2PP1A

Crystal structure of l-talarate/galactarate dehydratase from salmonella typhimurium lt2 liganded with mg and l-lyxarohydroxamate
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
395
structure length
395
Chain Sequence
SANSDAVTYAKAANTRTAAETGDRIEWVKLSLAFLPLATPVSDAKVLTGRQKPLTEVAIIIAEIRSRDGFEGVGFSYSKRAGGQGIYAHAKEIADNLLGEDPNDIDKIYTKLLWAGASVGRSGMAVQAISPIDIALWDMKAKRAGLPLAKLLGAHRDSVQCYNTSGGFLHTPLDQVLKNVVISRENGIGGIKLKVGQPNCAEDIRRLTAVREALGDEFPLMVDANQQWDRETAIRMGRKMEQFNLIWIEEPLDAYDIEGHAQLAAALDTPIATGEMLTSFREHEQLILGNASDFVQPDAPRVGGISPFLKIMDLAAKHGRKLAPHFAMEVHLHLSAAYPLEPWLEHFEWLNPLFNEQLELRDGRMWISDRHGLGFTLSEQARRWTQLTCEFGKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evolution of enzymatic activities in the enolase superfamily: L-talarate/galactarate dehydratase from Salmonella typhimurium LT2.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
molecule keywords L-talarate/galactarate dehydratase
total genus 138
structure length 395
sequence length 395
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.2.1.156: L-talarate dehydratase.
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2pp1A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2pp1A01
3UCDA 1JCTA 3OPSA 4Z1YA 3ES8A 1EC8A 5FJTA 3R25A 2CHRA 2GGGA 4E4FA 3U9IA 2AL2B 3VA8A 4DHGA 1E9IA 3UJFA 3SQSA 3HPFA 4IZGA 4GGHA 3TJ4A 4ZCWA 2OO6A 3IK4A 4DYEA 3VC6A 4A35A 3R0UA 2GL5A 4GYPA 1TZZA 4HCHA 2RDXA 4ENLA 4KPLA 4HCLA 5IDZA 3RITA 3FV9A 1MDLA 3UJEA 3U4FA 3UXLA 3UJRA 4DX3A 1R6WA 2P3ZA 3SN4A 3P3BA 4GYPC 3N4EA 3ES7A 2O56A 3MUCA 3PFRA 1SJDA 3VFCA 3BOXA 2PS2A 3N6HA 3PWIA 1MNSA 3TW9A 4A6GA 1MUCA 2QQ6A 5ENLA 5BOEA 4J1OA 4K2SA 1NELA 2OZ3A 3D46A 3QLDA 3SJNA 3ZVHB 4HNCA 3DFHA 2PP3A 4MMWA 1PDYA 3Q45A 3V5FA 3DG7A 3RR1A 3KUMA 3RCYA 4MKSA 4H83A 3MZNA 3ZLHA 3P0WA 2HNEA 4IP5A 4KWSA 3MQTA 1KD0A 2QJNA 3TWAA 2HZGA 3GD6A 3BJSA 4ROPA 3ZVHA 1R0MA 1P48A 1SJBA 1MRAA 3PK7A 3JZUA 3I4KA 3GY1A 2OZTA 4GMEA 2PPGA 2QJJA 3DERA 2PU0A 2POZA 3H70A 5FJUA 5FJRA 3PWGA 2PSNA 1TKKA 4IL0A 4DN1A 1TE6A 4KT2A 3H8AA 2NQLA 2P0IA 3CT2A 4GIRA 1F9CA 3OZYA 4H2HA 3ZLGA 4MGGA 4GFIA 2HXUA 4JN8A 2OFJA 1WUEA 1JPMA 2AKZA 2XGZA 4A3RA 2ZADA 3DESA 3DG6A 3OZMA 3QN3A 2PA6A 3FCPA 3RGTA 3B97A 4HPNA 3CAWA 3TQPA 2QGYA 3NXLA 1SJAA 3V4BA 3H12A 3OW1A 3T9PA 4Z17A 1DTNA 3UCCA 3UJ2A 1FHUA 3TJIA 2P8BA 1MDRA 5FJPA 4DXKA 3MY9A 2ZC8A 4IHCA 2GGIA 2HXTA 3ENLA 6ENLA 2AKMA 3SBFA 1XPYA 1BQGA 2PGEA 3DGBA 3TWBA 3SSZA 3EEZA 3DG3A 4JHMA 3FYYA 3FXGA 3R1ZA 3TCSA 4FI4A 3UJSA 4IP4A 4F4RA 4X2PA 1WUFA 3N4FA 3CK5A 5EU9A 3V3WA 2OPJA 1YEYA 4G7FA 1EC7A 2PTWA 2PMQA 4KEMA 3IJLA 2QVHA 1EBHA 3IJQA 4E5TA 3MSYA 3K1GA 2OG9A 4E8GA 2OQHA 2PTYA 4YWSA 4H19A 2PTZA 4EWJA 2DW7A 2DW6A 3TOYA 1PDZA 3SN0A 1RVKA 2PP0A 3VCCA 3ZVIA 3S47A 3DIPA 3JVAA 2GGJA 4M0XA 3BSMA 3RRAA 4DWDA 2OX4A 4K1WA 2OLAA 3R11A 3NO1A 1KKRA 3CXOA 3UXKA 1ONEA 3IJIA 2GGHA 1W6TA 1KCZA 3Q4DA 2FYMA 2PODA 3QKEA 3GC2A 2AL2A 3N6JA 3FJ4A 1P43A 2PP1A 3R10A 3I6TA 3MWCA 4GISA 4J3ZA 3QPEA 3EKGA 3T6CA 1EC9A 2PGWA 2GSHA 3DFYA 4FP1A 3UGVA 4E4UA 3OP2A 3TTEA 2PCEA 3OTRA 4M6UA 2QJMA 4K8GA 2AL1A 1XS2A 4JN7A 4HN8A 3SN1A 2XH7A 2P8CA 3T8QA 4ZA0A 3T4WA 4HCDA 4E6MA 2PTXA 3NZGA 2XSXA 3S5SA 2MUCA 3CYJA 4IT1A 1ELSA 3NFUA 1IYXA 1SJCA 4GGBA 1ECQA 3VCNA 3MKCA 2XH4A 1FHVA 2XH0A 3V5CA 3STPA 3D47A 3I6EA 2P88A 2MNRA 3THUA 1BKHA 3VDGA 4HYRA 1EBGA 2GDQA 1JPDX 5BOFA 1L8PA 3QTPA 2I5QA 1KKOA 3CB3A 2PU1A 2OQYA 4H1ZA 5J04A 1NU5A 2FKPA 3ZLFA 2OKTA 3GO2A 3FVDA 4IL2A 3DDMA 2XH2A 1JDFA 5FJOA 2OZ8A 3RO6A 2OVLA 3R0KA 3VC5A 7ENLA 2QDEA 2GGEA 3P93A 4G8TA 2ONEA 4HNLA 1OEPA 2QDDA 3JW7A 3DEQA 3H7VA
chains in the Genus database with same CATH superfamily
3HV8A 1CPUA 2YVJA 1AL8A 3MKKA 4FNPA 4Q6JA 4W86A 3RYSA 4CU7A 4JYEA 4O8AA 3GUGA 5EMUA 3RNMA 1WKFA 2E6DA 1L6GA 3PZIA 4I9TA 3POCA 1OF8A 3F2BA 3SQMA 4C1LA 4MFDA 5CZ0A 4PFMA 1ZHAA 2GSEA 4G56A 3ZSSA 1GOOA 4GGHA 3TJ4A 1DIDA 4L7ZA 4YN5A 2GWNA 3RN6A 3UXIA 3BLOA 3QZAA 4GH3A 4KETA 1GVSA 4XVDA 4BF7A 1FTXA 3SADA 2X41A 3LV5A 3VO0A 4Y7EA 3DECA 4HMNA 3SN4A 1D7KA 4NYYA 5A8PA 3WQ5A 4GUFA 3MUCA 3UEQA 1TJPA 2GVJA 3M7WA 5EBUA 3UPWA 3F4CA 3FNDA 1JZ8A 4PMVA 3NL2A 3TN4A 3OHMB 1F3PA 3TA9A 1PKNA 1LWIA 1H5VA 3IK2A 2R8WA 4B5VA 4HB7A 3FEQA 3SB0A 1MO0A 1X96A 1VHCA 3AIQA 4V1XA 2YL5A 4W8AA 1YTKA 1PZ1A 1Q66A 1GKQA 8TIMA 2E09A 4H9ZA 4DBDA 1OFQA 2YXGA 1DORA 4O17A 3CQIA 4UR9A 3S2NA 5JCNA 4IM4A 4HSNA 1GVEA 1TX2A 3VNYA 5A69A 1TWZA 3AS1A 3QLLA 1K8CA 2X1SA 3LQLA 3MHFA 1VJIA 1QI0A 5JU6A 4GY0A 5HQLA 3G6LA 1PV8A 2ZXBA 1MUMA 1WX0A 5FSEC 3VMNA 4KRZA 1VIWA 3I4KA 1FWSA 4GMEA 2PU0A 4B5XA 1MXGA 3DK8A 3OQ8A 3O6YX 1C7TA 3GXIA 1XLEA 3CZLA 5FJRA 2G3JA 5C71A 3HRDC 3LBCA 4M81A 3ARUA 4V28A 4EXAA 4B3KA 4EVZA 2Y85A 5LNUA 3AXXA 5A6LA 3T09A 1TE6A 4LSBA 1GRTA 2CLMA 2P0IA 2TPRA 4GIRA 3G1SA 4IQDA 4EPDC 1TPC1 4XAZA 3A7UA 1J01A 1M7XA 3PN8A 3NR0A 1JRPA 2ON3A 2Y6ZA 1Q6DA 4PMUA 3DKJA 2AKZA 4X61A 1H49A 2DSVA 3NVZB 4HOWA 5DO8A 2ZOXA 4K3ZA 3G1RA 1SJAA 4JIRA 1A5AA 1J79A 1R9ZA 3WENA 2WZEA 1GZ1A 1EDTA 1IXOA 4L80A 1KTNA 3P5ZA 3QFBA 4EF8A 3S5OA 1LPFA 3WJXA 1VBRA 1YQ2A 2ALRA 3KBSA 3MT1A 1UUMA 7TIMA 3OBEA 5FS8A 4OE7A 3WG6A 1KM6A 1V5XA 3F4VA 1R3TA 4HJWA 3KHDA 4H7ZA 