2PP1A

Crystal structure of l-talarate/galactarate dehydratase from salmonella typhimurium lt2 liganded with mg and l-lyxarohydroxamate
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
395
structure length
395
Chain Sequence
b'SANSDAVTYAKAANTRTAAETGDRIEWVKLSLAFLPLATPVSDAKVLTGRQKPLTEVAIIIAEIRSRDGFEGVGFSYSKRAGGQGIYAHAKEIADNLLGEDPNDIDKIYTKLLWAGASVGRSGMAVQAISPIDIALWDMKAKRAGLPLAKLLGAHRDSVQCYNTSGGFLHTPLDQVLKNVVISRENGIGGIKLKVGQPNCAEDIRRLTAVREALGDEFPLMVDANQQWDRETAIRMGRKMEQFNLIWIEEPLDAYDIEGHAQLAAALDTPIATGEMLTSFREHEQLILGNASDFVQPDAPRVGGISPFLKIMDLAAKHGRKLAPHFAMEVHLHLSAAYPLEPWLEHFEWLNPLFNEQLELRDGRMWISDRHGLGFTLSEQARRWTQLTCEFGKRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-talarate/galactarate dehydratase
publication title Evolution of enzymatic activities in the enolase superfamily: L-talarate/galactarate dehydratase from Salmonella typhimurium LT2.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 138
structure length 395
sequence length 395
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.2.1.156: L-talarate dehydratase.
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2pp1A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2pp1A01
5FJTA 1DTNA 3U9IA 3IJQA 1L8PA 4DXKA 3TJ4A 3MQTA 3VA8A 1PDZA 3VC5A 4HYRA 2PODA 3UCCA 4DWDA 3FYYA 2FKPA 4A35A 2GGHA 2GGEA 1ONEA 2PTWA 5EU9A 1KD0A 1E9IA 2AKZA 2POZA 3IJIA 3B97A 3NO1A 4E4FA 3ENLA 3UXKA 3V3WA 1ELSA 3DERA 3V5CA 2NQLA 2P8CA 3QLDA 3SQSA 4H2HA 2PCEA 2ONEA 2HZGA 4GISA 1IYXA 4E5TA 4J1OA 3ES7A 3H8AA 2AL2B 1JDFA 3DG7A 4MMWA 1P48A 1MUCA 2XH7A 3BOXA 3CT2A 3D46A 3UJRA 2QDEA 3Q45A 3P93A 4JN7A 4A6GA 3V4BA 1XS2A 2PTZA 2XSXA 2QGYA 4MKSA 3VC6A 3IK4A 1WUFA 2OLAA 2PS2A 4ZA0A 3R0KA 3ZVIA 2HXTA 3GC2A 1RVKA 3P0WA 2PA6A 4HNCA 4IZGA 4KWSA 3ZLFA 3GY1A 2CHRA 4IL0A 3RRAA 1JPMA 2XGZA 4GFIA 5BOFA 1R0MA 3STPA 1FHVA 1KCZA 3H7VA 4H1ZA 4FP1A 4IP5A 3THUA 2QJJA 3QPEA 2GSHA 3CAWA 1P43A 3JVAA 2PMQA 3K1GA 3DFYA 4E6MA 4JN8A 3ES8A 2P3ZA 6ENLA 4M0XA 3I4KA 2QQ6A 2OG9A 3OZYA 4GYPA 3TTEA 1YEYA 2QJMA 3MWCA 3OZMA 4G8TA 1XPYA 2RDXA 4GMEA 3DIPA 1MRAA 3OPSA 3RCYA 3N4FA 3ZLGA 2P0IA 4X2PA 1W6TA 2GL5A 1KKOA 2HNEA 4IL2A 4MGGA 2PP3A 3UXLA 1BQGA 1SJCA 3RGTA 3Q4DA 1NU5A 3RO6A 2ZC8A 1TZZA 2PTYA 3FV9A 1PDYA 3I6TA 4ROPA 3T8QA 3UCDA 4KPLA 2AKMA 3NZGA 3H70A 3DG3A 2O56A 4H19A 1OEPA 4KEMA 1FHUA 3CB3A 3SBFA 3KUMA 3N6HA 3MY9A 2PTXA 1SJAA 3UGVA 2OQYA 4DN1A 4DYEA 3NXLA 2PU1A 3DGBA 2GGJA 3DESA 2DW7A 2OZTA 2OZ8A 1ECQA 2PSNA 3DFHA 3PFRA 4K8GA 2PP1A 3EEZA 3FVDA 1BKHA 3GD6A 2AL2A 3UJEA 4EWJA 3R0UA 4GGBA 3VDGA 4DHGA 3IJLA 1F9CA 4H83A 4ENLA 3MUCA 2AL1A 1MDLA 2XH2A 3TJIA 3GO2A 3QKEA 2OKTA 4Z1YA 3S5SA 1MDRA 3CXOA 3EKGA 3OP2A 3TCSA 4E4UA 4HCDA 3VCCA 5FJOA 4GIRA 4YWSA 4GGHA 3CYJA 4A3RA 3PWIA 2XH4A 3T4WA 3N6JA 3N4EA 1SJDA 4HN8A 3DG6A 1SJBA 3VCNA 1EC9A 1KKRA 2MUCA 3RITA 5FJUA 2OQHA 3R1ZA 2ZADA 4HCHA 2QVHA 4ZCWA 3QN3A 2HXUA 4F4RA 3NFUA 4KT2A 4J3ZA 3TOYA 3T6CA 3MZNA 5FJPA 3JZUA 3P3BA 4HCLA 2OPJA 3UJ2A 5IDZA 5J04A 1EC8A 2PU0A 1JPDX 3S47A 1TE6A 3HPFA 4IT1A 3SJNA 2OFJA 2GDQA 4DX3A 2OZ3A 2XH0A 2OO6A 2OX4A 2GGIA 3SSZA 4IHCA 3CK5A 4HNLA 3R11A 3MKCA 3U4FA 3R25A 4G7FA 7ENLA 1MNSA 2PPGA 2MNRA 4IP4A 2OVLA 2P88A 2QDDA 3JW7A 1TKKA 2PP0A 3BSMA 3OW1A 3D47A 3H12A 3PWGA 4M6UA 2P8BA 1EC7A 2PGEA 3PK7A 3TW9A 3ZLHA 4Z17A 5ENLA 3TQPA 3VFCA 3ZVHB 2QJNA 2FYMA 3MSYA 3UJFA 3UJSA 1EBHA 3I6EA 4GYPC 3FXGA 3FCPA 4E8GA 3DEQA 3OTRA 5FJRA 3QTPA 4K1WA 3V5FA 4FI4A 2GGGA 3T9PA 1NELA 2DW6A 1R6WA 3FJ4A 3R10A 2PGWA 5BOEA 4K2SA 4HPNA 3BJSA 3SN4A 4JHMA 1WUEA 3SN0A 2I5QA 3DDMA 3TWBA 1EBGA 3TWAA 3RR1A 3ZVHA 3SN1A 1JCTA
chains in the Genus database with same CATH superfamily
4L61A 9XIMA 1WZMA 2ZZBA 3B05A 1OGSA 2GUBA 4TX8A 4DXKA 3SJ3A 4P7NA 2DZPA 1AJ2A 3GZAA 5A6BA 4HYRA 2J9ZA 3LTPA 4HIBA 3VINA 3EDDA 2DH2A 1EA0A 1YE6A 4PC8A 3LCGA 1G0CA 1Q2RA 2BODX 4TVUA 3CGBA 3VXGA 1EF2A 1AZ2A 4JDBA 3VMOA 3R79A 3A5FA 5CG7A 2PCQA 3TXZA 2ZRYA 2Y24A 4QRNA 7PTDA 1KM2A 2YOCA 1Q66A 2WLZA 4J3XA 1HKVA 2OWWA 3AIRA 5K9CA 3HGOA 1S5WA 3SCRA 3N1AA 3MVTA 4HVXA 3TTYA 1P48A 3AHVA 3PN8A 3G1SA 4U2YA 2BZNA 2VDHA 4D72A 1YDYA 3NGJA 4J3SA 4D8ZA 1EJSC 3UJRA 2CLFA 4EPKA 4A6GA 2EQ7A 3G18A 1VH7A 2V63A 2QUVA 4EX4A 3SECA 2Q8XA 3AS0A 4PMOA 1W37A 3V16A 1E6PA 1PYFA 4K36A 1V7YA 1KBLA 3R0KA 1RVKA 2WYSA 3VDBA 4MADA 1UD4A 1LYXA 2WAGA 4IZGA 3SO7A 5AECA 3V36A 1S2CA 1S2VA 3LCFA 1C3FA 3I3BA 1HKKA 1W56A 1LDCA 1X6NA 3XINA 3GDMA 1XG4A 5ECUA 1FH9A 5CSYA 3C2OA 3SCPA 1W3NA 4FPSA 3STPA 2HRWA 3GTIA 3W7IA 4N2YA 5T26A 5EMUA 4B9ZA 1KCLA 4NSBA 1FH8A 2WW5A 4CD5A 3U7BA 2CBVA 1XYAA 2P3EA 3K1GA 2VCCA 2PRHA 1A5MC 4NZ5A 1Z44A 3GG7A 4PUUA 4UZSA 1R47A 2J7EA 1JG9A 1ZCOA 2WMIB 4ZGYA 4OBTA 2DFAA 1WNOA 4GXWA 1AG1O 1YNPA 4C1KA 1I45A 4QEHA 5DANA 2WBKA 3CEUA 4KPRA 3T0AA 2BC1A 3SIMA 5T9CE 3GTXA 4KBXA 1E55A 3C56A 2PDJA 3E49A 4DWSA 5A1AA 3P84A 4X2PA 2JIEA 3R58A 2AAMA 4O1EA 4A8NA 2PP3A 4Q6JA 4CQBA 2GWGA 4GG9A 4G2DA 3RO6A 3H54A 4HMCA 2X42A 1ZAHA 1EWEA 1NSJA 4ZQCA 3IGUA 2QDGA 3LNPA 3QGKC 5CBBA 2AKMA 1AZ1A 3AHZA 1FHLA 3QV8A 3IV3A 1XP3A 2Y0FA 3W6YA 4AEFA 1CTNA 2E0PA 5DEZA 2IPJA 3TKFA 4GCAA 1JDEA 4H4YA 3SUTA 4A22A 5JQ9A 5AYXA 3DJGX 4OUEA 3GTFA 2O9OA 1PL9A 