2POJA

Nmr solution structure of the inhibitor-free state of macrophage metalloelastase (mmp-12)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
164
structure length
164
Chain Sequence
FREMPGGPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDFHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHAIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage metalloelastase
publication title Solution Structure of Inhibitor-Free Human Metalloelastase (MMP-12) Indicates an Internal Conformational Adjustment.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 28
structure length 164
sequence length 164
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2007-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2pojA00
4AIGA 1GKCA 1OS2A 830CA 2DW2A 1JJ9A 1MMPA 3LQBA 2X7MA 1G4KA 2FV9A 4PKUA 2O36A 1IAGA 2OW2A 2CKIA 2A8HA 3AYKA 1GKDA 3LIRA 1BUVM 2AIGP 3LMCA 2MLSA 3L0VA 3U1RA 4FXYP 4XM6A 2JT5A 1FBLA 1R54A 1BKCE 4WKIA 3DSLA 3F15A 1SU3A 2D1NA 3OHOA 3RTSA 4DF9A 3Q2HA 3AIGA 3LE9A 4CTHA 2E2DA 1KUIA 3KHIA 3B92A 1XUCA 3Q2GA 5I0LA 2DDYA 1Q3AA 3LJTA 1UEAA 3ZUKA 2L0RA 1Y8JA 1BKCA 1OMJA 1UMTA 3CKIA 2W14A 1EAKA 1KAPP 1PWQA 1BIWA 2OI0A 1BKCI 2OVXA 1ROSA 1XFZA 4JPAA 1KUHA 2O3EA 1BM6A 4GR0A 1G49A 2D1OA 1AYKA 1SRPA 3DPEA 2FV5A 3LEAA 1KBCA 3EDHA 2JNPA 5CZMA 5H8XA 2OXWA 1FM1A 3ZXHA 3WV3A 4H84A 4JQGA 1GO7P 4J4MA 3LUMA 3TSKA 1OM8A 4WF6A 1Z3JA 1HOVA 3LJZA 3ZVSA 4L19A 2V4BA 1DTHA 1OS9A 3I7IA 2JSDA 5I2ZA 2PJTA 3BA0A 2KRJA 3K7LA 1OM7A 1QJJA 1BUDA 456CA 4AYKA 3F1AA 4GUYA 2X3AA 3EHYA 1CGEA 4XM8A 1D5JA 1JIZA 1L6JA 1IABA 1UTZA 1PWUA 3KEKA 1R1JA 2DW1A 1C7KA 1IAEA 5I4OA 4JA1A 4FVLA 5CUHA 2OVZA 4IJOA 1HTDA 4PKWA 1D8MA 3K7NA 4DV8A 3E8RA 3TS4A 2MZIA 2DDFA 1JAPA 1BQQM 1XURA 1IAAA 1K7QA 3VTGA 2J83A 4A7BA 1YQYA 1QIAA 1XFWA 3I7GA 5D2BA 3HYGA 4H30A 3KMEA 1PWWA 4IN9A 4PKTA 2JIHA 4H49A 5BOTA 3F19A 1CAQA 4GR3A 3N2VA 1EB6A 1HFSA 1H71P 2EROA 1O0TA 5I12A 2YIGA 1ASTA 4Q1LA 1I1IP 1ZVXA 4PKQA 3G42A 2X3BA 5D1TA 3N2UA 3HB2P 4WK7A 1ATLA 1JKYA 1USNA 4DPEA 3HY9A 2YB9A 1ZTQA 3LGPA 3ELMA 1K7GA 1Y0VA 1CQRA 5JMYA 2W0DA 2E3XA 4H1QA 2OY4A 1KUKA 1I73A 4H3XA 1B3DA 2OW0A 3KRYA 3KWVC 4ZR5A 1MNCA 2WOAA 3B2ZA 3LKAA 4WZVA 1G9KA 1UMSA 4I03A 1R1HA 2W15A 2ERPA 2W13A 3O2XA 4R3VA 5L79A 5B5PA 1UTTA 1FLSA 1QICA 2RJQA 1CIZA 1JIWP 3F16A 3LJGA 1RM8A 5B5OA 3KMCA 3HBVP 1JK3A 4FU4A 1GE6A 4PKSA 4IUWA 4L6TA 1YCMA 2OY2A 4JP4A 1HFCA 1YP1A 1ZP5A 3LQ0A 5I3MA 4A3WA 2JT6A 1WNIA 4WKEA 2CLTA 1I76A 1MMBA 1HV5A 1PWVA 1D8FA 1OO9A 2OW9A 3V96B 1K7IA 3MA2A 2HU6A 3TT4A 4JIJA 3B8ZA 2K9CA 1YOUA 5BOYA 3DPFA 1CK7A 4XM7A 4GQLA 4ON1A 3F17A 4DD8A 1XFYA 1JH1A 1D7XA 2W12A 2POJA 4GWMA 4L63A 3EDIA 1ZS0A 3UVCA 1AKLA 3O64A 4HX3A 1C8TA 1MMRA 2Y6CA 3LIKA 4EFSA 4H82A 5CXAA 1CXVA 2MLRA 4I35A 1BSWA 1Y93A 3GBOA 2X3CA 3HDBA 1GXDA 2MZHA 3DL1A 1GO8P 