2PP1A

Crystal structure of l-talarate/galactarate dehydratase from salmonella typhimurium lt2 liganded with mg and l-lyxarohydroxamate
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
395
structure length
395
Chain Sequence
SANSDAVTYAKAANTRTAAETGDRIEWVKLSLAFLPLATPVSDAKVLTGRQKPLTEVAIIIAEIRSRDGFEGVGFSYSKRAGGQGIYAHAKEIADNLLGEDPNDIDKIYTKLLWAGASVGRSGMAVQAISPIDIALWDMKAKRAGLPLAKLLGAHRDSVQCYNTSGGFLHTPLDQVLKNVVISRENGIGGIKLKVGQPNCAEDIRRLTAVREALGDEFPLMVDANQQWDRETAIRMGRKMEQFNLIWIEEPLDAYDIEGHAQLAAALDTPIATGEMLTSFREHEQLILGNASDFVQPDAPRVGGISPFLKIMDLAAKHGRKLAPHFAMEVHLHLSAAYPLEPWLEHFEWLNPLFNEQLELRDGRMWISDRHGLGFTLSEQARRWTQLTCEFGKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evolution of enzymatic activities in the enolase superfamily: L-talarate/galactarate dehydratase from Salmonella typhimurium LT2.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
molecule keywords L-talarate/galactarate dehydratase
total genus 138
structure length 395
sequence length 395
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.2.1.156: L-talarate dehydratase.
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2pp1A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2pp1A01
1F9CA 3STPA 3UJSA 3P93A 2MNRA 1OEPA 4GMEA 4J3ZA 2OVLA 1L8PA 1R0MA 3DEQA 3OPSA 4MMWA 3MZNA 1KKOA 2PS2A 3MKCA 4MGGA 3HPFA 3EEZA 2OO6A 3P0WA 2AL2B 4H1ZA 3R25A 2XSXA 2QQ6A 3QTPA 2P8BA 3H70A 3S5SA 4HYRA 2FKPA 1FHUA 3V5CA 1E9IA 2GL5A 3TJIA 1MRAA 4HNLA 4IL0A 2ONEA 3VDGA 1PDYA 1FHVA 3UGVA 3ES8A 1YEYA 3T4WA 4IP5A 3MSYA 3R1ZA 3N4EA 4A6GA 1XPYA 4HCHA 2PP3A 1EC8A 1P43A 3THUA 3PWIA 3OZMA 2GSHA 3H8AA 3DG6A 3GO2A 3QN3A 3DG3A 1IYXA 4JN8A 3IJIA 3VC5A 3UCCA 3UJRA 2QGYA 2XH4A 3DFYA 2PP0A 2PP1A 2PODA 4GGBA 4ENLA 3UCDA 3DG7A 4A35A 2RDXA 3D46A 3VCNA 3S47A 5FJTA 3ES7A 3OW1A 3T6CA 2CHRA 4E4FA 2OLAA 1JPDX 2QJJA 2POZA 3CT2A 2PPGA 3NZGA 3SN0A 3SBFA 3DFHA 2OQHA 3SN4A 4DXKA 3JZUA 2NQLA 4IP4A 3TQPA 3U4FA 4KPLA 4F4RA 4KWSA 5EU9A 2PU1A 4KT2A 2GGIA 1SJDA 3T8QA 3SSZA 4FP1A 4Z1YA 3QPEA 3TTEA 3UXKA 3R11A 1ECQA 2OQYA 3CK5A 3I4KA 3SQSA 2OFJA 2HNEA 1MUCA 7ENLA 5ENLA 4IT1A 1TE6A 4M0XA 3OTRA 2HXUA 4E5TA 3RCYA 1MDLA 2PTYA 3I6EA 2PGWA 5FJRA 3ZVHB 3FYYA 1SJAA 2PTZA 4E8GA 2PA6A 4Z17A 3MUCA 4GFIA 4DX3A 3DERA 6ENLA 3BOXA 2OZ8A 3MY9A 3QLDA 3DIPA 2ZADA 3GC2A 4GIRA 3FJ4A 3R0UA 4H2HA 3ZVIA 3QKEA 2GGEA 1RVKA 3Q45A 4E6MA 3I6TA 1W6TA 3IJQA 3UJ2A 2QJNA 2OZ3A 4H83A 3ENLA 4H19A 2AKMA 3DGBA 3PWGA 3OP2A 4KEMA 4HCDA 4DHGA 4MKSA 2OPJA 4E4UA 2XGZA 3MQTA 3TCSA 3CB3A 4G8TA 2DW6A 3NXLA 3MWCA 2PSNA 2HZGA 3DDMA 1KD0A 3NFUA 3R10A 3ZLFA 3VFCA 4K8GA 3GD6A 3UJEA 3K1GA 3R0KA 4IHCA 2XH7A 2O56A 2PTXA 1WUFA 1XS2A 4K1WA 3ZLHA 1DTNA 2AKZA 5IDZA 3GY1A 3T9PA 3ZLGA 2PTWA 1JDFA 3UJFA 3KUMA 4IZGA 3ZVHA 3FV9A 2OZTA 3RITA 5BOEA 1EC7A 4A3RA 3N6JA 4DN1A 3SJNA 3V4BA 3BSMA 2HXTA 3PFRA 1KCZA 4YWSA 3TOYA 5J04A 2QDEA 3H12A 2GGGA 4FI4A 1P48A 4ZCWA 3N4FA 2PU0A 4HNCA 4GGHA 2GGHA 3VA8A 2OX4A 2XH0A 4ZA0A 3FVDA 1TZZA 2QDDA 1ONEA 5BOFA 1EC9A 3TWAA 1EBHA 1MNSA 1NELA 3N6HA 1BKHA 2GDQA 3H7VA 2AL2A 4J1OA 3IK4A 1JPMA 3P3BA 1WUEA 2MUCA 5FJPA 4G7FA 2P8CA 2QJMA 4ROPA 4X2PA 4HCLA 1SJBA 2ZC8A 3CYJA 3TJ4A 4GYPA 4HPNA 4M6UA 2PGEA 2P88A 3FXGA 3DESA 4HN8A 1EBGA 1PDZA 2AL1A 3VC6A 3NO1A 3FCPA 2XH2A 3D47A 4DYEA 3CAWA 1TKKA 1BQGA 1NU5A 1R6WA 2PCEA 3TWBA 3JVAA 3OZYA 2PMQA 5FJOA 3B97A 3PK7A 2DW7A 3V3WA 3CXOA 3Q4DA 1KKRA 2FYMA 1JCTA 2GGJA 2P3ZA 2QVHA 2I5QA 3RO6A 3U9IA 3V5FA 1MDRA 4K2SA 1SJCA 5FJUA 3RRAA 3JW7A 3RR1A 4GISA 4JN7A 4EWJA 4DWDA 3UXLA 4IL2A 3RGTA 4JHMA 1ELSA 3SN1A 2P0IA 2OG9A 3VCCA 4GYPC 3BJSA 3IJLA 3EKGA 2OKTA 3TW9A
chains in the Genus database with same CATH superfamily
2J7GA 3STPA 2B7QA 1JDDA 4R7OA 1XIBA 4L6OA 3GTNA 1A0EA 4J3ZA 3AIEA 2YPIA 1W1ZA 1HKKA 4V1YA 1E0XA 1XLGA 4NZCA 4PUMA 1S5WA 1FIQB 4H4YA 1G4EA 1IZJA 4WGHA 1H5VA 4IG2A 3R25A 1Z69A 4MUZA 1MXSA 4HOXA 1UD2A 1S2UA 1AW2A 3ITCA 4PMDA 4OFCA 2OXNA 1RPKA 4IXXA 4IIDA 1UKSA 3GXFA 3K30A 2ZQ0A 1KCLA 1H1YA 4HYWA 3MVTA 4QJ3B 4H2CA 4AHPA 4O13A 4TVYA 2PLKA 2XVKA 1R3VA 4GBDA 2VWSA 1UKOA 4H4TA 3CV1A 4A6GA 1XUUA 3B9DA 3BW3A 4P7QA 1ZBWA 1J18A 3M1ZA 1H7PA 4L5ZA 4QRNA 3GKAA 1W31A 2GR2A 3BE7A 1W54A 1SM9A 4XKYA 5AVHA 3SCTA 4I5RA 3W01A 3KVKA 4NILA 3N2TA 4WDTA 1OK6A 3G1XA 1UPPA 1PJ9A 1EKOA 4M5PA 4KCWA 4HSNA 2Y5EA 1UWQA 1E1EA 3PZNA 1DWGM 2CZDA 5E6YA 1BXCA 3AU2A 3AXXA 4Q4PA 1GOQA 1N82A 4E4FA 1UB3A 3GHSA 4MJZA 3ANUA 4HOZA 4R5EA 1VJIA 3PTKA 3F5LA 1NARA 1VFOA 2AGTA 3C2OA 2E28A 3CT2A 5AOUA 2X42A 3H2AA 4N7QA 1AZ1A 3RU8X 3SCVA 1XD0A 4B2DA 4GY7A 2PCQA 5FCZA 5HXMA 4HHMA 4O57A 2GLKA 1B2YA 3RG6A 2CBJA 3C3UA 4MKNA 1XW8A 1J5TA 4KWSA 2X1TA 2C7FA 1TQJA 1VP5A 3VE9A 5F2LA 3T2QA 1VIWA 4Z1YA 4S2CA 3Q67A 3QF0A 4BHYA 3GNDA 1X38A 1XP3A 1ME7A 5MKGA 2V9DA 3WD2A 2CFYA 3B9EA 4AG0A 4C1NB 3ZZ1A 5A8NA 2VZUA 1DXFA 2HJPA 2XINA 3AJXA 3C4UA 4LRTA 3TC7A 4GQGA 1OABA 3EWCA 4WKAA 1HP4A 3TZNA 1AH4A 4B5TA 1SO4A 2VZVA 3VIPA 4XO7A 2R24A 3P62A 5FIPA 3NURA 3QLDA 3FSUA 1IGSA 3W07A 4H6QA 2ZADA 3IRDA 1TREA 1WXYA 5CG7A 5EMJA 4KRZA 3ZVIA 2BODX 3QR3A 2O4QA 4JX6A 2BGNE 1R85A 1DJHA 3W24A 3F2BA 2E5AA 1ME8A 1V51A 3AWOA 3RR4A 2P0OA 3BO9A 1V6UA 1FP9A 3L21A 4LEFA 2ZC1A 2F8QA 