3RJYA 5CH9A 4EXQA 1I2NA 2UY2A 1EDGA 3S1GA 3FVDA 1BKHA 2F6XA 1HKMA 1NHPA 2XIOA 4EWJA 5I3HA 1CGUA 4KCVA 4V1YA 2Z1VA 4HZMA 3SCVA 1M7PA 2A5HA 3LPOA 5A94A 1RZMA 3QSTA 2ZRWA 1F05A 2Y7GA 4E2OA 3P61A 1Y5XA 4CN4A 1TTQA 3MKKA 1AQHA 4NYUA 1DQUA 1DWIM 2G95A 4CQ8A 4HHMA 4Z2HA 5DBUA 3KS5A 5AN7A 3SGUA 3STEA 1VR6A 4F2UA 1VFOA 1GNXA 1LRNA 3DENA 4EF8A 3GH5A 4J27A 2GR2A 1TPB1 2GFTA 3AC0A 1VFHA 3EOEA 4YCOA 4ML9A 3PPCA 4RV8A 2J7FA 4GVHA 4WEVX 2Y8KA 1CYGA 4CNPA 1B9ZA 1E5NA 4YL2A 5BRPA 2XPKA 3TYUA 1MW0A 4S1FA 2OSXA 3SSJA 5M1TA 3EWUA 4V15A 4XO6A 2OEJA 5C6MA 2R14A 5CLWA 3HZ3A 2XSBA 4X9YA 4DJEA 3SCNA 1YDOA 2HPIA 4HOZA 4D8LA 1E15A 3P8JA 4N9CA 3B4YA 2QCDA 4ZODA 3WIJA 5BNKA 1KRAC 2R82A 2GVGA 3ECQA 1LRQA 1HJSA 3DFTA 5KEZA 1ZUAX 4G1KA 1DWHM 3TQKA 4EIVA 3GUWA 1RBOB 4Q8NA 4NEWA 2EBNA 4Y96A 1VFUA 3B8TA 4DYKA 1HF6A 1SPQA 4HNLA 4EP8C 4KS0A 5AHNA 4O18A 4O54A 2GDUA 2VURA 3BMVA 1DWAM 3BMWA 2NZLA 5D9OA 1TG7A 1QJWA 1UB3A 3VIKA 3BANA 2B7PA 4F9DA 3TC6A 4K3ZA 2FPVA 4U3AA 3D47A 3H12A 3C0LA 4DNMA 2F84A 3L0KA 2FZBA 2HISA 2G3JA 1OABA 2PWHA 4D6HA 1XC6A 1LWJA 4N02A 1P0EA 1GQIA 1X1NA 4HKPA 5D03A 3W1NA 3VPLA 1FWAC 3UJSA 1F3PA 2QPUA 3WLTA 4HQVA 4DM2A 2GK1B 1LL6A 3VNLA 3UWZA 2RKXA 1Q6DA 5AHEA 3VOJA 4ASTA 4AU0A 1UD8A 3AN1A 1WXZA 1H1ZA 2BTMA 3NRZB 3LPGA 3W1UA 4CQDA 4JHMA 2B7NA 1CLKA 2Q8LA 2E5DA 1TWIA 3U4AA 1EBGA 1QTWA 2YDSA 4E38A 2I5IA 3BOFA 4PFHA 1Q7MA 3RR1A 2HWGA 5DY2A 2NQ9A 1WAWA 3II1A 5BRBA 4KIEA 4C6NA 3P5YA 3QV7A 1WXJA 2KAUC 4DNAA 3L8KA 1H5VA 1FWDC 1GKQA 3FA4A 1S3TC 1W0MA 1H50A 3TQVA 5D04C 4X0VA 2V30A 5JIWA 3EANA 2V3DA 2OOGA 1RQHA 2WPBA 3Q67A 3JR2A 2E9BA 1SM9A 3T0TA 3AUJA 1JD9A 3M0KA 1R2TA 4LIIA 2X1IA 2O92A 3GRTA 3WF3A 2PAJA 5T8GA 4O10A 1QXLA 3AIWA 3F5LA 4LB4A 4YTRA 2WOWA 4AVOA 4W5UA 3UR5A 4C6QA 3UZWA 2XIIA 3H8AA 3BAYA 2WBGA 3LXBA 1JDFA 1JGIA 3DG7A 4CD6A 2OCZA 1JXKA 1NJJA 4N4QA 2Y8VA 3CZKA 4HNTA 4DJDC 5KITA 3ITXA 3IK2A 2NXGA 4D1JA 3GZ3A 1QFEA 3ZT7A 2BVYA 4XAZA 2DJXA 8CGTA 2CETA 3L5AA 2WHJA 5DCDA 1JYWA 4ZVJA 2VZUA 3EDJA 2HEJA 1UUMA 5U1OA 1XDIA 1KTCA 3UWVA 3T55A 6REQA 1T8XA 4LF2A 5FESA 1R46A 3IGHX 3KTCA 2QCLA 2WZIA 1PKNA 2YCKX 2FIQA 3W2KA 4HU3A 4JN6A 1NF0A 1P43A 4HTBA 3ARPA 1YNQA 3URQA 1O5RA 3N12A 1BYBA 5KMYA 3SY1A 3SGZA 4MY8A 3OG3A 2BWGA 4L9XA 1ZX9A 2VFIA 3DYMA 3K4DA 4GINA 1XANA 2FVKA 2BXZA 1PCWA 4UQCA 1JDDA 1RJRA 3HPAA 2PDGA 4HTYA 4GUJA 4GYPA 3NVYB 3E02A 4FLRA 2CHNA 1FWHC 1ME9A 1DIEA 3CZ8A 1XIDA 2YB1A 3AS3A 1NOUA 1A5LC 4QG6A 3PG9A 1IGSA 2FLIA 2OKOA 1NFGA 3UPBA 2HNEA 4V33A 2NQ5A 2WNQA 3O1NA 3FYOA 3NQ2A 3TSMA 1MNZA 2CFFA 4C7FA 1V0MA 1U2YA 3LN3A 3IAQA 1MI3A 5CLTA 4NZ4A 3LCHA 1Y8BA 4DXXA 5BZAA 3VKDA 3H70A 3RU8X 2WKGA 1DQWA 4F48A 2W91A 3AMZA 1HVQA 3N6HA 2VC9A 4PCPA 3EUB3 1JNEA 2P53A 2Z6JA 5A6AA 3NWRA 2GUUA 4J2MA 4PUKA 3WD0A 1ZBVA 4REQB 2R9ZA 2X7WA 3PFRA 3APTA 3M16A 4O1DA 1UR4A 3MMWA 3P5ZA 1TCDA 4WRHA 3CIWA 4AIOA 4JX5A 5CGTA 5KZDA 4RNFA 5HOSA 1ADDA 3LUTA 3POCA 1RHCA 4XIMA 1SZEA 5E09A 2WZHA 4RDYA 4Q6XA 1H7OA 1WV2A 2QGHA 3LHUA 2Q3RA 3WFZA 3N3MA 2XTKA 3LB8A 3UERA 3QF0A 3KCLA 3LPPA 1ZAIA 4PCNA 2QUTA 3W6MA 2CLKA 4HA4A 4Q32A 1WXYA 3BCDA 3TJXA 3L4TA 1FUYA 4S3CA 1IXPA 4MY9A 3PAJA 1L0PA 3AZSA 1H0GA 3LLXA 1E4IA 3WQ4A 4QNEA 6XIAA 1D8CA 2PBGA 3MCOA 1QHZA 4GO9A 4INFA 5C9UA 1SU5A 3KRZA 4M51A 4L7ZA 2VEPA 1OD8A 1F3EA 4HOXA 1DWGM 2ZX7A 1Q6EA 1TPUA 1CXFA 1VEPA 2BP1A 4RCXA 2ZX6A 3P62A 4Y7EA 4X60A 1GV4A 5D33A 4PMRA 4IGNA 4WSKA 3CPUA 3HMCA 1V03A 3WZ0E 4G7EA 3TTOA 4GHRA 1U30A 4DUVA 4GA8A 5K9DA 2Z6IA 2OO6A 2F6KA 2QKFA 1I2OA 3UCQA 1J5TA 1VCFA 2PDHA 2QJIA 1W9XA 7ENLA 2CLIA 3NS1B 3KWSA 3W7HA 4M81A 1N5XA 2JGQA 4IP4A 2QDDA 4DAFA 1TZ9A 4H7CA 3NL6A 3OW1A 4Q4OA 5CZJA 3CUXA 3UZXA 5CPMA 2KZHA 1HGWA 4UTWC 3CQ0A 1N8IA 4K7ZA 1TMHA 4Y8FA 5ENLA 3S2LA 4ZBCA 1LTDA 3M1ZA 3NUKA 2AQOA 3N2TA 1BVWA 5A2BA 2ZXQA 2DZUA 2NQJA 3C2YA 2CWXA 1K6WA 3MV11 4ZXLA 4OJYA 1SFTA 3DHUA 2BASA 4LGXA 2PDKA 1V6UA 5JH1A 4PBFA 1OFOA 3LRLA 3R10A 3UBPC 2HE8A 4FA3A 1UH4A 4PMJA 1HZYA 4K2SA 4LW7A 1KBBA 2W92A 2B4GA 3KP1A 1J0JA 1WBHA 1EEXA 1REQA 3DDMA 4QFUA 5LYRA 4OGZA 5CZ0A 3TWAA 3S42A 4PUDA 1G67A 2DVUA 5H8MA 3QMTA 3UG8A 1BPLB 3PBWA 2A21A 4LA1A 3G24A 1XICA 4M7TA 1L2QA 2VRJA 3UESA 1TZ7A 3MQTA 1TREA 3M4HA 1QO2A 1K9TA 1PV8A 3R7MA 5M03A 3QFEA 4NJKA 4LOCA 3CHCA 3VVGA 4IFRA 3LERA 5T9BG 3S0CA 4IGHA 3WQEA 2HTMA 2EQ9A 1TE1A 2Z2BA 2DVTA 2CBIA 1EUAA 4MNLA 4TX9A 5BXSA 2E5AA 4GVFA 3IJIA 1O5KA 3B97A 2BXVA 3MC5A 3H2CA 1ELSA 2CDUA 1A50A 3CV1A 4W88A 2H3BA 1A53A 4H01A 1FXPA 1E6QM 3ZO9A 1MXSA 1JPIA 4N9BA 3GNPA 4CU8A 1ISZA 4P61A 3AXKA 3U2EA 4EOUA 2XH7A 2ZZ2A 2YR1A 1AH4A 4H9MA 3D46A 1KLZA 4PGLA 1IV8A 4CD4A 1YW1A 2PTZA 4IJRA 2UZ9A 2XSXA 1R3WA 3EZ4A 2WOVA 3O0KA 3TONA 4TVCA 1HGYA 3HURA 4UOZA 5CPLA 4CKQA 1TVLA 3NZ1A 3HW2A 4ZSUA 4FMVA 3DH9A 1Y65A 5FS8A 4W85A 3TYDA 5JXQA 1TPVA 3BGAA 1E0TA 2Y7EA 2NLYA 3UGRA 1KCZA 3PS7A 1UKTA 3PUEA 1MZRA 2BDQA 4MM1A 1ML1A 2YFNA 2DT1A 3M0MA 4MVAA 3C0QA 4D9PA 3S1VA 3G2GA 2ZXDA 5AHFA 2C13A 2EG6A 3N73A 2LLEA 2J13A 4AZBA 3CMJA 4JNZA 2QQ6A 3MBFA 4NY2A 4WY0F 4F9JA 5I78A 3DFQA 3F4WA 1K9DA 3BG3A 3UY7A 5AFDA 3OZMA 4G8TA 4U5KA 2R1NA 1E6XM 1EYWA 1KFJA 4I8YA 2UY3A 1YKWA 4LVDA 1OC6A 4R3UA 4GQRA 1D3CA 1BSIA 3NQMA 3GIYA 5CQ1A 1JCJA 4QJ5B 