5FMHA 5HJYA 1YLVA 1SU5A 1XDJA 4KESA 2J9ZA 3PPGA 3TYDA 3N29A 4M5PA 3V35A 3DG3A 2QCMA 5TD4A 3PB0A 1DJZA 4JCLA 3AMGA 4F4RA 1GVQA 1W91A 3LHZA 1EA9C 1LROA 1EJXC 2VVNA 2PDMA 3M9YA 3UWQA 2X2YA 3UWZA 1HJSA 3USZA 2QCNA 3WQGA 4E5TA 3MSYA 3P7YA 4JOMA 1O94A 1X7IA 2DPEA 3L23A 4GVFA 5AECA 2CC0A 1T7LA 4O54A 5D9NA 1TZ9A 4A8RA 4FX7A 2WHJA 2ZE3A 3AHZA 3K2GA 2J88A 1EQCA 4C6QA 3WK2A 1ZFJA 3GH5A 3S47A 1ZY9A 3B9OA 4CCDA 1DWIM 2WV8A 5HNUA 1UKPA 3BG9A 1L6SA 2EO7A 3B8WA 3L5AA 2C15A 2V2DA 3PZGA 4KEUA 3K30A 4H6QA 1EEPA 1Q1RA 3NZRA 2VZOA 3NTYA 1VJSA 1TSIA 2FB3A 4FA3A 1H0IA 2YL9A 3HJEA 1OFOA 1RJRA 3A4WA 3VIIA 4J4KA 1JF5A 1WAUA 3T6CA 4U5IA 1ZXIC 3UWYA 2WOVA 3W0KA 5DXXA 1S5TA 4O16A 1QNOA 4MAVA 1L6WA 3T0TA 2F84A 2J6XA 1JZ4A 4LUJA 1T6MA 1ENUA 5A8MA 3WUFA 1UP3A 1A5CA 2ATSA 3B8SA 2WMFA 3LB0A 5M1TA 4Y9PA 1E56A 1LL4A 3NZGA 1CBGA 3MO7A 1DNCA 2PDWA 3NPXA 3SAZA 4Q7NA 1NF0A 4KWUA 1UC4A 1DVJA 1ONRA 2PWGA 1D2KA 1J6OA 4NZJA 1CX9A 4H7VA 1TQXA 1MW2A 5EA9A 3BH4A 4UTJA 2XN2A 1NY1A 1T99A 2X16A 4DZHA 4DJED 4US5A 4J3TA 3Q94A 3BLIA 1CXEA 1CI1A 3CHDA 4KFNA 1GZJA 1KR1A 3U2OA 3UF9A 3U5UA 1HKJA 5B7ZA 2PWVA 2NLIA 1PIGA 1ECEA 2VELA 1GOMA 5FF7A 1REQB 5BZAA 2X0SA 4ZSUA 2GR3A 2JGQA 5ABHA 1DV7A 1VAHA 3K8KA 1VFMA 2I5IA 4QCEA 1OINA 1C29A 2DVXA 4UBPC 3FAXA 2H90A 1JCTA 4DZAA 1ZS2A 1WA3A 2WSPA 1KFWA 2Z7GA 4MJ2A 4ZGYA 4E4FA 1QI2A 3QM3A 3W1TA 2AL2B 2ZZ3A 3RLVA 3P61A 4GR1A 3SQSA 1OC5A 2QS8A 4IZGA 3S5YA 4MSSA 2WPBA 1G4PA 3DFSA 1VFOA 3CJPA 1IZJA 1EX1A 2GL5A 5A6BA 3QKZA 5LIKX 2ZICA 3LG3A 4L9YA 5FJIA 2IPWA 5DLCA 1ZX9A 1TVPA 4AD1A 4ENLA 3GXDA 1K4GA 2Z00A 3A24A 1NWUA 3C3UA 3B04A 1PUDA 3W22A 2E3ZA 4R34A 2NLYA 2GYIA 4RPQA 4S38A 3N4EA 2UY2A 1D7YA 3WQFA 1TV4A 2AAQA 1E4IA 1IWBA 1XIEA 2EGZA 2WNZA 1EJTC 1QI4A 2F61A 4LVGA 5TR3A 2E0PA 1SPQA 1WDQA 1O12A 4LFYA 5ENLA 3NQFA 4XUYA 4DUVA 3OGSA 4UMCA 2DY3A 5B7YA 1V7YA 1KWGA 1EH9A 1XX1A 1I9CB 2ZFAA 2PLKA 3ABXA 4HA3A 4J3UA 4NSBA 1GW9A 4W87A 2KAUC 4LYPA 3AYTA 4BV6A 1AZ1A 3WBWA 3LHTA 4J40A 2YZRA 3THDA 2G95A 4TVWA 3E0VA 4OJYA 4WHBA 3MDWA 5F4WA 1H7WA 4MKSA 1V8EA 4JQAA 4GRTA 3BCDA 4FNRA 1RV8A 3KHJA 3MKVA 2W9MA 2D2HA 3P0WA 4LUYA 4L4OA 1O66A 4IJBA 5T26A 1GYLA 1O4UA 4IP7A 1DJWA 3W7DA 1WBJA 3W38A 1GJPA 1MW3A 3INPA 4GLEA 2F9RA 3T4CA 1V0LA 5BRQA 2XGIA 3Q37A 1V6UA 1AODA 2POZA 4PUKA 2HTMA 2VOTA 3WQWA 3A21A 4D72A 5TIMA 3AICA 2Y61A 2HSAA 2GR0A 4D71A 1KXQA 1LDCA 4W7VA 3ANUA 1UWUA 4GI6A 1YXDA 4MGGA 1QFEA 3H2NA 3IGUA 4LA1A 2VFGA 5JQ9A 3CZJA 1E70M 2BY0A 4HK5A 3NVDA 3LGDA 1GG1A 4H3DA 3GRSA 4D6GA 1VEMA 3URHA 2IXUA 2DZAA 3GXNA 2ZUTA 3R94A 4GOAA 4AAJA 2VFHA 3TNBA 1UBSA 4JQ4A 1AQHA 3CHCA 1A5KC 2PDLA 3Q2DA 1NF7A 2A3LA 3LBMA 3K4WA 4H41A 2E9LA 4Z17A 4PTMA 3CPUA 1EFZA 1DTNA 1LZOA 5AC7A 3GXMA 3ZO9A 2NX9A 4I9MA 4ORMA 2P8BA 3EAUA 4L6DA 4W5UA 5BWAA 1HGWA 2QUNA 3VOJA 2YR1A 2GJXA 2D22A 2O4MA 1RCOB 3TWBA 5AYXA 3FXGA 3QY6A 3N4FA 3A3WA 3CK5A 5BNKA 3W84A 5DMMA 4JX5A 3A9BA 1M01A 2BOEX 2Y1HA 2CLPA 4ZOBA 7PTDA 2XIIA 1EBHA 1O60A 1ZNNA 3NDOA 2PRHA 3DJJA 1K4QA 5XIMA 3MUZ1 3GD4A 2PTZA 3M46A 4I3GA 4QSHA 8RUCA 3URNA 3ABOA 3URQA 2HV5A 2XM2A 1WXYA 2A2IA 4NAFB 2PP0A 4JFSA 3CS2A 4H4QA 3B8VA 4GY1A 3U2CA 4W4QA 3DOPA 4IX2A 4M0XA 2IS7A 4RV3A 2VCCA 4FS9A 2EG8A 2PAJA 3L68A 2BVWA 3K13A 2GUBA 3VKCA 3MS8A 3PG9A 5EMLA 1OFRA 3AYRA 1FIQB 3CV2A 2C6QA 3NPUA 3QKEA 3E49A 4IIDA 3M0ZA 2YOCA 1NDYA 2Y7DA 1RQEA 2Y5EA 3IJDA 5MHBA 4JS3A 1QNRA 4XKYA 3UERA 5A6TC 3H2EA 3H4WA 4B3LA 1R3RA 5HPCA 3ITGA 5GQBA 3HGJA 2RDTA 2EKCA 3NVTA 1O1ZA 4H4SA 2YXXA 3VU2A 1VCGA 3LGGA 4LS0A 4AEOA 4JYFA 4O52A 4RE3A 4BA0A 1QNSA 1Q6RA 4K8GA 4QG8A 3S5NA 3ITYA 4JN7A 4M7SA 5LYRA 4FAMA 1J18A 2X40A 3RIKA 1VCVA 1EGMA 3TZFA 1V77A 1W3NA 3GTIA 4YWOA 3E9AA 3WF2A 3W82A 6XIMA 1XSIA 1QW8A 3W1QA 1Z9AA 4CU6A 3POHA 2FVKA 3GC4A 3XISA 5C2GA 3F2CA 2C3CA 5C9ZA 4TVDA 3HO8A 3G2GA 2FB2A 4LOCA 2ZRZA 4C6MA 3VOHA 1A4MA 3EOEA 4NQ1A 1F7BA 1JNDA 1GOIA 3DU0A 3QSTA 3ZLFA 4ZQOA 1TMHA 3GO2A 3AI0A 4C60A 2F8QA 2XH2A 1TV5A 1OYAA 1N7KA 2BB0A 2AMGA 4MNLA 5I3DA 1VFLA 3TW6A 3EX4A 4UFIA 4QNEA 3O07A 1XLCA 4NXKA 4QCFA 1A80A 1N8WA 1CXFA 4M1RA 4IMEA 2WKGA 3T40A 1JJKA 4ACZA 2ZDRA 3T2QA 3FK4A 4RE0A 2D3NA 2P53A 5FJTA 5I00A 4EP8C 3LLFA 3FFSA 4DHGA 5FJJA 3W7RA 2NUXA 1E5NA 2NUWA 2GDVA 1HKKA 4LY8A 4BQ5A 2H8ZA 2YCKX 5FF4A 5DCBA 4DUWA 2OO0A 3R89A 4LEFA 4UOJA 2VC7A 2NQ5A 3BAKA 4NJHA 1E6XM 4NI8A 3PBMA 3A9IA 3SUTA 1LP6A 1UG6A 2VEKA 3LNPA 1FP8A 1FFQA 4YTTA 2GVYA 3PUEA 1W9PA 3FKRA 3L4VA 3EX2A 2AGKA 5F7UA 1LWJA 3ARPA 1JGIA 3MI3A 2DQXA 3VK5A 5TQLA 3W6LA 2OT1A 3TTSA 2D23A 3CXBA 1ZSXA 4FIQA 3ANVA 1JD9A 1X6LA 4I7WA 3TTOA 1F2JA 1QXLA 3GAYA 1W9BM 3LI1A 2CKRA 4QTGA 3PZ9A 3AUOA 1KRAC 3MWAA 3WF0A 4Q8QA 9RUBA 4R7OA 4E8CA 3BCFA 3WUGA 4XZ9A 2FGBA 5AHNA 4L6HA 5EL1A 1R38A 1U22A 1T5AA 1YIXA 1IZCA 3WQ8A 1WZKA 1TX0A 2EG6A 2XSBA 2BV9A 3MUIA 3P14A 5BOOA 1XIDA 4GZIA 2PD5A 3ZJ6A 2JEQA 3R6IA 1UD6A 3I7QA 2J7HA 1KFJA 1QHZA 3RR1A 1ZCOA 4AQLA 2BOFX 2QMKA 1RH9A 1XCWA 4QLLA 1SFJA 4CD5A 1ISXA 3MUAA 2PLMA 4WCJA 3SRFA 1XBZA 4IGHA 3C0JA 1KM1A 4PSRA 3E1F1 3FOKA 3N9KA 2DVTA 5FF3A 3F4WA 1PPIA 1M65A 3T0AA 1JR1A 1AJ2A 4OQVA 1KXTA 3ABQA 3WLOA 4APNA 2DIJA 2YBVA 1GV4A 5CGTA 2PUZA 2G3MA 3AZRA 3BQ6A 3A7AA 3QYQA 1GRGA 2VOMA 7REQB 5F2GA 1LBLA 