3R94A 3OP2A 3LZ5A 3UA3A 5D8ZA 1ENUA 4US6A 1Q2RA 4U3AA 4ZO6A 1I8JA 3CH9A 3RDKA 3ITLA 4IUOA 1KM1A 5M3WA 2ADAA 2WK2A 5ABTA 2YB1A 4ZOCA 3BK0A 1QHPA 3SUVA 3QFWA 1QI4A 4ZB0A 3FKKA 1K9DA 4RL3A 4ROQA 4MTVA 5G1TA 2QUVA 3KAOA 2OSWA 2WNNA 5C9XA 2Y1HA 1XIEA 4JFUA 5CPMA 1GONA 5K9XA 4DJFD 3PZGA 1N62C 3W1XA 3S1UA 4AZCA 3LHTA 2QZRA 2OZTA 2PFHA 1T96A 2Y0FA 2XVLA 2BVDA 1EC7A 4LUJA 4H4SA 3WNKA 1FBAA 3CQHA 1G4SA 3HQNA 3HF3A 4FOJA 5C70A 2HPMA 3ZIZA 1IEIA 4FI4A 4NF7A 1B3YA 3JUGA 3N4FA 2ACSA 3EB2A 4HNCA 2XN2A 2ZE3A 3UG5A 2ZWZA 1OWQA 2X7VA 4U10A 1YX1A 3NO3A 4GG9A 4CEUC 2TMDA 4MKVA 2Y4SA 1JG9A 3CIWA 5JIWA 1BKHA 4MNKA 2GDQA 5F2GA 4JPGA 3VNMA 4XAPA 1US3A 3QY6A 3GUGA 5D04C 1PSCA 1V08A 2Z7GA 2BHYA 1V3JA 2F38A 1NJJA 3R8GA 1R30A 4AUBA 1TJPA 1Z44A 3TNOA 3C61A 2P8CA 4AZIA 1DIEA 3PNZA 3DN5A 4Q8OA 4U5IA 1SJBA 3ARSA 4HHPA 5H6HA 1ZENA 4DJFC 2F2KA 3DESA 2QNEA 1YNQA 3UWWA 2X1IA 1TELA 3O05A 1ZQ5A 4B92A 3NO1A 1XX1A 5GVJA 3TNBA 3WMSA 4S3CA 3L4VA 3WUGA 4EQWA 1R2RA 4B9ZA 1TKKA 3ARVA 3EWYA 3VKAA 1EOKA 2W0HA 1NOFA 1I2PA 1TJ2A 3V3WA 2QPXA 2KX9A 1IIGA 3CXOA 2CXEA 4FNSA 1W1PA 1TTJA 4IMCA 3DU0A 4HIBA 3K13A 4HN4A 3TAKA 2V68A 4GLEA 4AD3A 2VZSA 1E15A 3I3EA 4GQQA 1KM3A 1YDOA 1KCKA 3LGGA 4ZO9A 1GQJA 5FJUA 3NZRA 1WP6A 1GVEA 2VQUA 4M80A 2D24A 4X9YA 3NO5A 1FWTA 3BJTA 1UWAA 4JR5A 2WZIA 4NUWA 3BLFA 4H8VA 3GXPA 4Y96A 3VCCA 1I45A 2WMKA 4F2TA 3V0UA 3B4YA 3GVRA 5D2XA 1N8IA 4NAFA 3S9YA 3B8IA 3P74A 3ARWA 3UQNA 4KEZA 4WZHA 1ZUAX 2P53A 3I3BA 1Q6CA 2NQ9A 2OVLA 1QMLA 4YTRA 4AY8A 1L8PA 4LBSA 1RAKA 3M0KA 2PLMA 4D2JA 4GX9A 3S5OA 3REQB 1GORA 3W84A 3VABA 3NWRA 1HT6A 3EEZA 3NOYA 4UOZA 3NGJA 4YMZA 1EL3A 3SGUA 1Q66A 3CQJA 4NZ1A 3P2VA 3W6YA 1Q6RA 6A3HA 4LF2A 4QNEA 3UWUA 4ADWA 1JI1A 3TJIA 3N1AA 4ZOHB 4CQBA 1WX0A 3WFZA 3E74A 4H8NA 2J25A 2CWXA 5BXTA 3TQKA 3CUZA 1DL3A 2XM1A 3FJ6A 5DMMA 4O17A 6CGTA 1HKJA 1SU5A 4FALA 3EPNA 2ZX6A 4BURA 3EDFA 1L6FA 3WQDA 4KCUA 3WNMA 4IPNB 4H7ZA 1S1PA 3PWIA 2GSHA 2FQIA 3RCNA 1OG6A 4JTIA 4AC1X 5KEZA 1JZ7A 4BV6A 1U1JA 3ARRA 4AIOA 4ENLA 2OX1A 3UCDA 1H6VA 1FWJC 4ZVJA 5BMXA 2GRTA 2XZ9A 4GBUA 3HMCA 2YCIX 1E4IA 4IOTA 3OW1A 4H8UA 2QT3A 4E8DA 2ISDA 4QGCA 3E9AA 5D9PA 1ZSXA 2CLLA 5AHLA 4O14A 1PIFA 3LCXA 1XDMA 3S5NA 1JL8A 3BVJA 3GTFA 2YW4A 4B4HA 4KESA 4D6CA 5LXEA 2D3NA 1XYMA 3NM1A 4YIWA 3PBVA 2QCCA 4JTHA 4OE7A 7XIMA 3PC0A 3PBYA 5C55A 1Q6LA 4LB4A 2PD9A 2GOUA 3OLEA 2L5HA 3WF3A 3MTWA 1VPYA 3GG7A 2WMJA 1DJWA 3I6EA 1XD1A 3GNPA 3WDQA 3VNIA 1AFSA 3QSRA 1MQRA 4J7RA 3ITGA 3PG9A 1JDAA 1S39A 3CO8A 3OIXA 4GZEA 4MNMA 4QIUA 3VYLA 3URHA 2VL4A 1PCKA 1UR2A 3IAQA 1BD0A 4R27A 3TZFA 2BBFA 3SO7A 3GLCA 1XCWA 2YL5A 4MAVA 2E25A 1N60C 1JRPA 3HN3A 1M3UA 3M6DA 4R7WA 4Q8VA 1JJKA 1E3ZA 3L0GA 4IIHA 3T07A 3RLHA 4JTGA 1EO5A 1FY6A 2E9LA 1FH7A 1ZBVA 4AMCA 4TXEA 3L12A 3ELFA 3WMLA 4RV8A 1ZJHA 3UZXA 3GKFA 4KEMA 1KA9F 4PL2A 3MYPA 1OF8A 1LT7A 1C8XA 3LCLA 1V6XA 1E73M 3V1HA 3EA3A 3TU9A 2X2YA 4P61A 1DJQA 5IRPA 2IW0A 1WKDA 1B90A 3I65A 2OZ0A 4PA8A 2CLKA 2VKZG 1ZXIC 2W27A 5TAOA 2TPSA 2DT3A 3CZ8A 3LNPA 4IHCA 3QPZA 1D9EA 3EMCA 3N9RA 1ZRQA 1O12A 4LQ1A 2VHLA 1HL2A 2AKZA 2HS8A 4CLMA 3GRIA 1J9YA 4Z0SA 5JMUA 2WVVA 4DWSB 2G5WA 2J7BA 3U2OA 5H8UA 3TN4A 3S1VA 5D2YA 3QXBA 3M5YA 4H4VA 2W3RA 1O6IA 1TRDA 4LTSA 4RX0A 1YDVA 3VIGA 3UEQA 5LA0A 3GWQA 3N29A 1AD4A 4R85A 1AQHA 4CNNA 3WYZA 3DGHA 4B5WA 1F5ZA 2E7FA 4U3CA 1VC4A 3H21A 3AHVA 4FR6A 3RX2A 3AHYA 3GR8A 5CEWA 1TVLA 4JQ4A 4C6FA 4N2YA 4GQBA 2PEVA 2D0GA 1GCYA 2X0YA 1TG7A 2GQAA 2ZZ5A 4NYUA 1O4UA 3QC0A 4GJ1A 1GG0A 4ZO8A 5C9RA 1KGUA 3FXYA 2OR2A 4X2PA 5BU6A 4HCLA 3M46A 3EA2A 3VPLA 2VDHA 2G41A 3FXGA 4GKTA 3KOFA 1G4PA 2WVVB 2A3HA 1XLMA 3EOSA 2BX7A 1OC5A 4JEQA 1JVNA 3B0PA 4KWWA 1VYPX 2YVGA 3KTCA 4H4UA 2CHOA 4S3AA 4IQJA 1TPB1 3DECA 1R6WA 3DGZA 3C8FA 5LIXX 5HUOA 3NQ7A 3LB8A 4M1RA 4JX4A 4FLRA 3IANA 3WQ4A 1A5BA 3SCQA 2YL6A 1TWWA 4MVAA 3B8DA 2D22A 1GOXA 2PLCA 4RE4A 1IEQA 5I78A 4LYQA 5HJLA 3GW3A 3HU7A 5GJPA 3E0LA 1EJVC 4I90A 3WH8A 4FNPA 4W9TA 1NTHA 3OA5A 4NJKA 4DUVA 3GXTA 1E1CA 1UR4A 3B8WA 3IIPA 4KBXA 2QIWA 2QF8A 4O16A 3N9SA 1RQHA 3W02A 4B5VA 2G4JA 3W22A 1EYEA 4I9TA 3WLLA 3EOOA 1BG9A 1A47A 1QU4A 2PDUA 3F03K 4PEKA 1C90A 2VGFA 4KWOA 1XICA 3R7MA 1K6WA 5G4HC 3VGBA 1H1NA 2OKOA 3LLFA 5AZ0A 5CSSA 2ICSA 1MWOA 3NDZA 4EE9A 2Y2WA 5A1AA 3GZ3A 5FEPA 2YAUA 1KXQA 5SWUA 3FEQA 3QHNA 2TRSA 1JROA 1W3JA 3OC4A 1BVNP 2GFTA 3DENA 1X97A 1RV8A 4TMCA 3KCLA 4JY8A 3G3DA 5TBOA 3TSMA 1K7EA 3EMZA 1FP8A 4WCJA 1GV4A 3LHVA 1I6NA 1SSGA 1EA0A 3LDVA 3SB0A 3WD3A 3COTA 1TA3A 2WZHA 1JNEA 3T40A 1SZEA 1XCFA 2Q8XA 1LBFA 2PDXA 4ZBCA 4JYEA 2WOQA 1EJSC 2X30A 4Z2LA 1OX4B 2VFGA 4PCFA 1GEUA 2IQ0A 4BWLA 3N2MA 2VR2A 4IIFA 4N02A 3IUIA 2OYKA 2GL5A 1XLCA 2J8GA 1G01A 3W75A 1H7WA 1QNSA 1JEZA 2VFIA 4H9MA 1NOWA 1PDYA 3KHJA 3E38A 2BG5A 5CPNA 1CGUA 1TRIA 3OYZA 4EM4A 1O7AA 4LUIA 4IP5A 4QISA 4U31A 2X8RA 3NZ1A 4KQNA 3SUUA 1GZ1A 3FS2A 4CVWA 4I9JA 3LHUA 2C16A 4WKHA 1WNOA 4BI7A 3EDKA 4L65A 4Q4RA 3H8AA 2DSWA 2P76A 3QN3A 3B0XA 1IYXA 3ITTA 4HJWA 1QI0A 4HPGA 1PZ1A 1G69A 4QLKA 4UBPC 2WBGA 3AYRA 3OBAA 2VT0A 1PCWA 3UZZA 4PCPA 3CZGA 3H23A 5FJTA 5AFDA 3T55A 2YOCA 3FX4A 1Y7VA 1H09A 3L4TA 2XIJA 3O7UA 3QR0A 4BI5A 2EQ8A 1QNRA 4H6KA 4ZOBA 2OQHA 1ONFA 3W3OA 4C90A 4KWVA 