4RXFA 2WMIA 2ODOA 1NU5A 1XRSA 2PTYA 3FV9A 3B9EA 3RK8A 3T7VA 4URIA 4XSLA 4RK8A 4MZ1A 2WC3A 4J35A 5FD0A 1V3MA 4MZYA 4KEMA 4ZO7A 3EMCA 3GVQA 3B06A 4ORMA 4QQ3A 3SBFA 3KUMA 3I7RA 3J7HA 2RFGA 3RM9A 3RNMA 5EKYA 2J8FA 4NEVA 1G7VA 5JBEA 1NDVA 3W73A 5JCKA 2OZ8A 2V5JA 1BF2A 3TFCA 3WLRA 2XGBA 2I57A 1U83A 3NQGA 2TAAA 1UZ4A 4Z0SA 1JULA 2RGLA 4XQ6A 6ALDA 1UR3M 1GWJA 3GD6A 4D6CA 1J5SA 3WH9A 2VCAA 1L6YA 1Q1WA 4BK9A 3C0SA 2JF7A 3IIVA 4YCPA 2OODA 2FGZA 1J0ZA 1TCMA 4D6JA 2Z1WA 5AY7A 2NUWA 4C6MA 1VYPX 2VX6A 3ANVA 4PFMA 1T6MA 3L21A 3D6NA 4AWTA 2BCPA 2RABA 2Y1HA 1MWOA 4PCSA 2EAWA 2VHLA 4H9YA 2E9MA 3BK0A 3OLDA 4Z2KA 1O94A 3PWIA 4LYRA 3RMJA 4GIYA 3AHTA 4NI3A 3G8RA 3ZMRA 1VFLA 2W6RA 2E28A 4KFOA 1F3TA 4C5ZA 2FPTA 3WBYA 2XG9A 3FSUA 2Y5SA 4JIQA 4AY8A 3G0SA 1E9ZB 2C3DA 2ZUNA 1L6WA 4JDRA 2V3FA 4HSNA 4UTLA 5LXXA 4AZCB 2PTDA 1JGMA 4Q8OA 1A5OC 4OZOA 3DGRA 4W5ZA 1W3HA 3N2OA 1NP0A 5LZLA 3T40A 3OQEA 2WKLA 3W9ZA 2OFJA 2GDQA 3K4AA 2OZ3A 4WUIA 3MU7A 4LEQA 4XZBA 3SSZA 3H4KA 3HPXA 3URAA 3W00A 5CBJA 3G0UA 5K4ZA 3MKCA 1XLEA 1DBTA 3GRIA 1D7FA 3DFPA 2XIMA 1GREA 4C90A 2E6AA 3AS1A 3WD1A 3B8DA 2FZMA 4PCTA 3LSCA 1LRTA 3Q2DA 1P7TB 3NVVB 1RCOB 3CGDA 2ZDRA 4JFTA 2DZVA 5EMLA 1P0NA 1UP2A 3NAVA 4JFWA 1JCYA 4Y9AA 3LA4A 3TQPA 4N7QA 3VFCA 3N14A 1VAHA 3E0VA 2XN2A 2XWDA 3GDTA 5IDIA 1P0BA 2VJXA 2RJHA 2EQDA 4NHVA 3SR6B 4CU7A 3KL0A 4DBEA 2VC7A 5EFDA 1EJUC 2EGZA 2V68A 5E0CA 3KW3A 1GEHA 1QASA 3C8NA 1ZJHA 4H6EA 3SN0A 1BTMA 1Q2SA 1QUMA 2PI6A 2PLMA 4CN1A 4OVXA 1AQMA 1KBJA 1A5KC 2XYLA 5FS9A 1JOAA 2F2HA 2WCAA 1KFEA 1M68A 3KOWA 3N4AA 1EBDA 1X1ZA 1KTNA 4H4QA 2P50A 2GK1A 1C8YA 1FA2A 3O8AA 3BAXA 1D3GA 3SFWA 2PODA 4NNAA 1NP2A 4F79A 4RPQA 4ZE4A 4UCGA 1CGTA 2FZDA 3I68A 1ZJBA 5ER0A 1ISVA 1DTUA 3KVMA 4CNUA 2ZE0A 3SAZA 4I3GA 4ZFCA 2H3DA 3UZ5A 2AKZA 1Z9AA 1DXLA 4NAFB 5D9MA 3GXTA 5AYZA 5I07A 5LIKX 3FYPA 4LVGA 4YU1A 2NQLA 3DKLA 4MWAC 3ARRA 1B90A 4FF7A 3G3MA 4LVBA 4DAIA 2EF9A 4US5A 3BE7A 1BVZA 1GTHA 1CDGA 3L9CA 4UTFA 2R6OA 5D8WA 5HUOA 1S46A 2ZDSA 4IMAA 4S2BA 3N19B 4PODA 2AL2B 2PDYA 2YVJA 4P7QA 3REQB 2J7BA 2FVMA 3GB6A 2XFFA 1XDMA 3PBGA 4JN7A 1GOXA 4CQAA 1JPKA 3B8WA 3UNDA 4L4OA 4XK2A 3AMCA 3CEPA 4ZA0A 3NTYA 1SFLA 4IICA 4BQ5A 3EX6A 4XISA 3QTGA 3ZJKA 1ESWA 2QF8A 3GC2A 1DJYA 2OLHA 4PL1A 1X96A 4M8UA 3LHZA 4WY0B 1WOBA 3QYQA 4F8XA 4BHYA 2WO5A 3BGJA 4M1RA 5FF7A 5I7GA 2R9RA 3CHDA 3PTDA 1RA5A 4IMCA 3DI0A 1DEDA 1VJSA 4G56A 3CL6A 1U1HA 4HU0A 3WD2A 3QPEA 3NQEA 3MB9A 1ZAJA 3URNA 3OOQA 3JVAA 1GG1A 1VEOA 2VC6A 4H9TA 1XC4A 3O7UA 2QMKA 1GETA 4UTUA 4DYJA 3K4WA 3SCQA 2PLJA 1QCWA 4GLEA 3S5YA 1SZNA 1NHSA 2FB2A 5FL0A 3OZYA 4ZB0A 4GD0A 3ZYZA 1GKRA 3L4VA 2W5FA 3T2QA 3WELA 1IT7A 1WBJA 1F4HA 3S2JA 4U28A 1TUXA 4ROQA 1W1A1 1T41A 1YTEA 4L64A 1UIOA 3R8RA 2VEIA 4GXMA 2NVDA 3BURA 7CGTA 1BGGA 2FMOA 2ZZ5A 4S2CA 5EA9A 2F61A 3TCEA 3QFBA 2PDQA 3MO7A 4LV4A 3DG3A 5G1YA 3VNKA 4C6LA 3N9SA 5J8LA 5HMEA 4WXZA 1LOQA 3M41A 2XINA 3LHYA 1SJAA 3E5BA 1U33A 2VUNA 4H8VA 4WSHA 2Y5JA 1QI3A 1GRHA 2FGBA 3I7SA 1K8XA 1XH0A 2C71A 2GSJA 5HMSA 3WF4A 1FWWA 4K8GA 2ZRVA 3F5JA 1QBBA 3KLJA 1LWIA 3LRMA 4OFCA 3GAYA 2NQHA 2B7QA 2WWDA 4KH2A 4ZB5A 1C7TA 1XISA 4M6QA 4Q8UA 3G0XA 4GYFA 4MKVA 5AB3A 4RNHA 3DOPA 1HX0A 1F5ZA 3HOJA 5DT7A 2XVGA 4UMBA 3QKEA 2CKRA 5F2LA 5C54A 1VP5A 3E6EA 3FAWA 1V4YA 1HVXA 2WZTA 4H4SA 1FWCC 3IVSA 3QKZA 1I2RA 1F3XA 4REQA 2DSKA 1HG3A 4I9JA 2J24A 2BVWA 3C61A 4IH3A 3NPVA 1TSIA 5GVJA 3VABA 4MTVA 1SO6A 1ZL1A 1OFBA 1EC9A 2A3HA 2PURA 1A5CA 4RUBA 2F5ZA 4HYWA 4IXHA 1P6WA 4MPQA 2ON3A 4XZHA 1FBAA 1ZSXA 5LNSA 4FLQA 3R1ZA 5AZ1A 5CSRA 1Q6CA 4NXSA 5LGXA 1DE6A 1O5QA 3W7CA 2ZZ7A 4C91A 2FJKA 3A7UA 5G5HB 2FTPA 3GG0A 3T6CA 4GH1A 1QU4A 1X8FA 4MLJA 4I6KA 1FY6A 4AMAA 1X2GA 4B5WA 3LRKA 5EMJA 3JZEA 4DJED 4NASA 4HCLA 4FNSA 2H9AB 3UPMA 3WNOA 3W7OA 3ERPA 3H23A 1IE7C 1XIJA 1MEWA 1M7XA 3HPFA 1NWUA 5E9XA 3PNUA 3K8MA 2OYKA 2GGIA 2WP6A 4Q8VA 4IFKB 4BFAA 1HJWA 2HDJA 2QV5A 4J4KA 3AMKA 2YLAA 3R25A 4XUGA 2IXVA 4H4PA 1IXQA 3EWZA 4A3HA 4P2VA 3VDCA 5D05A 4B3LA 3H2NA 4KWOA 1UWTA 1KO0A 1BWVA 5FI8A 3LLDA 1TJRA 3H4XA 3BAWA 1XF0A 2ZRXA 1IT8A 3NSMA 3FA3A 1GG0A 4LBSA 4K6AA 1LP6A 1LJYA 1X98A 3PVFA 1K8YA 3FGCB 1XD0A 2F9RA 1P6CA 2FJUB 1EUNA 2HE5A 3AYVA 1UBPC 1MYRA 4XBSA 1U5JA 3OTRA 1BWKA 3QTPA 3C2FA 4DJDA 4J56A 1PTDA 5LGZA 4IIFA 5DXYA 2VQUA 1RP9A 3T9PA 4F3HA 2XHYA 4LT9A 4DB7A 2PGWA 4WVXA 2VEKA 4EK7A 1Z3NA 2CNCA 1W1TA 3MA8A 2VVSA 4JQ9A 1KN0A 2W62A 4LXFA 3VX0A 4PTWA 5I3GA 1WX0A 2D69A 4Q4MA 1HO4A 5C2CA 1CT5A 2BOFX 5FMHA 2C16A 3BV7A 3LMYA 2D23A 3WMLA 4DWDA 2CLMA 1H63A 3HQOA 3VNDA 1TFVA 3GW0A 1VRXA 1WDDA 3IJDA 1GOKA 5EB8A 5E93A 1EO5A 1UQZA 3C0JA 2R8WA 2NWSA 1WQ5A 4NJGA 5G4EA 3L0NA 1J0YA 3WQWA 5CJMA 1WP6A 1MSSA 4UOJA 3GE7A 3QLDA 4FNRA 3LLFA 3L4ZA 2WKJA 5DN1A 3HF3A 4O13A 1FP9A 4Q8QA 1VYSX 1EP3A 4LU0A 4AYGA 3ES7A 5HK4A 3VK5A 3T09A 3SCWA 5MKGB 2Y63A 1OB0A 4MNKA 4DJFD 4M19A 1B0IA 1S5TA 1D2KA 4PB3A 2ZA2A 1JD7A 2PF8A 3LHWA 1W3IA 1IZCA 4LJ3A 4DLMA 1CNVA 3BVJA 1BYAA 4LAMA 1KBKA 2GR1A 4JQ2A 1N5WC 3W7DA 2A85A 4J3UA 3DBPA 2V69A 2ZZ1A 1ZMDA 4NL1A 3RRAA 1MEHA 1AUSL 3GHSA 1XYCA 3AYSA 3INPA 1UG6A 3HPZA 2Z2UA 2EKGA 3LBCA 1NQ6A 4AHQA 3BSGA 3AHXA 1M41A 4PUNA 4X63A 5GJNA 5HINA 4UTJA 2GOUA 1ZENA 4HA0A 