBT A;  4A8Z A;  1ZNK A;  1MX8 A;  4O3Y A;  3VU1 A;  5BVQ A;  4LZU A;  2WQ9 A;  3ELX A;  4O3Z A;  4ZHH A;  3PQS A;  3FYF A;  1DV9 A;  1KQX A;  1ERB A;  5D8J A;  1QFV A;  3SAO A;  4OS3 A;  4XME A;  2A3F X;  4ORY A;  2HYS A;  3KFH A;  4IAB A;  2LA7 A;  4YDA A;  3TGA A;  1RLB E;  1KT6 A;  2HZQ A;  5AQ6 A;  3O22 A;  3BSZ E;  2OVE A;  3BU1 A;  1A2D A;  4YGG A;  2GTL M;  2QM9 A;  1B0O A;  1I05 A;  1SY0 A;  1TVQ A;  4TKJ A;  1MDC A;  4D6B A;  4WHI A;  4YMY A;  4YCH A;  1X8N A;  3S60 A;  5AJB A;  4Y0S A;  1B4M A;  5HWZ A;  3STK A;  3WJE A;  4BOE A;  3APV A;  2WQA E;  1IFC A;  4XMD A;  1QY0 A;  3JS1 A;  4I3D A;  5EDC A;  3NR3 A;  1ZND A;  4LZV A;  3KZA A;  1G5W A;  3P02 A;  2JU8 A;  3U9P C;  4TLJ A;  2GTF X;  2GJ5 A;  3E3C A;  2WEX A;  2FR3 A;  3G7X A;  2BT9 A;  3LHN A;  2AT5 X;  3HWG A;  2KTD A;  5FAZ A;  4YCE A;  4N7C A;  4QGW A;  4ARH A;  1OPB A;  1IKE A;  2X8T A;  1KOI A;  3NQ9 A;  1TOW A;  2WR6 A;  4ID2 A;  3PEC A;  2YMS A;  4AZR A;  1HN2 A;  5IO5 A;  4QNI A;  3FA8 A;  4FBO A;  1EI5 A;  4R0B A;  4ZHC A;  1ERX A;  4XMH A;  1LKE A;  5F6Z A;  4I3B A;  2FS7 A;  4IB6 A;  2F09 A;  4TNN A;  1X8P A;  3GE2 A;  3STN A;  4OS0 A;  2BLG A;  3U0D A;  1LIC A;  1FEM A;  3NX2 A;  5LJG A;  4BQU A;  1E06 A;  1GX9 A;  4AYH A;  1YIV A;  3FR5 A;  1UZ2 X;  3CBC A;  1KT3 A;  2OVS A;  2BHV A;  2W2B A;  3U03 A;  3Q6L A;  2G79 A;  4KII A;  5C0N A;  5AJC A;  1TXL A;  3AKM A;  1JBH A;  3FA6 A;  2PY1 A;  4HPA A;  4WBK A;  4TJZ A;  3VG7 A;  3SOT A;  1YWD A;  4AZM A;  1D3S A;  4MVE A;  3VE1 A;  1I4U A;  2E4J A;  5LJK A;  5HZ8 A;  3FA7 A;  3FLL A;  1OBU A;  4ZHG A;  4HPB A;  5HA1 A;  3B2K A;  1CBQ A;  4QZT A;  1KQW A;  2HMB A;  2IFB A;  3DTQ A;  4JGL A;  5HZ9 A;  3P6F A;  4ORX A;  4BVM A;  3IA8 A;  1EW3 A;  4ZR2 A;  5HA0 A;  5IO7 A;  1ZNL A;  3OBL A;  1X71 A;  2JW1 A;  2YG2 A;  3TZS A;  1FEN A;  4O4O A;  4Y0Q A;  5FEN A;  1BBP A;  2POA A;  4KH8 A;  1X89 A;  4DQ4 A;  4ZH9 A;  3APX A;  4U8U M;  1IW2 A;  2X46 A;  1SY2 A;  3EM0 A;  4O4X A;  3L4R A;  1PM1 X;  2WWP A;  4K19 A;  5H9L A;  4KT5 A;  3VG4 A;  3LV4 A;  1DFV A;  1OEK A;  3OD9 A;  2W2F A;  4ODD A;  1BM5 A;  3HOE A;  3B2J A;  4COT A;  3CQN A;  1BSO A;  3KQ0 A;  5H9K A;  4LKT A;  2JU3 A;  4TQ2 A;  3N91 A;  5D47 A;  1DF3 A;  1CJ5 A;  1GT4 A;  2CM4 A;  2RA6 A;  4ON1 A;  4DQ3 A;  2NND A;  1ZRY A;  1D2U A;  2NP1 A;  3C76 X;  1YP6 A;  3GAQ A;  1GT5 A;  2ASN X;  4ALO A;  1ICM A;  2RD7 C;  5HZQ A;  1HMS A;  3P6E A;  4Y0R A;  3K3L A;  1ZNG A;  3F6Z B;  4MVK A;  4HWM A;  2QMI A;  1DC9 A;  3BDR A;  3JSQ A;  1L6M A;  2LBA A;  4QZU A;  1URE A;  4IMN A;  3ZUO A;  2WEW