1PTDA 2OWXA 2INFA 2OEJA 4DN1A 5D2TA 1E1FA 3QBUA 1SZRA 4KCUA 4E3VA 2DU2A 1HO1A 5B80A 3WNMA 1WPCA 4Y2WA 4EMIA 3HOJA 4JN8A 2X1TA 3II4A 4GIEA 1I60A 4JQ3A 4P8WA 3EPMA 4GYFA 2PA6A 3NL3A 3N2MA 1KM4A 1E9LA 4HPNA 2BGSA 1STZA 4HTYA 1JUKA 3VNDA 4I90A 4GACA 3I65A 3WD2A 3UXDA 3UVIA 2XN1A 3RG6A 5AYZA 4AZHA 1W0MA 3KS5A 3DH9A 4QSFA 5AOUA 1NDZA 2DQWA 1I2NA 1GRFA 4ZTXA 3RM8A 4K36A 4ZQPA 3RJXA 4RDWA 1LT8A 1WZLA 3MMDA 3ENLA 2YB1A 2WXDM 3CIXA 1SFSA 1V59A 4AF0A 3T05A 3KFTA 5F1VA 1G5AA 3M0HA 2BASA 1A5UA 1ZRQA 4FI4A 4XZNX 1B9ZA 4DJDD 5LHEA 5GNXA 4KEMA 8CGTA 4JQ1A 4R9OA 4R9XA 2CBVA 4OFCA 1EDGA 2A4AA 4UFKA 3B8IA 2Z1BA 3PG6A 3QJAA 4XISA 3SY8A 2DW7A 3EWYA 2A3AA 2PDGA 2CXGA 4XSMA 1B0IA 1EWEA 3SUUA 4YYFA 2DZPA 1MMFA 5CXPA 2BG5A 5CJ5A 3VNJA 3JVAA 3N3MA 3GDTA 4JR5A 1LWHA 3W00A 2GWGA 2OX4A 3CTLA 4K1WA 2ZYFA 4LAUA 4RE2A 5J5DA 2ZVIA 3UXAA 2VC5A 3BO9A 4JTDA 3I10A 4GJIA 3CWNA 1NQ6A 2GGHA 3GDKA 2CHOA 1R85A 3SEPA 3R7MA 3N34A 5KZ6A 1M53A 1AG1O 3LUTA 4O19A 1PEZA 4AVNA 1JVNA 3PG8A 3R10A 1HX0A 3I6TA 3EMQA 5BMWA 4J3ZA 1DHPA 3CH0A 4XZWA 3V0SA 4E4PA 2TAAA 1M6JA 4JAWA 4DJFC 3FDKA 1K9TA 2YDAA 3DFQA 2A21A 2DH2A 1UYQA 3M0JA 1JDCA 1YQZA 3R13A 4ZOCA 5C9UA 4NAEB 3RMJA 4JIIX 5CPMA 3P81A 4IXHA 1GRBA 2Q3OA 3LADA 4JD4A 4U28A 5K9CA 4XIAA 2PI6A 1F8MA 2XH0A 4PMQA 1TWIA 2DORA 5HDRA 5E9XA 2V9DA 4JFTA 4C91A 3VDHA 1C8VA 1U83A 4DBUA 3GTXA 5GJNA 4EXQA 4OBRA 3C61A 1W54A 5E0CA 1H5YA 2GJRA 2PF0A 4BK9A 4ZSTA 3GHTA 3HG2A 3NO5A 3CTTA 1GW1A 1QDSA 4DZ5A 1NU5A 3D0CA 4BQ2A 2UZ9A 3LLXA 1VHNA 4JTRA 3L9CA 1TREA 1NHRA 2C3DA 1EHNA 3SO7A 1UD8A 1JCNA 1FP9A 1GRHA 3U7BA 1EJUC 4R88A 5FJOA 7TAAA 2Z2AA 1K8YA 1VQTA 5CAKA 4FLOA 1T8XA 2VM8A 1MOKA 2PDUA 2PDKA 1PZ3A 4Z2JA 3PFMA 1CXIA 3DEQA 1GVIA 1M03A 4EWND 5JCIA 5HNTA 3MPGA 4CEXC 1E43A 1B3ZA 3CUGA 1FEBA 2JF6A 1YXYA 4XAYA 2V3BA 1SB3B 3ZR5A 3W86A 2ODOA 2VZSA 4PR4A 1ISZA 1UD4A 3WEMA 7ODCA 1TPH1 3AYVA 1H3GA 1D3HA 5RUBA 2V6OA 2E28A 1O6IA 4MB1A 1GETA 1H50A 2YFNA 2OO6A 1XCXA 3STEA 1TWDA 3O0HA 3OZOA 3B9AA 4Q7IA 4RE4A 3PUGA 1S5NA 5CPQA 1YW1A 2X50A 4LC8A 4RNJA 4Y9OA 3BOFA 4BEQA 4JFVA 1G67A 4H6EA 3FVMA 4PUNA 4R7JA 2IUZA 2Z28A 3MHGA 3SCNA 3UZWA 3P3BA 2BXZA 5AN7A 4JTLA 1TIMA 3W2UA 2CWXA 4MB4A 3R0DA 1B3XA 5JH1A 4MZ1A 5T8GA 3S6OA 5E6YA 1RXOB 2NXGA 4Y8EA 3L12A 3IIVA 1WDPA 3ATZA 3OA5A 2QQ6A 2O0TA 1B3OA 5D2WA 1EIBA 2X30A 1ZPTA 3G1YA 2QV4A 4WY0B 4K2SA 3NOEA 2OZ3A 2WAGA 3W7QA 4L1GA 4YJ5A 4GVGA 2XSAA 4HNCA 2I9UA 3GSMA 3O6AA 3OYXA 1VYRA 2PDIA 1VRDA 4YTSA 1K3UA 5FF2A 3AIUA 4KMQA 4LV4A 4TR9A 2X8CA 2XN0A 4AZ5A 4O10A 3HM7A 3RCMA 3RMEA 5LXXA 2FHCA 4P2VA 3NQEA 1AQ0A 2P5NA 3MZNA 1LUCA 2V30A 4B5NA 1UB3A 2W62A 1BYAA 3WDHA 5KINA 4S3JA 1EXBA 3VI2A 1FHLA 4BR1A 1EO5A 4ZO7A 1R0MA 4OV4A 4CCEA 1RBLA 1MRAA 5LNWA 4AD3A 4CGTA 1F61A 4O0KA 1C92A 4XZIA 5K4ZA 1FWDC 2AQWA 3VAVA 1AL7A 1CGWA 5JIPA 4TV5A 1SFLA 2F2KA 3W27A 3KVKA 1S2UA 4BI5A 3CUXA 1EF2A 1KO0A 2ISVA 3STGA 3B3DA 2FVMA 3SY1A 4YNGA 4PB3A 3HB9A 4QNWA 1F9CA 3EDEA 2V3AA 3LXDA 1Q2RA 3SQPA 4A3QA 5JBFA 4K8HA 5M2FX 2QUUA 4LUIA 4B3ZA 3LK6A 4B4HA 1QASA 3VIJA 3QZEA 1SR0A 4B92A 2QGYA 3KLKA 5D8ZA 4P7RA 3NG3A 5HNNA 1KB3A 2J7FA 1RY0A 5IBXA 4CQ8A 1B3YA 2E5DA 1JPIA 2VX6A 2MANA 2ZUNA 1FHUA 1I4NA 1QK0A 7REQA 2G0WA 3IC9A 1NOFA 3NQMA 4P5UA 2HXTA 3VNMA 4QR6A 3QV6A 4JNMA 4KCVA 1HIZA 2V2CA 2VEPA 4MWAC 4UTHA 5C6MA 3H2AA 4EXBA 1US3A 2A3HA 2W5FA 2IPGA 3NOYA 4C6FA 2GQWA 3EXSA 3TYEA 3E5PA 1W1TA 1D7FA 3WMSA 1G9HA 3V3WA 5KTLA 2OPJA 4RNHA 1GEUA 2PDYA 3LQGA 2VDGA 1V3KA 1W1ZA 3B05A 3W7GA 4BQ3A 5I2UA 3RO8A 4HHPA 1HJWA 1RA5A 3BTNA 4LC6A 1KM2A 1SUXA 4TU1A 3EB4A 4B5TA 1ICQA 3G18A 4XD3A 4XTDA 1H7NA 4ICMA 2ZZ0A 4RW3A 2CZ5A 1E0VA 1Z48A 3VMPA 4LALA 2XTKA 1VBGA 3OHIA 3WQDA 2YDSA 2P0OA 1SZGA 4M24A 5E9AA 3GDRA 3VZYA 3WN6A 4IPIA 3OO2A 2ATMA 2YW4A 1UZHA 3MTWA 4X9SA 3GDLA 3LCGA 3CMFA 3LPPA 2NX3A 3GTFA 2VL4A 3GC2A 4GBUA 3IANA 1LCOA 2J74A 1P43A 4MM1A 5G2HA 1VLWA 1IT0A 1W2PA 1I2QA 4I9AA 1EC9A 1JDAA 4QLKA 3SR7A 3MDUA 5FACA 1XYMA 5JIWA 4DUXA 2ISDA 1XHCA 4QX4A 1A5SA 1PX8A 3GRIA 2WVVB 4GO8A 5G4HC 4O28A 3V16A 4DF1A 3ICJA 2NVCA 2H3DA 1V08A 1V4YA 1MXDA 1EZ2A 1WOBA 3ME3A 3LHUA 4TIMA 3ORWA 3ECQA 3O63A 1HL8A 3M5YA 1ECQA 2HK1A 2ISFA 4HBKA 1XF0A 3KL5A 1OT1A 1VCFA 4IMCA 3THAA 3SFWA 4WSJA 1TTQA 4H4TA 3VDGA 4HSOA 3HPSA 2QT3A 3CASA 2GDQA 1IEIA 3CT7A 2C14A 3GNXA 1Y8BA 2W27A 1OCNA 1QOPA 3KP0A 2D0HA 3HBLA 3B0UX 3G0SA 4TQTA 2H3BA 1ZU8A 4PUWA 4ATWA 4OKDA 4WK9A 1B5TA 4MAZA 5HAOA 4RUBA 2OGJA 3NQ7A 4MY9A 4P7OA 3TVAA 1JDFA 4ZL1A 3QR0A 4N6FA 3LERA 1AFSA 1HT6A 1W5OA 1WDDA 4L56A 1ZB5A 1KWKA 2RKXA 2AQVA 2J9YA 4DI9A 4JTQA 4JCMA 4Z1YA 2WYSA 2QVNA 4ASTA 4NIRA 5EBAA 3GVRA 1DKWA 4UTTC 4TX8A 3R25A 3VGGA 2PDNA 4WKAA 4C7FA 1XLLA 1TMLA 3MBFA 4AX7A 4JY9A 1S2CA 3UJFA 1E71M 2VRKA 1K7EA 1JCXA 4JTCA 3HQNA 1BD0A 1J96A 1W9UA 2I57A 3UZJA 2OOFA 3MJYA 4RKAA 2E6FA 3G24A 2XZ9A 4M6PA 1QU4A 1FEAA 2YGYA 4GQGA 2Z1VA 4GNVA 5D38A 1PYFA 2I9EA 2RDXA 1JPKA 2WHMA 1RHCA 3RFAA 4J35A 2GUUA 3OLIA 2E40A 3BW2A 1MDLA 1XLDA 4FOJA 4F0MA 4F0KA 3KWXA 1M5WA 4JDBA 2C16A 2C91A 1O1HA 1PL9A 3N1AA 3I4EA 5CCZA 5DN1A 1X38A 3GNOA 1R2TA 1RBAA 4AY1A 4LW7A 4CCCA 2HCVA 2DT2A 2NSXA 1I1XA 1MNSA 2G96A 3T1GA 3CWOX 3VKJA 4GH1A 4NI3A 4DPPA 1MUCA 1BF2A 3HQ1A 