2FH6A 4F2UA 2NQLA 2WM1A 5KZDA 1UQZA 3TN3A 2VVNA 4TVUA 3WK3A 1QUMA 3GU2A 1VDVA 3HW2A 1UD4A 3AMGA 3G1HA 3LLXA 2I5IA 1SVDA 1TUFA 2HNEA 1NF0A 1GJWA 4YTSA 4M81A 2QKFA 4JTTA 1TE6A 4M0XA 3QEZA 2Z1SA 4TVWA 2HE5A 3LCFA 2PGWA 5LXXA 5DCBA 2OGYA 1E6ZA 4D6IA 2OELA 1YQ2A 3MUCA 4OVXA 4O1BA 3L5OA 1TPH1 4CGTA 2VQTA 3DKLA 7REQA 1IEWA 3S6DA 2ZTKA 2YBVA 3CB8A 2FFCA 1GREA 2J4GA 1S5VA 5DF0A 2A3EA 3L68A 5EFDA 5KINA 1VCGA 5HQLA 3PZVA 3I6TA 4Q22A 3P5ZA 1HKMA 4WGXA 4H83A 3H53A 5BWAA 1R2SA 1Q5MA 1KWKA 1NHSA 1A0DA 3BWWA 3PWGA 4B3KA 4ZXLA 1RP9A 4DHGA 4QCFA 3N2BA 2A8XA 4ZGYA 4UTHA 3TDFA 2NVCA 3RJYA 1REQA 3AXMA 2GDUA 4QNWA 3SDOA 4MB4A 1WZLA 5HOSA 4DZHA 3NTYA 3EKLA 1MEIA 2OMAA 3AFBA 3ZLHA 4FF5A 1MOKA 3EX3A 2DSZA 1AL8A 1V79A 1FCBA 3CMGA 2BY3A 3CZJA 2VGIA 2W63A 1H61A 1VFMA 1UWUA 4J2PA 4IZGA 3OZOA 3GYEA 3RITA 1WKEA 1XLFA 3N6JA 4NAEB 1MMFA 3TVAA 1LOLA 5MKGB 2BS9A 2YXGA 3BLEA 1EIBA 1HTIA 1EDTA 3E2VA 3ZJ7A 2VX4A 1LG1A 2VFHA 4YWSA 1XFCA 1T8QA 2XYLA 3BMVA 3WY1A 3TSDA 1WQ5A 5LKYA 5T91A 2VEGA 1XJBA 2GGHA 3EDJA 4DI9A 2J7FA 4DB7A 2RDWA 1NDWA 1DTUA 3LENA 3W1LA 6TIMA 5LNUA 4KFPA 1NELA 1I2QA 5LHFA 1DPMA 3FIGA 3VD3A 1HXJA 1CXLA 2VC7A 4G6CA 2HNHA 1ZAIA 2W0UA 1TPUA 4UNKA 3OQ8A 1D3HA 6XIMA 1GPWA 1TV7A 2I17A 2Z1BA 3WFAA 4ZO7A 1WZAA 4J3WA 4S3EA 1EJ7L 3CPGA 2DVXA 5DT5A 5C2GA 3CYJA 2GVYA 3BV4A 5D2WA 1JD9A 3S2MA 3U2ZA 1TFVA 1JFXA 4LVBA 2FB3A 4PMUA 1SFJA 2Q71A 1JF6A 4PUWA 4AD0A 3WEZA 1C9DA 1GW9A 3OVRA 3QY7A 6REQA 3CAWA 3MV11 1ONWA 1IXQA 3HGRA 1N5XA 2E6YA 2DDXA 2Z26A 5HDRA 4BFAA 5JU6A 1UWRA 1QWGA 2WWCA 1YDNA 4X61A 4W8AA 1GOIA 3IVUA 1E70M 3G1VA 2Q8LA 1J01A 3C2VA 3LA4A 4PTNA 1XBXA 3UNTA 3WLKX 1C9WA 4Q8TA 1FKXA 1BPLB 3T4CA 2AQVA 4IX0A 3W7NA 3OU8A 3WUBA 4QR6A 5H2ZA 2ZZ2A 3KEHA 1HJUA 3S5YA 3IIXA 4IPLA 3A23A 4JTLA 3APYA 4EMJA 2HSAA 1LQ2A 3S2JA 5EMLA 1CGTA 5HK4A 2V81A 3KXQA 3ZR5A 3IWPA 1MUWA 1OG0A 1QWKA 1PVNA 3M44A 3W7JA 3EUB3 3H7RA 3FHAA 4M7SA 2WAGA 2DEPA 4LFYA 2FZMA 4LOCA 3WLSA 4JFWA 1RJQA 4IMAA 3S0CA 4J4KA 3GD3A 5C5YA 2OQLA 4GY0A 2ZCGA 4YVPA 1RQBA 1DJZA 3DEQA 3HV8A 2QCNA 4MMWA 4RE3A 1S5MA 4I8YA 4GC3A 3MKCA 1LQAA 3T2OA 2O4MA 4MWAA 4V1XA 3SR7A 4PULA 3WMCA 4O1EA 3GRSA 1RCXB 3DJGX 1RP8A 2NSXA 4C5ZA 2XSXA 2ZKMX 1V3MA 5I07A 4FHAA 1C93A 1FFQA 5CBJA 3GQYA 1V02E 2WQPA 3CC1A 4Q7NA 3VIOA 1PL9A 1U30A 5M03A 3BLOA 4GI4A 4J2MA 1WKFA 1AD1A 5F2IA 3PTMA 4C1KA 5K9DA 4HNNA 2E5BA 4LV4A 3TLLA 2W62A 4RZ4A 4NASA 1Q65A 3T4WA 1FWNA 3VIHA 4LY8A 2OTDA 1AQFA 3AIRA 1NHRA 4LUTB 4EIVA 5CSUA 2J7DA 3MJYA 2INZA 2YBTA 1GVQA 5D09A 1SO5A 3OZMA 2ZZ1A 3CM4A 1LUCB 1SZRA 2BTMA 2DIKA 3LN3A 5A6LA 4LA1A 2ISSA 1VBUA 3NL3A 1W91A 4O19A 5DXYA 1C8YA 4Y2WA 4WX2A 2WNZA 4HMEA 2PDFA 1K4HA 4GKLA 1X1OA 1KR1A 3SRKA 4KGJA 2PDYA 1HKIA 2WANA 2WZMA 5CZTA 2WB5A 3SCOA 1FWDC 3WG6A 4AHOA 4YYCA 3INPA 1QO2A 4NAFB 4XBKA 2Z29A 1VLIA 1CLVA 2X40A 4GQ0A 1H0GA 1JRCA 1RY0A 2XIOA 2NT0A 3C56A 4GFSA 4JEJA 1LTDA 4B4FA 3AZSA 4RDWA 4EF8A 3T8QA 4ZOEA 4E2VA 2W3ZA 3ARZA 3HBLA 4Z1BA 3WN6A 1JZ6A 5U1OA 1PO9A 2VENA 1WOAA 2GQ8A 2PDIA 1J93A 1FQ0A 1H1ZA 1TTIA 4D8ZA 4PN2A 1FEBA 1ZGDA 3ZVHB 4W88A 4WSHA 4F66A 1AUSL 1VH7A 4OT7A 2DZTA 3PNUA 1DBTA 3ME3A 5DCEA 1XV8A 4YS1A 4WDXA 4MDPA 3PBMA 4UZUA 3UZ5A 2YDSA 3VKJA 5FAGA 3S4TA 1M68A 3QKEA 1PKNA 4INFA 2JIWA 4PMZA 3HJEA 3OG3A 5FKYA 1RJRA 1OFRA 2XZ7A 2V69A 1X39A 5CC3A 1QBAA 1VF8A 2HCVA 1HN1A 4J28A 2Y5SA 1DJNA 3FA5A 3P5YA 3WELA 4EMWA 2ZYFA 3NXLA 5A8QA 4AZHA 4AEFA 3NSNA 1POJA 2WQDA 1XLBA 3WEOA 2WVTA 4RCXA 3BJFA 2WKJA 1Q4NX 2P5NA 1DYSA 4ERAA 1NF7A 3MMTA 5JCNA 4ORIA 3VX1A 4JNZA 1ML1A 3GUWA 4Q8NA 2ZRUA 4D6DA 4QDWA 3WNNA 3AICA 5DELA 3TX9A 3LX9A 2CBVA 4MWAB 3B0UX 3PM6A 4HOWA 1A5OC 1UKTA 5DX7A 2BB0A 3UWQA 1Q85A 3QH2A 2WPBA 4PMOA 3ARPA 1R5YA 3DH7A 4PMNA 2BVTA 3SY8A 1UZ1A 4BCEA 1GOWA 1XCXA 5IDIA 3W1PA 4JIRA 2ZUSA 3NPUA 4DXVA 1HG3A 3WUFA 4UTKA 2VO5A 3PBGA 4KCVA 1X6NA 4QE4A 1KO0A 3VA8A 4LEQA 1KRCC 1TZZA 3GIPA 1FECA 1EC9A 4W86A 2GWGA 2FVLA 1OHLA 3ABRA 2FPVA 2DIJA 3N6HA 3FYOA 2J6VA 3M0HA 4AZBA 5CJ5A 2QV5A 1KM4A 1I9CB 4DJDA 2Q3RA 3W7RA 5E0KA 1J5SA 2QCGA 4G7FA 4KFNA 4HNOA 3NYZA 4C6QA 4US5D 4C6IA 2HQAA 5LGZA 4MOZA 1CXIA 1ZY8A 1QNVA 1XLAA 3PZQA 1WDQA 2E3ZA 4L9ZA 3TQ0A 5TF0A 5CG0A 4FR1A 1HF6A 1XRTA 1G5AA 4UQCA 2XIQA 4E8CA 2CLFA 3DAQA 3O07A 2CKSA 1ADSA 1SFTA 5TQLA 3MSGA 3O6CA 3T78A 1UD6A 2D2HA 3H2CA 3JVAA 1A4MA 2C0HA 5CGTA 3QY8A 5FJOA 3MP5A 3LPPA 4W7WA 3FYPA 4PCTA 3KDNA 1CWYA 2VR5A 1SQ7A 3R58A 3FVMA 5A94A 3U8GA 2RGMA 1O5XA 1KKRA 5DBUA 3UXAA 2EXOA 1TV2A 2PWDA 2I5QA 1UR0A 3POHA 3BC9A 1ZMDA 5CJMA 1W5PA 1X8FA 2WHKA 1G4TA 1VEPA 4JTRA 4JOMA 1HP5A 4ZMGA 4CEXC 1VBHA 1US0A 3U2EA 3UT0A 3MCOA 2NW0A 1LBMA 2YCKX 5CSYA 3CJPA 4O52A 4DWDA 4OV4A 3SN1A 1FH8A 2OG9A 1OM0A 2R94A 2C13A 3A24A 4IFKB 3WO8A 1BF6A 3IJLA 5A6TC 4F48A 3TW9A 1DP0A 1LOQA 2VRJA 2WM0A 3P80A 1EXBA 1ONRA 3OBEA 1S5TA 1EH9A 2YR1A 4KMQA 4GMEA 1R7OA 2Z2BA 1CXEA 2HDJA 4APNA 5IXEA 3SRDA 4I7WA 4LU0A 5BNKA 2PWUA 5BRBA 3RYSA 4XKYB 1W9BM 3NVWB 1OJTA 2DZSA 5LYRA 2Y7FA 2CYGA 3EYPA 3STCA 1YBQB 3LCHA 1OFEA 4GVHA 3IIOA 5EMMA 1SW7A 3GW0A 3QTPA 5EYWA 1MUMA 3BAKA 1PS9A 3VKDA 1XLDA 1PKLA 3GU1A 1X2GA 3UG8A 3KRSA 1QHZA 3WDHA 1D7KA 1H7NA 3V5CA 1XDIA 1YNPA 4C6OA 1HJSA 3LBOA 3AJ7A 4M6VA 3STGA 4UTIA 