2ERQA 1OM6A 3DNGA 3RTTA 3F18A 4XBHA 4H76A 1SLMA 2I47A 3EHXA 1XFXA 1ZXCA 2OXUA 1GE5A 1R1IA 1R55A 4FXQA 1PWPA 2SRTA 1B8YA 1IACA 1A86A 1JANA 1G05A 5D7WA 5D3CA 2OXZA 1IADA 1SMPA 4PKVA 3P1VA 1KUGA 4PKRA 3OHLA 2J0TA 1GE7A 5D1UA 1BZSA 1CGLA 2XS4A 4QKZA 3P24A 3TVCA 1BQOA 1KUFA 1QUAA 1JAQA 1EUBA 3VI1A 3G5CA 3LUNA 1ND1A 4GWNA 1SATA 2OW1A 1SLNA 1XUDA 3HY7A 4HMAA 1CGFA 5I43A 2AYKA 1O0QA 3DWBA 3HBUP 4GR8A 5LABA 1MMQA 1HY7A 966CA 1JAOA 3LILA 1QJIA 2DW0A 5D1SA 4G0DA 1XFVA 3L0TA 1A85A 3KEJA 3WV2A 3EDGA 1ZXVA 2Y6DA 3KECA 1S4BP 2XS3A 3HDAP 2WO9A 1DMTA 4AXQA 1G12A 4AUOA 1C3IA 2USNA 2TCLA 3AYUA 2MZEA 3LK8A 2OZRA 3USNA 5L7FA 3NX7A 2RJPA 4H2EA 2K2GA 1J7NA 4XCTA 1RMZA 3WV1A 2WO8A 1QIBA 3EDZA 4G9LA 3EWJA 4GF1A 2N8RA 2QPJA 3SHIA 1XFUA 4ILWD 1AF0A 2Z2DA 5BPAA
chains in the Genus database with same CATH superfamily
4AIGA 1GKCA 1OS2A 830CA 2DW2A 1JJ9A 1MMPA 3LQBA 2X7MA 1G4KA 2FV9A 4PKUA 2O36A 1IAGA 2OW2A 2CKIA 2A8HA 3AYKA 1GKDA 3LIRA 1BUVM 2AIGP 3LMCA 2MLSA 3L0VA 3U1RA 4FXYP 4XM6A 2JT5A 1FBLA 1R54A 1BKCE 4WKIA 3DSLA 3F15A 1SU3A 2D1NA 3OHOA 3RTSA 4DF9A 3Q2HA 3AIGA 3LE9A 4CTHA 2E2DA 1KUIA 3KHIA 3B92A 1XUCA 3Q2GA 5I0LA 2DDYA 1Q3AA 3LJTA 1UEAA 3ZUKA 2L0RA 1Y8JA 1BKCA 1XM5A 1OMJA 1UMTA 3CKIA 2W14A 1EAKA 1KAPP 1PWQA 1BIWA 2OI0A 1BKCI 2OVXA 1ROSA 1XFZA 4JPAA 1KUHA 2O3EA 1BM6A 4GR0A 1G49A 2D1OA 1AYKA 1SRPA 3DPEA 2FV5A 3LEAA 1KBCA 3EDHA 2JNPA 5CZMA 5H8XA 2OXWA 1FM1A 3ZXHA 3WV3A 4H84A 4JQGA 1GO7P 4J4MA 3LUMA 3TSKA 1OM8A 4WF6A 1Z3JA 1HOVA 3LJZA 3ZVSA 4L19A 2V4BA 1DTHA 1OS9A 3I7IA 2JSDA 5I2ZA 2PJTA 3BA0A 2KRJA 3K7LA 1OM7A 1QJJA 1BUDA 456CA 4AYKA 3F1AA 4GUYA 2X3AA 3EHYA 1CGEA 4XM8A 1D5JA 1JIZA 1L6JA 1IABA 1UTZA 1PWUA 3KEKA 1R1JA 2DW1A 1C7KA 1IAEA 5I4OA 4JA1A 4FVLA 5CUHA 2OVZA 4IJOA 1HTDA 4PKWA 1D8MA 3K7NA 4DV8A 3E8RA 3TS4A 2MZIA 2DDFA 1JAPA 1BQQM 1XURA 1IAAA 1K7QA 3VTGA 2J83A 4A7BA 1YQYA 1QIAA 1XFWA 3I7GA 5D2BA 3HYGA 4H30A 3KMEA 1PWWA 4IN9A 4PKTA 2JIHA 4H49A 5BOTA 3F19A 1CAQA 4GR3A 3N2VA 1EB6A 1HFSA 1H71P 2EROA 1O0TA 5I12A 2YIGA 1ASTA 4Q1LA 1I1IP 1ZVXA 4PKQA 3G42A 2X3BA 5D1TA 3N2UA 3HB2P 4WK7A 1ATLA 1JKYA 1USNA 4DPEA 3HY9A 2YB9A 1ZTQA 3LGPA 3ELMA 1K7GA 1Y0VA 1CQRA 5JMYA 2W0DA 2E3XA 4H1QA 2OY4A 1KUKA 1I73A 4H3XA 1B3DA 2OW0A 3KRYA 3KWVC 4ZR5A 1MNCA 2WOAA 3B2ZA 3LKAA 4WZVA 1G9KA 1UMSA 4I03A 1R1HA 2W15A 2ERPA 2W13A 3O2XA 4R3VA 5L79A 5B5PA 1TVIA 1UTTA 1FLSA 1QICA 2RJQA 1CIZA 1JIWP 3F16A 3LJGA 1RM8A 5B5OA 3KMCA 3HBVP 1JK3A 4FU4A 1GE6A 4PKSA 4IUWA 4L6TA 1YCMA 2OY2A 4JP4A 1HFCA 1YP1A 1ZP5A 3LQ0A 5I3MA 4A3WA 2JT6A 1WNIA 4WKEA 2CLTA 1I76A 1MMBA 3DTIA 1HV5A 1PWVA 1D8FA 1OO9A 2OW9A 3V96B 1K7IA 3MA2A 2HU6A 3TT4A 4JIJA 3B8ZA 2K9CA 1YOUA 5BOYA 3DPFA 1CK7A 4XM7A 4GQLA 4ON1A 3F17A 4DD8A 1XFYA 1JH1A 1D7XA 2W12A 2POJA 4GWMA 4L63A 3EDIA 1ZS0A 3UVCA 1AKLA 3O64A 4HX3A 1C8TA 1MMRA 2Y6CA 3LIKA 4EFSA 