4WX2A 4YS1A 3MJYA 1HKJA 4E6MA 1OCQA 1X6UA 3BW4A 1H1YA 4AEOA 2WANA 3O05A 3CZJA 4HK6A 3GVGA 1QW8A 2D0GA 4HU4A 1W5MA 3AU2A 1N61C 1PAMA 4FX9A 3GNOA 1ZHAA 1XPYA 3VNMA 2VVNA 3ITLA 5G2WA 1OCNA 4LNCA 3G5EA 4P5UA 3GSMA 4W93A 1X8CA 2IUZA 4N42A 4F2TA 4Z42C 4DM1A 4IXXA 1K03A 5TNVA 4C6JA 1KKOA 2NX1A 1TJ2A 3EWBX 3H6OA 3EB3A 3B8VA 1S1PA 1YPIA 2C19A 2DT0A 3MMUA 3I7QA 3TLQA 2ZA3A 3WLLA 1TMLA 3EPNA 4ZXOA 2YCEA 3O0FA 3W0KA 2J7CA 4WDXA 1OFDA 4KGJA 4FR1A 1JAKA 4ROPA 3S2MA 2PGFA 2J9XA 1F74A 1OEPA 4TV6A 1CENA 5HPCA 5A8PA 4L4LA 1VIZA 4LAUA 5D9PA 4LY4A 1QHPA 4ERIA 3VGFA 4U10A 4IUGA 1V08A 2PWUA 1UD3A 2WHMA 4XWUA 4DYEA 1PIFA 2OT0A 3DGBA 2GGJA 1GVRA 2FVLA 4I90A 2PSNA 4AAJA 1G4EA 4QGCA 2CITA 5C5YA 5KZMA 5E0KA 3RG6A 3WH6A 3OHMB 3NQ8A 3F4DA 3K13A 3N11A 1A3XA 1U1UA 3M5VA 1QRQA 4JX4A 4UUIA 5BROA 3UP8A 2ZZ4A 3SRDA 3TK7A 3TYBA 3D0CA 4WIWA 3OEXA 3MUCA 2HVMA 3PPFA 1JEZA 1SR9A 3SADA 4RJEA 2YW3A 5EBAA 4HMDA 1BXBA 1ZBWA 4QEEA 3TQ0A 5AZ0A 1E70M 1XH2A 1LF1A 3FLUA 2QAFA 1IEWA 2C0AA 3G1AA 3CPRA 1DXIA 4CVWA 3NEVA 4RW5A 4KKXA 4UOQA 3M47A 1E6ZA 1T40A 3OJGA 2J88A 2ZUUA 4Q3MA 1VBUA 1DJIA 3E5PA 4YVXA 2VZSA 3NQDA 1XLIA 3CWOX 2ISWA 2P76A 3W72A 3IVUA 1YXDA 4DBSA 4LBRA 3D5HA 3ZIZA 2VFEA 2X2GA 4WXYA 2V3GA 1JPHA 2NWRA 3KVKA 2ZZ0A 2ZXAA 3W3OA 3RYSA 3QY7A 1NH6A 4Z1BA 2J8TA 1DXFA 2EG7A 1TRDA 1E51A 4O1BA 1NOFA 2IKIA 3CT7A 4LTSA 4BQ2A 4C1LA 1W3LA 2ZKMX 1VPYA 3W81A 4GJIA 4QP0A 4YYFA 5DBTA 4UNLA 2DY3A 4HMNA 3GH7A 1XIMA 4GI4A 3AMGA 1YLVA 4GACA 1EXBA 1SO4A 5ABFB 4GUFA 2EPOA 1J11A 1UWAA 1SZFA 2Q01A 3UXIA 2VDGA 4E2VA 4A21A 4G7FA 4IX2A 5H8UA 3CZLA 1WO2A 3A4WA 2ZX9A 1AQFA 2NSOA 3CGCA 2C18A 1JZ5A 3ABRA 1GVQA 1TV2A 3SUSA 4ATWA 5F1VA 5U7SA 1WDRA 1I60A 2RJGA 3IRSA 1DHPA 5TD4A 1JUBA 1RY0A 3QGVA 3KBMA 1JCNA 2BGNE 3OGSA 1GZGA 4EM4A 2PDIA 1QI0A 2PUZA 2VD8A 1YXCA 5C9ZA 1NEYA 2Y7DA 3FCPA 5FJRA 2O55A 4HU8A 3WJYA 2GGGA 4CD7A 1P7TA 2DU2A 4ZO9A 1TWDA 3KCOA 3T1GA 1S2AA 1XLLA 2Y2WA 4QXIA 5D2XA 4ACYA 5FS6A 3EB2A 2EKCA 3PG8A 4EANA 1H7WA 1WZAA 1UWUA 3VNIA 2PDLA 4OECA 4IGMA 4POCA 4H2CA 1OF8A 4CQ9A 3NQFA 5DFAA 3AOFA 3G1XA 3EXSA 2FKPA 2JGYA 4RV3A 8XIAA 3PWAA 3KL5A 3A4AA 3TEVA 1BD0A 4GRSA 2F38A 3RR4A 1UWRA 3RX3A 1E1FA 2WBAA 2V5KA 1UA7A 4DF1A 1SO3A 3SQSA 2R1MA 1NDYA 1JZ7A 2ONEA 2YZRA 1TPC1 4ADWA 8RUCA 2PLKA 1OYCA 3N25A 1E6SM 3AIBA 4RZ6A 1V3LA 3BJFA 3H4GA 1GONA 1PVNA 4DQWA 1NDZA 5GJPA 2GJXB 3AYTA 3P93A 4B5NA 2Z1XA 3UFYA 2E1WA 1GRBA 3B9AA 2J77A 2GQ8A 4FHAA 4NAFA 1DOSA 4UQAA 3I3DA 4DNHA 2YBUA 3AI0A 3FKRA 4JYDA 4P8XA 5LA2A 5E6YA 1LL7A 1B5TA 3XISA 1H3GA 3CTLA 3ANUA 4RE3A 4MZ8A 3PZIA 1TYPA 3MI3A 1OQFA 3GTHA 1IXNA 4G6CA 5DXXA 3REQA 3DC8A 5BOFA 5HMFA 2PDCA 3LYEA 3W83A 2ADAA 1WPCA 1P0DA 3LDVA 3PBVA 3S46A 4NX5A 2HS6A 2Y6ZA 3S8HA 3CV7A 1EPXA 3QYSA 3B9DA 3ZT5A 3T08A 1VBHA 4IPJA 1EA9C 3TZNA 4HJFA 1H51A 1OFQA 3VOIA 3IUIA 1US2A 1PXGA 4H4WA 1WOAA 4FLOA 2Y4SA 5TF0A 2P3ZA 1V3IA 1ZU8A 5JIPA 2WMJA 6ENLA 5CCZA 2QCDB 2VOTA 4ZOEA 3P0XA 2WMGA 2OG9A 4JCLA 1ZPTA 1A49A 4B3ZA 1XYZA 3DUGA 1MOKA 2E25A 3NO3A 1VKFA 5LKYA 2WVVB 4XTIA 4DI9A 3LADA 1LPFA 3RN6A 4AH7A 3DXIA 5A5WA 3P81A 2V5BA 5D2WA 2A6LA 3B4UA 2TPSA 1GKPA 1GK8A 4NZFA 1SZGA 1E1CA 4JTJA 4BV6A 2PDUA 4ZO6A 2EG8A 3CV6A 2J75A 3W7GA 1CZ1A 1GYMA 4RNIA 4MYXA 4QR6A 1G4TA 3NPXA 3UCDA 3CPGA 5EY5A 4B15A 4AFYA 5E9AA 3VM7A 4B4FA 3AXXA 1A80A 1EP1A 3UWWA 3EOSA 2BVDA 1HP4A 2G96A 3LGEA 1TVNA 4O57A 4KWWA 2PFHA 4JKLA 3GVRA 3N29A 4MSSA 3FIGA 4WLCA 4J3VA 2YFOA 3WF2A 3N2MA 3HTWA 4TTUA 3THDA 3VDGA 5BXRA 1KXTA 1MW3A 3R6IA 4UR9A 2ACSA 3RX4A 4XZLX 3AMLA 4GUIA 2WVUA 4AVFA 5C55A 3CXOA 4NJHA 3KL3A 3GRSA 3CZGA 3TMLA 4PMDA 3WBWA 4W8LA 1H62A 4JOMA 1RCXB 1UQYA 4YXGA 3QXBA 1FCBA 3NVWB 2J7DA 4Z1CA 1EKOA 3UXAA 4FNTA 1C8VA 4GVIA 4PCFA 1SJBA 1PKYA 1NWSA 1KKRA 3ZJ8A 2RDWA 4IIGA 1V6VA 4AG0A 2MUCA 1JZ4A 4KRTA 1J8VA 3V0TA 3SFKA 3TYAA 2OQHA 2XZ9A 1FIQB 3EKZA 4U5IA 3WO8A 3WNNA 2QCHA 2BGSA 1AH3A 4O15A 3OBEA 4FIQA 3GH4A 4H4IA 1O66A 3TOYA 3V35A 2GJRA 5HWMA 3VD4A 2P0OA 4O1FA 4OBRA 2YCLB 4B2DD 1L6GA 4QS5A 1E0XA 3EMZA 2YGYA 3UEQA 1CI1A 1JRCA 4LVAA 1HL8A 2D2OA 4V28A 3GU9A 2G4JA 7A3HA 3ZWSA 2CCRA 3DK9A 2OJPA 2VEFA 1LM1A 1KWKA 3HJZA 4YTUA 2AQWA 4QBXA 3FOKA 1I75A 3M7SA 3LK6A 4GQBA 1MNSA 4CU6A 2W3SA 1RM6B 2CZFA 4RLIA 1OZQA 3P74A 4PULA 5IM51 3AXIA 2QNEA 3N15A 2PB1A 4AHOA 3PR2A 4DBUA 1KFKA 1KNWA 1DJQA 4GI8A 3TN6A 1R9XA 1FTXA 2WJFA 1QT1A 3QV6A 3IWPA 4X61A 2YQUA 3EWWA 3K1DA 3VGDA 2AQVA 1EC7A 1V77A 3HGSA 4LANA 4IFKA 4L6OA 2QJNA 2C8NA 3PBMA 4MAZA 1ZP4A 1MXGA 3AS2A 3MPGA 1B3VA 3QHNA 4C65A 2QPXA 3SB0A 1GQKA 2DEPA 1EOKA 4ZOCA 1CGYA 5D02A 4CQCA 1H7XA 5CKSA 4H4ZA 2IQ0A 4U2ZA 4NZ3A 3BSHA 3BJSA 2CLEA 1A5NC 4I9AA 3IIXA 1LG1A 2ISFA 5CAKA 1ZDLA 3FGCA 2IQTA 1POJA 5GNXA 3BG5A 1GJWA 1F8IA 6TIMA 3CASA 4BQ4A 4IQDA 5F4XA 3EPOA 2FHBA 2FTWA 3T81A 1KTBA 1R3VA 1Z48A 1TTJA 2Q8ZA 1NARA 3CO8A 4ZZ9A 5FOOA 1Q85A 3H24A 4CCEA 3VGGA 4QSHA 4ATLA 3BLDA 3EAOA 1TX2A 2PDFA 4GI6A 1KWGA 2VO5A 3W82A 1W9DM 5CAHA 4CNOA 4QQUA 4O52A 1R8LA 3GDBA 1Q7ZA 1XUZA 3Q6JA 4BQ3A 5FJIA 4UTHA 2FZNA 2P8CA 4F0SA 2A3AA 4GK8A 4X0NA 3A22A 1N7KA 2G3MA 1NDAA 2JE8A 1IYXA 4PTMA 3FNDA 1XM3A 3CGEA 2RH9A 3M5ZA 4JBRA 4HJWA 2QAEA 2QV4A 2XFRA 2CWNA 3L4XA 3GXDA 4KW2A 4GIEA 3LBMA 3V4BA 3OG2A 