5JCKA 3KDNA 1XYCA 3C86A 4XKYB 1SMAA 3N13A 5DMYA 2GZXA 2VDIA 3FA5A 1NELA 2JK2A 4ZE5A 1ODZA 1CLKA 2J8GA 2QAFA 1NHSA 3IV3A 2Z29A 3ABZA 5CGQA 1W3LA 5FKYA 1SO5A 3P84A 3A6OA 3TQ0A 4EAYA 3EWCA 2WWDA 3DBNA 4I9JA 1ME9A 1ZL1A 3KUMA 1PHWA 1H1ZA 1JI1A 3PANA 2ACSA 3MVTA 2QJNA 3L5LA 3B03A 1JZ5A 3SGUA 5G4EA 1I45A 3U5YA 3DZ1A 1KM0A 1FOBA 1OGGA 3TX9A 1QTWA 5MF5A 3RF9A 2DIKA 2PFHA 2REQB 1DXEA 1Q45A 3LTPA 2YB4A 3LMZA 1QNPA 4ZOAA 4DNAA 5CSUA 1E6NA 1K6AA 5LKYA 5IOBA 5EYWA 5EMYA 2NQLA 1OJXA 1FKXA 2Z2UA 1H51A 3W7IA 1B90A 1YPFA 3WQ6A 3PPFA 2BS9A 4O1FA 1SQ7A 1ZZMA 3TE9A 1KCLA 1QW9A 1A3WA 2XIMA 2JEPA 3GRTA 2CZVA 2ZADA 3WF3A 4E38A 5H8MA 3KL0A 4H9YA 2BWGA 4AZCB 3DX5A 5I24A 5EB8A 4MB3A 3B97A 3G22A 1GEHA 4FNUA 4O1EA 3QOMA 5D2XA 3KM8A 3V4BA 1QWGA 3H12A 2VRQA 3OW1A 1LLOA 2O9OA 3GYEA 3CL6A 4G1KA 2NVDA 3CL8A 2NVKX 3O9NA 4EPKA 1CXKA 1MDRA 2REQA 2C19A 2GJXB 3D5HA 2BGQA 3GH7A 3NQ2A 4A29A 1HL9A 1JZ6A 3BW4A 3E74A 3E0FA 3TYCA 1EKOA 3SBFA 1P5BA 4RDVA 3NA8A 3TQVA 5IHSA 5I06A 3PTDA 2DZXA 3SSZA 3NDYA 3CV7A 2WJZA 3CPGA 4L6OA 5I02A 2QJHA 3MBDA 1CTNA 1J2BA 2TRSA 3I3DA 2V3FA 3U4AA 1K6WA 4HNVA 3W76A 4S3FA 3PTQA 4ZENA 3GG7A 2OJPA 1OB0A 1F76A 3ALGA 1H11A 1Q4WA 2A3EA 2OQHA 2A0NA 5DCEA 3ZT5A 1Q5MA 3N9RA 3KRSA 4DPQA 1KV5A 1RALA 3T0DA 2CLIA 4DWSA 4BWLA 1V97A 4GHRA 4WUIA 1PJ9A 1EJSC 1QPNA 1UD5A 3KX6A 2VGIA 2WMIB 3PUOA 1OABA 3N73A 3DCPA 2QHAA 4WJEA 1TVNA 1B4EA 3QGKC 1I2OA 1ZDLA 1B1YA 2FJKA 4O53A 3IGHX 1VF8A 3BV7A 3LZ5A 4AU0A 1GKPA 3S2JA 2BHUA 3S1VA 1AQFA 4DF2A 4C65A 4CNNA 3W9ZA 3ABRA 1WCGA 3QW3A 3O6DA 1EJRC 2IW0A 3CUFA 3EX1A 2E7FA 2J75A 3TC6A 2BVYA 1J93A 1EHAA 1XYLA 5DXYA 1LF1A 5G5GB 2W63A 2VFDA 1UW9A 2YW3A 4S3KA 1IF2A 1TCDA 2PGWA 3C52A 3LSBA 1JCMP 4NASA 5I0DA 3AIWA 3ZS4A 4CD7A 1QNVA 3AALA 1XIHA 4C6CA 3NO3A 3SIMA 1EUAA 1Z32X 4KIRA 3EWZA 3FJLA 1S2AA 5M3WA 3EWBX 2WBKA 4B16A 3KBNA 3M0XA 1NWSA 2JIEA 2WCSA 3PPCA 4E6MA 3NVYB 3CGCA 2WCAA 3BGAA 4IPLA 4PL2A 4IUOA 3CZKA 3TOPA 7XIMA 2EXOA 4JTKA 1TPVA 2X7VA 2G4FA 4GJJA 2XZ7A 3VIGA 2Y5JA 4L64A 1ZKQA 4KWVA 3PC0A 3C0SA 4GJ1A 3I6EA 3AHYA 2ALDA 5H91A 1RD5A 4U3CA 4H2CA 3GXFA 4O11A 2VCAA 1L8PA 4AMAA 1MSSA 3EUB3 1UBPC 4KH2A 4IGMA 1W56A 2I5QA 2Z1SA 1DQWA 2C18A 3TC7A 2HDJA 4GXWA 3IIXA 3UVAA 2W3SA 3GLCA 1XGEA 1J11A 4J27A 3PBGA 3T44A 4IL2A 1R7AA 1WYIA 3IS4A 3IEBA 3VGEA 1RVGA 4TX6A 1B30A 1UZDA 1TE1A 3P93A 3PBUA 3A7RA 1OEPA 4ZR8A 1QI3A 1C93A 6PTDA 4Z08A 3W7JA 3M43A 4ERIA 2A85A 4F0LA 3QVQA 3E96A 3NQGA 3QC3A 4W85A 2OYLA 4Q4KA 3ARQA 5C9RA 2F7FA 1FY6A 3QC0A 4L1XA 4WDTA 2CHRA 4HK6A 4LGXA 2PWEA 1A3XA 1E9IA 1KM3A 2ZZ4A 4W93A 5EFDA 3KRZA 1UUOA 1U1HA 2OSXA 4I5UA 1LOQA 5XINA 4LYKA 1QO2A 3XIMA 3PZMA 1REQA 1V02A 4YIWA 1R47A 1HFBA 4N2YA 1J0IA 1UQYA 3NM3A 1UROA 4PMRA 3AU6A 3PJTA 3U4FA 3UG4A 2WPEA 4AXNA 1R87A 4GG9A 4IG2A 3ES7A 5FI8A 3GNNA 4V2XA 2IXVA 4EMJA 4ZXOA 1TVLA 3Q58A 3ERPA 4AWUA 3PWIA 4JZ5A 1FWIC 4UZUA 1A0CA 5DT7A 3BLFA 4HPJA 5FEZA 1UMYA 4NNBA 1LQ2A 1EOMA 4HYVA 5BOEA 4F9JA 3DK4A 1RY8A 3G3MA 1VIZA 3D46A 2ZWYA 5AHLA 1YPXA 2JGYA 4KKXA 2Y89A 5EBKA 2VX5A 3DFHA 3QF0A 1OCQA 4YMZA 4UTIA 4M3PA 3VOGA 3WX7A 1IEVA 2V5CA 1TMQA 1GVRA 1ICPA 1FWNA 1POJA 1HN1A 2V68A 4TTGA 3RCYA 1RP9A 4FXJA 4K68A 2XG9A 1YADA 4DBEA 1T96A 1H62A 3GWQA 4DWSC 4ZTYA 6ALDA 3RPTA 4D8ZA 2FIQA 4D6IA 1JYWA 4YL2A 3LV6A 1XUUA 4UMBA 1XIJA 4C6JA 5AVHA 1F74A 3I68A 3TR2A 2UY5A 3U48A 5CLTA 1OFAA 4S2CA 1NFGA 2DT0A 2QF7A 2ZX9A 4XVEA 2E5CA 2X0YA 1QBBA 3L2LA 3ABSA 3NQAA 3HURA 4N9EA 4GIAA 3W74A 3CWHA 3K1DA 3ZR6A 1KRBC 5I3FA 2QDGA 3GQYA 3W87A 2PDCA 1V0KA 4NJIA 1OIMA 2BHZA 2AQOA 3LB8A 3CT2A 3FHQA 3VABA 2E1DA 4MTVA 4AVFA 1IXNA 3IPWA 1W5NA 5MKGA 3W1LA 1J0JA 2WNQA 3MP5A 3ZZ1A 3QMRA 2HBXA 4C6NA 3MI2A 3IIPA 3DESA 3WH5A 3TKFA 3KL3A 3AIVA 1CLXA 4DM2A 4YXGA 1V3JA 5DMLA 2QJIA 1P0KA 1PVNA 4KEZA 3ZJ8A 3NIYA 4QITA 4CQAA 3TAKA 1TPUA 3EB3A 4CKQA 2I5GA 3LBOA 5D33A 3A4XA 3FX4A 4TXEA 3TSDA 2DSUA 1OWQA 1SW0A 2W4XA 4BS0A 2CWNA 5H8UA 2XUCA 3KBJA 3TH6A 4NF7A 5JBEA 1MNZA 2ZUMA 3EEZA 5CEWA 3FA3A 4CQDA 4A2RA 3I3EA 1KFCA 2AOSA 2FFIA 1IGSA 3M64A 3MV11 4UQ9A 2WZHA 2KX9A 2FQIA 1KBJA 3DGHA 5A2AA 4WJ8A 5LXEA 9CGTA 1B31A 2VZUA 3IJQA 2NQ9A 4XB3A 4AD0A 2XINA 1JCLA 1TB3A 1TJRA 5CPTA 4ROQA 1D9EA 4UR7A 4K37A 4TVYA 1S3HA 1Y5XA 3GM8A 4DJFD 3GTNA 2OEKA 3IVTA 1ZJAA 1XSJA 3LEPA 4RZBA 4P8VA 1TJ2A 2W91A 1D3GA 4F3HA 3KBMA 3LPGA 4UTLA 2FHBA 3KOYA 1J12A 1F3TA 5H6HA 3S1UA 3TTYA 4YVXA 2TPSA 4O18A 1I1WA 1K03A 5D2VA 4O1BA 2OU4A 2CLLA 4EMWA 1F6PA 3DHFA 2R9ZA 1ITCA 2X99A 3CUIA 4FLQA 3AC0A 2HVMA 3B8UA 3PBVA 4B5WA 4JHOA 5CPOA 1P0DA 2WBGA 4HTBA 1JZ7A 1DOSA 4PN2A 1YBQB 1E15A 2PDFA 3IAPA 3T2PA 1OJTA 1W1A1 4PCNA 4X0VA 1ISVA 3UGVA 1E3ZA 3TTQA 5KVIA 1GPFA 5C2CA 3V36A 2BVTA 3H4XA 2AL1A 2ZUSA 4XV0A 3CUZA 1W17A 5D9MA 3SM0A 2WM0A 1EPVA 2VO5A 3O0KA 2EQ7A 3SY5A 1H7OA 2FZNA 4GYJA 2OSWA 2Y88A 1ELSA 3NFUA 1IYXA 1S5WA 4YCPA 4UXDA 1A5BA 1VPXA 4I5RA 2BC0A 2QR6A 1MQQA 5PTDA 4K7YA 3SGGA 2GK1B 1JG9A 3TONA 1SZEA 1EDQA 4Q4OA 4LEQA 3N2XA 2EBNA 2V38A 1JRCA 3TYAA 2DEPA 3LNMA 2VHLA 4QDWA 4QDPA 3IAQA 4C6PA 1VH7A 1E4LA 3VIHA 2OQYA 3OVQA 2WWCA 1QR7A 1CGVA 3W1UA 4JEQA 1E0UA 4LPCA 2GQ8A 4L65A 4Q6XA 5AZ1A 1LG1A 4N0RA 1KCKA 3FHAA 4AD4A 1ZBKA 1JPHA 1Q65A 3MYOA 4G1NA 4M6QA 3M41A 2ZTKA 