4H82A 5CXAA 1CXVA 2MLRA 4I35A 1BSWA 1Y93A 3GBOA 2X3CA 3HDBA 1GXDA 2MZHA 3DL1A 1GO8P 3DTEA 2ERQA 1OM6A 3DNGA 3RTTA 3F18A 4XBHA 4H76A 1SLMA 2I47A 3EHXA 1XFXA 4L7AA 1ZXCA 2OXUA 1GE5A 1R1IA 1R55A 4FXQA 1PWPA 2SRTA 1B8YA 1IACA 1A86A 1JANA 1G05A 5D7WA 5D3CA 2OXZA 1IADA 1SMPA 4PKVA 3P1VA 1KUGA 4PKRA 3OHLA 2J0TA 1GE7A 5D1UA 1BZSA 1CGLA 2XS4A 4QKZA 3P24A 1OZ9A 3TVCA 1BQOA 1KUFA 1QUAA 1JAQA 1EUBA 3VI1A 3G5CA 3LUNA 1ND1A 4GWNA 1SATA 2OW1A 1SLNA 1XUDA 3HY7A 4HMAA 1CGFA 5I43A 2AYKA 1O0QA 3DWBA 3HBUP 4GR8A 5LABA 1MMQA 1HY7A 966CA 1JAOA 3LILA 3DTKA 1QJIA 2DW0A 5D1SA 4G0DA 1XFVA 3L0TA 1A85A 3KEJA 2YUFA 3WV2A 3EDGA 1ZXVA 2Y6DA 3KECA 1S4BP 2XS3A 3HDAP 2WO9A 1DMTA 4AXQA 1G12A 4AUOA 1C3IA 2USNA 2TCLA 3AYUA 2MZEA 3LK8A 2OZRA 3USNA 5L7FA 3NX7A 2RJPA 4H2EA 2K2GA 1J7NA 4XCTA 1RMZA 3WV1A 2WO8A 1QIBA 1XAXA 3EDZA 4G9LA 3EWJA 4GF1A 2N8RA 2QPJA 3SHIA 1XFUA 4ILWD 1AF0A 2Z2DA 5BPAA
chains in the Genus database with same CATH topology
4AIGA 1GKCA 1OS2A 830CA 2DW2A 1JJ9A 1MMPA 3LQBA 2X7MA 1G4KA 2FV9A 4PKUA 2O36A 1IAGA 2OW2A 2CKIA 2A8HA 3AYKA 1GKDA 3LIRA 1BUVM 2AIGP 3LMCA 2MLSA 3L0VA 3U1RA 4FXYP 4XM6A 2JT5A 1FBLA 1R54A 1BKCE 4WKIA 3DSLA 3F15A 1SU3A 2D1NA 3OHOA 3RTSA 4DF9A 3Q2HA 3AIGA 3LE9A 4CTHA 2E2DA 1KUIA 3KHIA 3B92A 1XUCA 3Q2GA 5I0LA 2DDYA 1Q3AA 3LJTA 1UEAA 3ZUKA 2L0RA 1Y8JA 1BKCA 1OMJA 1UMTA 3CKIA 2W14A 1EAKA 1KAPP 1PWQA 1BIWA 2OI0A 1BKCI 2OVXA 1ROSA 1XFZA 4JPAA 1KUHA 2O3EA 1BM6A 4GR0A 1G49A 2D1OA 1AYKA 1SRPA 3DPEA 2FV5A 3LEAA 1KBCA 3EDHA 2JNPA 5CZMA 5H8XA 2OXWA 1FM1A 3ZXHA 3WV3A 4H84A 4JQGA 1GO7P 4J4MA 3LUMA 3TSKA 1OM8A 4WF6A 1Z3JA 1HOVA 3LJZA 3ZVSA 4L19A 2V4BA 1DTHA 1OS9A 3I7IA 2JSDA 5I2ZA 2PJTA 3BA0A 2KRJA 3K7LA 1OM7A 1QJJA 1BUDA 456CA 4AYKA 3F1AA 4GUYA 2X3AA 3EHYA 1CGEA 4XM8A 1D5JA 1JIZA 1L6JA 1IABA 1UTZA 1PWUA 3KEKA 1R1JA 2DW1A 1C7KA 1IAEA 5I4OA 4JA1A 4FVLA 5CUHA 2OVZA 4IJOA 1HTDA 4PKWA 1D8MA 3K7NA 4DV8A 3E8RA 3TS4A 2MZIA 2DDFA 1JAPA 1BQQM 1XURA 1IAAA 1K7QA 3VTGA 2J83A 4A7BA 1YQYA 1QIAA 1XFWA 3I7GA 5D2BA 3HYGA 4H30A 3KMEA 1PWWA 4IN9A 4PKTA 2JIHA 4H49A 5BOTA 3F19A 1CAQA 4GR3A 3N2VA 1EB6A 1HFSA 1H71P 2EROA 1O0TA 5I12A 2YIGA 1ASTA 4Q1LA 1I1IP 1ZVXA 4PKQA 3G42A 2X3BA 5D1TA 3N2UA 3HB2P 4WK7A 1ATLA 1JKYA 1USNA 4DPEA 3HY9A 2YB9A 1ZTQA 3LGPA 3ELMA 1K7GA 1Y0VA 1CQRA 5JMYA 2W0DA 2E3XA 4H1QA 2OY4A 1KUKA 1I73A 4H3XA 1B3DA 2OW0A 3KRYA 3KWVC 4ZR5A 1MNCA 2WOAA 3B2ZA 3LKAA 4WZVA 1G9KA 1UMSA 4I03A 1R1HA 2W15A 2ERPA 2W13A 3O2XA 4R3VA 5L79A 5B5PA 1UTTA 1FLSA 1QICA 2RJQA 1CIZA 1JIWP 3F16A 3LJGA 1RM8A 5B5OA 3KMCA 3HBVP 1JK3A 4FU4A 1GE6A 4PKSA 4IUWA 4L6TA 1YCMA 2OY2A 4JP4A 1HFCA 1YP1A 1ZP5A 3LQ0A 5I3MA 4A3WA 2JT6A 1WNIA 4WKEA 2CLTA 1I76A 1MMBA 3DTIA 1HV5A 1PWVA 1D8FA 1OO9A 2OW9A 3V96B 1K7IA 3MA2A 2HU6A 3TT4A 4JIJA 3B8ZA 2K9CA 1YOUA 5BOYA 3DPFA 1CK7A 4XM7A 4GQLA 4ON1A 3F17A 4DD8A 