2WMKA 4AWEA 1K4HA 4JIRA 4LC6A 3AFBA 3GXIA 1P1MA 4H9VA 3VUPA 3BAKA 1VHCA 1X7FA 2ZOXA 1OWQA 1HXJA 3W70A 2X8CA 4JYFA 3UF9A 1R9YA 3OVGA 4JHZA 2PA6A 5I6SA 3OVRA 1D3HA 3WK0A 4W86A 1BF6A 2CZ5A 3SZ8A 2X0SA 4LNYA 3V7PA 5I0DA 2Z28A 1P6BA 4IJCA 4FF5A 1PB0A 2VRKA 2FH8A 2G3NA 2FH6A 2X16A 3WLJA 3EEGA 1XBYA 4OHQA 2QJJA 3BLFA 3BZJA 1C29A 3HRDC 4NI8A 1V0NA 1YIXA 1FEBA 4YTQA 2OOFA 5A3HA 3W27A 3DZ1A 1XFCA 1C7SA 3MP5A 4Q8TA 1X7IA 1JZ2A 4A8LA 3T0CA 1JUEA 1O7AA 4NZJA 2E6FA 1PX8A 1MQQA 1HQTA 3OIXA 1V02E 3PZTA 2QDHA 5ABTA 5BXTA 1OYBA 5HR6A 1JZ6A 4G7EB 2QJMA 2UY4A 4DBWA 4FK9A 3MTWA 1X1OA 2ZRUA 3ME3A 4GMEA 4Z1DA 1CB7B 2D24A 3UZZA 4PTNA 3W07A 3RCYA 3LTYA 2YXGA 3NDZA 4ZSTA 4MPKA 2HCVA 4DBDA 4KWVA 2YCJA 4JTFA 1FWBC 1G4PA 3EOOA 5BMXA 2WCGA 1VC4A 3VMNA 1F8MA 2W66A 4AD4A 4RX0A 5A6LA 1B30A 3PP7A 2YJQA 3IV8A 3UXDA 1J6PA 3P8IA 2FDSA 4Y6GA 1UW9A 1QI5A 1GGOA 5HATA 1GVOA 3H4WA 4RZ5A 1XIBA 2NV9A 5JCNA 4ZQPA 2IKGA 1SSDA 3IJ9A 3SR7A 1CW2A 4XKMA 1UMYA 1XSIA 1SYTA 3DFNA 3NDOA 3BMXA 1QPRA 1CXKA 4F0RA 1WZLA 3C2VA 4CNSA 3MP4A 1GESA 1IHIA 4EE9A 1CX9A 1M6JA 3S9IA 5AC7A 3VD7A 3OODA 3PJUA 5KVHA 4ZR8A 2W3RA 5DF0A 4QJ3B 2QXWA 3C52A 4NYYA 5DCEA 3GHTA 5FEWA 3EEZA 2CERA 3FDGA 3IS4A 3VIHA 2GJLA 3RPMA 2BC0A 4WF7A 3GIPA 1REQB 1EO7A 4GXPA 2ZWYA 4LVFA 2O9TA 1ZCCA 3FJLA 4DHGA 5CGMA 1J10A 3ICJA 4QAWA 3LCXA 4I5UA 1UBSA 2G41A 4FSAA 1KB3A 1MDRA 4LUSB 4OE7A 3EX2A 2Y62A 4S3BA 3DGZA 4K68A 1A0DA 4QSFA 2PDPA 1Q6LA 4GNVA 2DGAA 3VCCA 3UWQA 5GNZA 3LG3A 4R9OA 1HJVA 3CYJA 3UA4A 1KLYA 3C2RA 4LALA 2J47A 3CUJA 4LQ1A 4A3QA 2JF6A 4TMBA 3CLMA 1OT2A 2I7GA 1L2UA 4HN4A 3II4A 2P10A 4D6GA 3O15A 4GC4A 1I8JA 2OT1A 4QG9A 4LUYA 1W91A 3KBNA 4KRZA 1LQ2A 1E3XA 4LB3A 2R1LA 3GK0A 4YVVA 5GNYA 4S3DA 1SQ7A 3A21A 5FCZA 4B4HA 4J3ZA 4W89A 3W22A 3NOYA 5LHEA 2OZ0A 3W2LA 3FVMA 3WDPP 1BG9A 3WFLA 1WDWA 3GU1A 3M0IA 5XIAA 5BYWA 3WK2A 2DUZA 4QE1A 5IDZA 4Z2LA 5J04A 2PU0A 3VU2A 1VF8A 2O7SA 3PZGA 1HKIA 1F3WA 3ALGA 1JVNA 3AHYA 4E2BA 4MB5A 3YPIA 4PMQA 3BL3A 1DQXA 3ABOA 1FHDA 4W4QA 5GPRA 1CGVA 2DIKA 2E67A 2F6UA 3F1QA 2VR4A 3T07A 2E3TA 3VIJA 4L9YA 2CEQA 1DXEA 3HG4A 4JTRA 2WQPA 2Q09A 1UCWA 1HTIA 3RIKA 2CYGA 2H6RA 3NM1A 4Y9OA 1KRBC 4UFMA 3CQIA 4ACZB 3EB4A 3TW9A 3WQFA 3O0HA 1HN1A 3RMEA 5IFTA 4GZIA 5ABFA 1QNPA 5AC5A 1CEOA 3NQBA 1E0VA 3LY0A 4DRSA 1W5OA 1PWMA 1H0IA 4AIBA 3WQCA 1EJTC 3L4WA 1UIPA 3WLSA 3VFLA 4K1WA 4LV9A 2FHFA 1OSEA 3N17A 1M6IA 2DW6A 4GVGA 1OZMA 1I0BA 2AOSA 5FF2A 3A4XA 5DT5A 2I5QA 4AZIA 2GVEA 4LPCA 2W54A 1E73M 1FRBA 4AC7C 2BXYA 1VJIA 1IXOA 3EOLA 3DN5A 4UXDA 1EZWA 1EWDA 4YN5A 4H4VA 1DTNA 2XUCA 3AZRA 3BZGA 1SGJA 4I9MA 3GD4A 3LHVA 4V27A 2YKKA 2FB3A 2ACQA 2WHLA 2XN0A 4LUIA 3VOHA 4I6VA 4H4UA 4ATDA 4JL1A 1U1JA 1W5NA 3FDKA 1CXIA 1J01A 1W3KA 3TA9A 3ARVA 4E4FA 3GFYA 3ENLA 4ZOAA 3TTSA 4WOZA 4AD1A 3SCOA 4QHRA 3UXKA 2W67A 4L56A 3A12A 4PMZA 2CU0A 1GVEA 3TC7A 1OY0A 1K6AA 4RE0A 3IUDA 3TX9A 1FDYA 2G4FA 3KAOA 2D73A 2YA2A 2VUYA 1VFMA 4UFKA 2YYUA 5HUPA 1YMYA 3W1LA 5EFFA 4GY7A 3TIMA 1XGDA 2V3AA 1XIIA 2BY3A 5JBFA 1E6RA 1HJXA 2VQTA 4IMGA 2EPHA 1PHWA 2OXNA 4PUMA 3EYPA 2REQA 4RPPA 3G1HA 1SW0A 1QOPA 2XN1A 3NL3A 3ZSTA 5KTLA 1VS1A 3ABZA 3BXWA 1OK4A 4JTAA 3FFSA 3ZVIA 2G50A 1ENUA 4TX6A 1E9YB 5F4WA 7XIMA 1TV7A 4KWSA 3GY1A 4S23A 1AOGA 1JPMA 1P5BA 4XZIA 4C1NA 4K38A 3N2CA 3KTSA 1GW9A 5FL1A 3B0YA 5A8NA 2GJXA 3E0LA 1V6WA 2YL9A 4Q33A 4M6PA 3TFXA 4DJEC 1A47A 4DIAA 2HK1A 4H6KA 1UC5A 1KXVA 3STGA 1EHNA 1VHNA 3TSBA 3DC0A 1RP8A 4BKNA 4B5XA 3CJPA 1Z69A 2QLYA 1R87A 1XLCA 3EGJA 4RL3A 4HPGA 1LQ0A 4GZ7A 3GVVA 2PWDA 2DDXA 4HD5A 1FFVC 1A3WA 1RD5A 2KX9A 1ZK7A 2WOQA 4TR9A 2YPIA 2P5NA 2R1KA 3OLEA 4J9JA 4DELA 3KOFA 3GM8A 1T8QA 4DZIA 4WQ6A 1V79A 3NDYA 3IPWA 1N2VA 3GVWA 1BQCA 2WWCA 4QDMA 4XVEA 3VUSA 2EPNA 2YYTA 3NOEA 1EB3A 3URHA 4XAFA 3TV8A 3P60A 5DCBA 4X2RA 5AKQA 3S3GA 4H4RA 4JS3A 2Z27A 4MGGA 1GEUA 4FOJA 1BTCA 3VM5A 3RGTA 1GZ1A 1PDYA 1PPIA 1V6XA 3HU7A 3MCMA 4Q8WA 3TZFA 3IIPA 2XIJA 3LV6A 1SZRA 1ISWA 3CB8A 2WSQA 4H19A 2WVVA 3VIGA 4DO4A 4JXCA 1JYXA 4FZIA 1LL4A 4C6DA 5U25A 2G37A 1XRFA 3NXLA 4Y90A 1HP5A 4CCDA 2PU1A 1HO1A 2OZTA 4D2JA 4DEFA 3UG5A 5CC5A 4UFLA 3C3NA 3URBA 3ZJ6A 1R3TA 4Y9MA 3MVIA 3C2EA 1JYNA 5CC3A 2V67A 1FWEC 1EL3A 4HP5A 5LIXX 1VYRA 1S2WA 1JXJA 1IF2A 3ATYA 1WAUA 3IJLA 1F9CA 2V9DA 5CSUA 3MI6A 4M29A 1PCKA 3PUOA 5H1WA 3S6OA 1RA0A 5IBXC 3RPDA 1MQRA 4GIRA 4OV9A 1J0IA 1Q7QA 2H8ZA 4IMDA 1X6LA 5CZTA 3E74A 3V5OA 3OLGA 5ABEA 5F4SA 3FA5A 4NJJA 4DJFC 4XVDA 3NZRA 4N0RA 1AW1A 3WD4A 1RCQA 3ZT6A 1BRLA 5A2CA 2FPYA 3SM0A 1C9WA 3MSRA 1KGUA 1NF7A 4HCHA 1N82A 5AYIA 3QR1A 4APNA 3GTNA 3QN3A 3PC0A 3NFUA 1LOLA 2PEVA 1KCXA 4JTLA 5FJPA 1GHSA 1LT7A 1AODA 4QJ1A 1WCGA 3UJ2A 2AMGA 3RU6A 4I8DA 5C8BB 2JEQA 1DJHA 3UW6A 1UPMB 1C8XA 3LCWA 4R34A 1X97A 4DX3A 5A8OA 2VEGA 4AW7A 3CUZA 3IGSA 1F73A 4C60A 1I0DA 3R11A 4FNUA 1Z7AA 4UTTC 1JNDA 1BXCA 3C5QA 2PDWA 4CNNA 1OT1A 4ERAA 2ZVIA 2YCLA 1TKKA 4RE4A 5JH2A 4NQ1A 3UETA 1EJXC 1RQEA 5DELA 3BSMA 2YXXA 1XCXA 2CZDA 4HNVA 2J6VA 4B91A 2J6XA 3UR7A 3GNDA 1H5YA 3MSYA 1C9DA 3VTRA 3PFMA 3STCA 4GYPC 5E5CA 1CB2A 4EMIA 2IMRA 3W75A 3T0BA 5H6HA 1KV8A 4FI4A 3CH9A 4DO7A 3UT0A 4WZHA 4ZTYA 1W54A 1W5PA 1I2PA 4FDCB 1KM0A 3U2ZA 4WDUA 1XJBA 4EXBA 4LUTA 2DUXA 1S5MA 1MFUA 