3V36A 3B9NA 3UG3A 1NQKA 1YEYA 3MHFA 3BGGA 3RK8A 1LLZA 4HCHA 2PP3A 1U5HA 3WDRA 3HFTA 3GRTA 1YTDA 4HPHA 4RXGA 2QS8A 4D6FA 1BWCA 4BS0A 3WSUA 4J27A 4XBSA 3KCOA 4GRSA 1NSJA 2OYMA 4LAMA 3QZ6A 4K8DA 1AOGA 1W37A 3HTWA 5A8OA 2HRWA 4QDPA 3C5QA 3CBWA 2IPGA 2ACUA 2DQWA 3V75A 2YA1A 2CBIA 4GA8A 3W87A 4S3GA 1VBRA 4IQLA 1CDGA 4Y90A 1J11A 3JZUA 2FPTA 4IP4A 3CIVA 1YMYA 3CAQA 4FA3A 1N2VA 1Y5XA 4DWSC 3MB9A 3DH9A 2YLLA 3QPEA 4G2DA 4AZ6A 4PMYA 1FH9A 2BY0A 1QOPA 3GNXA 4FPSA 2W54A 1T99A 4US5A 2HPIA 2OFJA 2PDPA 3KFTA 3W76A 3BL3A 2W66A 5HMSA 5CGMA 3SM0A 4XZLX 1N5WC 6XIAA 2D2OA 4HK6A 3U48A 1ZY9A 3WF1A 3HZ3A 1XLHA 4F0MA 5JXQA 1AJ0A 2TPRA 3LHZA 5I7GA 1DE6A 1Q8JA 3K1DA 3TR9A 2X05A 3VIJA 3DFOA 4FK9A 4QP0A 4QLJA 4HZ7A 3IJ6A 1S46A 4UOQA 1GQIA 2VUNA 3NVYB 1JYXA 4BQ3A 3VO0A 3EX4A 5A8MA 2EG6A 1KFWA 2XN1A 1Y0EA 2PLJA 3NOEA 2B81A 2CU0A 3WK0A 4JTCA 3RN6A 3BGJA 5HJXA 4HHHA 4C6JA 1BWLA 2CPUA 1CW2A 4I6KA 1D2KA 2W67A 2QJHA 1TWZA 3WD0A 4WRHA 2ZUTA 2VEIA 3UYIA 2IMRA 2YYUA 1UH2A 3AROA 3VD4A 4ECLA 4IH3A 2XFFA 1RH9A 4AXKA 3PZ9A 1Q6QA 1US2A 1XKYA 3RF9A 4MY1A 1KFEA 1XS2A 2IKJA 1E1FA 2O7SA 1SSDA 3HQOA 3NGFA 4O54A 3QR1A 4FX9A 5IDZA 4Q33A 1CXKA 3MCNA 5G2WA 1JOAA 4BJHA 1B9ZA 2QLYA 1LCOA 3CEUA 2BZNA 2ZZCA 4M82A 1F3TA 4NIRA 1W9PA 3B03A 2A3BA 3KVLA 1NHPA 2C1HA 5CKSA 3VZYA 3XIMA 1XFBA 5JBFA 2A4AA 3ZM8A 4MAZA 4ASTA 2YDQA 1PTAA 3SCWA 2FMNA 3E2RA 1REQB 4CU6A 1CEOA 3L5LA 2VM8A 1E1CB 1GZGA 1C8VA 2OYLA 3NPXA 4O0ZA 3W1NA 5CH9A 2AL2A 3U3HA 4XAYA 1PHQA 1WUEA 3IGHX 2OLHA 2D1ZA 1J6PA 2ANUA 5U4NA 1S2TA 4AF0A 3WF4A 1A0CA 3G1YA 1BYBA 1TZ7A 2PWEA 1C3FA 4XVEA 4Y9NA 1DE5A 2XTKA 1VPXA 3TYEA 1KB3A 1KFLA 5FS9A 2ZC8A 3NQ6A 3LBCA 4L80A 4G5DA 3N3TA 2DP3A 4C6KA 2GVJA 4H6EA 2HROA 4P5UA 2P88A 4HKPA 2WJDA 5CLTA 5JH1A 2V3BA 1S3HA 2C0AA 2ZZBA 2WMHA 3WX7A 3R0DA 2YA0A 5AY7A 4CCZA 1F4AA 4TV6A 5LZLA 3NL5A 1W3LA 4QCEA 1UZDA 3ECQA 2PCEA 4CQ8A 3UR5A 3C2YA 4HMCA 3VU2A 1JCYA 1R9XA 3R12A 1L2UA 4H50A 2P1FA 1GZJA 5BXSA 5DQPA 4GUHA 1QPRA 4J3XA 4F3HA 1SUXA 1VEOA 4OKDA 1F3EA 3WEMA 1DWAM 5CQ1A 4H41A 4A29A 1WPCA 5KITA 2YW3A 3WJYA 3IACA 3LG3A 4ZTXA 2CC0A 3P8JA 1FEAA 2O7QA 1J0KA 4DYJA 4MFEA 2OODA 1OY0A 4PMXA 1Z89A 4LANA 4W84A 1UA7A 4GXMA 5FD0A 4E2BA 1TQXA 1YBQA 3L66A 4MF4A 1O5KA 5ABEA 2C6QA 4KRTA 3KZPA 4O4WA 2BC1A 5B7YA 2MANA 2MNRA 2JKPA 4WVXA 3HO8A 3OGSA 1NWRA 1KQYA 1V4YA 3PAJA 1GEQA 4Q8PA 1B3OA 3UZWA 1R0MA 4JHZA 2ZRWA 4O50A 1AODA 1ZFJA 1SZGA 1JZ5A 2PB1A 2GK1B 3MZNA 2ABBA 4UTMA 1VRXA 5H8MA 1IZKA 1CB7B 1CYGA 1R3WA 3LXCA 5AN7A 1V0LA 3FDGA 4K8HA 2WKGA 3BDKA 2AL2B 1OBAA 4L1WA 3BZJA 5HWNA 2CZEA 3PB0A 4HYRA 5FJJA 3TLQA 1TX2A 1HJXA 3E2SA 4ZQPA 3H2MA 4R53A 1E6SM 5E9XA 5CXPA 1RCOB 1CCWB 3QHOA 2BOFX 1RZMA 2XN0A 3E5BA 2DUAA 4OGZA 4M52A 2ZA1A 3Q65A 1XBVA 4O0KA 2XWDA 3E0FA 2PGFA 4XSLA 5JCMA 4M56A 3ES8A 1TB3A 2ZXAA 3SIZA 1AG1O 3R1ZA 4M7TA 4QG9A 1QCWA 1E3XA 1IXOA 5D2VA 1WDRA 3W29A 1UP2A 3BLLA 3THUA 2X1RA 3BARA 1UD3A 3MO4A 3F5KA 2TAAA 5CPTA 4DELA 3WLRA 4LNCA 2FTPA 4PL1A 3UETA 3GO2A 2WMIA 2Q3OA 4PBEA 1D3GA 1M7OA 3WBAA 1FWAC 4O15A 2AAMA 4DNAA 1OC6A 2WSQA 2UY3A 3NVZB 1TE1A 5HANA 2PP0A 3O1NA 4URIA 1WXZA 4XSMA 4R9XA 2E5DA 3JRKA 1VS1A 2WJZA 4LXFA 3ES7A 5HQMA 3LB0A 3LRKA 4WSKA 1A5SA 1CGWA 3F4WA 3GDLA 1V3IA 3T08A 3PJXA 3TFCA 3NNTA 3QBUA 4QS6A 3ZT7A 3HV9A 5C2CA 2ON3A 1UUQA 4H4WA 3AMKA 3CPRA 4WF7A 1GQNA 2B0MA 1F74A 3SSZA 3UVIA 1P6CA 3VZZA 3N13A 3AS0A 3NPVA 1IT8A 1UQYA 3CK5A 2GSJA 4LAKA 2FLIA 3I4KA 1PWMA 4BR1A 1KCXA 1EDGA 7ENLA 3BQ6A 1QPQA 2W61A 1D8CA 1EO7A 2CNCA 1P6BA 1FWBC 4TIMA 5F4WA 1M9HA 1FXPA 2NV2A 5FJRA 2GK1A 3V7PA 4PTVA 4W5ZA 4CQ9A 5A6SA 4ATDA 1SJAA 2WPFA 1PX8A 2XM2A 2R8WA 2DZBA 1EDQA 1DWHM 4O12A 1M41A 2E9MA 4Z1CA 1VFLA 4IIGA 4P8WA 2B31A 3WQ6A 2Z0IA 1A4LA 1MO0A 1JQXA 2G95A 4PZVA 2V3AA 4BQ4A 3NUKA 2V5JA 4UNLA 2ZZ0A 5H91A 4AWSA 4UTJA 2WP5A 1SW0A 4HTBA 1Q3NA 4Q8MA 1FDZA 3M64A 3PZIA 3JS3A 2GVLA 3PFMA 4WY0B 3L4XA 1AJZA 4M51A 1EPXA 2ALDA 4XAFA 3S9ZA 2XGZA 4IM4A 1HFBA 3MA8A 3GK0A 4RNJA 3CZKA 3VOCA 3MWCA 3UR7A 5I02A 3HG4A 1OZMA 1EWEA 4LT9A 4ZEPA 4PCSA 1BYDA 2EQ9A 2ZRVA 2TODA 2VEKA 4G7EA 3SSJA 3FOKA 3SR6B 5EY5A 3B0VC 3GM8A 1GXFA 3UF9A 1CZ1A 5T9BG 1U1UA 1OX5A 1Y5WA 2I9UA 2X50A 1KN0A 1GRFA 3BANA 3II4A 4HHLA 2X99A 5CPSA 3ZVHA 1TV5A 5A6JA 1I2OA 3SECA 4Q6JA 1L0PA 3N14A 3W7LA 3L8KA 4Q4SA 4PB4A 1V6WA 1LVLA 2CERA 1LRTA 2WC3A 3L4YA 3LRMA 1X6LA 1RBOB 6PTDA 4X0NA 3CUIA 3NEHA 1JEHA 1GJUA 4UR8A 3AYSA 3EB3A 1CBGA 1EQPA 3B05A 3H2EA 3NA8A 1YW1A 2EPHA 3E96A 1KRBC 3TWAA 4IMGA 1MNSA 4QG8A 4PTMA 3VDCA 1CXHA 1ECEA 4REQB 1H7RA 3WDIA 3DYMA 1LPFA 4O10A 1R3QA 4KF1A 3P3BA 4MSSA 1VQZA 5EGRA 4AZGA 3NAVA 1SW3A 2O9PA 3MI2A 3A12A 4LC8A 5AHFA 4EOUA 1P1MA 1ZTVA 1LT8A 1XRFA 5ECUA 4A4AA 1UIOA 4H01A 4GZ7A 1PIGA 1R9YA 1B4KA 1I60A 4N6FA 3VC6A 4FDCB 3CHFA 2RJGA 3VDBA 1LUCA 3TKFA 3KTXA 2VFDA 2J9ZA 3CHCA 3PBUA 1F4HA 1VKFA 4KIRA 4NRSA 4DI8A 4LIIA 1ZKQA 1RA0A 3UA4A 1IQ8A 3D3AA 1OF6A 5REQB 2QEZA 3A47A 4NXSA 1KXTA 4AH7A 4HU3A 3LNMA 3NQ2A 3GDBA 1JCTA 3N19B 1U22A 2ZA2A 4UTWA 2BOEX 3FKRA 4B91A 3DYPA 3G2GA 1TIMA 3EOUA 5E70A 4C60A 4EACA 1TYGA 3OEXA 1XG4A 1LWIA 1KWGA 3GAYA 1UH4A 2WMFA 1LZOA 3EANA 3OODA 4YWOA 4Y6GA 1ZAJA 1MO9A 3BJSA 1PV8A 3E12A 3AIUA 1VCFA 3W73A 4NJIA 4ZL1A 4Q8WA 