1UR9A 4ZE4A 1Q3NA 4RK8A 1EJWC 4FXRA 2I16A 3SCVA 2WLYA 5AFDA 8XIAA 4IFRA 3C0QA 3LX9A 1JCJA 2OX1A 1UWAA 1MWOA 3LPFA 3NCOA 3T7VA 3VIKA 4EK7A 2HE5A 3C8NA 3U3HA 1YE4A 1CYGA 1Z69A 5G1TA 3U8GA 2XIJA 1BXCA 4ADWA 4ZQMA 2OLSA 1MUWA 3RLUA 3CYVA 3IK4A 1XLGA 4LQ1A 1KLZA 1UKSA 1KLYA 3O06A 1Z8AA 4CQCA 5FOOA 1AUSL 1NOUA 2W0UA 2FPVA 3S3GA 3THCA 3OIHA 4Y8FA 2B7PA 1M6IA 1THFD 1OX4A 1UJPA 1SO4A 3N2CA 1WYGA 2VWTA 3FV9A 3GK0A 3RLHA 2NZLA 3EYPA 1GQNA 1PTAA 4MY8A 3BGGA 2C8NA 2WP5A 3ETRB 2YYTA 2NQZA 4NILA 1RPKA 4BHYA 2HK0A 3EOSA 3LRLA 1AJZA 3VFCA 4C6KA 2FTYA 2WVSA 2V5DA 2O9RA 1A47A 2A6LA 4GZJA 1UR3M 2ZZ6A 3N3TA 5HOSA 2Z4GA 3EWDA 1X8CA 1VBJA 4FNSA 4W9TA 1MQPA 3QLDA 3OG3A 3REQB 2FZMA 3CUJA 3Q65A 1FXPA 4UQDA 4A3YA 2YYUA 4I6VA 1OX4B 2GQ9A 1K9DA 1F4AA 3B0XA 3BPWA 3TFXA 4HYWA 3WLIA 4LBUA 3GZ3A 1UQZA 3WEOA 1CGUA 1KFLA 5IDIA 3ZLHA 3W7HA 2OMAA 5C54A 3GIYA 4DJDA 1HVQA 1BVWA 3LPOA 3CH9A 3TWAA 2HZGA 2BHYA 1E51A 1WZMA 3BZGA 4IICA 3WDPP 3TXZA 2P10A 3T55A 2UY3A 3GY1A 1EP1A 2OZTA 1T0OA 2VZTA 1HG3A 1XL9A 1OFEA 1C90A 1N61C 3H21A 4QQ3A 1M3UA 5U25A 4AHOA 3NEHA 1PZ2A 1ZP4A 4MOZA 1SSDA 2CDUA 3G8EA 1ZTVA 2CITA 5D9OA 2WBAA 2ABBA 1RR2A 5JRBA 4HNUA 3SRHA 3WF1A 4CNTA 4HZ8A 1AW5A 3RUBL 4C6BA 1GOWA 4HT3A 1UKQA 2ZRWA 3CQHA 4M7TA 4OGZA 1Q6GA 1TPB1 1OD0A 1G0CA 1AVAA 2XGZA 1POKA 4ZMGA 3QQ1A 3MO4A 3E38A 1ZBWA 5HJXA 4MWAB 3M47A 1WDRA 4LUSA 5KETA 3NS1B 4GK8A 3GFZA 3C8FA 3S4TA 2PLJA 4S3EA 4N6EA 3AXKA 3RCNA 3QGAC 4JTTA 2QCLA 3WNNA 3P2VA 3OIXA 2FZ9A 1DWGM 3W7NA 1GUVA 1OGBA 4MG4A 1W3IA 1LQAA 3PJWA 1CGTA 3OBKA 3R43A 3OVPA 4ADUA 3VE7A 1RQBA 3EPNA 4OUEA 2FH6A 2A7RA 3FA4A 3WLQA 1K8ZA 3W2KA 1R5YA 1LORA 4DM1A 1HF6A 1XISA 2ZQ0A 1XDIA 5FA5A 4AY7A 1EQPA 4EQXA 4CN1A 1U1JA 4OZOA 2YKKA 3PTMA 1SYTA 1PDZA 3ARWA 1OHLA 1Z7AA 1B54A 1ZQ5A 3TYZA 2ADAA 3TYBA 4B90A 3TNOA 5BYWA 4LB3A 3RILA 1HKMA 2CBIA 1JFHA 3KTSA 1FHDA 2WQDA 4MJ4A 6CGTA 3AISA 1FWHC 3NQVA 3H2CA 4QG9A 2XJ7A 3WNKA 2A1YA 2WVTA 3W85A 5CG0A 5CZTA 2BGNE 4BKNA 3EDDA 4AYGA 1HQTA 1W6TA 3GH4A 4O15A 1IR1A 1EJ7L 3OVGA 5A6JA 4GC3A 3WLLA 3ARZA 2FMNA 3K4DA 1BAGA 3L0KA 3UT0A 5HJLA 3A4JA 4LJ3A 4H8NA 1W1B1 3QPEA 4BZYA 1XYBA 3O2LA 3EMCA 4QE5A 4DLFA 2QPSA 2Z0IA 3GYCA 1TRDA 5DX7A 4G9PA 1FDZA 3K8LA 1EEXA 4FP1A 3UBPC 4HPGA 3A13A 4WGHA 2VKZG 4H4UA 3W6YA 2BXYA 2OXNA 3KWSA 3AS2A 2XSXA 1BSLA 1ZBCA 4FR1A 4A8NA 2Y0FA 2Z26A 1Y65A 1OC7A 5LIYX 3LM3A 4P7LA 1WOAA 1P6CA 5I3KA 1XRVA 1XDMA 2EKGA 2MNRA 3THUA 4UCFA 2VUYA 4HYRA 3BE7A 4GY7A 5BOFA 4TTUA 2IKJA 1S38A 2X2GA 1FRBA 4GQQA 3OEXA 4ML4A 2X05A 2PU1A 1ZP3A 3CZ8A 2CNCA 4GE8A 1H4PA 5I03A 3DDMA 1J6PA 5C7HA 4J7RA 3VC5A 4GINA 2GGEA 2BY3A 2E25A 3ALFA 2QIIA 3MP3A 2VEGA 4PE8A 5C8BB 3QHOA 1UWTA 1UR8A 4XX6A 4ZQNA 3APTA 2O9PA 1FCQA 1U2YA 1XLKA 4RL3A 4WDWA 2BFGA 3HGOA 5KMYA 3E12A 2QUVA 1D8CA 4D8AA 4NNCA 1WQ5A 4UZSA 4C6DA 4CQBA 2JBMA 1OG0A 2J9XA 5AHFA 2QAPA 4A2SA 2BVDA 2QUTA 1O5KA 2FZ8A 2WJEA 2PDQA 3EA2A 2V6AA 3HZ3A 4O0QA 4EM4A 5BRBA 3PHAA 1TWSA 3NQ6A 2GRTA 2IQ0A 4PFHA 3WEZA 3LI0A 3HF3A 2W3ZA 3FGCA 4J9JA 4HGXA 3EDFA 3UXLA 1UIPA 1Z42A 1FWCC 3D6NA 1A5MC 2P3ZA 3AQUA 4WKFA 4AIUA 4GYPC 1JQXA 4HNTA 1RK6A 4PBEA 4UFJA 3IJ6A 1FH7A 3VKBA 4PRWA 2HBVA 3C4UA 3TW9A 1DBTA 1H0GA 1HNYA 4Q8TA 2X7WA 2NV9A 3EGJA 1XHGA 4Z2HA 3W88A 1NWRA 3P6LA 2WW5A 3L4WA 5HULA 1MI3A 5C9WA 4F2BA 3VD4A 4HMEA 3S83A 4QM1A 3ZVHB 1DJQA 2FFCA 2PP3A 1IWAA 3G5EA 3WJSA 4Q8PA 3QPYA 4NJGA 4AEEA 2J8TA 3ZJKA 3ONBA 3ARRA 3VGFA 5IFTA 4M51A 4CVWA 4GXMA 1X1ZA 4ZFMA 1MW1A 3GC5A 3OB8A 1CDGA 4ZB0A 1J5SA 1QHOA 2ZRVA 3T08A 4FPSA 3W29A 3MQTA 1KGXA 2ASHA 4NG3A 3GFYA 2J7CA 4GZ7A 2RDUA 3L4YA 5BXRA 3R4IA 4QEEA 1KCXA 4JTIA 2WCGA 3UWEA 4OVXA 3WNLA 2NT1A 2XVNA 4Q7BA 4M6VA 3AIRA 4UTWA 1VBUA 2W67A 4ZFCA 4JPGA 1V79A 4GYKA 2CIPA 4H04A 3EF6A 3H4KA 3CZEA 3PAOA 2H6RA 3QW4B 4GNKB 4JX6A 4E8DA 1B57A 2DZTA 3OOQA 1L6FA 1HZYA 1RAKA 4CNSA 3ELFA 4MB5A 3MCMA 2IKHA 4BJHA 4UUIA 4JIHA 4ZB5A 4C1NA 1CIUA 1OYBA 2PB1A 3QN3A 4OU1A 4Z42C 4FHAA 4NZ4A 3BV4A 4BFAA 4DAFA 1JI2A 1OQFA 4GABA 1ESWA 4RZ5A 3DBPA 1LYXA 1LOSA 1DJIA 1YMYA 1QPRA 2BMBA 4Y90A 3W71A 1TYPA 5H8PA 2QZRA 4DO6A 4D1IA 3GU2A 1OF6A 3VD9A 2CLEA 5HR7A 1UP0A 2X8GA 4PC8A 2YVFA 1S3TC 4WY0F 1A50A 4NEVA 2A7PA 3L0NA 3NM1A 3CQKA 4W84A 1IZKA 4M56A 5D32A 1XQLA 1DTUA 4IP4A 3M0LA 4FALA 4GQBA 3WFLA 5AHIA 5EU9A 2PTDA 3WCZA 1YEYA 2XFYA 2VZVA 2I56A 3OC4A 1Y0EA 4AZCA 2F6KA 3V1PA 2FVLA 1PBGA 1ZK7A 4BF5A 3S1GA 1TJ0A 4IIEA 4H19A 1XIBA 3S2LA 3NVWB 4B15A 2DDXA 2DUAA 3LCIA 1TO3A 3ZSTA 1ZAJA 1QPQA 2YIHA 1ADSA 3IJ7A 2ZDSA 2BDQA 1PWLA 1WO2A 1HGYA 1XR2A 3VCCA 4LANA 2OB3A 1V3IA 3ZVIA 2D2GA 3SGZA 3DK9A 3M1ZA 5HUOA 3UD6A 1JUBA 5AKQA 3W26A 3T78A 1VGAA 3LCLA 1IQ8A 3W02A 1GREA 3M44A 2Y8UA 2E8ZA 4KEVA 4BEUA 1LRQA 4R53A 1ONEA 2EPNA 3IJIA 1PIIA 1BWCA 2NV1A 4YTUA 2VP8A 2ZX7A 3W70A 3EXTA 4WX2A 3G1VA 2J25A 3IVUA 1EL3A 3JRKA 1RUSA 4JHZA 1N8FA 3ARTA 3IUDA 1SFTA 2E9MA 4MNKA 3LTYA 3QFWA 2ZXAA 4OUIA 4XAGA 2QDHA 2WANA 2DT3A 2FDSA 2PWUA 2QPUA 3AIBA 2BNJA 1JOAA 3MVIA 1GJWA 3SR6B 1TA3A 2Y62A 3DHDA 4FF7A 4TX9A 3QXBA 3WQEA 2VQTA 2WSRA 4IPNB 5DEZA 4Q4MA 3S5SA 4O14A 2WO5A 3PBYA 4DIAA 3W7OA 4FOKA 3UR8A 4GGBA 3IGSA 3H24A 3SI9A 3NQCA 3PJUA 2AAMA 9XIMA 3MKCA 2A3CA 2XH4A 4QLJA 4U10A 3V5CA 4FSAA 1O68A 1UZ1A 