1R38A 1TR9A 2O9PA 4BEQA 1KQYA 1S38A 2I5GA 1XCWA 3LMZA 4QTGA 5TR3A 6A3HA 4TOQA 5C7HA 2DUAA 2V0TA 4J5NA 5I3FA 1E0WA 3TJ4A 1IWBA 5CZSA 2J66A 3PTKA 3KLLA 3RO8A 2XM2A 3WUEA 1VB9A 3FX4A 3WENA 3E0IA 2VCBA 3QQ0A 2WK2A 1KXHA 1PKLA 3W1PA 4GQ0A 3HFYA 2DSWA 5D2TA 3NURA 1QPOA 2FZ8A 2A79A 2V81A 1M04A 3RCNA 3M5YA 4Z2IA 3FS2A 3WQ8A 4IX0A 3UWYA 3DERA 3CHEA 1GOWA 2HBVA 3RLGA 1G94A 4HMEA 3HGJA 1EDQA 3VGHA 5K3VA 2VFDA 2Z7GA 1UKOA 2A6NA 2FTYA 2IKHA 1RLDA 4EXAA 3BUVA 1XLJA 2PWVA 4IM4A 4QROA 4XBJA 3R0DA 3EX3A 1UC4A 3R8HA 4P8UA 3UWUA 3VYLA 2J4GA 3VKJA 2PRLA 1GTEA 1QDSA 4GIAA 5HR7A 3WMCA 1FX6A 3MW7A 4D6IA 4FNQA 4C7DA 2A2IA 2G0WA 3ZLFA 3BV4A 3Q94A 3BOLA 4IL0A 1EIXA 4XZNX 4GJJA 1JRBA 2IXUA 3WDRA 1MQPA 1JROA 2E5BA 4GO8A 2WNWA 1QBAA 4GBDA 3VO0A 4W9TA 2VR2A 5FIPA 5MF5A 2JKPA 4OKDA 3E0FA 4OOZA 4FP1A 1QPNA 4IPPA 1XW8A 5A6MA 4LH8A 4ZQOA 1EYEA 1KRCC 4QLJA 4BURA 3WUFA 4IGSA 4PRWA 4JKMA 1T7LA 4JN8A 4E3VA 3G1DA 5A8QA 3WLKX 4UQBA 1XWYA 1AW2A 4JTUA 2GH5A 5CJNA 1R7OA 1UOZA 1C8QA 1Q6FA 3LBOA 1UWQA 1PHQA 3MUZ1 4RNJA 4JIHA 4JFUA 2A7RA 3EWXA 4PB4A 2XVPA 4HPXA 1GJUA 1J2BA 3E2QA 3MWCA 4MJ2A 4NVTA 3SW6A 1A5UA 3DI1A 3OPSA 1RBAA 4PRTA 3TVAA 9XIAA 1SW3A 4PTVA 3N4FA 2GRTA 3ZLGA 1GPFA 4AD2A 1EXPA 4XTDA 2P0IA 2PWFA 2EO7A 3QOKA 1K4GA 3ZFHA 1B2YA 5FACA 4L4PA 5D2YA 4GI9A 4GZJA 1OFEA 3ITGA 3RM4A 1YX1A 2VI0A 3NIYA 1ME8A 5C70A 2X0YA 5CPTA 4X3ZA 1H2JA 4IPIA 4PN2A 4K8EA 4DZAA 4MG4A 4H9UA 4IMEA 1BVNP 3GHRA 3A13A 1FHUA 3GFXA 2NXHA 3WQPA 1LUCB 1TQJA 1VFTA 5L6UA 4DF2A 5A6TC 3HFTA 4XSMA 3WF0A 1HL9A 4CLMA 3DESA 4BY3A 2WMFA 5C7VA 4MKNA 1L6SA 2PC8A 1XFBA 4YTTA 3LV5A 2GDVA 3NQ7A 2CLPA 3B3DA 4HSOA 2NV2A 4QITA 2WJEA 3GD3A 4AYSA 4O1AA 5HANA 2WLYA 4LF1A 2E9LA 5LNUA 4HZ7A 3ZOAA 4C6EA 4H8UA 2VXNA 2HVOA 4MY1A 3GXNA 4PYSA 3S5OA 1F4AA 5F2MA 4C6PA 2O4QA 5CPQA 4FB7A 5IHSA 2EJ1A 2V6OA 1TWSA 3AALA 3IC9A 3WH7A 1GQNA 3KS6A 1UP0A 3DHPA 4K8HA 4FX7A 5CZKA 3TC3A 5E0FA 2ZICA 1ITQA 4LS0A 2J62A 4FO4A 3AXHA 3U0HA 3OB8A 4PR4A 3T4WA 4ZOBA 1VQZA 1K70A 1A3HA 4EVZA 3JS3A 4O8AA 2INZA 4JTHA 3HV8A 1OK6A 2NLIA 2VC5A 2OGYA 5E70A 4BWLC 3GW3A 2OEKA 4MAVA 1EP2A 2J79A 2IKJA 2ASHA 3TDFA 4LUSA 3CWHA 2ZADA 5M5DA 4WHBA 2QVHA 1YHTA 5RUBA 4DPPA 2HXUA 5C9WA 4JTIA 1N8WA 3NVTA 3S83A 3W7JA 3W37A 2XDFA 3RLUA 1UKQA 4GNKB 3KE0A 3DGHA 2ATSA 3W7LA 1ICQA 3ZQ9A 5G2HA 3ZWTA 1TV5A 1SUXA 1CCWB 2ZBTA 1WDSA 1JPDX 1ECEA 4AY1A 2I56A 2WMHA 4LRSA 3RM8A 4JAWA 2NX9A 2XFWA 1ITUA 1OYAA 2NUYA 3L2LA 3UA3A 1BWCA 4IHCA 1SMAA 3V1PA 1GRFA 3MP3A 2ACUA 3ARWA 4KF1A 1AA1B 3O2LA 5E6ZA 3GR4A 3ARQA 2XGIA 4IP7A 1PKMA 1Q63A 4OBSA 6TAAA 1BSLA 3CO4A 5HPOA 3NL2A 3BAIA 3PF3A 2C0HA 4HNUA 4M6UA 3IJ7A 3NNTA 4H00A 2WC4A 2ZC1A 1AQ0A 1T5AA 3ZVHB 2WPGA 3R94A 3I6EA 4JTTA 1XL9A 1LWHA 3DEQA 3VDAA 1MO0A 2VNCA 5HDRA 3O16A 4HGXA 3AXMA 4HA1A 3F4VA 2D3NA 5I24A 3PUGA 1E9LA 3DX5A 1OD0A 4UCFA 3KHDA 4AZGA 2PD5A 4JTCA 3WSUA 2TRSA 1WUEA 4ACZA 2PWEA 3QJAA 4M3PA 3FJ6A 4OT7A 4GQQA 2QT3A 4JQAA 5C9RA 4IG2B 1LVLA 3LQGA 1CXLA 4H9ZA 4IFOA 4DI8A 1R3RA 3VA8A 2VGFA 1VD6A 1J93A 1JR1A 2W61A 3SI9A 2UBPC 4UQEA 3LTSA 2WSKA 3OGVA 1DV7A 2GGHA 2GGEA 2HROA 3S6DA 1DPMA 1IGWA 5EU9A 3WMBA 1KD0A 3MANA 4TTGA 2A4AA 4ILSA 2QYGA 1I6NA 2NVKX 4A8IA 2CKSA 3DCPA 3KZPA 1J0KA 4R33A 2WPFA 4TO8A 1TV3A 4XIAA 2RAGA 2D1ZA 3W7RA 9CGTA 4OOUA 4U4MA 2PCEA 2HZGA 4QLLA 1V3JA 1X2HA 3W1RA 1XG3A 1L6FA 3NG3A 1RUSA 5D09A 4LSBA 3W28A 2R91A 2PDXA 1QPKA 3ZXWA 1B4KA 1UH3A 3AICA 3BOXA 3M6YA 3CT2A 4MUPA 3RDKA 3CV2A 4HK7A 4XUYA 1ZBCA 3N6QA 3XIMA 3RAOA 3L65A 4XKYB 3R13A 1UR9A 1FCVA 2QGYA 5CJ5A 1B1YA 2ISSA 4MKSA 2GYIA 3ZR6A 3NR0A 3V1HA 4MIMA 2I14A 4NP7A 3U57A 1DHKA 5D9NA 3M0VA 4HNCA 2JK2A 3TW7A 4HBKA 4UMAA 1K7FA 1OGGA 1VENA 1ONXA 1F2JA 3BARA 4PRRA 3QEZA 1UA3A 1K4QA 1EF3A 2F2KA 4DLFA 1CIUA 3CHFA 1OFPA 3MZ2A 3R5EA 3W1AA 2PDNA 2WVSA 3TMQA 1EZ2A 3C8FA 4HPHA 3EPMA 4A3UA 2X2YA 1EJWC 3G1VA 5AYYA 3TYZA 4PE8A 1R9ZA 1J9YA 3KBSA 2X99A 4BF9A 4MJZA 1TV8A 3DK8A 3OC4A 1FCUA 3M64A 1ZP3A 3O6CA 4UR7A 5D32A 5HBFA 1RAKA 1NQKA 3KBWA 2HNHA 1LLOA 4AD0A 2B0MA 3I4KA 3ONCA 3QC3A 3MUY1 4QS6A 3VZZA 3O6DA 3QPZA 4XX6A 4Q4RA 3VOGA 2W63A 1QK2A 4A4AA 2OYMA 4UQDA 4RKAA 2Z24A 1UZ1A 3HA1A 4NNCA 4BI7A 3CTTA 1FFRA 3GXFA 3ZJ7A 6PTDA 3BLIA 2QF7A 3OA5A 4UZUA 2XFYA 3AIQA 1XGZA 4ZMGA 4HHHA 1LBMA 4PBGA 2RHGA 1WDQA 3QQWA 1PEZA 4MB4A 4AZ6A 1V0KA 3NEHA 3GNNA 4GJ1A 2BB0A 4R5EA 1K8CA 1EGMA 5CC6A 1GT8A 1FOBA 4KPLA 1OF6A 2XM1A 2WSYA 1BEUA 4F0LA 4YYCA 2PGRA 2VZTA 3QMSA 3UZYA 4NUWA 1GSNA 2VGBA 3QY6A 1UJPA 1DP0A 2E8ZA 2V2CA 5HULA 3QHMA 3TH6A 3HMJG 2HVNA 4MNMA 1AD1A 4RZ4A 5HNNA 5AHLA 1R7AA 2J74A 2JALA 1ECQA 4UNIA 2QUMA 3QZ6A 3KM8A 2E09A 3W1TA 4H04A 3A7AA 2PP1A 4NKCA 3LXAA 1JL8A 1IEXA 3PY2A 4E3TA 4HOWA 5EL1A 3W71A 1W1B1 3MMDA 3W7KA 2ZUMA 4M7SA 3UPWA 4NF7A 3ETRB 3LOTA 1XRTA 3KTXA 3PB2A 4OTKA 4F66A 4O12A 1UR1A 4L6DA 3S9YA 2FFCA 3OP2A 3QW4B 1WB0A 2E3ZA 4IQJA 3PHAA 3B0VC 4WSJA 1G4SA 5CSSA 3KXQA 3O07A 1A5BA 1ZY8A 3MCNA 4YWSA 3APYA 4GGHA 5HJXA 3TN4A 4JIEA 3E2VA 4NILA 1WKFA 4H6QA 4HN8A 3WN6A 3GUGA 1IEVA 2VYOA 3UZJA 4AD3A 2JK6A 3D9XA 2PZ0A 4GUGA 4JFSA 3E96A 1V59A 3RITA 3U48A 1E72M 3W29A 4DY1A 5IRPA 1QHOA 2V2DA 2QIIA 1FFUC 4S3FA 2OX1A 2X40A 3RF9A 1FP8A 4KT2A 1RPKA 3LCIA 4N4PA 4LCSA 1FKXA 