5AHIA 2R14A 4GUJA 3CHVA 4ORMA 4V33A 4TVDA 2X7WA 3SGGA 3GXDA 3TYUA 3TQVA 3CAKA 3ABQA 4DZ5A 3BCFA 3CMFA 4NZ5A 1N55A 2Z1VA 1H2IA 1DJXA 4CUCA 4PCNA 3SAZA 3VOGA 2GWNA 1Z48A 1PZ2A 1ME9A 2H9AA 4NY2A 4IJBA 2DGAA 3WH9A 1IHIA 5BWFA 3N2XA 2RGLA 2CZ5A 4WY0F 3AC0A 1CENA 4GI6A 3H70A 3MHUA 4FXRA 4LW7A 1V3LA 4JGDA 1J4EA 1HJWA 4DO7A 4PGLA 1U5JA 1ZCOA 4M6PA 1E9ZB 1CXFA 3AS3A 4DM1A 1JGIA 3E02A 3S2LA 5HNRA 3E0IA 2RUSA 2WP6A 4LSBA 3LPFA 1PZ3A 2QDGA 1JCJA 4GHRA 3KLKA 1F73A 2DSVA 3GU9A 1E6QM 1Q7MA 3PZUA 3PS7A 2Z24A 5GJNA 1JR1A 1QBBA 4IMFA 2GDVA 4YN5A 1TPC1 4D8LA 2Y89A 2NXGA 3MUAA 2CZFA 1ZBKA 1UR1A 1KR0A 2E4TA 3GTXA 4ZQNA 3T09A 2IQTA 2R9ZA 3TUUA 3S3GA 3UP8A 1QJWA 2W91A 3DG7A 3C0QA 2YL9A 2YFNA 3DHDA 4LF1A 4C6DA 3E3HA 2G8ZA 4EKJA 3CEPA 2DZXA 2POZA 2Q02A 3NL6A 1TPEA 1HVQA 1XINA 4QS5A 5AHMA 2W6RA 4E0CA 4XBJA 4NZFA 1KV8A 3D5HA 4M3PA 2OO0A 2LLEA 4I5UA 2XWEA 3U4FA 4JIHA 3GG1A 3E5PA 1H5YA 2V6AA 2XG9A 4GH1A 5FEZA 4AWUA 1FCVA 2DU2A 3NJ3A 1HQTA 1DHKA 1T8XA 4AWTA 3BICA 1GOKA 2DZVA 4X9SA 3QYSA 1MFUA 1F3PA 5A5WA 4RW5A 3THAA 4HNUA 4FXJA 1KM5A 3IV3A 3CL7A 2V5LA 3AHTA 3UYCA 1JCMP 4G1NA 1EX5A 1W1TA 4ZE4A 5F4SA 2FJKA 4IX2A 3O3RA 1W9DM 4C1NA 2EPKX 4X2RA 5KZ6A 1JZ4A 2QIIA 3BLPX 3N34A 4RLIA 3TK7A 1RPXA 2GJXB 3ABZA 4FAMA 2OZ8A 2IXVA 5DCDA 4V15A 1XRSA 2QMJA 3VM5A 3G1RA 4UMCA 1MI3A 5BYWA 1Z32X 2FVMA 4BY3A 4P7RA 5I00A 3F4CA 5FL0A 1H49A 4GVGA 1OD8A 1GESA 1GSNA 1XF0A 1F8MA 3TEVA 2VC5A 3KRUA 1DQUA 3LCGA 2POTA 2GR1A 4A3YA 1F6YA 4NHVA 3RNMA 5CAHA 1KGWA 3I7SA 3W88A 2YXOA 1KFCA 1QNQA 2YVJA 2ZZ7A 3HPAA 3BQ5A 2OPJA 3W7GA 3SURA 5FSEC 2WC4A 2AMGA 1EPVA 3DYOA 2QW5A 2QDHA 5A6MA 2Y7DA 4HNVA 3UY7A 4ADSA 1N8FA 3W23A 3R10A 3W1UA 3ZLFA 2CWNA 1VLWA 1RBAA 5AYXA 3AXIA 2ZDSA 4HZ8A 5AC5A 4XVDA 2NQZA 1XLLA 3K46A 4K1WA 3H4GA 1M03A 3QQ1A 1DTNA 3NVDA 3DFQA 4AFYA 2Z6IA 4MIMA 2PWVA 2GQ3A 4L4MA 1TMLA 5LGXA 2CKRA 4XIAA 3G77A 3D3FA 3FV9A 4PRWA 3EWWA 3VM7A 2VD8A 4JHOA 3TYAA 3V4BA 1BYCA 4TTGA 3IEBA 4AQLA 5D33A 1XYLA 4L4LA 3W53A 2WVUA 4HP5A 2FIQA 4A8IA 3C6CA 1QT1A 4X3ZA 3EX2A 4FNQA 2VNCA 2J13A 3ABXA 4FLSA 3WH5A 4H04A 1RM6B 4P8VA 4F0RA 1P7TA 2P3EA 3H55A 1XLIA 4PSPA 3N11A 4M1BA 2MUCA 5J5DA 1SZNA 3TCEA 3VNYA 4JQ1A 1NDYA 3P0XA 4I9AA 2Z28A 4GY1A 1Z6KA 1EGZA 1W2VA 1U5VA 3OJGA 5I6SA 3TJ4A 4HMNA 3WZ0E 4GYPA 4R88A 3HM7A 2PGEA 3WQWA 4JIQA 1I1XA 4HK7A 5FS6A 4O4VA 1PDZA 2J9XA 3KX6A 1K4QA 4AIUA 3L4UA 3DBPA 2XH2A 1DEDA 3ZXWA 3W7PA 1IT0A 4LVFA 1JNDA 3NQMA 4TMBA 3QKZA 1TUXA 3TIMA 2J78A 4EANA 2O55A 1TWIA 4UQEA 1RSCA 4F0LA 2HE8A 3A7AA 5LIYX 1X7FA 3PPHA 3EOLA 1OIMA 2GUYA 1IE7C 1K4GA 3MV01 4A3UA 2ZXBA 8RUCA 1N7KA 2C18A 5CPOA 4WD0A 4REQA 4S2BA 3TP4A 2V3FA 4JQ3A 3RGTA 4AZ7A 1CLXA 4IIBA 2J9YA 4J3TA 1ITUA 5JBDA 4JTSA 2PDLA 1YDYA 2REQA 2HVOA 1TMQA 5FSDC 5REQA 5C9ZA 4GWEA 1UP0A 1MXDA 1DJGA 2YKKA 3EX1A 2GJXA 1V5XA 2OEMA 1E0WA 4NAEA 5D2TA 3CV6A 4NJJA 4NEWA 1KV5A 3B04A 2WSPA 2DVTA 2WJEA 1NHQA 4TX8A 3QVQA 1KXHA 2PDWA 1BF2A 2WPEA 3FG2P 2ACRA 3FNDA 4WJ8A 4HK5A 3RM4A 2YSWA 3UNDA 3ERPA 4H1ZA 3VMOA 4JQAA 3DOPA 3MW7A 3WK2A 3S5SA 4I7VA 4JBRA 4FO4A 5C6MA 4S38A 4Z1DA 1C8QA 3W7EA 3CGDA 1MYRA 2JF6A 2P10A 1XH2A 2BASA 4JKLA 1ZNNA 3PR2A 1GJPA 3UVAA 4O28A 1TTQA 3P8IA 4CU8A 1TSIA 3P14A 2E68A 3V0SA 3TYDA 4TVCA 3G0XA 1J79A 2CLMA 3UZYA 4C65A 1C29A 2EPMX 4K7ZA 4H6RA 1J0YA 2ISWA 3RHGA 1T0OA 2GQWA 4HMDA 3KWSA 3MC5A 2VTFA 4RPPA 3B9OA 4EVZA 4LB3A 3BH4A 1ADOA 2PUZA 2VJXA 4DLMA 2E8ZA 3T0CA 3I7QA 1FRBA 2XVGA 5I3IA 4R7JA 3WBEA 1QTWA 4WQ6A 3G1AA 3URQA 3UR2A 3VKKA 3U2CA 2WHMA 1DIOA 1TO3A 3EWUA 1J6OA 5F4XA 2ZUMA 2PPGA 1XIDA 3AHXA 5FACA 4DLFA 2W5FA 1UBSA 3WLTA 4LALA 4ALDA 5EU9A 4YHGA 1V6TA 2HMCA 2YYTA 1J0JA 4N9CA 1FFRA 3WMBA 2PC4A 1KRMA 3M07A 5A2BA 1VBGA 3OVGA 2WCAA 1EYWA 2TYSA 3IIVA 4GZJA 4XD5A 4AD1A 4S3KA 4GO9A 4JYFA 4WUIA 5ENLA 4IT1A 2RH9A 2YA2A 1B3VA 2JQXA 2IKHA 1NVMA 2CITA 4MWAE 1A53A 3VKBA 3M0YA 3AIQA 2EF9A 1SO3A 1DIDA 4RR4A 5C9UA 2X0SA 1W8SA 1OFAA 4DX3A 4NJGA 1SYTA 2ZXDA 3CV2A 4BWLC 2J75A 4QFUA 4FXFA 3BPWA 2WPCA 4Q6XA 4IXHA 2IQDA 4W8BA 4EPDC 3RX3A 1Y5VA 3P6LA 4H7VA 4BF7A 3H26A 7TAAA 4O53A 2V3GA 4MNJA 4PB5A 2B7PA 5DMNA 4W87A 1HZYA 2V6OA 1MSSA 3O16A 3NSXA 2WOVA 3AIBA 3MUXA 2DZPA 5HNTA 4AZ5A 3NFUA 5LA2A 5EBUA 1K6AA 4FMVA 3UJEA 1S3TC 5HINA 3R0KA 4DO6A 3GH7A 2O56A 3TONA 1WV2A 1OFPA 3MWAA 4ML9A 4UMBA 5AC4A 1E5JA 2ZE0A 3I10A 2XIMA 1QR7A 4YNGA 3SW6A 2DSUA 2C14A 3CHDA 2FH8A 4IICA 4E2DA 2EJAA 1PWLA 1EBDA 4XQ6A 1OCNA 3AS2A 4AB4A 3V1PA 4ZQCA 3CS2A 4A3RA 3PWAA 4MHBA 3RMEA 1P0DA 1NOUA 4CQDA 4UFLA 4GYKA 3BSMA 1UR3M 4O1AA 1YKWA 1BGAA 3M43A 5IM51 1OFQA 3ATYA 4J9JA 2GGGA 1P48A 3CLMA 2BSLA 2XHYA 4B5SA 2QAPA 1EUAA 3N6QA 2OX4A 4EAYA 1JUKA 5BOFA 4NNCA 3MBDA 3EWDA 1EBHA 2WBAA 3CL8A 1ZJAA 2FDSA 2A7RA 4DBSA 3KP0A 4PUUA 1Q7QA 3NCOA 1XH1A 3NZPA 3N18A 3URNA 4CNUA 5AC7A 4LAOA 1E4LA 4RNIA 3PZOA 1K8YA 1T3QC 3AI0A 1XYCA 1XIMA 1JGMA 2DSKA 3C2FA 5DY2A 1GOMA 2HBXA 3S42A 3USBA 3A6OA 1EGVA 1SO6A 3IRSA 4NZJA 4HN8A 3H4WA 1V0KA 3P67A 2FGLA 4S23A 3H22A 4DYEA 3VE7A 1Z3NA 1W9XA 4IGHA 2ZVIA 4B5NA 5EFFA 3BURA 5BU9A 3WBXA 4NP7A 2CHNA 5E93A 1TPFA 5IHRA 2GQ9A 1QK0A 3C0LA 4GZIA 3WCZA 1XI3A 3MBFA 1KLYA 1JQVA 4C6LA 1UWTA 4JAWA 4P2VA 3MYOA 2ZIDA 1LG2A 3NIYA 2V5BA 4OV9A 3A5FA 1W3IA 3E49A 