1XFYA 1JH1A 1D7XA 2W12A 2POJA 4GWMA 4L63A 3EDIA 1ZS0A 3UVCA 1AKLA 3O64A 4HX3A 1C8TA 1MMRA 2Y6CA 3LIKA 4EFSA 4H82A 5CXAA 1CXVA 2MLRA 4I35A 1BSWA 1Y93A 3GBOA 2X3CA 3HDBA 1GXDA 2MZHA 3DL1A 1GO8P 3DTEA 2ERQA 1OM6A 3DNGA 3RTTA 3F18A 4XBHA 4H76A 1SLMA 2I47A 3EHXA 1XFXA 4L7AA 1ZXCA 2OXUA 1GE5A 1R1IA 1R55A 4FXQA 1PWPA 2SRTA 1B8YA 1IACA 1A86A 1JANA 1G05A 5D7WA 5D3CA 2OXZA 1IADA 1SMPA 4PKVA 3P1VA 1KUGA 4PKRA 3OHLA 2J0TA 1GE7A 5D1UA 1BZSA 1CGLA 2XS4A 4QKZA 3P24A 3TVCA 1BQOA 1KUFA 1QUAA 1JAQA 1EUBA 3VI1A 3G5CA 3LUNA 1ND1A 4GWNA 1SATA 2OW1A 1SLNA 1XUDA 3HY7A 4HMAA 1CGFA 5I43A 2AYKA 1O0QA 3DWBA 3HBUP 4GR8A 5LABA 1MMQA 1HY7A 966CA 1JAOA 3LILA 3DTKA 1QJIA 2DW0A 5D1SA 4G0DA 1XFVA 3L0TA 1A85A 3KEJA 2YUFA 3WV2A 3EDGA 1ZXVA 2Y6DA 3KECA 1S4BP 2XS3A 3HDAP 2WO9A 1DMTA 4AXQA 1G12A 4AUOA 1C3IA 2USNA 2TCLA 3AYUA 2MZEA 3LK8A 2OZRA 3USNA 5L7FA 3NX7A 2RJPA 4H2EA 2K2GA 1J7NA 4XCTA 1RMZA 3WV1A 2WO8A 1QIBA 3EDZA 4G9LA 3EWJA 4GF1A 2N8RA 2QPJA 3SHIA 1XFUA 4ILWD 1AF0A 2Z2DA 5BPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AIG A;  1GKC A;  1OS2 A;  830C A;  2DW2 A;  1JJ9 A;  1MMP A;  3LQB A;  2X7M A;  1G4K A;  2FV9 A;  4PKU A;  2O36 A;  1IAG A;  2OW2 A;  2CKI A;  2A8H A;  3AYK A;  1GKD A;  3LIR A;  1BUV M;  2AIG P;  3LMC A;  2MLS A;  3L0V A;  3U1R A;  4FXY P;  4XM6 A;  2JT5 A;  1FBL A;  1R54 A;  1BKC E;  4WKI A;  3DSL A;  3F15 A;  1SU3 A;  2D1N A;  3OHO A;  3RTS A;  4DF9 A;  3Q2H A;  3AIG A;  3LE9 A;  4CTH A;  2E2D A;  1KUI A;  3KHI A;  3B92 A;  1XUC A;  3Q2G A;  5I0L A;  2DDY A;  1Q3A A;  3LJT A;  1UEA A;  3ZUK A;  2L0R A;  1Y8J A;  1BKC A;  1OMJ A;  1UMT A;  3CKI A;  2W14 A;  1EAK A;  1KAP P;  1PWQ A;  1BIW A;  2OI0 A;  1BKC I;  2OVX A;  1ROS A;  1XFZ A;  4JPA A;  1KUH A;  2O3E A;  1BM6 A;  4GR0 A;  1G49 A;  2D1O A;  1AYK A;  1SRP A;  3DPE A;  2FV5 A;  3LEA A;  1KBC A;  3EDH A;  2JNP A;  5CZM A;  5H8X A;  2OXW A;  1FM1 A;  3ZXH A;  3WV3 A;  4H84 A;  4JQG A;  1GO7 P;  4J4M A;  3LUM A;  3TSK A;  1OM8 A;  4WF6 A;  1Z3J A;  1HOV A;  3LJZ A;  3ZVS A;  4L19 A;  2V4B A;  1DTH A;  1OS9 A;  3I7I A;  2JSD A;  5I2Z A;  2PJT A;  3BA0 A;  2KRJ A;  3K7L A;  1OM7 A;  1QJJ A;  1BUD A;  456C A;  4AYK A;  3F1A A;  4GUY A;  2X3A A;  3EHY A;  1CGE A;  4XM8 A;  1D5J A;  1JIZ A;  1L6J A;  1IAB A;  1UTZ A;  1PWU A;  3KEK A;  1R1J A;  2DW1 A;  1C7K A;  1IAE A;  5I4O A;  4JA1 A;  4FVL A;  5CUH A;  2OVZ A;  4IJO A;  1HTD A;  4PKW A;  1D8M A;  3K7N A;  4DV8 A;  3E8R A;  3TS4 A;  2MZI A;  2DDF A;  1JAP A;  1BQQ M;  1XUR A;  1IAA A;  1K7Q A;  3VTG A;  2J83 A;  4A7B A;  1YQY A;  1QIA A;  1XFW A;  3I7G A;  5D2B A;  3HYG A;  4H30 A;  3KME A;  1PWW A;  4IN9 A;  4PKT A;  2JIH A;  4H49 A;  5BOT A;  3F19 A;  1CAQ A;  4GR3 A;  3N2V A;  1EB6 A;  1HFS A;  1H71 P;  2ERO A;  1O0T A;  5I12 A;  2YIG A;  