2VWSA 4AF0B 5A6BD 5HXMA 4MFEA 4MB3A 1PWLA 3H55A 3WQGA 3FEQA 3AIVA 3LZ5A 7TAAA 2ZWZA 3ARSA 4PA8A 1W1VA 4EACA 1XBZA 5EPDA 2XJ7A 1XCFA 4O53A 5F1UA 2WSPA 3WJXA 2MANA 1Q6QA 2TMDA 4Z1AA 4XD3A 4ZENA 1HKWA 1OG6A 3UWEA 3A23A 4JYEA 3GG8A 1J4EA 3CYVA 4J28A 1FWSA 3IJ8A 3TN5A 4MHBA 3JW7A 1DIKA 2PP0A 3H2FA 3HN3A 3QZAA 3RRXA 3BH4A 3E2RA 5DY3A 3WJWA 4E2DA 2NV1A 2P8BA 5CC7A 5H2ZA 1B3ZA 2OR2A 5FSEC 3BW2A 3PK7A 2VR5A 2ZUTA 4LYKA 1RK6A 4UR8A 1UZHA 4QISA 2CFYA 1VLIA 1PIIA 4JZ5A 3AYRA 1EBHA 1KBIA 5KSWA 4J2PA 4WKHA 1VFFA 1VLWA 2YZ5A 3RCMA 1C90A 2OMAA 1CXHA 2H90A 3M0XA 4TV5A 5CPOA 1K1DA 5G5GB 3QR0A 3UR8A 3W74A 3L5OA 4YPJA 1Z8AA 4C6CA 1BKSA 3RUBL 4WGHA 3SN1A 1AFSA 4KCTA 2P1FA 2ZIDA 1W9VA 2Q71A 1QWKA 1W2VA 3UVIA 2X8RA 3B8UA 3LNMA 3VMPA 1LLZA 3ATZA 1CGWA 1I4NA 1E1CB 1QW7A 4W84A 1PDZA 4CUCA 5LIUX 4E4PA 3A7RA 2BY0A 3GQYA 1XUUA 3O06A 2J8GA 4WGXA 3A3HA 2X1RA 1GRTA 2ALRA 2JBMA 3ZR4A 3W84A 3O3RA 1V3HA 4JEJA 4I7VA 4E8CA 2Q6ZA 4D6FA 4JR5A 5I02A 3SDOA 5FJJA 3BW3A 4MB1A 1R2SA 3GX9A 3LGGA 1QI4A 1QNVA 1UROA 2QCNA 3U8GA 3V5CA 3QW3A 4DWSD 1O1ZA 3CL7A 3A64A 4Q4PA 2ZA1A 3AJ7A 1O5XA 3PAOA 5HQLA 4D1IA 3SRHA 1NVMA 4L5ZA 1OHLA 5FEZA 2YX0A 3T2PA 3ELFA 2A3CA 3OU8A 3ORWA 1UPPA 1Q6RA 4H8NA 3SRFA 4OWGA 1JYVA 4A2RA 1L9WA 3TROA 1KXQA 1DJXA 3VC6A 3A5VA 1G6CA 4A2SA 3P82A 3LI1A 1GQJA 1XLGA 2NX3A 1GVSA 3STFA 1D9EA 2WVTA 2ATMA 2HXTA 2G3FA 3VAVA 3T78A 3W86A 4BF7A 1BYDA 2A8XA 4DZ5A 4GOAA 1O68A 3ITOA 3VKCA 4TVWA 1DIOA 1B3YA 2OELA 4R88A 4KCWA 2DSVA 3S1UA 5HWJA 3FHQA 3OZOA 3PTQA 3P67A 1ADSA 2EXOA 1BYCA 4L9ZA 7REQB 2ZUSA 3H7VA 2C15A 2QCCA 1ZLPA 4DO6A 3HQ1A 1QATA 5ABGA 1RLCL 1PX3A 2B7OA 2V8ZA 2GPTA 3TNOA 3RX2A 3OQ8A 1XLDA 3W2UA 3VIPA 1UR2A 1XDLA 3THCA 3M7WA 2QULA 4FIRA 4PUWA 4M80A 3EXRA 4RZBA 2XVNA 2R94A 3AMDA 3N18A 1UWSA 3SQLA 3RILA 2ZZCA 3TTEA 3LXDA 2QS8A 4LY8A 4Q7NA 3WUGA 2RDXA 3FXYA 4US6A 2W79A 2QCFA 3GKFA 3PB0A 4ADUA 1D8WA 2BGQA 3I65A 5IBXA 1R3QA 4FNPA 4J40A 3TAOA 2V3BA 1NFBA 3GLCA 3GYEA 1AL8A 4XD6A 1EX1A 5EMMA 1ITXA 2TPRA 3TN3A 1BXNA 2PWGA 3WBAA 4DJFA 3P6LA 3QLLA 3V18A 2X7VA 3EXTA 1HUVA 2EPMX 5C2GA 2NVCA 1NWRA 3W7EA 1XI3A 4KETA 1US0A 4MWAB 1QWGA 3LENA 2X50A 1XIEA 1G5AA 1NFPA 3CB3A 3WYZA 3KP0A 2BMBA 1FH7A 4UTKA 3MY9A 1AD4A 3E2SA 3EX1A 1A5AA 4DN1A 1FDJA 5I3DA 4O17A 1RD6A 3WY1A 5LXEA 3F4NA 5JRBA 4HT3A 2A7PA 2QUNA 3W1XA 5HJYA 3ISIX 4JNYA 3WMSA 4F0KA 1TPEA 4HZ8A 5BWFA 3CMFA 3GDRA 3OVQA 3VI2A 3QY8A 4R85A 4GGBA 2A3LA 2FZ9A 5LA1A 2VM8A 3CZEA 4UTTA 2C7FA 4K8DA 3W7MA 5I3IA 1LUCA 3MSGA 3M5XA 1FVPA 3MWAA 1O95A 4PTDA 3W38A 3F2BA 2QAPA 4MLRA 1AVAA 4BF5A 4IIBA 1RALA 1Q65A 3NQAA 1NHRA 1QPQA 4R27A 1D7KA 1H7PA 3PZQA 4E4UA 1VCGA 1CECA 3PZOA 5FJOA 3QH2A 3WLPA 4DUOA 1CGXA 3F7JA 1R3SA 4BEUA 4KWUA 4A3RA 3GNXA 1G1YA 3KRSA 3TJLA 4KERA 8XIMA 1XLBA 5CG0A 2HMCA 3F4CA 4O16A 3NCOA 2WPCA 1ZRQA 5I2UA 1E5JA 3FJNA 1VBGA 1KM1A 1TJ1A 3WFAA 2D2JA 3C86A 4XBKA 1JQXA 3CWNA 3VZYA 2BS9A 4NRRA 2RUSA 1QOXA 3QM3A 3MZNA 3H2AA 4AY7A 4LRTA 1LQAA 3PTMA 3GS6A 1VDVA 3R8GA 1AL7A 1OX4B 3SY8A 2F8QA 4KFPA 1A4LA 1KM5A 2VMFA 3I10A 3S47A 1TE6A 1NPXA 3NQCA 2ZE3A 4E8DA 3AUOA 1W9UA 1GYNA 2XH0A 3V0UA 2DZWA 3H53A 4YMZA 2BNJA 4EPDC 2YDRA 3WQVA 4ZO8A 2OYLA 1ZMCA 3H21A 3GR7A 3A3WA 1WDPA 1L8NA 4KRUA 1SFSA 4DO5A 3HPSA 1RV8A 4Q8PA 3H26A 3T2OA 5DMLA 1V5XA 3EA3A 4EM3A 3KOZA 1M7JA 5C71A 4PTXA 3VNJA 4Z17A 2BY1A 3VGEA 2V6AA 1ME7A 2FYMA 2PDBA 5G2IA 1OINA 2E6YA 3K30A 1B4EA 1TRIA 4WJEA 3K8LA 4KEVA 4FXSA 1AJZA 1Q45A 4W8BA 3W7NA 3FJ4A 1ICSA 1Q5MA 3NQ6A 4F2BA 3HG2A 1PBGA 1AJ0A 3HG3A 3MMTA 3EMQA 3GXPA 1KFLA 1W1IE 1PX4A 1K77A 1U5HA 2BX7A 1TO3A 3ZVHA 4HNNA 2BG5A 3GU2A 3VE9A 3PZMA 3QC0A 2VGGA 4JNMA 1E1EA 3LM3A 1HL2A 3OO2A 3FG2P 1YBQB 3LS9A 3GXMA 2ZX8A 3QMRA 2HQMA 3AAMA 3LM7A 3VC5A 3RNDA 2EPLX 4S3JA 3BICA 3UU0A 3QQ1A 1OC7A 1MUMA 3QHOA 3NJ3A 3BCJA 4TUFA 2QMJA 1E9IA 4O4VA 1ZTVA 3IARA 1FWNA 3BWWA 2YIHA 1WKEA 3W4RA 3TR2A 1MEIA 4UIOA 3L12A 3NPWA 2VFFA 4IG2A 3WJZA 8A3HA 1TUFA 1LG2A 2E4TA 2RGMA 3SCTA 3AM9A 3V75A 2HS8A 1BZLA 1Z32X 3T44A 3NXFA 1MUCA 4S3KA 4EQXA 1NDWA 4B5VA 1VIWA 3NSXA 3ITTA 2C91A 3DYPA 1G01A 3OZPA 2CXGA 3QZEA 1G7UA 3WKZA 3ITCA 4GKLA 3VNYA 3MYPA 1KA9F 3JRKA 3IK4A 1F07A 1SO5A 2PS2A 4C6IA 3AO0A 2V5CA 3G22A 3KDOA 4RDZA 4S3GA 1WYGA 1B31A 1JI2A 1OX6A 3D3AA 3T4CA 2Z7KA 2VGIA 3WDQA 1QO5A 2RDUA 5G4HC 2ZCGA 4AXNA 4YWIA 3R89A 1IT0A 2GLKA 4XKYA 4NZCA 3IAPA 4LS2A 1TWZA 3G3DA 2WNZA 3K46A 1J6OA 1FO4A 4IQLA 2WHKA 4C6KA 4KEUA 3BC9A 2CC0A 4C6FA 5F7UA 3M0LA 4A29A 1DIDA 1Z42A 4N6FA 2D22A 3FN9A 1UKSA 4H9XA 4UTWA 3S4TA 1S2TA 4N9EA 4PZVA 4LCQA 2PDMA 3QPYA 4QDWA 2VELA 3I6RA 2WM1A 4H41A 1P1XA 3DAQA 4UTMA 3Q37A 2W3ZA 1EGZA 3MO4A 1CWYA 2E68A 1Z41A 4HK5A 3DK4A 1UR0A 5I03A 3GYCA 2FFIA 1W9BM 1ONRA 4MJMA 1W6TA 3WL0A 1VEMA 4GX9A 5JCMA 1QNOA 1GQLA 4JTSA 1E43A 4S38A 3O6YX 3KWXA 3MYOA 3Q4DA 1RJQA 5I23A 1EFZA 3W53A 3DBNA 4BWLA 3B03A 5IHRA 4AHPA 4YNGA 2YA1A 3R2GA 4ECLA 3U2OA 1E4MM 3OVPA 3TYEA 2Y61A 3A3XA 3W76A 4HZ6A 1XHCA 2EQ8A 2D20A 3LPFA 3NGFA 1FWJC 1THFD 3ONBA 4CD8A 2DW7A 3GHUA 4ICNA 1O1HA 2EHHA 4KFNA 3ZR5A 1TQXA 1EPVA 3DFHA 3RFAA 2NXIA 1NOWA 3G77A 2AAQA 2VDIA 4OQVA 3ARYA 4V1XA 3BLEA 1CPUA 4M5PA 1XBXA 1PZ2A 4GY0A 4D8AA 3QSRA 4QCFA 2A0NA 4MJ4A 1KGWA 1U5VA 3GO2A 3M6DA 