4H9TA 3W1RA 3DGZA 3NAVA 3QMSA 1YDOA 2WC7A 1UPMB 3NWRA 3QFEA 3M0IA 2R1PA 2EPHA 4GI8A 2XFFA 3S1XA 4X9YA 5E1QA 3WLTA 4KFOA 3QHNA 5J04A 5IXEA 3WK3A 1VFUA 3ITTA 4QEHA 4K7ZA 1K7XA 3UA3A 3MV01 2A5HA 3RO6A 3M7SA 2OVLA 3RAOA 3TUUA 4K6AA 2YVGA 4J3VA 2XWDA 1O5XA 3BMVA 5GJPA 4AMCA 5I3JA 3KCOA 2Q8ZA 3OPSA 2E77A 4ZBCA 3ES8A 3GR7A 2WSYA 2F5ZA 3CMGA 4Z1DA 3KOFA 1FA2A 2J24A 3SDOA 4QHRA 4DXVA 4KIEA 4CEUC 1M7JA 5A6BD 4NKCA 2IQTA 3UFYA 1Q6EA 3M0KA 3C2FA 1H09A 1XD0A 3WMLA 4E2DA 3H2MA 2QULA 1OFDA 4IQJA 1NTHA 1P0EA 1KFEA 1EJVC 3BJFA 3AJ7A 1UWSA 5IFPA 5A6AA 4ZQRA 1TELA 1FFUC 1DQUA 2WP6A 3EWUA 2X1RA 1TUFA 4DWSD 2JALA 3NPVA 2F2HA 2C1GA 2Y63A 1WV2A 3TQKA 2DSKA 2ZBTA 4HU8A 1SJDA 4MUPA 5FS6A 4JYDA 4Q4PA 3LRMA 1IT8A 4L4MA 3UGRA 4AC1X 2VCBA 3VD5A 1A5OC 2PWDA 1TR9A 1CNVA 1W3HA 1W1VA 1PZ0A 2EJAA 3PS7A 4W88A 1SZFA 1HP4A 4JIEA 2QGHA 3RLGA 2PC4A 5U7SA 3O16A 4NL1A 3H55A 3ZXWA 2WC3A 1MZHA 1F3EA 4N9DA 3V1HA 3CEPA 4M52A 4A3UA 3UY7A 1GVOA 4I5XA 4C7DA 4PTDA 5KZEA 3CLWA 1JIBA 4IMGA 4S3AA 3DN5A 3CO8A 1C9WA 1US0A 5DRIA 3RU6A 1JXJA 1G7UA 2UWFA 1CECA 5AHMA 3FN9A 3W6MA 3LZ3A 1DL3A 1ALDA 1S2TA 2HPIA 3DGRA 3HGRA 1X2GA 2QCHA 2PLCA 5A5WA 3TROA 2BP1A 2A79A 4AX6A 2E67A 1E72M 3DENA 4RXFA 5CG7A 1NDWA 1W37A 1I6NA 3IACA 1A53A 1MEIA 2DGAA 1XG3A 2X42A 1KBLA 4PTXA 3P5YA 4QE4A 1HJXA 2Z6JA 4OIFA 4XO6A 1R3QA 3LXAA 2B31A 5DFAA 3WQPA 1ADDA 4TVCA 3EAOA 1NWTA 4GFIA 3HG5A 3T42A 1H6VA 4LYRA 3NURA 1JROA 3N11A 1EIXA 5K9XA 2RAGA 2OCZA 4J3SA 3OZMA 3FCPA 3RGTA 4Q8MA 2RUSA 3WDQA 4RLIA 1CLVA 2SFPA 1E0XA 3C6CA 3ZJ7A 2Z24A 3DFOA 1UUQA 3PSVA 3W7LA 3MI6A 1PS9A 3WFAA 1ADOA 3OQEA 2G50A 3G3DA 1Q6QA 3MSDA 3TA6A 2ZZ5A 1VC4A 1Q6CA 3W2LA 5A95A 1IXQA 3IIOA 2YAUA 4IGNA 3N19B 3M07A 5KZMA 2DZWA 4POCA 3N14A 1N8IA 2WPGA 3NQBA 2H9AB 2I7GA 2HQAA 3KCJA 4MWAE 1FWAC 4QG6A 3QHMA 2INZA 2OTDA 2QKFA 4B9YA 2Q8XA 2PDJA 2HS8A 9XIAA 1ME8A 2GUYA 4B9ZA 1FH9A 2CKSA 1CGXA 3S5ZA 3W73A 3AROA 1OADA 1H41A 4F48A 5BU6A 1YDYA 1JGMA 1LQ0A 2FTPA 4D8LA 5M03A 4O12A 4DO4A 4FDCB 3LN3A 1QHPA 4AXKA 4DNHA 1XLAA 4HN4A 2WOQA 4RR4A 1U1UA 3P0XA 3NZ1A 3NGJA 3URBA 3GIPA 4DZIA 3O3RA 2QYGA 2H9AA 4MPQA 1KKRA 5EMKA 1SZNA 3UXKA 5HMEA 4L61A 4GXPA 4Y96A 1IT7A 3NQDA 3GVGA 4AD2A 1RZMA 4C90A 5DY2A 1EXPA 3S6DA 5HXMA 1RJPA 1MRQA 3FJ4A 1FVPA 1GQJA 3BANA 1ZGDA 3BGJA 3QFAA 3ZT6A 4FOUA 3NZQA 2RJHA 2WM1A 1NQKA 5AZ0A 2QPXA 1JYNA 2YPIA 3TN5A 4WOZA 4L9XA 1A3HA 2YA0A 2OT0A 3CUHA 2HS6A 4NRSA 5I77A 1YHTA 1XUZA 4HA0A 3W81A 1VLIA 3TTEA 1E1CB 1GQLA 1V3HA 2NWSA 1MFVA 3V0TA 1ZMCA 4YLWA 5TBOA 3J7HA 5LIUX 3T4WA 5KEZA 3LTSA 1AH3A 2XM1A 4XSLA 3REQA 1QPOA 2J62A 3AHXA 1GYNA 5A8NA 5KITA 1UJQA 1VPQA 4RZ4A 1GOQA 4MJZA 1BGGA 3L4ZA 3VUSA 4JTUA 1YXCA 2BXVA 5C55A 2F38A 2PBOA 2XHYA 1OX6A 3CHVA 2VFIA 1JPDX 1X2HA 3EMZA 2X09A 4IMAA 2C7FA 1K4HA 2G3NA 3L66A 3QTPA 2WMGA 5T9CE 5AC5A 1AZ2A 1W5MA 5CZKA 3C2OA 3E0IA 1G4EA 4H4RA 3SRDA 2FKPA 2HEJA 3UESA 4L1WA 4H8UA 4RNIA 3R12A 3AXMA 4GC4A 2DT1A 1CZ1A 4AUBA 1AW1A 4Q22A 5JCMA 4JDRA 2C1HA 3R0KA 3EPOA 3W2JA 1XRFA 4HNLA 1UR1A 5CSYA 3G1AA 3UCDA 3EB2A 3WD0A 1W3TA 1YX1A 4MHBA 5FEPA 2G3IA 4HHMA 5C70A 4ML9A 3VA8A 1C8YA 4UOQA 4WGXA 3VOFA 3GUWA 4QS5A 3FG2P 4KPRA 1A5LC 1JYXA 4O50A 1PIFA 3UPBA 4DB7A 5A8QA 4ZCWA 4EQRA 3F03K 4MWAA 1VZWA 1B4KA 2DH3A 3EX6A 4GYPA 2EEXA 4YVPA 5CPNA 3CGDA 4F2TA 3CGEA 2AAAA 3GB6A 4HCLA 4C1NB 3RXZA 2ZZ7A 4RJEA 4CNOA 2B81A 4Z1BA 4DYKA 3H2OA 2VVSA 2ZA3A 1DYSA 4NYUA 1R6WA 4AVOA 1YDVA 3G1DA 1UR2A 1HJVA 4X60A 3PFRA 3LU2A 3MMUA 4ICCX 3RDKA 4UC5A 1TG7A 3QYSA 1CEOA 1L2QA 3BARA 5IM51 2B0MA 2FPTA 2HVOA 4HU4A 3UZZA 1UWQA 4A6GA 3VM5A 4OHQA 3LCFA 3P74A 3KOWA 1A49A 3G0XA 4U3AA 1ZUAX 3DAQA 1LL6A 1DPMA 4CVUA 4IXXA 2WZIA 4LXFA 3W3OA 1Q2SA 5HWNA 4JTGA 3KTCA 2BSLA 2VENA 2TMDA 1F4HA 3AHVA 3NSMA 5I23A 4IIFA 1F6KA 2VGBA 1BF6A 1F73A 3LENA 4S2BA 3HN3A 4B2DD 2P76A 1KM5A 4U5KA 3LGEA 2Z25A 4JTSA 2V81A 2V63A 2WMIA 5K4XA 2HNEA 4KWSA 3II1A 1ZAHA 3FW6A 4O8RA 1DXIA 2ZWZA 3BJSA 2V3DA 2ICSA 3CAKA 3L4UA 2C0HA 3NJ3A 1KRCC 3ANYA 3BAYA 1PX3A 4ZOEA 4JDYA 4LCQA 3VIPA 1SW3A 3IUIA 3N25A 3HU7A 3DI1A 2PSNA 3VD7A 2JKEA 1E40A 3ARSA 5CC5A 1AJ0A 4XZMX 1FWWA 4M29A 1OZMA 4ZZ9A 1TWWA 3TXVA 3AN1A 4C6IA 3E2QA 3F5LA 3FSUA 2QEZA 4B4FA 1G1YA 1H2IA 4RDYA 4ZODA 4ADTA 3THQA 5LGZA 2EHHA 1R2SA 3FGCB 2VMFA 1NHPA 4MZYA 3O7UA 3DG6A 1H60A 3MUXA 1I2RA 4EM3A 4S3CA 4LS1A 1KBKA 2JF7A 3TYUA 5EMJA 2YLLA 2XFWA 2FGLA 3CNYA 5G1MA 2CZFA 2NUYA 1W9DM 4HMDA 3I7SA 3ITXA 1Q6LA 1QUMA 2OYMA 4KFPA 1XFCA 2ZX5A 4XBJA 3U57A 4YU1A 1X7FA 3DHUA 3KXQA 3W23A 3MC5A 1NP0A 1OIFA 5U4NA 3OLEA 5LIWX 2YL6A 4WD0A 5DCDA 2PZ0A 4H9UA 2W66A 2PGEA 4WIWA 5CPLA 3TR9A 4JFUA 2RGLA 2V0TA 3LXBA 2FHFA 4LRSA 4ECLA 1EF3A 1UOZA 1C8QA 2Y7FA 3TCSA 4U4MA 4LY4A 3N2BA 1VS1A 1XM3A 1L0PA 4P7NA 4NHVA 4OBTA 1ZBVA 4WEVX 4PMJA 5LSMA 4G7FA 1EC7A 1KNWA 1VPYA 4JQ2A 4W7UA 2QVHA 4EKJA 1XYFA 3H2FA 2Q8LA 3IJ9A 4F2UA 1OZQA 4AIBA 4MNJA 4BQ4A 1NFBA 1C9DA 1PHQA 2ACRA 4YWSA 4UFHA 1W8SA 3PZUA 3OYZA 2BX7A 3F4DA 3PY2A 4IUGA 1XWYA 4UQBA 1IIHA 4MNMA 4ONVA 4AB4A 2CZEA 4ERAA 4JBRA 2YBUA 4ILSA 3S2MA 4Z2KA 1Q6OA 4LCRA 2ZRUA 4JTFA 5LA0A 1PKYA 1KGUA 4O4WA 5G4WA 3VKAA 1JCYA 2P50A 2VT0A 3BAXA 3HA1A 1KCZA 5CGMA 3IV8A 5I6SA 3VNKA 4Q8VA 5LGXA 1XBXA 3T2OA 3CV6A 3QEZA 2DUXA 