1AST A;  4Q1L A;  1I1I P;  1ZVX A;  4PKQ A;  3G42 A;  2X3B A;  5D1T A;  3N2U A;  3HB2 P;  4WK7 A;  1ATL A;  1JKY A;  1USN A;  4DPE A;  3HY9 A;  2YB9 A;  1ZTQ A;  3LGP A;  3ELM A;  1K7G A;  1Y0V A;  1CQR A;  5JMY A;  2W0D A;  2E3X A;  4H1Q A;  2OY4 A;  1KUK A;  1I73 A;  4H3X A;  1B3D A;  2OW0 A;  3KRY A;  3KWV C;  4ZR5 A;  1MNC A;  2WOA A;  3B2Z A;  3LKA A;  4WZV A;  1G9K A;  1UMS A;  4I03 A;  1R1H A;  2W15 A;  2ERP A;  2W13 A;  3O2X A;  4R3V A;  5L79 A;  5B5P A;  1UTT A;  1FLS A;  1QIC A;  2RJQ A;  1CIZ A;  1JIW P;  3F16 A;  3LJG A;  1RM8 A;  5B5O A;  3KMC A;  3HBV P;  1JK3 A;  4FU4 A;  1GE6 A;  4PKS A;  4IUW A;  4L6T A;  1YCM A;  2OY2 A;  4JP4 A;  1HFC A;  1YP1 A;  1ZP5 A;  3LQ0 A;  5I3M A;  4A3W A;  2JT6 A;  1WNI A;  4WKE A;  2CLT A;  1I76 A;  1MMB A;  1HV5 A;  1PWV A;  1D8F A;  1OO9 A;  2OW9 A;  3V96 B;  1K7I A;  3MA2 A;  2HU6 A;  3TT4 A;  4JIJ A;  3B8Z A;  2K9C A;  1YOU A;  5BOY A;  3DPF A;  1CK7 A;  4XM7 A;  4GQL A;  4ON1 A;  3F17 A;  4DD8 A;  1XFY A;  1JH1 A;  1D7X A;  2W12 A;  2POJ A;  4GWM A;  4L63 A;  3EDI A;  1ZS0 A;  3UVC A;  1AKL A;  3O64 A;  4HX3 A;  1C8T A;  1MMR A;  2Y6C A;  3LIK A;  4EFS A;  4H82 A;  5CXA A;  1CXV A;  2MLR A;  4I35 A;  1BSW A;  1Y93 A;  3GBO A;  2X3C A;  3HDB A;  1GXD A;  2MZH A;  3DL1 A;  1GO8 P;  2ERQ A;  1OM6 A;  3DNG A;  3RTT A;  3F18 A;  4XBH A;  4H76 A;  1SLM A;  2I47 A;  3EHX A;  1XFX A;  1ZXC A;  2OXU A;  1GE5 A;  1R1I A;  1R55 A;  4FXQ A;  1PWP A;  2SRT A;  1B8Y A;  1IAC A;  1A86 A;  1JAN A;  1G05 A;  5D7W A;  5D3C A;  2OXZ A;  1IAD A;  1SMP A;  4PKV A;  3P1V A;  1KUG A;  4PKR A;  3OHL A;  2J0T A;  1GE7 A;  5D1U A;  1BZS A;  1CGL A;  2XS4 A;  4QKZ A;  3P24 A;  3TVC A;  1BQO A;  1KUF A;  1QUA A;  1JAQ A;  1EUB A;  3VI1 A;  3G5C A;  3LUN A;  1ND1 A;  4GWN A;  1SAT A;  2OW1 A;  1SLN A;  1XUD A;  3HY7 A;  4HMA A;  1CGF A;  5I43 A;  2AYK A;  1O0Q A;  3DWB A;  3HBU P;  4GR8 A;  5LAB A;  1MMQ A;  1HY7 A;  966C A;  1JAO A;  3LIL A;  1QJI A;  2DW0 A;  5D1S A;  4G0D A;  1XFV A;  3L0T A;  1A85 A;  3KEJ A;  3WV2 A;  3EDG A;  1ZXV A;  2Y6D A;  3KEC A;  1S4B P;  2XS3 A;  3HDA P;  2WO9 A;  1DMT A;  4AXQ A;  1G12 A;  4AUO A;  1C3I A;  2USN A;  2TCL A;  3AYU A;  2MZE A;  3LK8 A;  2OZR A;  3USN A;  5L7F A;  3NX7 A;  2RJP A;  4H2E A;  2K2G A;  1J7N A;  4XCT A;  1RMZ A;  3WV1 A;  2WO8 A;  1QIB A;  3EDZ A;  4G9L A;  3EWJ A;  4GF1 A;  2N8R A;  2QPJ A;  3SHI A;  1XFU A;  4ILW D;  1AF0 A;  2Z2D A;  5BPA A; 
#chains in the Genus database with same CATH topology