4DZIA 4JCLA 3S83A 1UG6A 3MANA 5DFAA 3W25A 3RRAA 3JW7A 1DHPA 3MCMA 4WY0A 5TIMA 4EWJA 4JTQA 1VBJA 1QO5A 4IL2A 1A5LC 4DRSA 1NP0A 1E6NA 2P0IA 2X16A 4DAIA 1PBGA 4UB9A 1EUNA 3PUOA 5TD4A 2DVUA 3KP1A 2HK0A 3EKGA 1W1YA 1UHVA 2NVKX 3WLHA 1BSLA 1QDSA 1E0VA 3ATZA 1X1NA 4FX7A 5LNRA 3F2DA 1GYLA 5EKYA 4P8UA 1GKPA 3MSRA 2WMIB 1NAL1 1QFEA 3ZWTA 1ALDA 1KKOA 1T41A 3KM8A 4D71A 1KFBA 2EPNA 4C7DA 4UTFA 4NU7A 1EP3A 1JAKA 4Y7EA 5A6AA 3HJZA 4HU8A 4LV9A 1UMLA 4OOZA 2NXHA 2QQ6A 3A13A 1IWBA 1RBLA 3QMTA 1R3SA 2FFIA 4LY4A 3NQFA 5I3GA 1PXGA 2G50A 4LCQA 3TOPA 1XDJA 3PY2A 4C7GA 2KAUC 1WBJA 3R8RA 4XD6A 2EG8A 8XIAA 4J3UA 3VDGA 5K2ZA 2NV1A 1FHVA 1M53A 3LM3A 3UERA 1ZJIA 1JZ3A 3CXBA 4CU7A 4RZ6A 3SQPA 4UTTC 1TA3B 1QATA 1XSKA 5G2HA 1UYQA 4XZWA 5K9CA 1FWRA 5E6ZA 3UCQA 2CFFA 5I23A 3QPYA 4JIEA 3EZ4A 3DG3A 3MVIA 2C1IA 3EDEA 3ONBA 5EMYA 4AHQA 5DRIA 3TW6A 4JKMA 3NVVB 2PP1A 1MW1A 3EWBX 2BHZA 1HNYA 1ZJBA 5A95A 3A7UA 5M1TA 1RQEA 3MJMA 3NSMA 1YE4A 4QG6A 1TVPA 3U7VA 4JZ5A 4WR3A 4OIFA 1XUZA 2DZAA 2JEPA 4JTEA 1E55A 2Y8VA 1V0NA 2A85A 2OCZA 2XU2A 3LTYA 3SBFA 4XV0A 3VNJA 4EXBA 4WSJA 3P60A 4PYSA 4GR1A 3HURA 2RDTA 4L1GA 5T26A 1OCJA 3UXKA 1TYTA 4OTKA 4QE1A 3DHPA 5D32A 4MUPA 4HA4A 3GHTA 3B8VA 2PDNA 5E9AA 4X0VA 1H3GA 2Z1WA 4GIEA 3SGZA 1LP6A 1FWIC 2C3DA 3BMWA 4N42A 4JYDA 4GIAA 5JRBA 4V2XA 1BWVA 2CCRA 3ZJKA 1Z42A 3AIVA 5CSRA 1G0CA 1LJYA 1QW9A 1UW9A 4UTWC 2E6FA 4CNSA 3FA4A 1IR2A 3N15A 3F5JA 1EZ2A 2VRKA 2OOFA 4M24A 2NWSA 3LRLA 2WKLA 4H4RA 4GIRA 3APGA 4IFRA 3FJ4A 1DQXA 3S46A 1W3TA 1V7AA 1O95A 5DT7A 3V16A 3B3DA 2UY4A 1YPIA 3N04A 5LIUX 4C6PA 2PGRA 2QCEA 3GHRA 1RJPA 3AMCA 1FWFC 1QK2A 5FJIA 3RNDA 2GJRA 3CTTA 4EPKA 4H4QA 3W72A 3CQ0A 4G8TA 3TXZA 5HR6A 2I1OA 4UWMA 2ACQA 4ERGA 1B57A 1KD0A 3LLDA 2J88A 3FHQA 3K1GA 3I7RA 3DK9A 5CGQA 4TO8A 3RX4A 1FDJA 3UGRA 2PTXA 3VZXA 3GS6A 3I4EA 4IUGA 4XWUA 3WIJA 4MPKA 1JD7A 4IISA 1M7XA 4J5NA 3OLGA 2OEJA 1UOKA 5LNWA 3H2FA 1TV3A 4ZXOA 4IQEA 4DUXA 1GT8A 3KBWA 1F6PA 1GQKA 1W0MA 3OA3A 1B5TA 3CGEA 3EPOA 2G3MA 1PPIA 3TN6A 1R8LA 2ALRA 2PTDA 3TOYA 4AD4A 3ARQA 1KNWA 2Z4GA 4ZCWA 3P84A 1JPHA 4CN1A 3WL1A 2Y8UA 1RD5A 2DORA 2Y61A 3L67A 3UPMA 4Q32A 4ZA0A 1OIFA 3LI0A 1NPXA 1B1YA 2V8ZA 2C19A 4MLJA 3RM9A 1OGSA 2G3IA 2KZHA 2E8YA 3QZEA 2PZ0A 5TR3A 1JXJA 1QNPA 3EWXA 2INEA 3EWZA 5K7JA 2Y7GA 2VYOA 1UWIA 1TVNA 2E1WA 1AJ2A 2NXIA 2YL8A 1XM3A 2X8CA 3KBVA 1H7XA 4TX6A 4ZR8A 4GJJA 4PMJA 4DJFA 2ZZ3A 9RUBA 5EBAA 1XYBA 1M6IA 3W6LA 1JAEA 3TN5A 1X8CA 3UR8A 2PBGA 2XUCA 2CIPA 4CD4A 3D47A 1BTMA 1TIWA 1NP2A 3GE7A 3ICJA 3GXNA 3THQA 5ABGA 2ZBTA 9CGTA 3RCMA 2OGJA 5HMEA 2BHUA 1Q63A 5BCAA 1G7UA 3PK7A 1XXXA 3W1MA 1Y8BA 3Q4DA 5G1YA 1JZ8A 3GVQA 5PTDA 1L6WA 2GGJA 3M41A 3IAPA 4NNAA 5ER0A 4MWAC 2DFAA 3RO6A 3TROA 4XZIA 3DI1A 4JKKA 4H9TA 3W9ZA 4H8HA 2W79A 1L8NA 4JY9A 3RR1A 2NUWA 4PTXA 4S3BA 3GHUA 4RXFA 1A3XA 1LDCA 2J7HA 1LLOA 1ELSA 2O9TA 4AAJA 4ZFMA 2BFGA 2YDRA 3IJDA 2V3DA 1D3CA 3T42A 3PUDA 1GHRA 4DNHA 4S3JA 2VRQA 1XR2A 2OKTA 1KBJA 1K7FA 4RK8A 3UJSA 1B9BA 5H1WA 2VFFA 2VCAA 3M0JA 4UQDA 3M4HA 2QAFA 2X1SA 3GH5A 3MDWA 3D0CA 1TTPA 2QCDB 2J77A 1XYAA 1SR0A 4NX0A 1B3ZA 4AYGA 4WDUA 5A6KA 3IUHA 2W92A 3LXBA 4WOZA 1ODZA 1V7YA 5HJYA 1MXGA 2UY2A 4W8LA 4HA0A 1U2YA 4UCFA 5XIMA 3K8MA 1A3HA 2P8BA 4RDVA 1KFKA 3NM3A 4F0SA 4CD8A 2C15A 5I03A 3QOMA 4DF0A 3R13A 3FGCB 1V3KA 4K3ZA 4ZQMA 3F1QA 4HNLA 4EQRA 3CGCA 2XGBA 3G6MA 1L6SA 3WDJA 2PDCA 1WCGA 1FOBA 3MZ2A 1F3WA 1A5UA 2BXZA 4AY1A 4MZYA 1Q6GA 2Y24A 4Q7BA 3MKVA 4JIPA 3BW2A 2DUZA 3IVSA 5AYZA 5DANA 4XO6A 3EB4A 1EC8A 5I3FA 2ZX8A 3KZSA 3BCJA 4V27A 4YYFA 3I6RA 1E9LA 3EF6A 1W5OA 3N25A 4XISA 1G94A 3FLUA 4FB7A 3NQEA 3EDDA 1E43A 3TXVA 4EQXA 1OVDA 4FIQA 3L65A 3G1FA 4CD5A 5C7HA 1MW3A 5GJMA 1EQCA 1EF2A 1RK5A 2XH4A 4IJRA 5CZKA 2FHCA 3LTPA 4YHEA 3SRFA 4A35A 4L9XA 3VDAA 5DY3A 5GNYA 1BZLA 1JPDX 3CUJA 2PDQA 3WBYA 3BAYA 1FWGC 1AW5A 3GNOA 4PUDA 2JE8A 3L5AA 3ANVA 3W26A 4BK9A 1BVWA 3UFYA 1KQZA 4O0QA 4UFMA 4Y8FA 4UNIA 1EWDA 3B8SA 3NZQA 1O60A 2E6AA 4A8LA 3TQPA 1FA2A 1ZZMA 4F4RA 3LGDA 3SY5A 3RMJA 4DJED 4KT2A 4K6AA 5KMYA 2DJLA 4DIAA 2C79A 2BDQA 1XC6A 1KBKA 3AOFA 3NG3A 2FTYA 4P7LA 4R34A 4LBRA 2E09A 1DV7A 1W9VA 4A2RA 2Q6ZA 5JCIA 2ZXQA 4FIRA 3AWNA 2CLEA 4TU1A 3T8LA 4UR9A 3EPMA 3RRXA 1D7FA 3T0AA 1ZP3A 3A4XA 3AALA 1J2BA 3T2PA 3SCSA 4QJ5B 1VPQA 3C2RA 2ZUNA 3DKJA 4A8RA 3L0NA 2CESA 2R1MA 3DERA 3KVJA 5ABFB 4ZFCA 4EM3A 4U4MA 4J57A 3LOTA 3A4JA 2A7NA 1XIFA 1ITXA 3GC2A 3A7RA 1NIUA 3C0SA 4AEOA 1MEWA 3W2LA 3Q45A 3CUFA 3PTQA 2OZ3A 1Q45A 1JI2A 3QW3A 3V35A 1N63C 4YU1A 3W7DA 3WQCA 3VNLA 5EBKA 1R87A 2ZDRA 4GPNA 4L4PA 2OU4A 4WJXA 2DZUA 3B40A 1XIIA 1H63A 1GG1A 3DDMA 1H41A 2FVKA 3AYVA 3T0BA 1O1HA 2VMFA 3WQFA 2G3NA 4W4QA 3G5EA 3UWEA 1ICQA 1QOXA 1TPDA 3LCIA 3TW7A 3HGJA 3SUWA 5HNUA 3KWXA 2HV5A 1F8WA 4UUIA 3HPXA 3OBKA 4MZ1A 4IFOA 3UJFA 4PUJA 1RUSA 1VEMA 5C54A 1OFBA 5AYIA 1AW1A 4LUTA 3WDPP 4LYPA 3G3MA 1E6XM 3KOXA 1FFUC 4N9EA 3HGSA 5IFPA 2V82A 2IKGA 3GNNA 5GPRA 4OUEA 3WQPA 1W3HA 4R3UA 5FEWA 3VAVA 4S3FA 5EPDA 3S2CA 1I2RA 1D8WA 4IF2A 1IR1A 1RD6A 4RUBA 1RR2A 2F6UA 4R33A 4GVIA 2ZRYA 4PODA 5EMUA 1JXKA 2TSYA 1GYMA 2G96A 1P0KA 3CL6A 4KEVA 1HVXA 3IK4A 1JPMA 1VYRA 4H9UA 2VI0A 4PTDA 5FJPA 8TIMA 1XKJA 3IJ9A 4NRRA 1PYFA 4ROPA 4ACZA 