1UC5A 5I3HA 3SZ8A 4N9BA 3WD3A 2PURA 1TYTA 2KZHA 5D04C 1PCKA 3UG8A 3DFYA 1PSCA 2YCJA 3AAMA 4GI4A 4J2PA 4NY2A 1Q7MA 3IARA 4E4UA 5FS9A 3OP2A 4AWSA 1YYAA 5I5RA 1R46A 4KQNA 1KN0A 5A2CA 2QW5A 4QAWA 2OWCA 3MCNA 4ZA0A 4HMCA 3HMCA 2RFGA 5AHEA 4AF0B 4MIMA 1ZMDA 3G6MA 4GVIA 1Q63A 2E8YA 4FLRA 1K9EA 1GVYA 4ADSA 4ATLA 2Y4SA 1X97A 2J66A 3D47A 4RCXA 3ZFHA 1QBAA 3SCWA 3WELA 2Q71A 2FPYA 4M1BA 3RRXA 1Q7ZA 3NZPA 3VE9A 3GDBA 4I6KA 3WNOA 1LL7A 3WBYA 3E2RA 3FAWA 4TVUA 5ABFB 1KKOA 3KRUA 1BYCA 3CB3A 2GDUA 4M8UA 4PRTA 5I3IA 2GOUA 3CM4A 1FDJA 4LCSA 3ITVA 2Z6IA 4HKPA 1RBOB 1XJBA 4R7WA 1PCWA 2QCDA 1OCJA 3U6WA 2EPLX 1JULA 4G8TA 4LIIA 3A22A 3MANA 1M7PA 1GK8A 1Z89A 2R82A 4UTMA 3W1PA 3ZIZA 4PCTA 2ZZBA 3RJYA 2QMJA 3FKKA 1WXJA 2ANUA 1M04A 4G6CA 3KOXA 2ZVRA 2R91A 4F8XA 3EDKA 4QJ3B 3TDFA 2R1KA 5CJMA 1BVZA 3MCOA 1Q8JA 1VR6A 4AIEA 3OA3A 3C2EA 1XKYA 4JL1A 4A8LA 3BDKA 1LOLA 3M16A 4UFLA 1DXLA 4DBWA 1JDEA 5HMFA 3CLMA 3K5XA 5IDZA 3RITA 4WXZA 3AZTA 5JXQA 4PODA 4WLCA 3WL1A 3R8GA 4CQ9A 4WSKA 4E2OA 3CMJA 4DX3A 1LBFA 3F5KA 4E0CA 2NQJA 3W2MA 2PS2A 2PRMA 3P60A 4JKKA 3QY8A 1OY0A 5EY5A 3W37A 4AH7A 3W28A 2D2JA 3CEUA 3P8IA 3GXPA 3WYZA 3TN6A 4K8DA 2B7NA 5AY7A 1M1BA 2OYKA 1XICA 1XLJA 1V6VA 2PE4A 4RZ6A 2CFYA 1G6CA 5GVJA 2FLIA 1OFBA 1V03A 4QFUA 3EXRA 2WVVA 3LHVA 3XINA 4H4VA 3PSWA 1US2A 4D9PA 2YZ5A 4S3GA 1TCMA 3V5FA 1DJYA 4MWAD 3H53A 1J0YA 1XCFA 1JZ3A 3HQOA 4TUFA 3B0PA 1Y5VA 2Q09A 1GTEA 3COTA 4ZO6A 5REQB 2XVKA 2CEQA 2BC1A 2GJNA 3UZYA 4H01A 2NX1A 3HG3A 3GD6A 4AZ6A 3P67A 3LMYA 1KQYA 5JBDA 4IJCA 1EUNA 4R33A 2WOWA 4UNLA 2W55A 4TV6A 1FH8A 2PPGA 1G7VA 3GNDA 4DI8A 2QJJA 5D4YA 3VX1A 3V18A 2Z1WA 1XD1A 4FEZA 4M80A 3VNLA 1FWTA 1EGZA 4DF0A 3PWGA 2PRLA 4KRUA 3KOZA 4MUZA 3OZPA 1TYGA 3OODA 3OLGA 1QOXA 4KT2A 3TSMA 3H8AA 1GORA 3BSHA 4L5ZA 3VGBA 1HL2A 4FB7A 3E3HA 1H63A 1F07A 2W79A 2FZDA 1F8IA 3WLKX 4L4PA 3CBWA 2VNCA 2A8XA 4UNKA 3VMOA 3VYLA 1TIWA 3OGRA 1AK5A 3R5EA 3O6CA 2TYSA 5ABFA 2GFTA 3HIJA 4H4YA 1TQJA 2WLZA 4UB9A 2CXEA 2AMXA 2ZIDA 3T9PA 2QCGA 1E0TA 4J28A 3AS3A 1UA3A 2Y5SA 4W7WA 1S2WA 5BMXA 3JR2A 1J9YA 3KZSA 2VUNA 3ISIX 3WDRA 4QDMA 3GBEA 3WKZA 4KGLA 4IHCA 4RXGA 1GGOA 1IE7C 2BY1A 4Y6GA 2FTWA 1TPFA 1DEDA 4XTIA 1V6WA 3GAKA 1OM0A 2OEMA 3GBDA 1V02E 4JIQA 1L8NA 2YCLA 3R1ZA 1BG9A 1E73M 3UJSA 1M68A 2QXWA 5BW6A 1WUFA 1T41A 4GX8A 3W25A 1WP6A 1XSKA 3O1NA 3WY1A 3IUHA 4IFOA 2D0FA 1FWRA 2PTWA 4LBSA 5LIXX 1IWPA 1F8WA 3PZVA 3TSBA 1EO7A 1R3WA 3NVVB 3VDBA 1F5ZA 1XXXA 2OG9A 4FX6M 2RGMA 2E9BA 3BAIA 1GXFA 2FDMA 1I75A 2P3EA 3VX0A 4MLRA 3N6QA 4WJXA 4JTJA 2VGFA 1AQMA 3ITOA 4WOQA 4H6KA 3G1XA 4PBGA 1ITXA 1JRBA 3RX4A 1AMYA 3DIPA 1LUCB 1YRRA 1XI3A 4AD5A 4JX4A 5EGRA 4MPKA 4HP5A 4DRSA 4R85A 1RLCL 4H8VA 1W5PA 2QCEA 2I17A 2ZUUA 3E6EA 4DJDC 3TJXA 4WDUA 1GONA 1YE6A 4G7EA 1UH2A 1ITUA 4FNQA 4W8LA 4RNFA 2YDRA 5M5DA 3M6YA 3B4UA 4D6HA 3TP4A 3OBAA 1FFVC 3D3AA 3DC0A 4XK2A 2EQ9A 2OSYA 1J8VA 1AH0A 1HKVA 2PCEA 3CIVA 1XW8A 2QJMA 3VTRA 3GW3A 1XIFA 2P8CA 1KTCA 1AW2A 1WBHA 4KW2A 4R3UA 4X63A 4B5UA 4NUWA 4U2YA 5E70A 3JS3A 5FL1A 5HQEA 4CU8A 1DWHM 4DVOA 5BU9A 2OZ0A 5AC6A 5ECUA 2PGRA 3UWWA 1BLIA 3CGTA 4US5D 4UTTA 3DKLA 2D3LA 4R27A 1K9FA 4EAMA 3N12A 2IMRA 4LRTA 2E68A 2WVUA 2QV5A 2WKLA 4V33A 4GKTA 1RLDA 4WRHA 4FX9A 4FIRA 1Q6FA 1MFUA 1TV7A 3OLDA 3TIMA 1KR0A 2PWFA 4A4AA 3H7UA 4NZ1A 1MXSA 5ABTA 1TA3B 1GZGA 3BK0A 4HZ6A 3ZWSA 4GVHA 1XLMA 2PBGA 1JYVA 3MP4A 1Z3NA 4GI9A 4MKVA 1HTIA 2QDDA 2QF8A 3CIWA 4X22A 2QNEA 3H7VA 2NXIA 1JZ2A 2JFEX 4A05A 3LA4A 6REQB 3SRKA 3ARXA 1EA0A 2VWSA 5HQMA 1LT7A 3W1AA 1GHSA 5BXSA 4BI6A 5HATA 3P8JA 1HJQA 3WDIA 3CHFA 1UMLA 5DRCA 2XPKA 1XBYA 2ZC1A 3WQ4A 1GT8A 5IBXC 1QPKA 3DXIA 1XV8A 3UYIA 3QR1A 4DYEA 1E6PA 2JKAA 4JNYA 5AYBA 5CSRA 4A35A 4C6EA 2Y7EA 4JGDA 1MZRA 1BWLA 4PYSA 4LF1A 8A3HA 4A22A 3N18A 3JUGA 4LF2A 3E0WA 4JICA 2BBFA 3M0MA 3UJRA 1DWAM 4Q8OA 3KP1A 3WBXA 4DJFA 4DXXA 3IVSA 2O56A 3M0VA 1PWMA 4E2BA 1EYWA 1W3KA 2NW0A 3BAJA 4LBRA 1XKJA 3H7RA 2VFFA 1Z6KA 2IKGA 3N2OA 1H2JA 2IKIA 4J1OA 1HXJA 4ACYA 2FZBA 3VOIA 4XWUA 3CAVA 1NPXA 4AZBA 1EX5A 2E6YA 2VEIA 5C9XA 2V3EA 1XIIA 4MMWA 1PDYA 1E1CA 4IMFA 3T0BA 2PD9A 4EIVA 1T8QA 4XO7A 3T0CA 3AU2A 1GJUA 5EMMA 3IGXA 1OSEA 3PB2A 5FD0A 3VKDA 3M0YA 3AMCA 5FF0A 2GVLA 1JD7A 4IP5A 2OQLA 3FXYA 4Q33A 5AB3A 1TV8A 4ROPA 3ZVHA 4DJEA 1BVNP 4LAKA 1OD8A 3SQLA 3JZUA 4DBSA 3S9IA 2RDWA 3SCPA 1H61A 2GR2A 4Q8UA 1JDDA 1MQRA 5BROA 2ZXQA 3H70A 1PYMA 2UBPC 3U7VA 2CERA 4LUTB 1QWKA 1ODUA 2Q6ZA 5E6ZA 4DLMA 2EPKX 5DBUA 2YXOA 3TZNA 3TN3A 4XD6A 1IEXA 1CT5A 4WZHA 5DELA 4XG1A 5T9BG 3CHEA 3F1QA 1MEHA 3FEMA 1X98A 5D37A 3WQVA 2O4QA 5A6SA 1KTBA 4GZEA 2OFJA 3TW7A 1NARA 5AYYA 3QPZA 3UR7A 5DF0A 3ZT7A 3SCQA 4H7CA 4N9CA 2F6UA 2WKJA 4RX0A 4YS1A 1BSIA 1HJUA 5E0FA 2CFFA 1KFKA 3BURA 3PF3A 1XFBA 1GTHA 4NX0A 2WJDA 3F4NA 3PM6A 3OVRA 4RV8A 4L4LA 1R30A 3MY9A 1W9VA 4S3DA 3WLHA 1R9XA 2V5KA 1TV3A 1V3LA 5TAOA 3QZ6A 4LAOA 1BQGA 5A2BA 1QK2A 2GLKA 4HOXA 4LNCA 3SCRA 4WSHA 1N55A 4XBKA 1XBVA 3PTKA 4D6FA 3EKLA 5M17A 1BYBA 1CGYA 1V51A 2HROA 2XVPA 1BRLB 2CZDA 3QOKA 2J13A 5L6UA 2CLFA 4K1GA 4IQLA 3RX2A 1VFFA 1E6ZA 3PBWA 4U33A 2ZUVA 4Y9AA 3CB8A 3BUVA 5LNVA 1FCBA 4RDZA 4E8GA 3SUVA 3WDJA 2YL8A 1B3VA 5FAGA 1M9HA 1CXLA 3FYOA 4C7GA 1YPIA 5DMNA 1E4MM 