A;  5LJC A;  5EEE A;  1YP7 A;  1BWY A;  1AVG I;  3HTY A;  3D4R A;  3WVM A;  2ACO A;  1BRQ A;  2R56 A;  1S7D A;  2AKQ A;  1B8E A;  3B2H A;  4HPD A;  2KT4 B;  4UU3 A;  2BS6 A;  2OVD A;  2FTB A;  5KHP A;  5AEO A;  1B56 A;  1FTP A;  1ADL A;  2KTS A;  5LJB A;  3P6G A;  3VPJ E;  1GX8 A;  3NQK A;  1QWD A;  4NYR A;  1PBO A;  4HFO A;  4KC8 A;  3WJF A;  1KXO A;  4A1H A;  4EXZ A;  1BRP A;  3CWK A;  4GU8 A;  4L3R A;  4QAE A;  2MHD A;  1IKJ A;  1HQP A;  1ML7 A;  2L5P A;  1BLR A;  4WFU A;  5HCE C;  4ORW A;  4QGV A;  2AT0 X;  1E00 A;  1TOU A;  4M6S A;  2FRS A;  3NBX X;  3NPO A;  1EPA A;  5CYB A;  2RCQ A;  2X45 A;  3S5V A;  1U18 A;  3P6C A;  3ZW0 A;  5KID A;  4I9S A;  1P6P A;  4QYN A;  1JYD A;  2L67 A;  5H9A A;  3RSW A;  2X8F A;  1OPA A;  1YWA A;  4IAW A;  1AQB A;  3AKN A;  3FW5 A;  5DPQ A;  2OZQ A;  1GKA A;  1GT1 A;  2ZAG A;  3D96 A;  3RZY A;  3WBG A;  3FEL A;  3HOL A;  3HWE A;  2OFR X;  4EFG A;  3TGB A;  3F8A A;  3OJY C;  4YKM A;  1KT5 A;  1DZM A;  2O62 A;  1HMR A;  4QGX A;  3EMM A;  1CBS A;  1NGL A;  1AB0 A;  2A13 A;  1U17 A;  2GC9 A;  4XMC A;  2LBV A;  3HK1 A;  5LKF A;  3VG6 A;  3P6D A;  3CR6 A;  3WJG A;  2K62 A;  1EPB A;  3FEK A;  4NP1 A;  3UEU A;  4YGZ A;  2W2A A;  2A2G A;  2RCT A;  1OEE A;  4IB7 A;  1LFO A;  3EYC A;  4MVI A;  4FBV A;  3MX7 A;  5F6B A;  3HWF A;  1FE3 A;  4TKB A;  5IO6 A;  2RN4 A;  1QQS A;  4ZFX A;  3ZW0 B;  5HTD A;  4QRL A;  2AMM X;  1DZK A;  4YFR A;  1EII A;  3EBK A;  5L8N A;  3BU9 A;  1A3Y A;  3ZI8 A;  1LIF A;  4NLJ A;  3PPT A;  2HNX A;  1EXS A;  1IFB A;  3ZQ3 A;  2A0A A;  1G7N A;  3P24 A;  1FEL A;  2FWV A;  1X8U A;  2ZAI A;  4U9C A;  5BYP A;  1GKA B;  3ZW2 A;  1O1V A;  3JQO A;  4UU2 A;  3VG3 A;  4EQA C;  2Q9S A;  3APW A;  2OFM X;  1HMT A;  3KFI A;  5D48 A;  1RBP A;  1LF7 A;  3KFF A;  2R73 A;  4FBR A;  1E02 A;  3PH6 A;  3RWX A;  2Q4N A;  2QO4 A;  1U0X A;  3BS2 A;  5EZ2 A;  3WOV A;  1KT4 A;  1Z24 A;  1ACD A;  1BSY A;  2CZT A;  2X8S A;  3WJD A;  1SMP I;  1JJJ A;  3S5X A;  3B2I A;  4CSB A;  2JOZ A;  4KCA A;  2M4L A;  2Q39 A;  4INN A;  1Y9T A;  1CBI A;  4NYQ A;  3FR2 A;  5F7G A;  1QAB E;  4PSQ A;  3V8U A;  1NP4 A;  4ZJ0 A;  4NNT A;  1OBP A;  3MVF A;  4I9R A;  5K06 A;  3UEV A;  3BY0 A;  4GH7 A;  2AT8 X;  2CZU A;  2K23 A;  3S26 A;  1LIE A;  4GDZ A;  2LFO A;  4O9S A;  4OS8 A;  4ORU A;  4IBA A;  2JMB A;  3IFB A;  1KZW A;  1ZNH A;  2XST A;  4GNW A;  2A2U A;  3I0A A;  4MVL A;  3NX1 A;  3CQR A;  1NP1 A;  1T0V A;  2KD2 A;  4AW8 A;  4GET A;  3FMZ A;  2G7B A;  4RUU A;  2MM3 A;  5EPQ A;  2HZR A;  1YWB A;  1HBP A;  2EU7 X;  5BVS A;  4CK4 A;  2DM5 A;  4CV7 A;  4QYP A;  1XCA A;  5FQ6 