1NEYA 4XG1A 4D8AA 1ZCCA 2XFYA 9XIMA 4YTQA 3I68A 3MP4A 3PUGA 4GNJA 2I14A 3TMQA 1PX3A 4ML4A 4O1DA 1UUOA 3CZEA 3IC9A 1XYFA 2CLIA 2VZTA 2HK1A 1GVIA 2QCLA 1NU5A 2ZZ6A 1HKWA 3CT7A 1HKVA 3P7YA 3F4NA 3URBA 1LWHA 4K39A 5AYBA 2QULA 3KTSA 2YX0A 3GFZA 4YJ5A 3DFTA 5GNZA 1GYNA 2DW7A 4ZSTA 1OADA 4UCGA 1NFGA 3DC0A 4U2ZA 1W8GA 1ZALA 2FGZA 4HZ6A 5G5HB 1NFPA 2VGBA 1AH0A 4DJEA 1VZWA 1C92A 1J0IA 4B16A 3SCUA 3M0ZA 1XIGA 3Q94A 4DUWA 2E40A 2YB4A 3VIFA 3EXTA 2I9EA 4DPQA 1XQLA 1MW2A 4GXWA 4LNYA 1CIUA 1EF3A 3MUY1 5FF2A 2ZVRA 4GD0A 4Z0JA 2E5CA 2WWDA 2O9OA 4KETA 4MFDA 4CNTA 2J47A 4H9ZA 3M47A 3D6NA 4DO4A 1IGWA 2X09A 1IEXA 1N61C 2EKCA 3ZS4A 3ZYZA 5CJNA 2VC9A 5F1UA 1X1ZA 4FLOA 1E6RA 3OPSA 3O6DA 1A5CA 1BYAA 3WF2A 4O11A 1PHWA 3Q58A 1EOMA 3U5YA 2W4XA 1CPUA 1MVYA 2A21A 3R07C 3KBJA 1J0ZA 4F9JA 3NR0A 3PPFA 2PZNA 4FZIA 3HQPA 3UU0A 4OOUA 1F7BA 4GUGA 3GR4A 4B3ZA 4QJ1A 1OT2A 1E9IA 4GNKB 4QJ4B 1MRAA 4Q8QA 4WEVX 3FEMA 3QC3A 3C86A 2F2HA 2HS6A 5HMDA 3GDMA 1KM6A 2ONEA 4JFTA 3HG3A 1V6VA 5DMYA 3TTSA 3UGVA 4JXCA 4ZENA 3GC5A 2RKXA 2VWTA 4N9BA 4ZTYA 7ODCA 5TNVA 3WLJA 3RPDA 1XLKA 3M0MA 1R9ZA 5CPQA 3A3XA 4B5UA 1NY1A 5I2UA 8XIMA 1J10A 2WZEA 4N6EA 5C9WA 1O94A 2A1YA 3DG6A 4GABA 1VENA 1HJQA 1IIHA 2V3EA 1K02A 4UFKA 3KVMA 3E2QA 7REQB 3UCCA 3MMDA 2Q01A 2QGYA 1IV8A 1PB0A 2OLSA 4QAIA 4D9PA 4YCPA 1WZKA 3A4WA 3D46A 2FTWA 2DZWA 3S47A 4OWGA 3W7CA 1NQ6A 1XSJA 3NQAA 3JR2A 3GIQA 5GQBA 4ZB2A 4LWWA 1XHGA 1DXIA 2QJJA 3L9CA 3EMQA 4LS2A 4F79A 2FZ8A 3HMJG 2QCMA 2Q8ZA 3O0HA 3TAOA 3BOFA 4C6CA 4N4QA 2QHAA 3M5VA 1A49A 1E4MM 3LSBA 3WLPA 4CCCA 4NG3A 3TYBA 1JUBA 1SGJA 2C71A 2FZBA 4IG2B 3G8EA 1CTNA 5FMHA 2NQHA 1ITQA 3VMNA 5K4ZA 3WNPA 3G6LA 1KLZA 4X22A 1ICSA 4H9YA 5FS8A 3DUGA 1OX6A 2WZTA 4H00A 3DK4A 6REQB 4PH6A 5HPOA 1XQKA 4Q7IA 4JNYA 3R79A 3TTQA 4ONVA 3BOXA 4W89A 1DJYA 4A8NA 3LYEA 3DXIA 1E5NA 3PP7A 4DBEA 3R43A 1JUEA 4DBDA 1GWJA 2BXYA 1W1VA 3R0UA 4JTDA 3CHEA 3YPIA 5LSMA 1E0UA 3FAWA 3N73A 2BMBA 4JD4A 5K4XA 1RK6A 4X60A 2GSEA 3WKZA 3HOJA 4TX9A 1BEUA 5BXPA 2Q09A 1B4EA 4YXGA 1WDPA 3CIXA 1GTEA 1GVOA 4K38A 4E4UA 2H90A 1UH3A 5CLWA 1DWFM 4PUEA 1VFUA 1GPFA 1WAWA 4UR7A 1JFHA 2JF7A 2Z1XA 1HUVA 3WENA 3AUOA 3W86A 3S9IA 1GOOA 5G4WA 4AU0A 3QMSA 3RILA 4HNTA 4LPCA 3LV6A 4FX8A 6ALDA 3TMLA 2VXNA 2PRMA 4H9VA 1WUFA 1CNVA 1Z9AA 3W7KA 1Z7AA 2EO7A 2XIIA 3M0VA 3PZMA 1G9HA 3UY8A 2WW5A 2QXWA 1E9YB 1QPKA 2PTWA 5JCKA 1TJRA 5DXXA 3L5MA 1R2TA 4J3SA 2J8FA 4RJEA 2WOIA 4PE8A 4NZ3A 3H54A 3KOYA 4CQCA 1W1A1 5CBIA 4QE5A 4WXYA 3IPWA 3M5ZA 3BXWA 2QR6A 2ZX7A 1E40A 2PRLA 1MQQA 3W27A 1C7SA 4C6BA 2XH0A 3FVDA 3LHYA 4GRTA 1OX4A 3CU2A 3S1GA 4PUNA 4HJFA 4H3DA 2PURA 3EX6A 1GKRA 2P50A 5F7UA 1SFLA 3WNLA 3SIMA 3H7VA 4J1OA 1KTNA 2CXGA 2RDUA 1KM0A 1BLIA 3IK2A 4RW3A 3VMPA 4GVFA 5A2AA 3EBVA 3NL2A 4EXQA 1YIXA 1ZP4A 5A2CA 3MUIA 1UR9A 2AAQA 1LQ0A 4HPNA 5D30A 1ZDLA 3KLLA 4WOQA 3VD9A 3VKCA 1NFBA 5FF3A 4OBRA 1KBBA 2Z2UA 2WYSA 1DNCA 5JQ9A 3M7WA 3SFKA 3GXMA 5FI8A 3VX0A 2G3FA 4DBUA 1LWJA 2QUUA 1H62A 4MJ4A 4G7EB 1FCUA 4O1CA 3F2CA 3LU2A 4U33A 1AA1B 2I56A 4K1GA 3BAXA 4GXPA 1BTCA 3RPTA 3IGUA 3B97A 4ERIA 4Z08A 4BQ2A 3AIWA 4RZBA 2NUYA 3DFSA 1F2JA 4L56A 1V0MA 3VINA 1X98A 5E0CA 3NQDA 2VZOA 3R2GA 3AS1A 2VX7A 8A3HA 1FWEC 3L4ZA 1UOZA 4CVUA 4PB3A 4YVVA 3AZTA 3K4AA 3ZSTA 4Q4MA 4XIMA 4JHMA 1LL6A 3R8HA 3SCNA 3AZRA 2GR0A 3NRZB 4JS3A 5AKQA 3W0KA 3TJXA 4QQUA 2F5ZA 2ASHA 1UJQA 7TIMA 3OGVA 4V28A 3KLJA 1K77A 2IS7A 3P93A 4D1IA 2ATMA 3PF3A 3LXDA 4XUYA 3FY1A 5ABHA 5AB3A 4MWAD 1UPMB 4KH2A 3ALFA 3WK1A 1P0BA 1EJTC 5A3HA 3OOQA 2EBNA 3ISIX 4MGGA 3P0WA 5KVHA 1S1RA 1OFDA 1V97A 1F61A 4MDOA 4ZQRA 3LMZA 1AH3A 2AGKA 1OK4A 2A3LA 2BNJA 2A0NA 2H8XA 1LRNA 3CASA 3BW4A 2PE4A 4I3GA 1W2PA 4IL0A 5BXRA 3A22A 4F40A 4KWUA 1OFOA 1QPOA 4PBGA 1RCQA 4L9YA 4YCOA 3HA1A 5KZEA 2ZZ4A 2Y8KA 3B8UA 5HULA 4OZOA 3M16A 3CPUA 3AU6A 2VP8A 1G1YA 4J56A 1XGDA 4MY8A 3H4KA 1P43A 2WCSA 3A9IA 2WVSA 3DHUA 3Q2DA 1YNYA 3OQEA 3E6EA 1ISWA 3GBEA 1YTKA 2D2JA 1I0BA 2C8NA 4BF9A 2YCLA 3VC5A 1PAMA 5EMKA 2GJNA 2NLYA 3O0FA 4A3QA 2EQ7A 3BTNA 3STFA 5D03A 2XDFA 4QLLA 3VCNA 1YQZA 2OJPA 2ZX5A 2GH5A 3AN1A 2BY2A 1ZU8A 3IARA 4S1FA 4AX7A 1YYAA 3QZAA 1FWSA 1XISA 5D37A 5ECVA 1UC5A 2FZDA 3GDKA 4XZ9A 1W3NA 2VC6A 4HZMA 3RM8A 1OGBA 1QASA 1XDLA 3OVQA 3W81A 3FN9A 5RUBA 4P7NA 1NWUA 4FP1A 3TTOA 2GJLA 1ZL1A 1TCDA 3AISA 2IPJA 1VFSA 3R11A 5HMFA 4FOUA 2FDMA 2WSKA 3OGRA 4QSFA 1OQFA 3SQSA 4DPPA 2VR4A 1MUCA 2JGYA 2PI6A 3NYDA 3SRHA 2CW6A 5G4EA 2J24A 5HR7A 4W93A 1ZX9A 4DBWA 3HRDC 3B0YA 3ZWSA 2PTYA 1Q4WA 1KBIA 1ZHAA 1F6KA 3XINA 3RLUA 1YHTA 2GVEA 1L6GA 4PEEA 1OZQA 1TR9A 1DWIM 4E8GA 5IBXA 1A3WA 4GFIA 1CT5A 1E72M 3FJLA 1E4NA 3AXHA 2YCLB 1VQTA 3G0SA 3PPGA 1Z8AA 3QQ0A 3CTLA 3W71A 2VD9A 3LSCA 3N2OA 2H6RA 3T81A 4UQBA 1UP3A 1RVKA 1V6YA 4E6MA 3KE0A 3H2OA 2VEMA 3ITOA 4BKNA 4MZ8A 4D6GA 4Z2GA 4O18A 1HJVA 4RE2A 1O66A 3KW3A 1GW1A 1UUMA 4DEFA 1FWCC 3AMLA 1EIXA 2VELA 5I09A 3LQLA 3JZEA 2ZWYA 1M6JA 2PSNA 3GIYA 4Q8UA 1AL7A 2OOGA 4DM2A 1IXNA 2XGIA 4J35A 2Y85A 3RO8A 4EXAA 4K8GA 2BVWA 3O63A 4LAZA 2CLPA 1X7IA 5D05A 1W5QA 4AXNA 4Y9PA 1K8XA 4ADUA 4XTDA 1PKMA 2Z7KA 2W55A 2V2DA 3LBMA 3URAA 2ZICA 3HGOA 4AC7C 1YTEA 4GK8A 4RPQA 1FXQA 2J8TA 4QM1A 5KETA 2AQOA 3CNYA 1HGWA 4B90A 3LADA 3PUEA 