 4AIG A;  1GKC A;  1OS2 A;  830C A;  2DW2 A;  1JJ9 A;  1MMP A;  3LQB A;  2X7M A;  1G4K A;  2FV9 A;  4PKU A;  2O36 A;  1IAG A;  2OW2 A;  2CKI A;  2A8H A;  3AYK A;  1GKD A;  3LIR A;  1BUV M;  2AIG P;  3LMC A;  2MLS A;  3L0V A;  3U1R A;  4FXY P;  4XM6 A;  2JT5 A;  1FBL A;  1R54 A;  1BKC E;  4WKI A;  3DSL A;  3F15 A;  1SU3 A;  2D1N A;  3OHO A;  3RTS A;  4DF9 A;  3Q2H A;  3AIG A;  3LE9 A;  4CTH A;  2E2D A;  1KUI A;  3KHI A;  3B92 A;  1XUC A;  3Q2G A;  5I0L A;  2DDY A;  1Q3A A;  3LJT A;  1UEA A;  3ZUK A;  2L0R A;  1Y8J A;  1BKC A;  1XM5 A;  1OMJ A;  1UMT A;  3CKI A;  2W14 A;  1EAK A;  1KAP P;  1PWQ A;  1BIW A;  2OI0 A;  1BKC I;  2OVX A;  1ROS A;  1XFZ A;  4JPA A;  1KUH A;  2O3E A;  1BM6 A;  4GR0 A;  1G49 A;  2D1O A;  1AYK A;  1SRP A;  3DPE A;  2FV5 A;  3LEA A;  1KBC A;  3EDH A;  2JNP A;  5CZM A;  5H8X A;  2OXW A;  1FM1 A;  3ZXH A;  3WV3 A;  4H84 A;  4JQG A;  1GO7 P;  4J4M A;  3LUM A;  3TSK A;  1OM8 A;  4WF6 A;  1Z3J A;  1HOV A;  3LJZ A;  3ZVS A;  4L19 A;  2V4B A;  1DTH A;  1OS9 A;  3I7I A;  2JSD A;  5I2Z A;  2PJT A;  3BA0 A;  2KRJ A;  3K7L A;  1OM7 A;  1QJJ A;  1BUD A;  456C A;  4AYK A;  3F1A A;  4GUY A;  2X3A A;  3EHY A;  1CGE A;  4XM8 A;  1D5J A;  1JIZ A;  1L6J A;  1IAB A;  1UTZ A;  1PWU A;  3KEK A;  1R1J A;  2DW1 A;  1C7K A;  1IAE A;  5I4O A;  4JA1 A;  4FVL A;  5CUH A;  2OVZ A;  4IJO A;  1HTD A;  4PKW A;  1D8M A;  3K7N A;  4DV8 A;  3E8R A;  3TS4 A;  2MZI A;  2DDF A;  1JAP A;  1BQQ M;  1XUR A;  1IAA A;  1K7Q A;  3VTG A;  2J83 A;  4A7B A;  1YQY A;  1QIA A;  1XFW A;  3I7G A;  5D2B A;  3HYG A;  4H30 A;  3KME A;  1PWW A;  4IN9 A;  4PKT A;  2JIH A;  4H49 A;  5BOT A;  3F19 A;  1CAQ A;  4GR3 A;  3N2V A;  1EB6 A;  1HFS A;  1H71 P;  2ERO A;  1O0T A;  5I12 A;  2YIG A;  1AST A;  4Q1L A;  1I1I P;  1ZVX A;  4PKQ A;  3G42 A;  2X3B A;  5D1T A;  3N2U A;  3HB2 P;  4WK7 A;  1ATL A;  1JKY A;  1USN A;  4DPE A;  3HY9 A;  2YB9 A;  1ZTQ A;  3LGP A;  3ELM A;  1K7G A;  1Y0V A;  1CQR A;  5JMY A;  2W0D A;  2E3X A;  4H1Q A;  2OY4 A;  1KUK A;  1I73 A;  4H3X A;  1B3D A;  2OW0 A;  3KRY A;  3KWV C;  4ZR5 A;  1MNC A;  2WOA A;  3B2Z A;  3LKA A;  4WZV A;  1G9K A;  1UMS A;  4I03 A;  1R1H A;  2W15 A;  2ERP A;  2W13 A;  3O2X A;  4R3V A;  5L79 A;  5B5P A;  1TVI A;  1UTT A;  1FLS A;  1QIC A;  2RJQ A;  1CIZ A;  1JIW P;  3F16 A;  3LJG A;  1RM8 A;  5B5O A;  3KMC A;  3HBV P;  1JK3 A;  4FU4 A;  1GE6 A;  4PKS A;  4IUW A;  4L6T A;  1YCM A;  2OY2 A;  4JP4 A;  1HFC A;  1YP1 A;  1ZP5 A;  3LQ0 A;  5I3M A;  4A3W A;  2JT6 A;  1WNI A;  4WKE A;  2CLT A;  1I76 A;  1MMB A;  3DTI A;  1HV5 A;  1PWV A;  1D8F A;  1OO9 A;  2OW9 A;  3V96 B;  1K7I A;  3MA2 A;  2HU6 A;  3TT4 A;  4JIJ A;  3B8Z A;  2K9C A;  1YOU A;  5BOY A;  3DPF A;  1CK7 A;  4XM7 A;  4GQL A;  4ON1 A;  3F17 A;  4DD8 A;  1XFY A;  1JH1 A;  1D7X A;  2W12 A;  2POJ A;  4GWM A;  4L63 A;  3EDI A;  1ZS0 A;  3UVC A;  1AKL A;  3O64 A;  4HX3 A;  1C8T A;  1MMR A;  2Y6C A;  3LIK A;  4EFS A;  4H82 A;  5CXA A;  1CXV A;  2MLR A;  4I35 A;  1BSW A;  1Y93 A;  3GBO A;  2X3C A;  3HDB A;  1GXD A;  2MZH A;  3DL1 A;  1GO8 