3VOCA 3SN0A 4C1KA 2ISSA 2JKPA 1RVKA 1G4SA 1EYEA 4CUCA 2O55A 4H4XA 4MLJA 3JU2A 4CN6A 5JCLA 1RCXB 3PULA 3Q6JA 3WLSA 4FXFA 1YKWA 3WMCA 1PO9A 1KBBA 3STFA 1SM9A 4DWDA 1R86A 3A3HA 3LCHA 4EACA 4BWLC 2Y2WA 2VQUA 1TPDA 4QQUA 4M82A 4F0SA 3KZPA 4JNZA 2V3GA 4EE9A 4YCOA 3KBVA 3WJZA 4UQAA 3OGVA 1I2PA 1W3JA 3QY7A 3DYPA 4KWOA 2R24A 4J3WA 2RABA 2YA1A 1KA9F 3NSNA 3R07C 4IIBA 4A3HA 1OX5A 2J7DA 1TJ1A 3MWCA 2VD8A 3B40A 2CLOA 2PDHA 1RQHA 2DVUA 1TUXA 3T8LA 4H9MA 3WQCA 1CB2A 3GNRA 4F40A 1IHIA 4FZIA 1DXFA 2INEA 3GTHA 1X1OA 2QCDB 2BCPA 1E3XA 1GQKA 4D1JA 4ERGA 1GG0A 1XS2A 2DSZA 4XD5A 5CAHA 5H1WA 2EJ1A 3UETA 3N04A 4H4PA 1TFVA 1QJWA 1BXBA 4ZB2A 1N5XA 2X1UA 4J57A 1VB9A 2PEVA 1KXVA 3L4XA 4N4PA 2VXNA 4MDPA 3EA1A 4CD4A 3N4AA 3W83A 2QIWA 3LS9A 5CPSA 1DP0A 3UG5A 1ZENA 5HBFA 4W8BA 5ER0A 3BJTA 2VEMA 4QRNA 5HR6A 3GS6A 2W54A 3H4GA 4PMYA 4GD0A 3HGSA 4G2DA 1R9YA 3ARYA 3UR2A 1WZAA 2G97A 2X8RA 3G77A 4B91A 4MYAA 3EOUA 3VZZA 3EWWA 2C1IA 1VBHA 1V0NA 2ZUWA 3AMDA 2ONEA 2PZNA 4MY1A 4PULA 5C2XA 5EPDA 1N5WC 3CQ0A 2VR2A 5G1YA 1GQIA 3UWUA 5HMSA 1LTDA 1EC8A 2C13A 1I0DA 1VDVA 4GUJA 2WPCA 2V67A 3PNUA 2Q02A 3FLUA 3FY1A 3UZXA 1K77A 5C7VA 3BMWA 4HU3A 3H23A 3MU7A 6TIMA 2YFOA 1N63C 4Q4RA 3A47A 3EEGA 3GVVA 4Q4QA 4Q8WA 5F4XA 3PJXA 3DHPA 3USBA 4I8DA 3Q67A 3TV8A 2DFAA 4F0HA 2ZA2A 4IX0A 5FAJA 4PEEA 5ECVA 4UIOA 3UA4A 4NU7A 5E09A 2WHLA 1DIOA 1EGVA 2WMHA 1I8JA 1FQ0A 6TAAA 1P0BA 4O1DA 1JUEA 1YDNA 4DY1A 1BEUA 3UG3A 1GWJA 1RCQA 1R3YA 2GJPA 2ZKMX 4Z0SA 4PUJA 1PAMA 4XIMA 3H54A 4PCPA 3H6OA 4IG2B 3GHSA 5HMDA 3IRDA 3CU2A 2EF9A 1XRSA 3HJZA 1FWJC 1R3SA 3LHWA 1YNPA 4IOTA 3WLPA 4B5SA 1UKOA 4ACZB 4BI7A 2E1WA 2J4GA 3Q45A 3DG7A 4OV9A 5LNSA 4PCFA 2FJUB 4PGLA 4H83A 1SVDA 1WAWA 3B06A 4BF9A 3BC9A 4GUHA 1Z44A 1H7RA 2HPMA 4ZXLA 4HPHA 1R3VA 3QH2A 2CLKA 4LAMA 3KLJA 4IWWA 1XINA 3CAQA 5FCZA 1CCWB 3A23A 2H8XA 3GG8A 1SJBA 4PBFA 1SW7A 1U33A 4MADA 1FWEC 4GCAA 4CCZA 4UQCA 3LRKA 4ORIA 3SURA 3UPMA 4KGJA 2G37A 1O95A 2D73A 3S2CA 3HMJG 3AYSA 1TKKA 3CPRA 4N02A 4OTKA 3MMWA 3BZJA 1XH2A 1UPPA 3MW7A 4PUDA 5U1OA 3SIZA 3WH6A 1CWYA 3R8RA 3OZYA 3QR3A 1BGAA 4UR8A 1AOGA 3SFKA 1T40A 1ONXA 5AYIA 1S46A 5EFFA 4S3BA 3A12A 3BL3A 1V93A 4Q8NA 3EDJA 2EG7A 5CC6A 3CAWA 2NVAA 3W2NA 1Q1WA 4YYCA 4K38A 1R8LA 1X39A 3I3BA 3W1NA 2WPFA 1P1MA 1GNXA 2YA2A 1WNOA 3IWPA 1OBAA 1UA7A 2YCIX 3KE0A 1N60C 4NVTA 1DWFM 1KXHA 3S6TA 4ZQCA 4GUGA 1VFTA 3BCJA 1NEYA 3LOTA 1CW2A 4AW7A 4CLMA 4URIA 2VI0A 1F3WA 2JIWA 2FH8A 1E6QM 2OLHA 1IGWA 2DV0A 2DZVA 1MVYA 4AY8A 5T91A 3DGBA 1NIUA 3NEVA 1HP5A 1WKDA 3OJGA 2B4GA 2BLEA 3WF4A 3AFBA 3PUDA 4PUEA 4JHMA 4GBDA 3ZQ9A 4PMZA 3MJMA 4XBSA 4V15A 2Z27A 1J0ZA 3WLJA 3NSXA 2ZXDA 4V1YA 2CBJA 2PMQA 2OELA 3H26A 3WD4A 3IJLA 3B8TA 4ZVJA 1XIMA 2R9RA 2J3NA 4PMOA 4XZHA 4DELA 3FDGA 1JNEA 1NDVA 2DW6A 3RNDA 3TOYA 5K7JA 3UNTA 1XRTA 3L8KA 2I14A 5I79A 4WDXA 4QE1A 2WB5A 1X1NA 4TOQA 1W31A 2W0HA 3QV9A 5FESA 4BURA 4IMDA 3C56A 4GIYA 4FX8A 3GU9A 4CNPA 1IIGA 2D0GA 2OWWA 2A6NA 1O7AA 1WDWA 1AD4A 1F6YA 5TNVA 2C71A 5FSDC 3Q4DA 4DWSB 1SGJA 4OECA 5CBBA 3K46A 4K8EA 4U31A 2YCEA 1CB7B 2R6OA 3UZ5A 3WUBA 2CYGA 4ICNA 4GISA 5ABEA 1XDLA 4PB4A 1E9YB 2GSHA 4DQWA 2J6VA 2GH5A 3F5JA 2XYLA 3LHYA 4J5NA 3O8AA 1LG2A 1UHVA 3GE7A 5BXPA 1GVFA 3DFTA 4P8UA 2XVLA 1BTMA 3GDMA 1QT1A 4M6UA 2Y7GA 4NZ5A 1UKTA 3SCTA 3SN1A 2XH7A 1CXHA 4HJFA 4IISA 4EX4A 3IJ8A 3LD5A 3GKAA 1OG6A 4HCDA 1V3MA 2MUCA 4PTNA 3CYJA 3BWWA 2VYOA 1QW7A 3WBAA 3KCLA 1CENA 5I78A 4HVXA 1PTGA 3V0UA 3VCNA 3VCRA 2ZTJA 2Z7KA 3STPA 3DJGX 5F2MA 2RH9A 1YNYA 1BKHA 5KSWA 2VRJA 4NP7A 1EBGA 4UTFA 4YVVA 4UTWC 3VXGA 3SCOA 3M5ZA 4M19A 3CL7A 1ICSA 3KVJA 4OWGA 5FEXA 4GUIA 3L2IA 1TTIA 1K8XA 1VEOA 3GU1A 3AHTA 4H4ZA 2ZX6A 3W53A 3W4RA 1DWJM 5FIPA 2YQUA 4NZCA 2D20A 3BG5A 4X2RA 4XUGA 2CPUA 2YDQA 1RK5A 1XC4A 3S9ZA 4D6EA 5CC7A 3AZSA 1UP2A 2WSKA 3DYMA 2PDBA 4NX5A 5E0KA 3UU0A 1NVMA 1J4EA 4XZBA 2AGTA 5JH2A 3GD3A 3SUSA 4EQSA 3CV1A 3EKZA 3PZQA 1UH4A 5FL0A 2BODX 3ITLA 3W7EA 4W5ZA 1B3WA 3VC6A 5A1AA 1BXNA 2PCQA 3M5VA 2ZA1A 4AFYA 2GR1A 4TMBA 2IPJA 3AUJA 4HCHA 3VILA 4AWTA 4P61A 1AD1A 4KPLA 3TLQA 3BMXA 1Q7QA 3UJEA 2VX7A 3MUY1 1D3CA 3R79A 4UNIA 4AISA 1AA1B 1HKWA 5F1UA 4Z2LA 3SW6A 4IGSA 5CLWA 2X0HA 1X6NA 4XAPA 3SCUA 1A0EA 4GWEA 1YTDA 4NZFA 1W1IE 4O57A 4MFEA 1U30A 4HA1A 1BHGA 1K1DA 2E5BA 3DH7A 3EZ4A 2OR2A 4JEJA 4RW5A 2HMCA 4GPNA 1DJXA 2R1MA 1JEZA 1J10A 3MHUA 1GSNA 5D8WA 2POTA 4DEFA 1EPXA 4WVXA 5CJNA 4H9VA 4I8YA 1P0NA 3OU8A 4C5YA 4WF7A 1JFXA 3S9YA 2DZSA 1H7PA 1UWIA 3B9JB 3MA8A 1XYAA 4Z2IA 4AYSA 3T81A 1FWGC 1SO3A 4R5EA 3MSGA 3BOLA 3A3XA 3PK7A 5AC8A 3LY0A 2LLEA 2NSOA 4Q3MA 5JUVA 1ZJIA 5FJUA 1J5TA 4LS2A 3V75A 4O0ZA 5D9PA 4KS0A 1EP2A 2GJLA 5GPRA 5KVHA 1TV2A 1KGWA 2UV8G 3MSRA 4LAZA 2CCRA 1J0KA 2R1LA 3ZLGA 3QGVA 3H22A 3WMBA 1DJNA 4EPEC 4AC7C 1OK6A 3TLLA 1ZLPA 2OKOA 4XD4A 4DAIA 1WUEA 4JQ9A 1JPMA 1OVDA 1G4TA 5GNYA 4JKMA 1WDSA 1BZLA 3GG1A 2E5AA 1IXPA 4CNUA 2TSYA 5D05A 3WJYA 1BFNA 1FKWA 5F2LA 2WNNA 5CQ1A 3NXLA 2XVGA 3AXIA 1VD6A 4MJMA 3AO0A 2W6RA 4XAFA 1QOQA 3VPLA 3CO4A 1Q13A 1PKMA 3UJ2A 2J27A 3C3NA 3S42A 3N17A 3VIMA 3NYDA 1AMKA 5FJPA 4LVBA 5D09A 3URAA 2CETA 3WIJA 2XIBA 4XQ6A 1P6WA 2GVGA 2RJGA 1FDYA 2WK2A 3WH8A 4QS6A 5JVLA 3GIQA 1GESA 4N42A 4IIGA 4LYQA 3WLMA