3VDHA 4HA1A 2Y62A 4Y9MA 3T0DA 3ORWA 4UQAA 3SJNA 1BQCA 4ZOAA 3W6MA 3PJTA 1GHSA 5T8GA 4E38A 1P5BA 3H12A 3GVWA 4LC6A 3CAVA 3C2EA 1ZBCA 2ISFA 1YXDA 1V02A 4GGHA 1WKYA 3QSTA 1H7OA 3G24A 2QDDA 4BEUA 3W2JA 4JFVA 2G97A 7PTDA 2WHJA 3QGVA 1MZHA 4UZSA 1KGXA 3G22A 3ZQ9A 1EHNA 4UQ9A 3P82A 2Y5JA 1I1WA 3MMUA 3UPBA 1J8VA 3VI2A 2NLIA 1HGYA 4DJDC 4DJDD 1EJWC 2C1GA 3TH6A 4I5XA 1VYSX 3HG2A 2I7GA 3F7JA 2PDHA 3GX9A 4C6EA 4BZYA 1TJ1A 4W85A 1EBGA 4OQVA 4HPJA 1MZRA 3ZSSA 3BLIA 3ARUA 3O6AA 4XD3A 3M5XA 1VRDA 2JFEX 2NUXA 4NNBA 3GFYA 1H4PA 3BG3A 3M7SA 2BLEA 1O1ZA 1NWTA 2X0HA 1WE5A 4M29A 2EAWA 3KHDA 5DRCA 5G1MA 4EX4A 3WQ5A 3IGSA 4DQWA 3T7VA 1GVSA 1U83A 2VVSA 3W74A 4TTUA 3A9BA 5JBEA 2HWGA 4QX4A 1VFTA 2Z1KA 3V5FA 5CBBA 1J12A 4LVDA 5M5DA 1HW6A 3W2UA 2HVNA 3BG9A 3SI9A 3W1RA 3O06A 4JNMA 4W7VA 1DIKA 3PANA 2BV9A 4YWIA 3DFNA 1FO4A 3V18A 1J0HA 5A6BD 1M7PA 3ZOAA 3W85A 1UD5A 1F8IA 4W7UA 2GR3A 3CZLA 3W70A 1SR9A 3K2GA 5IFTA 3AUJA 1OYBA 4G1KA 3KS5A 3VOJA 1TPVA 3FDKA 2CDUA 4PBFA 1SMDA 1BGGA 1YLVA 2NQJA 3CQKA 2AMXA 1YXCA 4RNHA 4HPXA 2QUTA 1E6PA 4DWSD 3A21A 5GRTA 2GJPA 2VUYA 3C8NA 3VIKA 3BLKA 4ICCX 4Q4KA 5HQEA 3QFBA 3VNDA 5CC5A 4JX5A 2VX5A 4LVAA 1H60A 3NDOA 1V03A 1M65A 2VEFA 3VILA 2ZUVA 3CLWA 1UZ4A 3TJLA 2F84A 3GTIA 3NQGA 1HX0A 2PRHA 3VTRA 4K8EA 1KFJA 4UOJA 3QOKA 4F0KA 1V77A 2W3SA 1DXLA 4RE0A 1GQLA 2J66A 1P7TB 2R6OA 3DGRA 1ADDA 2OT0A 4WHBA 2DJXA 1E56A 1EEPA 2BGQA 2F7FA 1HO1A 4IPJA 5BRPA 5G5GB 1FKWA 5AZ1A 1IZCA 3WJSA 3MSYA 1FWHC 3CWOX 3T44A 4NQ1A 4ZE5A 2A5HA 1XPYA 1AMYA 4GYFA 2B7NA 2A3CA 4M8UA 3HPSA 1WDDA 3QGAC 4ZODA 4A2SA 3UW6A 1VHCA 2E0PA 2A3AA 2FJUB 5I5RA 1O5QA 3KCJA 1KC7A 2SFPA 4LVGA 3TSBA 1K3UA 4I7UA 3PULA 3PJWA 3T6CA 1HIZA 1ONXA 2OEKA 1RVGA 2FZNA 2JK2A 4C91A 1L9WA 4BI6A 3ETRB 3W37A 1QW7A 2EPOA 3U6WA 2NX9A 1Y65A 2G3JA 4JN6A 2FGBA 5BOOA 1THFD 4OECA 2DY3A 1YPFA 2BCPA 3UBPC 4DXKA 3FAXA 5I24A 5CZJA 1GRHA 2GGIA 5CPLA 2VDIA 3G8RA 4MB1A 1QI3A 5B80A 2J62A 2BC0A 4JTAA 3TTEA 2X41A 5HUPA 5BW6A 2OQYA 2R91A 4C6MA 4Z2JA 4EMIA 1UZHA 3WLQA 1CGYA 5M17A 2D3LA 3GZAA 5C8BB 3WJWA 3GD4A 5K3VA 3IIZA 1OYAA 4ICNA 4KERA 2Y7EA 2CBUA 4E5TA 1FVPA 5D9NA 3WH7A 2PDGA 1EHAA 3VNKA 2GPTA 1P6WA 4RZ5A 3FYYA 4K37A 4Z2HA 1YRRA 2YCEA 3L4WA 2WMGA 6ENLA 5DMLA 4YL2A 1F3XA 3A3WA 3BG5A 1Q6OA 2PF8A 1RALA 4DXXA 3VUPA 3SY1A 3GG0A 4B3LA 3IJ7A 1R3TA 4GCAA 2ABAA 3DIPA 1M04A 4PC8A 2V5KA 1Q6EA 1UROA 4H2HA 5D4YA 5E0FA 4B5XA 1XANA 5C7VA 3POCA 3ALGA 1DQWA 3GVGA 3A5VA 1E51A 3QHMA 3GBDA 1K9EA 4FOKA 2YDAA 2REQB 4H19A 3R5EA 1R3RA 1JPKA 4BF5A 1EP2A 1WYGA 5DLCA 1UWSA 2J74A 3PTDA 2R9RA 3VIIA 2ZFAA 2ZTJA 4BQ5A 1R86A 4D1JA 3WJXA 3WQGA 1LRQA 4UMAA 2HZGA 3TYZA 4Q4OA 3QRHA 3WD1A 1PEZA 4E4PA 3LUTA 4IQDA 2V5DA 4PTWA 3ZJ8A 5I0DA 2YQUA 1V8EA 3LTSA 2CEQA 1GTHA 1A50A 1NM9A 2XJ7A 3O9NA 3OHMB 2EKGA 2UV8G 4ICMA 1OC7A 1GNXA 4U5KA 5G2IA 1EA9C 1RHCA 3UD6A 3SCPA 2EPLX 3VFLA 5L9FA 4A05A 3M9YA 1VAHA 1EJXC 2O9RA 4NXKA 2WLZA 1KBLA 2X2GA 1K7XA 3WJZA 1B31A 1VFFA 3PSVA 4EPBC 3LGEA 2QCHA 2PC8A 3PFRA 1KCZA 2QMKA 3V5OA 1K8CA 1UC4A 1IWAA 3GH4A 3ZT6A 1W1B1 4POCA 3SQLA 2FHFA 4WK9A 3APTA 3IGXA 3HQ1A 3QM3A 2ZRZA 3PVFA 1IWPA 5BMWA 1UKQA 2CETA 4MY9A 4KS0A 5JCLA 3DBNA 2WV8A 3RIKA 4JTJA 4X63A 5U25A 3EEGA 4AY7A 4FLQA 1DJIA 4DAFA 4HGXA 3P81A 2QAEA 2QJMA 4PFMA 4IGNA 3QV9A 4TV5A 3SZ8A 1UMYA 4XX6A 2H9AB 3CUXA 2IPFA 3ZFHA 4AZCB 3LMYA 2NSOA 5T9CE 2PWFA 1TPWA 5HATA 1AQMA 4PMQA 4LAUA 3GTHA 4M6QA 2O0TA 1P0NA 3LZ3A 2XFWA 1BQGA 4ACZB 1GRBA 1Z41A 3O8AA 4PMVA 2NVDA 3N17A 1S7MA 2XISA 1MFVA 3TA6A 5EB8A 5CC7A 3QFAA 4H4XA 3E0WA 4YPJA 1PX4A 3SUTA 4B2DD 5I79A 4K7YA 2DT0A 4AW7A 3VIMA 3N4AA 4UTTA 5IHSA 1NDAA 4UC5A 3TC6A 1JIBA 2PBOA 3N9KA 5IOBA 4K2SA 2OWCA 4HSOA 3BMXA 2EQ6A 1OINA 4I8DA 4JN7A 5CAKA 3UXLA 1GVFA 1M5WA 4FNRA 3DK8A 1B3XA 4DJEC 2A79A 3OIHA 5FL1A 4AEEA 2B4GA 3W82A 1BXNA 4O1FA 5AHNA 3W7HA 3QQWA 1XGZA 5HWJA 3GDRA 5I3HA 4GI9A 1ISVA 3EGJA 2F6KA 3H6OA 3SEPA 5L6UA 3AMDA 4CNPA 1R7AA 2QCDA 3AMZA 4GCXA 1F05A 4MB3A 4DVOA 4KRUA 4LBUA 4AYSA 3WQ8A 4P8XA 2G0WA 4K7VA 3O15A 3GSMA 4XZHA 3LY0A 2YXXA 2RHGA 1T40A 3HPFA 1C7TA 5HNNA 3SADA 3WQOA 4G9PA 1U33A 3GFXA 4LYKA 3CQIA 3LK6A 1BFNA 5KSWA 1GERA 1TWDA 3CH0A 2VURA 1L2QA 4AIEA 1VGAA 1K03A 4MJMA 5CC6A 2QVNA 3KRBA 2WBKA 1FTXA 4GO8A 1OSEA 1BKSA 4DO5A 4LRSA 5LA1A 2Z2AA 4GACA 1DORA 3RU6A 1Q13A 2YLAA 4AISA 2DH3A 3A3HA 3VOIA 2J6XA 5G5IA 1XHCA 3N2CA 4KIEA 3PG8A 4W5UA 4CN4A 2XPKA 2YBUA 3ABOA 3U5UA 1XG3A 4DYKA 3VUSA 1BWKA 3EAOA 4DF2A 3MP3A 2HVMA 1OJXA 2QUMA 1CLKA 1S2VA 4JL1A 1ZPTA 2A6NA 3OO2A 2V5CA 1XLEA 1TCMA 5MF5A 4JN8A 1RLCL 1GVRA 3WUEA 1B54A 4R9OA 3UJRA 5FA5A 4YTUA 4GGBA 4HU0A 1TMHA 2RDXA 2ZUWA 2E3TA 2DQXA 2PD5A 1JCNA 1WYIA 2YJQA 3CWNA 2OLAA 4Z1AA 2NVAA 3MHGA 4F0HA 4C1LA 2D69A 4XB3A 2JEQA 4QEHA 1ZB5A 2XVNA 3BAWA 4QROA 3GR7A 4TOQA 5FS7A 1FDYA 3S8HA 3OB8A 1EP1A 1T5AA 3AHZA 1SB3B 4CCDA 4PMRA 4KPLA 3BZGA 2PU1A 5IBXC 2JGQA 3ARYA 1SJDA 2OSYA 5DBTA 1LL7A 3FW6A 5I3JA 3OLDA 3MO7A 3UWZA 4KGLA 1ECQA 3FJNA 3W2NA 2VFEA 3OG2A 1VD6A 1XBZA 1IEVA 4A21A 2Z00A 2BOGX 2QV4A 3OLIA 4F9DA 3OTRA 2G4FA 1J2WA 2HXUA 3RCYA 1JYVA 3WLMA 1UIPA 1MDLA 3W2KA 3AYTA 4C7FA 3IJ8A 2PF0A 3MI3A 1WZMA 3W4RA 1DKWA 2D2GA 3WLIA 5FESA 1EB3A 2PA6A 5D9MA 3F4DA 3S2NA 4H7CA 4Z17A