P;  3DTE A;  2ERQ A;  1OM6 A;  3DNG A;  3RTT A;  3F18 A;  4XBH A;  4H76 A;  1SLM A;  2I47 A;  3EHX A;  1XFX A;  4L7A A;  1ZXC A;  2OXU A;  1GE5 A;  1R1I A;  1R55 A;  4FXQ A;  1PWP A;  2SRT A;  1B8Y A;  1IAC A;  1A86 A;  1JAN A;  1G05 A;  5D7W A;  5D3C A;  2OXZ A;  1IAD A;  1SMP A;  4PKV A;  3P1V A;  1KUG A;  4PKR A;  3OHL A;  2J0T A;  1GE7 A;  5D1U A;  1BZS A;  1CGL A;  2XS4 A;  4QKZ A;  3P24 A;  1OZ9 A;  3TVC A;  1BQO A;  1KUF A;  1QUA A;  1JAQ A;  1EUB A;  3VI1 A;  3G5C A;  3LUN A;  1ND1 A;  4GWN A;  1SAT A;  2OW1 A;  1SLN A;  1XUD A;  3HY7 A;  4HMA A;  1CGF A;  5I43 A;  2AYK A;  1O0Q A;  3DWB A;  3HBU P;  4GR8 A;  5LAB A;  1MMQ A;  1HY7 A;  966C A;  1JAO A;  3LIL A;  3DTK A;  1QJI A;  2DW0 A;  5D1S A;  4G0D A;  1XFV A;  3L0T A;  1A85 A;  3KEJ A;  2YUF A;  3WV2 A;  3EDG A;  1ZXV A;  2Y6D A;  3KEC A;  1S4B P;  2XS3 A;  3HDA P;  2WO9 A;  1DMT A;  4AXQ A;  1G12 A;  4AUO A;  1C3I A;  2USN A;  2TCL A;  3AYU A;  2MZE A;  3LK8 A;  2OZR A;  3USN A;  5L7F A;  3NX7 A;  2RJP A;  4H2E A;  2K2G A;  1J7N A;  4XCT A;  1RMZ A;  3WV1 A;  2WO8 A;  1QIB A;  1XAX A;  3EDZ A;  4G9L A;  3EWJ A;  4GF1 A;  2N8R A;  2QPJ A;  3SHI A;  1XFU A;  4ILW D;  1AF0 A;  2Z2D A;  5BPA A; 
#chains in the Genus database with same CATH homology
 4AIG A;  1GKC A;  1OS2 A;  830C A;  2DW2 A;  1JJ9 A;  1MMP A;  3LQB A;  2X7M A;  1G4K A;  2FV9 A;  4PKU A;  2O36 A;  1IAG A;  2OW2 A;  2CKI A;  2A8H A;  3AYK A;  1GKD A;  3LIR A;  1BUV M;  2AIG P;  3LMC A;  2MLS A;  3L0V A;  3U1R A;  4FXY P;  4XM6 A;  2JT5 A;  1FBL A;  1R54 A;  1BKC E;  4WKI A;  3DSL A;  3F15 A;  1SU3 A;  2D1N A;  3OHO A;  3RTS A;  4DF9 A;  3Q2H A;  3AIG A;  3LE9 A;  4CTH A;  2E2D A;  1KUI A;  3KHI A;  3B92 A;  1XUC A;  3Q2G A;  5I0L A;  2DDY A;  1Q3A A;  3LJT A;  1UEA A;  3ZUK A;  2L0R A;  1Y8J A;  1BKC A;  1OMJ A;  1UMT A;  3CKI A;  2W14 A;  1EAK A;  1KAP P;  1PWQ A;  1BIW A;  2OI0 A;  1BKC I;  2OVX A;  1ROS A;  1XFZ A;  4JPA A;  1KUH A;  2O3E A;  1BM6 A;  4GR0 A;  1G49 A;  2D1O A;  1AYK A;  1SRP A;  3DPE A;  2FV5 A;  3LEA A;  1KBC A;  3EDH A;  2JNP A;  5CZM A;  5H8X A;  2OXW A;  1FM1 A;  3ZXH A;  3WV3 A;  4H84 A;  4JQG A;  1GO7 P;  4J4M A;  3LUM A;  3TSK A;  1OM8 A;  4WF6 A;  1Z3J A;  1HOV A;  3LJZ A;  3ZVS A;  4L19 A;  2V4B A;  1DTH A;  1OS9 A;  3I7I A;  2JSD A;  5I2Z A;  2PJT A;  3BA0 A;  2KRJ A;  3K7L A;  1OM7 A;  1QJJ A;  1BUD A;  456C A;  4AYK A;  3F1A A;  4GUY A;  2X3A A;  3EHY A;  1CGE A;  4XM8 A;  1D5J A;  1JIZ A;  1L6J A;  1IAB A;  1UTZ A;  1PWU A;  3KEK A;  1R1J A;  2DW1 A;  1C7K A;  1IAE A;  5I4O A;  4JA1 A;  4FVL A;  5CUH A;  2OVZ A;  4IJO A;  1HTD A;  4PKW A;  1D8M A;  3K7N A;  4DV8 A;  3E8R A;  3TS4 A;  2MZI A;  2DDF A;  1JAP A;  1BQQ M;  1XUR A;  1IAA A;  1K7Q A;  3VTG A;  2J83 A;  4A7B A;  1YQY