5C2XA 1E4LA 4BA0A 1K02A 4Q22A 4H50A 2GVYA 4PMYA 2DQXA 1UZDA 2B31A 1TX0A 1YTKA 3TCSA 1M5WA 1J96A 3PNZA 2Y7FA 3HQPA 1KM6A 2VD9A 2C3CA 3WH8A 4I5RA 1XSJA 3W26A 3VZXA 1JI1A 4DXVA 4EQSA 1LROA 2DZSA 2XH4A 4LYQA 1SJDA 2Y88A 2WP5A 2WJDA 1FWGC 2ABAA 3BO9A 2GJPA 3SUUA 3HJEA 4CCCA 4JQ3A 3W7PA 1TTIA 4I5XA 1LZOA 1OIFA 4RDWA 4EQWA 3HG5A 1JZ8A 4A05A 1GOQA 3TW6A 8TIMA 1DJWA 5LA0A 1IEQA 2WSRA 4MDPA 1YXYA 3NYDA 1HJQA 5FAJA 1GERA 1JZ3A 3BQ5A 3AJXA 5JMUA 5K4XA 5DO8A 4GABA 2D0HA 4C6BA 2HQAA 4JTGA 3VX1A 5I3KA 4J3TA 2REQB 2X1TA 1PE1A 1V0LA 4JTEA 3MUXA 1RBLA 4HA3A 5DQPA 5KZEA 1PZ1A 2DZBA 4F40A 1MZHA 5REQB 4JKKA 3CMGA 4FLSA 3U4FA 1Q6GA 4CNTA 3CC1A 3N9RA 4C1NB 2PPGA 4AX7A 2G97A 3A9BA 3LX9A 2CLLA 3CUGA 4AF0A 1KR1A 5HA7A 2Z26A 3C4UA 3KOXA 4Q4KA 5XIMA 2ZUVA 5FA5A 1R5YA 4GKTA 2QR6A 4I7UA 4WDTA 3MT1A 1SSGA 3MSDA 4ML4A 1J0HA 2BSLA 1V51A 3KVLA 4PMVA 3ZLHA 2Y5EA 5FEPA 2JQXA 1JFHA 1DKWA 3CU2A 3EDFA 2X30A 4NRSA 3RJXA 2POTA 4RE2A 5G5IA 4NZ1A 2Y70A 1IIHA 3M0ZA 3L67A 2V3EA 2ZXBA 3DECA 1JFXA 1NELA 4UBPC 2ZZ6A 3SRKA 2E5CA 5BOEA 2WOIA 2O0TA 3PM6A 2C6QA 1K3UA 4G9PA 3PUDA 5E1QA 2IPWA 3CUIA 2ZQ0A 3W7QA 1YDNA 3WJSA 1TR1A 2QEZA 1WZKA 5K2ZA 3C3UA 5FJTA 1A0CA 3DHDA 1RPXA 3U9IA 3IJQA 1ISXA 1XGEA 4NNBA 2E6DA 2E8YA 4B2DA 4H7VA 3N9KA 4B5UA 1TTPA 3BLOA 1ICPA 2HV5A 3TXVA 3GBDA 3UCCA 1KRMA 1Z6KA 4QM1A 4MUZA 3LB0A 1IEIA 3ITYA 2V2HA 4GWEA 5BXPA 2Z1KA 1NY1A 5FF3A 4C7GA 4ZE5A 1E4NA 1H4PA 3L7RA 3NO1A 4KEZA 4BCEA 3AQUA 1QNSA 1VJZA 3E1F1 3GFZA 5FF0A 4YLWA 1S39A 4EMWA 1XV8A 2FDMA 5FF4A 1H09A 2ALDA 3UYIA 4FXRA 5A95A 4H3DA 2NVAA 3FKKA 4CEXC 4UMCA 4GFSA 3Q45A 4GYJA 1Q13A 3ARTA 2QUUA 3GG1A 3NQVA 2C1HA 1OGBA 3CIVA 2YW4A 2OLAA 1V3KA 3FW6A 4Q7IA 4Q4QA 3H22A 4P7OA 1OX5A 3OA3A 1N63C 1K9FA 3CIXA 1XIHA 3M44A 3AISA 3ARXA 3CQKA 2ZYFA 3L4UA 2YAUA 2EJAA 2CHRA 5LNVA 2QW5A 5FAGA 5GJMA 5SWUA 3M43A 3KDNA 2G3IA 1NAL1 3S5NA 1ZY9A 3H2MA 1LLWA 1V7AA 4XZMX 3CM4A 4AIEA 5H91A 5K7JA 3GDLA 1BRLB 4IP5A 3THUA 4M6VA 3CUFA 1XD1A 3GDKA 4EKJA 4ALDA 2PMQA 2NQZA 4AUBA 3WLMA 1F6PA 2R1PA 3VKAA 5AC8A 1W8SA 4U33A 4JHOA 3ZSSA 4O0ZA 4GUHA 1PJ9A 4GPNA 4TQTA 4M0XA 5MHBA 2Z0IA 3UNTA 3W01A 5BMWA 5JCIA 2QVNA 7REQA 2XWEA 3W2NA 3N13A 1EJVC 4IF2A 1QNRA 2YL5A 1UP3A 3WK3A 3RXZA 1C91A 3P80A 5LHFA 2ZFAA 3GBEA 3W1MA 2JEPA 4EPEC 2XISA 3PPGA 1XLMA 2FQIA 3G6LA 2BHYA 3AIUA 5A69A 5G1MA 4MYAA 3PBUA 1W31A 1ZKQA 1BLIA 5TAOA 3ALFA 4K7YA 1OJTA 1R3YA 1Y5WA 3EBVA 1W9PA 2C79A 3NZGA 3V0SA 3U6WA 4AZHA 3VIIA 2AMXA 4H7ZA 4NAEB 1GOMA 3WQDA 1VGAA 3U3HA 4NT0A 1H61A 3VGBA 2X05A 5BU9A 4XZ9A 4QCEA 1GVYA 2V5DA 5H8PA 2ZZ3A 3BPWA 4JICA 5AOUA 4IOTA 3CAVA 1EH9A 1F76A 1B3WA 2QCMA 3F2DA 4CVUA 1UMLA 4MWAA 3UJEA 3R0UA 4LUTB 3AU6A 2BOEX 3WQ5A 1ZBKA 1O4UA 2DIEA 1YNYA 3LZ3A 2AL1A 1MDLA 4HB7A 3IJ6A 4QNWA 4Z2JA 2IPGA 3DHFA 3CLWA 2CPUA 4I9TA 4TXEA 4LAKA 1YYAA 2PZNA 4TMCA 2YDAA 3F2CA 4ZQNA 4BI5A 5JUVA 5JU6A 3LQLA 3K8KA 3WX7A 1ISYA 3WBXA 1Y7VA 1GUVA 3EKLA 4W7UA 4YIWA 3N6JA 4Z08A 2ACRA 1FFQA 1TA3B 2E77A 3WK1A 2BBFA 2OEMA 1ODZA 1J79A 3A6OA 3MV01 4Y9PA 3B40A 1EJ7L 4A3YA 4WDWA 5HQEA 3WNPA 1CLVA 4UFJA 3SY5A 4PMXA 1XKJA 5F2IA 1M01A 3FK4A 3L2MA 5B7YA 3NL5A 4NIRA 5AVHA 1DYSA 3BLKA 1M9HA 1EJRC 4O0KA 4Y9NA 5A6JA 2Z00A 3P3BA 3WQOA 3WNKA 4AB4A 1EC8A 1PUDA 5HNUA 2GSEA 2XU2A 4IT1A 4IMFA 5LIWX 3TR9A 5JVLA 2XIBA 2Z2AA 4GX8A 3ABQA 3WCZA 3AROA 2VFGA 4XV0A 1KGXA 5DRIA 2INEA 4US5D 3CAQA 2PRMA 1OX4A 4O0QA 1E56A 1XYFA 3PWGA 3W1QA 4CEUC 4UTIA 3VILA 4XO7A 3UYCA 3Q58A 2J9YA 4BJHA 5BWAA 3PANA 2PGEA 4M56A 1N62C 5BCAA 2YL8A 1W1PA 4WD0A 2Z25A 1TVPA 3UY8A 1S5NA 3S5ZA 3UJFA 2HPMA 3KZSA 1XLHA 5F2GA 2YXOA 1H1NA 2GVLA 2OWXA 1TMQA 1PZ0A 1GORA 3C6CA 2QIWA 3K2GA 2QCGA 4JTQA 4HPNA 2OQLA 3F5KA 1VCVA 2O7QA 4ICCX 3GC4A 2DJLA 1SW7A 4RXGA 2X0HA 3VNZA 3EX4A 1BHGA 4Y8EA 4CCZA 3WUBA 3W25A 1E3ZA 2W27A 1RR2A 3UVAA 3NYZA 1FCQA 1U22A 2AAAA 3L0GA 1TYTA 3EA1A 1FXQA 1K7XA 4HHPA 4AD5A 5FS7A 1WE5A 4A35A 1LBFA 3H2EA 2WXDM 2IS7A 1FKWA 4FOUA 1ZGDA 4LFYA 1W2PA 1VPXA 2POZA 4MFDA 3OLIA 1DWJM 1XBVA 5TQLA 2VP8A 3TA6A 5LIYX 1HIZA 3OIHA 4WKFA 4W7VA 1JJKA 1GPWA 4EWND 1TYGA 2HK0A 2IQDA 1YBQA 4PUEA 2O4MA 1M03A 4XAPA 3N3TA 4J1OA 4QIUA 4L1XA 2WPEA 4ERGA 4WJXA 3TOPA 5EYWA 1LBLA 3TYCA 4S39A 4NU7A 2DT2A 3L23A 1WYIA 2JKEA 1QVBA 3WD3A 4DF0A 1JDAA 5D8ZA 2BVTA 4LUJA 4ONVA 3M0JA 1WUFA 3W6LA 3EAUA 4AWUA 2VTFA 5D30A 3HV9A 4FS9A 3DFSA 1TWWA 4IUOA 3DU0A 3USBA 1S3HA 2VX5A 1Z89A 1UD6A 4MWAE 3UQNA 5CEWA 4GFIA 1JCXA 2H8XA 4AZ7A 2WZMA 1R0MA 1VBJA 2G5WA 1W5QA 2X1SA 3DH7A 2OSYA 4LYPA 3U7VA 4E0CA 1GW1A 2OTDA 5IFPA 3UG4A 4L1GA 5PTDA 3QGAC 4LBUA 3S6TA 2O9RA 3HQNA 4ICMA 3G6MA 5I77A 2W0HA 1I9CB 4OU1A 2WZEA 1MUWA 4WOQA 3W2MA 1AMYA 3CXBA 3ES8A 5EMKA 2CW6A 3USZA 1ZZMA 4DVOA 2ZTKA 4OIFA 2Q02A 2BLEA 3VD3A 4D6DA 3TE9A 1DNCA 3OBAA 1SR0A 4LWWA 2E40A 4L4MA 1XYBA 1Y5VA 1XSKA 3PPHA 2YLLA 4GRTA 2J7GA 1HFBA 2W55A 4HHLA 3FY1A 3SCUA 1UASA 4U3CA 1BQGA 1NTHA 3PJXA 5TBOA 1XDJA 1DORA 3IIZA 5D37A 4IIEA 3I6TA 3KFTA 3IEBA 2W0UA 3FHAA 1TPH1 2EQ6A 4FOKA 3T8QA 3BTNA 5DRCA 4XD5A 4B92A 2W9MA 3QRHA 2YBTA 4NXKA 3CNYA 4W87A 1O60A 4JX6A 1EEPA 4UC5A 1M1BA 1UHVA 3WL1A 1H60A 1RXOB 2I1OA 4I7WA 2E7FA 2GQ9A 1YADA 3OYZA 2VL4A 4PUJA 3U5UA 1XR2A 4MNJA 1F6KA 4TU1A 2VFHA 4UFIA 4KESA 5G1TA