E;  4RUN A;  4O3X B;  5L8I A;  2Q2M A;  4LQZ A;  3BX8 A;  1QY1 A;  2L68 A;  3NP1 A;  3P6H A;  3TF6 A;  4ALB A;  5F1E A;  3RBY A;  4ZGF A;  4FQB B;  5HTE A;  2MWH A;  3APU A;  1S44 A;  5EDB A;  3DSZ A;  2HLV A;  4GE1 A;  4I3C A;  3VG2 A;  1MX7 A;  2XKL A;  1BSQ A;  5FQ7 E;  4ORS A;  1LIB A;  4O4S A;  1DZJ A;  3I17 A;  2AH7 X;  4EEJ A;  5HZ6 A;  3QKG A;  1I06 A;  4MIS A;  2FT9 A;  2GTL O;  4IAX A;  3UEW A;  2WUT A;  1G74 A;  4YBP A;  1BEB A;  2Z4I A;  1VYG A;  2FLJ A;  1VYF A;  2N93 A;  5CE4 A;  4MIR A;  2F73 A;  4GK9 A;  4IB9 A;  1PMP A;  4WFV A;  3FW4 A;  4ML7 B;  1LNM A;  1SXW A;  4YDB A;  5LJD A;  5L8O A;  1A57 A;  2LB6 A;  4IMO A;  3KFG A;  4NW4 A;  3PH5 A;  4U3Q A;  1GXA A;  3O19 A;  1SA8 A;  2GTL N;  2G78 A;  5H9N A;  1LID A;  1A18 A;  4OMX A;  1I04 A;  5FFH A;  4A1Y A;  4NLI A;  1JIW I;  1X8O A;  1S2P A;  2Z4H A;  2RQ0 A;  1GM6 A;  2OVA A;  1ICN A;  1SXY A;  3B2L A;  1R0U A;  2CM9 A;  4ORR A;  5H8T A;  1IIU A;  2QOS C;  4PJ2 A;  1KGL A;  4A60 A;  5LJH A;  4ZHD A;  1SY3 A;  1LPJ A;  4YFP A;  4ZH6 A;  3NAD A;  1VPR A;  2AT6 X;  4ZGU A;  4XMF A;  5EED A;  1SXU A;  4AZO A;  2NNE A;  1XKI A;  3WJC A;  1YWC A;  2JU7 A;  1KZX A;  3BLG A;  3HWD A;  5BVT A;  3RKG A;  1TW4 A;  2Q2P A;  4GRJ A;  5HCD C;  3CMP A;  4LKP A;  1EIO A;  3PP6 A;  5B27 A;  4D6A A;  2NNQ A;  4YFQ A;  2QO5 A;  3FEP A;  2BS5 A;  5F58 A;  1HBQ A;  2L9C A;  4NNS A;  1JZU A;  5HCC C;  1AEL A;  4YH0 A;  1OEJ A;  3D97 A;  2CBS A;  2AL0 X;  4ZHF A;  4AZP A;  4I95 A;  4AZQ A;  3BX7 A;  1PEE A;  2ACP X;  5LKE A;  3TGC A;  1EQD A;  5HBS A;  3VE2 A;  3FIQ A;  1Y9L A;  2WSJ A;  3ELZ A;  3PED A;  1YUP A;  5HZ5 A;  3ZW1 A;  3FR4 A;  2LKK A;  5KIC A;  3D95 A;  1BJ7 A;  4OMW A;  4GNY A;  3UAQ A;  4GZV A;  5DG4 A;  1O1U A;  3T1D A;  1QY2 A;  4IB8 A;  2R74 A;  5FQ8 E;  1SY1 A;  3ZWE A;  1X8Q A;  3O2Y A;  4EDE A;  1OBQ A;  2MO5 A;  3WXQ A;  1GT3 A;  3OE3 A;  1CBR A;  3EBW A;  3VG5 A;  1FDQ A;  2P8G A;  4L1N A;  1CRB A;  1JJX A;  3ZZV A;  1N0S A;  1O8V A;  3F9D A;  1KT7 A;  2ANS A;  4U8U O;  4ZCB A;  2AT3 X;  1T68 X;  5JR8 A;  1MUP A;  1T8V A;  4O4U A;  4Y0P A;  4YKO A;  2FR2 A;  2MJI A;  4AZN A;  3FA9 A;  5HAE A;  3PQU A;  1E5P A;  3STM X;  1QG5 A;  5D4A A;  1SXX A;  4N7D A;  1JV4 A;  1ZNE A;  1JYJ A;  2QO6 A;  3C77 X;  3ZW1 B;  3H3I A;  5LJE A;  4YBU A;  1GGL A;  4GKC A;  4M7M A;  2FS6 A;  2JN3 A;  4U8U N;  3UEX A;  1G85 A;  1EAL A;  4I6S A;  4XMG A;  5B29 A;  5D45 A;  3CBS A;  4ES7 A;  2KW1 A;  4O49 A;  4KC7 A;  4HPC A;  3ZUI A;  4QQ1 A;  1DZP A;  1QFT A;  2ALL X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...