A;  1QIA A;  1XFW A;  3I7G A;  5D2B A;  3HYG A;  4H30 A;  3KME A;  1PWW A;  4IN9 A;  4PKT A;  2JIH A;  4H49 A;  5BOT A;  3F19 A;  1CAQ A;  4GR3 A;  3N2V A;  1EB6 A;  1HFS A;  1H71 P;  2ERO A;  1O0T A;  5I12 A;  2YIG A;  1AST A;  4Q1L A;  1I1I P;  1ZVX A;  4PKQ A;  3G42 A;  2X3B A;  5D1T A;  3N2U A;  3HB2 P;  4WK7 A;  1ATL A;  1JKY A;  1USN A;  4DPE A;  3HY9 A;  2YB9 A;  1ZTQ A;  3LGP A;  3ELM A;  1K7G A;  1Y0V A;  1CQR A;  5JMY A;  2W0D A;  2E3X A;  4H1Q A;  2OY4 A;  1KUK A;  1I73 A;  4H3X A;  1B3D A;  2OW0 A;  3KRY A;  3KWV C;  4ZR5 A;  1MNC A;  2WOA A;  3B2Z A;  3LKA A;  4WZV A;  1G9K A;  1UMS A;  4I03 A;  1R1H A;  2W15 A;  2ERP A;  2W13 A;  3O2X A;  4R3V A;  5L79 A;  5B5P A;  1UTT A;  1FLS A;  1QIC A;  2RJQ A;  1CIZ A;  1JIW P;  3F16 A;  3LJG A;  1RM8 A;  5B5O A;  3KMC A;  3HBV P;  1JK3 A;  4FU4 A;  1GE6 A;  4PKS A;  4IUW A;  4L6T A;  1YCM A;  2OY2 A;  4JP4 A;  1HFC A;  1YP1 A;  1ZP5 A;  3LQ0 A;  5I3M A;  4A3W A;  2JT6 A;  1WNI A;  4WKE A;  2CLT A;  1I76 A;  1MMB A;  3DTI A;  1HV5 A;  1PWV A;  1D8F A;  1OO9 A;  2OW9 A;  3V96 B;  1K7I A;  3MA2 A;  2HU6 A;  3TT4 A;  4JIJ A;  3B8Z A;  2K9C A;  1YOU A;  5BOY A;  3DPF A;  1CK7 A;  4XM7 A;  4GQL A;  4ON1 A;  3F17 A;  4DD8 A;  1XFY A;  1JH1 A;  1D7X A;  2W12 A;  2POJ A;  4GWM A;  4L63 A;  3EDI A;  1ZS0 A;  3UVC A;  1AKL A;  3O64 A;  4HX3 A;  1C8T A;  1MMR A;  2Y6C A;  3LIK A;  4EFS A;  4H82 A;  5CXA A;  1CXV A;  2MLR A;  4I35 A;  1BSW A;  1Y93 A;  3GBO A;  2X3C A;  3HDB A;  1GXD A;  2MZH A;  3DL1 A;  1GO8 P;  3DTE A;  2ERQ A;  1OM6 A;  3DNG A;  3RTT A;  3F18 A;  4XBH A;  4H76 A;  1SLM A;  2I47 A;  3EHX A;  1XFX A;  4L7A A;  1ZXC A;  2OXU A;  1GE5 A;  1R1I A;  1R55 A;  4FXQ A;  1PWP A;  2SRT A;  1B8Y A;  1IAC A;  1A86 A;  1JAN A;  1G05 A;  5D7W A;  5D3C A;  2OXZ A;  1IAD A;  1SMP A;  4PKV A;  3P1V A;  1KUG A;  4PKR A;  3OHL A;  2J0T A;  1GE7 A;  5D1U A;  1BZS A;  1CGL A;  2XS4 A;  4QKZ A;  3P24 A;  3TVC A;  1BQO A;  1KUF A;  1QUA A;  1JAQ A;  1EUB A;  3VI1 A;  3G5C A;  3LUN A;  1ND1 A;  4GWN A;  1SAT A;  2OW1 A;  1SLN A;  1XUD A;  3HY7 A;  4HMA A;  1CGF A;  5I43 A;  2AYK A;  1O0Q A;  3DWB A;  3HBU P;  4GR8 A;  5LAB A;  1MMQ A;  1HY7 A;  966C A;  1JAO A;  3LIL A;  3DTK A;  1QJI A;  2DW0 A;  5D1S A;  4G0D A;  1XFV A;  3L0T A;  1A85 A;  3KEJ A;  2YUF A;  3WV2 A;  3EDG A;  1ZXV A;  2Y6D A;  3KEC A;  1S4B P;  2XS3 A;  3HDA P;  2WO9 A;  1DMT A;  4AXQ A;  1G12 A;  4AUO A;  1C3I A;  2USN A;  2TCL A;  3AYU A;  2MZE A;  3LK8 A;  2OZR A;  3USN A;  5L7F A;  3NX7 A;  2RJP A;  4H2E A;  2K2G A;  1J7N A;  4XCT A;  1RMZ A;  3WV1 A;  2WO8 A;  1QIB A;  3EDZ A;  4G9L A;  3EWJ A;  4GF1 A;  2N8R A;  2QPJ A;  3SHI A;  1XFU A;  4ILW D;  1AF0 A;  2Z2D A;  5BPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...